4U5EE

Crystal structure of glua2 t625g, con-ikot-ikot snail toxin, partial agonist ka and postitive modulator (r,r)-2b complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/toxin
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 25
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5eE00
4U5CE 4U5BE 4U5EE 4U5DE 4U5HA 4U5GA 4U5FE
chains in the Genus database with same CATH superfamily
3ZQYA 3AGUA 1BDJB 4DVZA 2C04A 2KW3C 3MYFA 1FTSA 2OEVA 1RKEB 1VK5A 1VYKA 4YT5A 2J9VA 2P61A 2IXNA 4U5BE 3FOOA 5A6JA 3UMKA 2EPNA 2GWWA 2LK4A 2XM0A 4U5DE 2A69F 4CS9A 2XL6A 1H6GA 3B0UX 1Q0DA 2VB6A 2OCCC 3EH1A 3C7JA 4G78A 4AL0A 3GORA 1SMYF 1D0XA 3ZTMA 4AK9A 3ZDLA 2J9UA 1FMWA 2R7VA 2AWYA 3ABKC 3DE9A 3S9OA 3K7DA 3EPVA 4DBRA 4Q4ZF 4NTAA 1YLMA 4PK4A 3US6A 2HV6A 1ZZPA 4P9FA 2VCBA 3FVYA 1LE4A 4EWCA 4MQ9F 4OIQF 2XXAA 1G4WR 2GDCA 3C8GB 3NG1A 4J7TA 3W4YA 4G7HF 4LACB 3E9VA 4BJ6A 1LIHA 4KC9A 1NSGB 3I5PA 3HKKA 1Z6AA 3O10A 3SXMA 5E33A 4C3BA 2CNWD 1A0BA 2XL4A 3HNKA 1LKXA 1T5OA 1RKCA 2P0NA 4AL1A 5DLJA 3U5SA 2VC9A 3GM2A 2QUPA 4YL3A 4N06A 1VMAA 4E0HA 3W8IA 5L0CA 2IXMA 2YL0A 5KYNA 3GEIA 1HY5A 1LM3B 4QI2A 1BR4A 1PD0A 5GPGB 2Q3TA 2ETSA 2Q9AA 3C18A 3JZ0A 4E7SA 4CSAA 5JSLA 2VCCA 4U5HA 4XLNF 1H7IA 1E84A 5K0IA 1W2WA 4JJGA 1HE1A 1JPJA 1PCXA 5DS4A 2L9JA 4XLPF 2CYDA 3DE8A 4IAQA 1FNTc 2BE5F 1JOGA 1S05A 2XLHA 5EK0A 1QSPA 4MVOA 3SZRA 2A1DD 2MWQA 2YLGA 3CQZA 2RSEB 4U9DA 3RQFA 1Q0MA 4GQHA 1BZ4A 4I44A 3W2WA 2A6HF 3FHDA 4AX2A 4KNVA 2R7WA 1YAUO 4YJWA 2M4EA 2JX0A 1Z3IX 2KK1A 3QVYA 4U5GA 5BQGA 3ZG1A 1IW7F 1OXBA 2LD6A 1G4US 4MNDA 3MYIA 4I3MA 1OKKA 4ULVA 5AC4A 2NG1A 1VLSA 1Z63A 3NKEA 1G5ZA 2QNLA 1WWPA 5L0FA 1QQ3A 3C63A 4B6IA 1ZHTA 3HNLA 2TMVP 2AVKA 5EHHA 2HZ8A 3RH3A 4ZLCA 3UMHA 1UG7A 4XPWA 3SXKA 5DQTA 1F1MA 1T9KA 4O6MA 2NUPB 1N1CA 1RJ9B 1EKYA 2X51A 2Y39A 3DWWA 3L1MA 1C03A 2Y3BA 1A7DA 2W9YA 3VRCA 2EPMX 4PJNA 1M2VA 2LQGA 3AOUA 3NMJA 1AVOB 1YZAA 2KYHA 4J30B 3C62A 2Q9BA 4O6NA 3NYJA 5KYYB 3X1OA 2XLWA 1YVIA 4K1OA 4P9TA 1BR2A 4G7OF 4HEAJ 5D92A 4MVQA 2R7OA 3SXZA 1I4ZA 3O39A 2R7RA 3RQGA 5JUAA 2D5RB 1PD1A 3JRMO 1OQCA 4PFOA 5KYUB 1D0ZA 3GM3A 2FFHA 1K05A 3UMIA 2KC3A 2PF4E 5F5HA 3K1IA 3KYIA 4OD5A 3B29A 2YHSA 4BJ6C 4X0RA 2YL1A 2L81A 1CPRA 4JTDB 3SEOA 3AG1C 3L8IA 3T6JA 2B0JA 5A6AA 5COGA 2HFIA 3S84A 3VYWA 4Q7CA 2P7VA 3O55A 5F28E 2CNWA 3EQLF 4WGZA 3I4UA 1MQVA 1V55C 3F47A 4E17A 3JCUQ 3G4ZA 3VM6A 4NC3A 2G62A 3DKAA 3DM9B 3O6XA 3TD7A 3TJ5A 3PDMP 1L7CA 3DD7A 1JRAA 1ZU4A 4BEJA 4MVZA 2I15A 1NU7D 4CDVA 2QTVA 1KNYA 1ZHXA 2OU6A 4LERA 2G3VA 4P6IC 5DS6A 1D1AA 3LUTB 5L3QA 2R7XA 4U5EE 3EGDA 3WG7C 3SYNA 3FDQA 1XZPA 2IOQA 4CSAC 2R7UA 2LFDA 4IGGA 4JURI 2ZPAA 3N2ZB 4U9EA 2I8BA 4IAOA 4G7ZF 4IB4A 5COMA 4CJGA 1U6HA 2H7VC 2HSBA 2XL8A 3EG9A 3JYHA 3RF3A 4JIOA 2XLMA 2HJ3A 2EILC 3DI5A 4NTFA 4AE4B 5HV9A 3IEEA 1T01A 5A6KA 1AUEA 256BA 3VAYA 1YYXA 2WZGA 3KMIA 4DJ9A 2XLVA 3LS1A 1SYQA 1WOLA 2CGEA 3BEHA 4BEMJ 4MW8A 3FMSA 3Q6MA 2YLIA 4PJLA 1E85A 4IRUA 3KPHA 1D0YA 4DXWA 2UUHA 3GEEA 3B0VC 3EG9B 3ECSA 1R5ID 2J9BA 3RIPA 1E86A 1TQGA 3LAYA 4RBNA 2XM4A 3RW0A 2DYRC 3E70C 3PMRA 3M79A 3U2LA 3ZWIA 2LSEA 4K7BA 2VASA 3C8ZA 4DRJB 2LIGA 3G50A 3HTKC 1V4AA 1NBBA 3H2UA 2QLAA 4IARA 4N4WA 4O6YA 2H8AA 4QI0A 4Z9JA 4MVMA 5T1DB 4BJ1A 5B3SC 4D4NA 3U0CA 4DRIB 3AQBA 2PP4A 1WGWA 4ONSA 4YL0A 1L3PA 4W8KA 1BBHA 1TWGA 1SR2A 3EZHA 2R02A 1LVKA 1J8MF 3AGTA 3JSEO 2FGYA 5JRAA 1ORJA 2HKVA 1QZXA 3AG4C 3I5QA 3G4XA 4XTKA 1CGOA 1LS1A 2O9XA 2WVQA 4BJTA 3T6BA 3TULA 2KGOA 1WTYA 4WABA 1QKRA 4BG0A 5F5FA 3IQ5A 3ASOC 4CDAA 4ZLDA 2UUIA 3IHUA 4DOZA 4NQFA 3RYLA 5JVEA 1DOWA 1ZYRF 5JP7A 3EFOA 3RFYA 3A11A 3KKBA 2R03A 1TKNA 1O5HA 2CDQA 4PR9A 4D4XA 3K1IC 3NMKA 2Z15A 4CIHA 4OIRF 2IBFA 4JJFA 4NY3A 1JPNA 3FAPB 2HV7A 3LNRA 3MLGA 2HJMA 4JEAA 3TK0A 3JTLO 1J8YF 2NSGA 3N24A 2R7QA 1O87A 1ZHWA 2KNHA 1SZIA 2ZXPA 1FMVA 3JRTA 2W45A 1MNEA 1MMGA 2DGJA 1GGQA 5CI9A 1Y6DA 3H2VA 2D4UA 1M2OA 2XS8A 3EFOB 4JRZA 3C8GD 5E2QA 1ST6A 4CS7A 2R05A 3RKOF 3T4RA 2P6VA 2KJGA 2Q4FA 1NLXA 1OCRC 3M1CB 2FAPB 2HMZA 2YQYA 4HFKB 4XEFA 3UR3C 4KI2A 4C7OA 3LEVA 1EQ1A 4FX5A 4J32B 4C3EA 1FFHA 1Z5ZA 2IXPA 1Y4CA 2IXOA 4XWJA 4CJOA 1OCZC 2J45A 4JW1A 3LJBA 2WZFA 3Q7LA 4GYTA 3POVA 3HLZA 4M63A 4CX9A 2JPUA 3M15A 3RQEA 3RVZA 5BQHA 2WVOA 2V3CC 2R9RB 3PCVA 1MMAA 4F4BA 3U8VA 2R25A 1VB5A 3LEOA 3U3FA 4N6CA 2QY9A 1BR1A 2A0BA 2EIMC 3FOPA 1MMNA 4A4AA 2L7AA 3EGXA 1R4TA 2GAQA 4PJMA 1HMDA 4EUKB 5KYWA 2OEXA 1M57C 3GEHA 1ZVZA 4YN0B 5TJ5E 2EPOA 5JT4A 3TJ6A 4EHPA 4ANJA 3J06A 1A41A 3K1HA 3T9OA 1M2VB 2QE9A 3IQCA 3KYJA 5KYXA 2Q9CA 2AP3A 5HSWA 1DOVA 3ATPA 3HJCA 1Q0KA 3X2QC 2AWCA 1S7ZA 2AU5A 1OR2A 4R32A 2YL3A 4CS8C 3L0IA 4PFPA 3L8JA 3CEXA 4N6HA 1OCCC 2W4BA 4MVRA 5JLIA 5KYWB 5BQIA 2YKZA 2PX0A 3ZSUA 3S27A 3PHF2 2L6HA 2NUTA 4LDRA 4BPMA 3SXYA 3UGOA 2ZXWC 2PFDA 2KQ9A 1OW8A 3LLIA 3IPMO 3ZTZA 4CS9C 2J0WA 1QLEC 2ZXRA 2KSFA 4WJ0A 1C17M 3GWLA 3DM5A 3V7OA 1VYIA 3IQTA 4HE8D 4JTCB 1YDIA 4E7ZA 2W4MA 4WGYA 1TWAA 3OA1A 4BJ5C 5E3AA 3OEOA 4MVUA 2DI3A 4O79A 1T6IA 2M64A 4OINF 3RVYA 3EHNA 4MTFA 2PBEA 4Q5SF 2CCYA 2J7PD 2OJED 1HMOA 4ER9A 5L0JA 4YT4A 2A68F 4DVYP 1WN0A 1E2XA 4I1MA 4YT2A 4FAPB 5B1AC 3UGPA 3EZIA 1RKEA 2B0HA 1GS9A 3EJNA 4JKVA 2XLOA 3LNMB 5L3VA 2PX3A 3SP1A 2LP4A 4U5FE 3EGDB 1TWCA 4O7GA 3U9MA 2OQMA 1LS4A 2Y3DA 1NFOA 1FR0A 4J7YA 1NFNA 3NKDA 1JR8A 4C3DA 5FZTA 3QMKA 1ORSC 5E3CA 4YL1A 2ZD9A 4W8PA 1LPEA 2R7TA 2EINC 3AG2C 2ASRA 3H65A 1EA8A 1Z23A 4HFFB 2X0CA 1ZW2A 4EIYA 3S90A 2CW0F 3U9JA 4XPYA 4LDKA 3ZQVA 1TR2A 4CS8A 1VTMP 4MVSA 1ZW3A 2J8WA 2H7OA 3C8GA 3V5XA 1CGME 1PV3A 5L0DA 1OXKA 2V26A 4MTOA 2MYSA 5A6BD 2F22A 2YVKA 3NYLA 4UDVA 3OWTA 1M56C 4JZAA 1JMWA 4NCQA 1MNDA 4FWVA 1ZHYA 4MTGA 2JD3A 2P1AA 1WATA 1E83A 1Q0GA 4E18A 4ULWA 4KBLA 2L6FA 3GANA 1TWHA 4GEHA 3N0TA 3Q6NA 1Q0FA 2LFFA 3TOMA 1U0BB 4BJ5A 4XQ1A 2E87A 4JC7A 1H9TA 4MW3A 1RXQA 4YT8A 1D1CA 3U3BA 1K04A 1A7EA 2OJQA 4E0IA 3R7CA 3NYMA 3EH2A 2NSFA 4QDLA 1NG1A 3Q7GA 5COFA 1SF8A 2WVNA 3KH2A 4H4KC 1JAFA 3K33A 3WAQA 2J9WA 2XSEA 4NTBA 3HNJA 5T3WA 5L0IA 4Z9IA 2R7SA 1QPUA 4OD4A 1B68A 5L0GA 1LE2A 2BL2A 1M6TA 3QTHA 2C03A 3AJMA 3KL4A 2OOCA 2J46A 2XS1A 5A69A 1RMVA 1I4YA 1QVXA 2DYSC 3LS0A 1XWJA 2MHRA 3ABMC 4XPXA 3ITFA 3DJUB 4I1OB 4JVSA 2Y3GA 2WZLA 3QW1A 4RD9A 1ZHZA 4EBJA 4EBBA 3ABLC 5IY5C 1GQAA 3L34A 4DRHB 3R2PA 4LDQA 4A2NB 1D1BA 1I5NA 3JT1A 3WODF 3DAGA 2ICWG 1TFKB 4PJJA 1FAPB 4JEBA 3CAXA 1VOMA 1XZQA 3GM1A 4EKWA 1LI7A 2OKUA 1EI7A 2NPUA 1NU9C 3B71A 3FXHA 2RD9A 1HW1A 1C02A 3A9CA 1O3UA 1RCPA 3QZCA 3ZIBA 3ZVRA 4PACA 3M4BA 2XRHA 3HNIA 1V54C 4JCZA 1G8XA 3IQ6A 4KNWA 2GFHA 1U89A 3EHMA 4K0DA 2NUPA 2A0UA 1OR3A 1RJ9A 2J0XA 1OW7A 2J7PA 5DVWA 4RDAA 4YWQA 5T3TA 4DBQA 3B9QA 5L0HA 2XLDA 4Z9HA 3UNGC 4C7OB 5KYYA 1YZCA 4EBKA 1OCOC 2VCAA 1TFOB 3DMDA 5FCLA 4IJJA 2Q7RA 2H7BA 2Y3HA 5AGFA 3U8PA 1YARO 1Z7Qc 1LI5A 1HE9A 3CZ6A 4H54A 4JTAB 4MS2A 3TQOA 3BRJA 2EPLX 2XLEA 2EIKC 3F46A 2HS5A 1WASA 1KU2A 2PNOA 3M4CA 3QW0A 4L6RA 5KYUA 3NRHA 4CDYA 4OIPF 1KTMA 1APCA 3AQCA 4XEKA 5AC5A 4JCHA 5B3IA 3EGXB 2WB7A 2IM8A 2XXAB 3GWNA 3DZAA 2DB4A 2G3KA 1YA7O 2HSQA 1IZMA 2LCHA 3DAFA 4LLCA 5CIVA 2BC5A 3DJNB 4U5CE 3U2MA 3B0PA 3V5YA 3VF0A 3W8HA 5A6BA 5EGYA 5KYXB 4G0HA 5B1BC 3MX3A 2HMQA 3K6BA 3FAJA 2WL8A 3S28A 3GODA 5CI8A 1T6UA 2VH3A 1AEPA 2Q00A 3T6GB 2OG2A 2YL7A 5DQZA 2L6GA 2A6EF 2YLDA 2ZXOA 1OW6A 1T6QA 1ZU5A 2YZSA 3LESA 3W2VA 3K66A 4CIPA 1H9GA 3CSKA 2NUTB 1V74B 1YYJA 2YWAA 5DS5A 2Y69C 1GM5A 4JE9A 4YK5A 2HUJA 1ORYA 3AG3C 3MFNA 5D91A 3V5ZA 4FESA 1OKKD 3TOLA 1NZEA 2YRFA 3S0XA 5JS5A 1MMDA 3DXJF 4IWBA 1CGNA 1VLTA 1CPQA 3NDBB 3WHNA 1FFTC 3JSZA 4LLEA 3ASNC 2IYLD 3MBGA 3SNHA 1YJGA 5BUOA 1HW2A 2GA0A 1A7VA 3JYYA 3QVZA 3ZC4A 4CBEA 1YA9A 2EPKX 3LLKA 1K40A 3NMIA 4OIOF 2YEVA 4AE4A 2EIJC 4XEVA 1UFBA 3S29A
chains in the Genus database with same CATH topology
4DVZA 2C04A 2KW3C 1FTSA 1VK5A 1VYKA 4YT5A 2J9VA 4U5BE 2IXNA 3UMKA 4U5DE 2A69F 3B0UX 2VB6A 2OCCC 3EH1A 1SMYF 1D0XA 4AK9A 2R7VA 2J9UA 1FMWA 3ABKC 4Q4ZF 4DBRA 3K7DA 3EPVA 4PK4A 2HV6A 3FVYA 4EWCA 4MQ9F 4OIQF 2XXAA 4G7HF 3NG1A 4LACB 3E9VA 4BJ6A 4KC9A 3I5PA 1Z6AA 5E33A 4C3BA 2CNWD 2XL4A 1LKXA 5DLJA 4N06A 1VMAA 3W8IA 2IXMA 5KYNA 4QI2A 1BR4A 1PD0A 2Q3TA 2Q9AA 4E7SA 4CSAA 4U5HA 4XLNF 1W2WA 4JJGA 1JPJA 1PCXA 5DS4A 2L9JA 4XLPF 2BE5F 3SZRA 2A1DD 2MWQA 3CQZA 4I44A 3W2WA 4AX2A 2R7WA 2A6HF 3FHDA 4KNVA 4YJWA 2M4EA 3ZG1A 1Z3IX 4U5GA 1IW7F 4MNDA 4I3MA 1OKKA 2NG1A 1Z63A 3NKEA 4B6IA 1ZHTA 5EHHA 3RH3A 4ZLCA 3UMHA 5DQTA 4O6MA 2NUPB 1N1CA 1RJ9B 2EIJC 2X51A 2Y39A 2Y3BA 2W9YA 4PJNA 1M2VA 4J30B 2Q9BA 4O6NA 3NYJA 5KYYB 3X1OA 4G7OF 1BR2A 4HEAJ 5D92A 2R7OA 3O39A 2R7RA 2D5RB 1PD1A 4PFOA 5KYUB 1D0ZA 2FFHA 3UMIA 2PF4E 5F5HA 4OD5A 2YHSA 4BJ6C 4X0RA 2L81A 3SEOA 3AG1C 3T6JA 2B0JA 3VYWA 4Q7CA 2P7VA 2CNWA 3EQLF 3I4UA 3F47A 1V55C 3JCUQ 2G62A 3DM9B 3O6XA 3TD7A 3DD7A 1ZU4A 4BEJA 1NU7D 2QTVA 1ZHXA 4LERA 2G3VA 4P6IC 5DS6A 1D1AA 5L3QA 4U5EE 3EGDA 3WG7C 3SYNA 3FDQA 2IOQA 4CSAC 2R7UA 4JURI 2ZPAA 3N2ZB 4IAOA 4G7ZF 2H7VC 3EG9A 3JYHA 4AE4B 2EILC 3IEEA 3VAYA 2WZGA 3KMIA 3LS1A 2CGEA 3Q6MA 4PJLA 4IRUA 1D0YA 3B0VC 3EG9B 3ECSA 3RIPA 3LAYA 4RBNA 2DYRC 3E70C 3PMRA 2LSEA 4K7BA 2VASA 3HTKC 4O6YA 4QI0A 4CS9A 2R7XA 5T1DB 2XXAB 4BJ1A 5B3SC 3AQBA 2PP4A 1WGWA 4W8KA 1TWGA 3EZHA 1LVKA 1J8MF 2FGYA 1QZXA 3AG4C 3I5QA 4XTKA 1LS1A 2O9XA 2WVQA 4BJTA 3T6BA 2KGOA 4BG0A 5F5FA 3ASOC 4ZLDA 4DOZA 3RYLA 1ZYRF 3EFOA 3RFYA 3KKBA 1TKNA 1O5HA 2CDQA 3K1IC 2Z15A 4CIHA 4OIRF 4JJFA 4NY3A 1JPNA 3MLGA 2HV7A 3LNRA 1J8YF 3N24A 2R7QA 1O87A 1ZHWA 2KNHA 1SZIA 2ZXPA 1FMVA 3JRTA 2W45A 1MNEA 1MMGA 2DGJA 5CI9A 5E2QA 1M2OA 3EFOB 1ST6A 4CS7A 3RKOF 3T4RA 2P6VA 2KJGA 1OCRC 3M1CB 4HFKB 3UR3C 4KI2A 4C7OA 3LEVA 4FX5A 4J32B 4C3EA 1FFHA 1Z5ZA 2IXPA 2IXOA 4XWJA 1OCZC 2J45A 4JW1A 3LJBA 2WZFA 3Q7LA 4GYTA 3POVA 3HLZA 4M63A 2WVOA 2V3CC 1MMAA 4F4BA 2QY9A 1BR1A 2EIMC 1MMNA 3EGXA 4PJMA 5KYWA 1M57C 4YN0B 4ANJA 3K1HA 1M2VB 5KYXA 2Q9CA 5HSWA 3HJCA 3X2QC 1S7ZA 4CS8C 3L0IA 4PFPA 1OCCC 2W4BA 5KYWB 2PX0A 3ZSUA 3S27A 3PHF2 2NUTA 3UGOA 2ZXWC 2PFDA 2KQ9A 4CS9C 3LLIA 2J0WA 1QLEC 2ZXRA 4WJ0A 3DM5A 3V7OA 1VYIA 4HE8D 4E7ZA 2W4MA 1TWAA 3OA1A 4BJ5C 5E3AA 3OEOA 4O79A 4OINF 3EHNA 4Q5SF 2J7PD 4YT4A 2A68F 4DVYP 4I1MA 4YT2A 3UGPA 5B1AC 3EZIA 3EJNA 5L3VA 2PX3A 3SP1A 4U5FE 3EGDB 1TWCA 4O7GA 2Y3DA 3NKDA 4C3DA 3QMKA 5E3CA 2R7TA 2EINC 3AG2C 3H65A 1Z23A 4HFFB 2CW0F 4CS8A 1TR2A 2H7OA 2V26A 2MYSA 3NYLA 3OWTA 1M56C 4JZAA 1MNDA 4FWVA 1ZHYA 2JD3A 4ULWA 4KBLA 3GANA 1TWHA 4GEHA 3N0TA 3Q6NA 4BJ5A 2E87A 4YT8A 1D1CA 3NYMA 3EH2A 4QDLA 1NG1A 3Q7GA 1SF8A 2WVNA 3KH2A 4H4KC 3K33A 2J9WA 2XSEA 5T3WA 2R7SA 4OD4A 2C03A 3KL4A 2J46A 2DYSC 3LS0A 3ABMC 3ITFA 3DJUB 4I1OB 4JVSA 2Y3GA 2WZLA 4RD9A 1ZHZA 3ABLC 5IY5C 3L34A 4A2NB 1D1BA 3WODF 3JT1A 3DAGA 4PJJA 1VOMA 1NU9C 3QZCA 3ZIBA 3ZVRA 2XRHA 1V54C 4KNWA 1G8XA 2GFHA 4K0DA 3EHMA 2NUPA 1RJ9A 2J0XA 5DVWA 2J7PA 4RDAA 4YWQA 5T3TA 4DBQA 3B9QA 3UNGC 4C7OB 5KYYA 1OCOC 3DMDA 5FCLA 4IJJA 2H7BA 2Y3HA 3CZ6A 4EBBA 2EIKC 3F46A 1KU2A 5KYUA 4OIPF 3NRHA 3AQCA 4JCHA 3EGXB 2WB7A 3DZAA 4LLCA 2G3KA 1IZMA 3DAFA 3DJNB 4U5CE 3W8HA 5EGYA 3B0PA 5KYXB 4G0HA 5B1BC 3MX3A 3K6BA 3FAJA 2WL8A 3S28A 3GODA 5CI8A 2VH3A 2OG2A 5DQZA 2A6EF 2ZXOA 3LESA 2YZSA 1ZU5A 3W2VA 3K66A 3CSKA 2NUTB 5DS5A 2Y69C 5D91A 3AG3C 4FESA 1OKKD 1NZEA 3S0XA 1MMDA 3DXJF 4IWBA 3NDBB 1FFTC 3JSZA 4LLEA 3ASNC 2IYLD 3SNHA 5BUOA 3ZC4A 4CBEA 3LLKA 4OIOF 2YEVA 4AE4A 2I8BA 3S29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5C E;  4U5B E;  4U5E E;  4U5D E;  4U5H A;  4U5G A;  4U5F E; 
#chains in the Genus database with same CATH topology
 3ZQY A;  3AGU A;  1BDJ B;  4DVZ A;  2C04 A;  2KW3 C;  3MYF A;  1FTS A;  2OEV A;  1RKE B;  1VK5 A;  1VYK A;  4YT5 A;  2J9V A;  2P61 A;  2IXN A;  4U5B E;  3FOO A;  5A6J A;  3UMK A;  2EPN A;  2GWW A;  2LK4 A;  2XM0 A;  4U5D E;  2A69 F;  4CS9 A;  2XL6 A;  1H6G A;  3B0U X;  1Q0D A;  2VB6 A;  2OCC C;  3EH1 A;  3C7J A;  4G78 A;  4AL0 A;  3GOR A;  1SMY F;  1D0X A;  3ZTM A;  4AK9 A;  3ZDL A;  2J9U A;  1FMW A;  2R7V A;  2AWY A;  3ABK C;  3DE9 A;  3S9O A;  3K7D A;  3EPV A;  4DBR A;  4Q4Z F;  4NTA A;  1YLM A;  4PK4 A;  3US6 A;  2HV6 A;  1ZZP A;  4P9F A;  2VCB A;  3FVY A;  1LE4 A;  4EWC A;  4MQ9 F;  4OIQ F;  2XXA A;  1G4W R;  2GDC A;  3C8G B;  3NG1 A;  4J7T A;  3W4Y A;  4G7H F;  4LAC B;  3E9V A;  4BJ6 A;  1LIH A;  4KC9 A;  1NSG B;  3I5P A;  3HKK A;  1Z6A A;  3O10 A;  3SXM A;  5E33 A;  4C3B A;  2CNW D;  1A0B A;  2XL4 A;  3HNK A;  1LKX A;  1T5O A;  1RKC A;  2P0N A;  4AL1 A;  5DLJ A;  3U5S A;  2VC9 A;  3GM2 A;  2QUP A;  4YL3 A;  4N06 A;  1VMA A;  4E0H A;  3W8I A;  5L0C A;  2IXM A;  2YL0 A;  5KYN A;  3GEI A;  1HY5 A;  1LM3 B;  4QI2 A;  1BR4 A;  1PD0 A;  5GPG B;  2Q3T A;  2ETS A;  2Q9A A;  3C18 A;  3JZ0 A;  4E7S A;  4CSA A;  5JSL A;  2VCC A;  4U5H A;  4XLN F;  1H7I A;  1E84 A;  5K0I A;  1W2W A;  4JJG A;  1HE1 A;  1JPJ A;  1PCX A;  5DS4 A;  2L9J A;  4XLP F;  2CYD A;  3DE8 A;  4IAQ A;  1FNT c;  2BE5 F;  1JOG A;  1S05 A;  2XLH A;  5EK0 A;  1QSP A;  4MVO A;  3SZR A;  2A1D D;  2MWQ A;  2YLG A;  3CQZ A;  2RSE B;  4U9D A;  3RQF A;  1Q0M A;  4GQH A;  1BZ4 A;  4I44 A;  3W2W A;  2A6H F;  3FHD A;  4AX2 A;  4KNV A;  2R7W A;  1YAU O;  4YJW A;  2M4E A;  2JX0 A;  1Z3I X;  2KK1 A;  3QVY A;  4U5G A;  5BQG A;  3ZG1 A;  1IW7 F;  1OXB A;  2LD6 A;  1G4U S;  4MND A;  3MYI A;  4I3M A;  1OKK A;  4ULV A;  5AC4 A;  2NG1 A;  1VLS A;  1Z63 A;  3NKE A;  1G5Z A;  2QNL A;  1WWP A;  5L0F A;  1QQ3 A;  3C63 A;  4B6I A;  1ZHT A;  3HNL A;  2TMV P;  2AVK A;  5EHH A;  2HZ8 A;  3RH3 A;  4ZLC A;  3UMH A;  1UG7 A;  4XPW A;  3SXK A;  5DQT A;  1F1M A;  1T9K A;  4O6M A;  2NUP B;  1N1C A;  1RJ9 B;  1EKY A;  2X51 A;  2Y39 A;  3DWW A;  3L1M A;  1C03 A;  2Y3B A;  1A7D A;  2W9Y A;  3VRC A;  2EPM X;  4PJN A;  1M2V A;  2LQG A;  3AOU A;  3NMJ A;  1AVO B;  1YZA A;  2KYH A;  4J30 B;  3C62 A;  2Q9B A;  4O6N A;  3NYJ A;  5KYY B;  3X1O A;  2XLW A;  1YVI A;  4K1O A;  4P9T A;  1BR2 A;  4G7O F;  4HEA J;  5D92 A;  4MVQ A;  2R7O A;  3SXZ A;  1I4Z A;  3O39 A;  2R7R A;  3RQG A;  5JUA A;  2D5R B;  1PD1 A;  3JRM O;  1OQC A;  4PFO A;  5KYU B;  1D0Z A;  3GM3 A;  2FFH A;  1K05 A;  3UMI A;  2KC3 A;  2PF4 E;  5F5H A;  3K1I A;  3KYI A;  4OD5 A;  3B29 A;  2YHS A;  4BJ6 C;  4X0R A;  2YL1 A;  2L81 A;  1CPR A;  4JTD B;  3SEO A;  3AG1 C;  3L8I A;  3T6J A;  2B0J A;  5A6A A;  5COG A;  2HFI A;  3S84 A;  3VYW A;  4Q7C A;  2P7V A;  3O55 A;  5F28 E;  2CNW A;  3EQL F;  4WGZ A;  3I4U A;  1MQV A;  1V55 C;  3F47 A;  4E17 A;  3JCU Q;  3G4Z A;  3VM6 A;  4NC3 A;  2G62 A;  3DKA A;  3DM9 B;  3O6X A;  3TD7 A;  3TJ5 A;  3PDM P;  1L7C A;  3DD7 A;  1JRA A;  1ZU4 A;  4BEJ A;  4MVZ A;  2I15 A;  1NU7 D;  4CDV A;  2QTV A;  1KNY A;  1ZHX A;  2OU6 A;  4LER A;  2G3V A;  4P6I C;  5DS6 A;  1D1A A;  3LUT B;  5L3Q A;  2R7X A;  4U5E E;  3EGD A;  3WG7 C;  3SYN A;  3FDQ A;  1XZP A;  2IOQ A;  4CSA C;  2R7U A;  2LFD A;  4IGG A;  4JUR I;  2ZPA A;  3N2Z B;  4U9E A;  2I8B A;  4IAO A;  4G7Z F;  4IB4 A;  5COM A;  4CJG A;  1U6H A;  2H7V C;  2HSB A;  2XL8 A;  3EG9 A;  3JYH A;  3RF3 A;  4JIO A;  2XLM A;  2HJ3 A;  2EIL C;  3DI5 A;  4NTF A;  4AE4 B;  5HV9 A;  3IEE A;  1T01 A;  5A6K A;  1AUE A;  256B A;  3VAY A;  1YYX A;  2WZG A;  3KMI A;  4DJ9 A;  2XLV A;  3LS1 A;  1SYQ A;  1WOL A;  2CGE A;  3BEH A;  4BEM J;  4MW8 A;  3FMS A;  3Q6M A;  2YLI A;  4PJL A;  1E85 A;  4IRU A;  3KPH A;  1D0Y A;  4DXW A;  2UUH A;  3GEE A;  3B0V C;  3EG9 B;  3ECS A;  1R5I D;  2J9B A;  3RIP A;  1E86 A;  1TQG A;  3LAY A;  4RBN A;  2XM4 A;  3RW0 A;  2DYR C;  3E70 C;  3PMR A;  3M79 A;  3U2L A;  3ZWI A;  2LSE A;  4K7B A;  2VAS A;  3C8Z A;  4DRJ B;  2LIG A;  3G50 A;  3HTK C;  1V4A A;  1NBB A;  3H2U A;  2QLA A;  4IAR A;  4N4W A;  4O6Y A;  2H8A A;  4QI0 A;  4Z9J A;  4MVM A;  5T1D B;  4BJ1 A;  5B3S C;  4D4N A;  3U0C A;  4DRI B;  3AQB A;  2PP4 A;  1WGW A;  4ONS A;  4YL0 A;  1L3P A;  4W8K A;  1BBH A;  1TWG A;  1SR2 A;  3EZH A;  2R02 A;  1LVK A;  1J8M F;  3AGT A;  3JSE O;  2FGY A;  5JRA A;  1ORJ A;  2HKV A;  1QZX A;  3AG4 C;  3I5Q A;  3G4X A;  4XTK A;  1CGO A;  1LS1 A;  2O9X A;  2WVQ A;  4BJT A;  3T6B A;  3TUL A;  2KGO A;  1WTY A;  4WAB A;  1QKR A;  4BG0 A;  5F5F A;  3IQ5 A;  3ASO C;  4CDA A;  4ZLD A;  2UUI A;  3IHU A;  4DOZ A;  4NQF A;  3RYL A;  5JVE A;  1DOW A;  1ZYR F;  5JP7 A;  3EFO A;  3RFY A;  3A11 A;  3KKB A;  2R03 A;  1TKN A;  1O5H A;  2CDQ A;  4PR9 A;  4D4X A;  3K1I C;  3NMK A;  2Z15 A;  4CIH A;  4OIR F;  2IBF A;  4JJF A;  4NY3 A;  1JPN A;  3FAP B;  2HV7 A;  3LNR A;  3MLG A;  2HJM A;  4JEA A;  3TK0 A;  3JTL O;  1J8Y F;  2NSG A;  3N24 A;  2R7Q A;  1O87 A;  1ZHW A;  2KNH A;  1SZI A;  2ZXP A;  1FMV A;  3JRT A;  2W45 A;  1MNE A;  1MMG A;  2DGJ A;  1GGQ A;  5CI9 A;  1Y6D A;  3H2V A;  2D4U A;  1M2O A;  2XS8 A;  3EFO B;  4JRZ A;  3C8G D;  5E2Q A;  1ST6 A;  4CS7 A;  2R05 A;  3RKO F;  3T4R A;  2P6V A;  2KJG A;  2Q4F A;  1NLX A;  1OCR C;  3M1C B;  2FAP B;  2HMZ A;  2YQY A;  4HFK B;  4XEF A;  3UR3 C;  4KI2 A;  4C7O A;  3LEV A;  1EQ1 A;  4FX5 A;  4J32 B;  4C3E A;  1FFH A;  1Z5Z A;  2IXP A;  1Y4C A;  2IXO A;  4XWJ A;  4CJO A;  1OCZ C;  2J45 A;  4JW1 A;  3LJB A;  2WZF A;  3Q7L A;  4GYT A;  3POV A;  3HLZ A;  4M63 A;  4CX9 A;  2JPU A;  3M15 A;  3RQE A;  3RVZ A;  5BQH A;  2WVO A;  2V3C C;  2R9R B;  3PCV A;  1MMA A;  4F4B A;  3U8V A;  2R25 A;  1VB5 A;  3LEO A;  3U3F A;  4N6C A;  2QY9 A;  1BR1 A;  2A0B A;  2EIM C;  3FOP A;  1MMN A;  4A4A A;  2L7A A;  3EGX A;  1R4T A;  2GAQ A;  4PJM A;  1HMD A;  4EUK B;  5KYW A;  2OEX A;  1M57 C;  3GEH A;  1ZVZ A;  4YN0 B;  5TJ5 E;  2EPO A;  5JT4 A;  3TJ6 A;  4EHP A;  4ANJ A;  3J06 A;  1A41 A;  3K1H A;  3T9O A;  1M2V B;  2QE9 A;  3IQC A;  3KYJ A;  5KYX A;  2Q9C A;  2AP3 A;  5HSW A;  1DOV A;  3ATP A;  3HJC A;  1Q0K A;  3X2Q C;  2AWC A;  1S7Z A;  2AU5 A;  1OR2 A;  4R32 A;  2YL3 A;  4CS8 C;  3L0I A;  4PFP A;  3L8J A;  3CEX A;  4N6H A;  1OCC C;  2W4B A;  4MVR A;  5JLI A;  5KYW B;  5BQI A;  2YKZ A;  2PX0 A;  3ZSU A;  3S27 A;  3PHF 2;  2L6H A;  2NUT A;  4LDR A;  4BPM A;  3SXY A;  3UGO A;  2ZXW C;  2PFD A;  2KQ9 A;  1OW8 A;  3LLI A;  3IPM O;  3ZTZ A;  4CS9 C;  2J0W A;  1QLE C;  2ZXR A;  2KSF A;  4WJ0 A;  1C17 M;  3GWL A;  3DM5 A;  3V7O A;  1VYI A;  3IQT A;  4HE8 D;  4JTC B;  1YDI A;  4E7Z A;  2W4M A;  4WGY A;  1TWA A;  3OA1 A;  4BJ5 C;  5E3A A;  3OEO A;  4MVU A;  2DI3 A;  4O79 A;  1T6I A;  2M64 A;  4OIN F;  3RVY A;  3EHN A;  4MTF A;  2PBE A;  4Q5S F;  2CCY A;  2J7P D;  2OJE D;  1HMO A;  4ER9 A;  5L0J A;  4YT4 A;  2A68 F;  4DVY P;  1WN0 A;  1E2X A;  4I1M A;  4YT2 A;  4FAP B;  5B1A C;  3UGP A;  3EZI A;  1RKE A;  2B0H A;  1GS9 A;  3EJN A;  4JKV A;  2XLO A;  3LNM B;  5L3V A;  2PX3 A;  3SP1 A;  2LP4 A;  4U5F E;  3EGD B;  1TWC A;  4O7G A;  3U9M A;  2OQM A;  1LS4 A;  2Y3D A;  1NFO A;  1FR0 A;  4J7Y A;  1NFN A;  3NKD A;  1JR8 A;  4C3D A;  5FZT A;  3QMK A;  1ORS C;  5E3C A;  4YL1 A;  2ZD9 A;  4W8P A;  1LPE A;  2R7T A;  2EIN C;  3AG2 C;  2ASR A;  3H65 A;  1EA8 A;  1Z23 A;  4HFF B;  2X0C A;  1ZW2 A;  4EIY A;  3S90 A;  2CW0 F;  3U9J A;  4XPY A;  4LDK A;  3ZQV A;  1TR2 A;  4CS8 A;  1VTM P;  4MVS A;  1ZW3 A;  2J8W A;  2H7O A;  3C8G A;  3V5X A;  1CGM E;  1PV3 A;  5L0D A;  1OXK A;  2V26 A;  4MTO A;  2MYS A;  5A6B D;  2F22 A;  2YVK A;  3NYL A;  4UDV A;  3OWT A;  1M56 C;  4JZA A;  1JMW A;  4NCQ A;  1MND A;  4FWV A;  1ZHY A;  4MTG A;  2JD3 A;  2P1A A;  1WAT A;  1E83 A;  1Q0G A;  4E18 A;  4ULW A;  4KBL A;  2L6F A;  3GAN A;  1TWH A;  4GEH A;  3N0T A;  3Q6N A;  1Q0F A;  2LFF A;  3TOM A;  1U0B B;  4BJ5 A;  4XQ1 A;  2E87 A;  4JC7 A;  1H9T A;  4MW3 A;  1RXQ A;  4YT8 A;  1D1C A;  3U3B A;  1K04 A;  1A7E A;  2OJQ A;  4E0I A;  3R7C A;  3NYM A;  3EH2 A;  2NSF A;  4QDL A;  1NG1 A;  3Q7G A;  5COF A;  1SF8 A;  2WVN A;  3KH2 A;  4H4K C;  1JAF A;  3K33 A;  3WAQ A;  2J9W A;  2XSE A;  4NTB A;  3HNJ A;  5T3W A;  5L0I A;  4Z9I A;  2R7S A;  1QPU A;  4OD4 A;  1B68 A;  5L0G A;  1LE2 A;  2BL2 A;  1M6T A;  3QTH A;  2C03 A;  3AJM A;  3KL4 A;  2OOC A;  2J46 A;  2XS1 A;  5A69 A;  1RMV A;  1I4Y A;  1QVX A;  2DYS C;  3LS0 A;  1XWJ A;  2MHR A;  3ABM C;  4XPX A;  3ITF A;  3DJU B;  4I1O B;  4JVS A;  2Y3G A;  2WZL A;  3QW1 A;  4RD9 A;  1ZHZ A;  4EBJ A;  4EBB A;  3ABL C;  5IY5 C;  1GQA A;  3L34 A;  4DRH B;  3R2P A;  4LDQ A;  4A2N B;  1D1B A;  1I5N A;  3JT1 A;  3WOD F;  3DAG A;  2ICW G;  1TFK B;  4PJJ A;  1FAP B;  4JEB A;  3CAX A;  1VOM A;  1XZQ A;  3GM1 A;  4EKW A;  1LI7 A;  2OKU A;  1EI7 A;  2NPU A;  1NU9 C;  3B71 A;  3FXH A;  2RD9 A;  1HW1 A;  1C02 A;  3A9C A;  1O3U A;  1RCP A;  3QZC A;  3ZIB A;  3ZVR A;  4PAC A;  3M4B A;  2XRH A;  3HNI A;  1V54 C;  4JCZ A;  1G8X A;  3IQ6 A;  4KNW A;  2GFH A;  1U89 A;  3EHM A;  4K0D A;  2NUP A;  2A0U A;  1OR3 A;  1RJ9 A;  2J0X A;  1OW7 A;  2J7P A;  5DVW A;  4RDA A;  4YWQ A;  5T3T A;  4DBQ A;  3B9Q A;  5L0H A;  2XLD A;  4Z9H A;  3UNG C;  4C7O B;  5KYY A;  1YZC A;  4EBK A;  1OCO C;  2VCA A;  1TFO B;  3DMD A;  5FCL A;  4IJJ A;  2Q7R A;  2H7B A;  2Y3H A;  5AGF A;  3U8P A;  1YAR O;  1Z7Q c;  1LI5 A;  1HE9 A;  3CZ6 A;  4H54 A;  4JTA B;  4MS2 A;  3TQO A;  3BRJ A;  2EPL X;  2XLE A;  2EIK C;  3F46 A;  2HS5 A;  1WAS A;  1KU2 A;  2PNO A;  3M4C A;  3QW0 A;  4L6R A;  5KYU A;  3NRH A;  4CDY A;  4OIP F;  1KTM A;  1APC A;  3AQC A;  4XEK A;  5AC5 A;  4JCH A;  5B3I A;  3EGX B;  2WB7 A;  2IM8 A;  2XXA B;  3GWN A;  3DZA A;  2DB4 A;  2G3K A;  1YA7 O;  2HSQ A;  1IZM A;  2LCH A;  3DAF A;  4LLC A;  5CIV A;  2BC5 A;  3DJN B;  4U5C E;  3U2M A;  3B0P A;  3V5Y A;  3VF0 A;  3W8H A;  5A6B A;  5EGY A;  5KYX B;  4G0H A;  5B1B C;  3MX3 A;  2HMQ A;  3K6B A;  3FAJ A;  2WL8 A;  3S28 A;  3GOD A;  5CI8 A;  1T6U A;  2VH3 A;  1AEP A;  2Q00 A;  3T6G B;  2OG2 A;  2YL7 A;  5DQZ A;  2L6G A;  2A6E F;  2YLD A;  2ZXO A;  1OW6 A;  1T6Q A;  1ZU5 A;  2YZS A;  3LES A;  3W2V A;  3K66 A;  4CIP A;  1H9G A;  3CSK A;  2NUT B;  1V74 B;  1YYJ A;  2YWA A;  5DS5 A;  2Y69 C;  1GM5 A;  4JE9 A;  4YK5 A;  2HUJ A;  1ORY A;  3AG3 C;  3MFN A;  5D91 A;  3V5Z A;  4FES A;  1OKK D;  3TOL A;  1NZE A;  2YRF A;  3S0X A;  5JS5 A;  1MMD A;  3DXJ F;  4IWB A;  1CGN A;  1VLT A;  1CPQ A;  3NDB B;  3WHN A;  1FFT C;  3JSZ A;  4LLE A;  3ASN C;  2IYL D;  3MBG A;  3SNH A;  1YJG A;  5BUO A;  1HW2 A;  2GA0 A;  1A7V A;  3JYY A;  3QVZ A;  3ZC4 A;  4CBE A;  1YA9 A;  2EPK X;  3LLK A;  1K40 A;  3NMI A;  4OIO F;  2YEV A;  4AE4 A;  2EIJ C;  4XEV A;  1UFB A;  3S29 A; 
#chains in the Genus database with same CATH homology
 4DVZ A;  2C04 A;  2KW3 C;  1FTS A;  1VK5 A;  1VYK A;  4YT5 A;  2J9V A;  4U5B E;  2IXN A;  3UMK A;  4U5D E;  2A69 F;  3B0U X;  2VB6 A;  2OCC C;  3EH1 A;  1SMY F;  1D0X A;  4AK9 A;  2R7V A;  2J9U A;  1FMW A;  3ABK C;  4Q4Z F;  4DBR A;  3K7D A;  3EPV A;  4PK4 A;  2HV6 A;  3FVY A;  4EWC A;  4MQ9 F;  4OIQ F;  2XXA A;  4G7H F;  3NG1 A;  4LAC B;  3E9V A;  4BJ6 A;  4KC9 A;  3I5P A;  1Z6A A;  5E33 A;  4C3B A;  2CNW D;  2XL4 A;  1LKX A;  5DLJ A;  4N06 A;  1VMA A;  3W8I A;  2IXM A;  5KYN A;  4QI2 A;  1BR4 A;  1PD0 A;  2Q3T A;  2Q9A A;  4E7S A;  4CSA A;  4U5H A;  4XLN F;  1W2W A;  4JJG A;  1JPJ A;  1PCX A;  5DS4 A;  2L9J A;  4XLP F;  2BE5 F;  3SZR A;  2A1D D;  2MWQ A;  3CQZ A;  4I44 A;  3W2W A;  4AX2 A;  2R7W A;  2A6H F;  3FHD A;  4KNV A;  4YJW A;  2M4E A;  3ZG1 A;  1Z3I X;  4U5G A;  1IW7 F;  4MND A;  4I3M A;  1OKK A;  2NG1 A;  1Z63 A;  3NKE A;  4B6I A;  1ZHT A;  5EHH A;  3RH3 A;  4ZLC A;  3UMH A;  5DQT A;  4O6M A;  2NUP B;  1N1C A;  1RJ9 B;  2EIJ C;  2X51 A;  2Y39 A;  2Y3B A;  2W9Y A;  4PJN A;  1M2V A;  4J30 B;  2Q9B A;  4O6N A;  3NYJ A;  5KYY B;  3X1O A;  4G7O F;  1BR2 A;  4HEA J;  5D92 A;  2R7O A;  3O39 A;  2R7R A;  2D5R B;  1PD1 A;  4PFO A;  5KYU B;  1D0Z A;  2FFH A;  3UMI A;  2PF4 E;  5F5H A;  4OD5 A;  2YHS A;  4BJ6 C;  4X0R A;  2L81 A;  3SEO A;  3AG1 C;  3T6J A;  2B0J A;  3VYW A;  4Q7C A;  2P7V A;  2CNW A;  3EQL F;  3I4U A;  3F47 A;  1V55 C;  3JCU Q;  2G62 A;  3DM9 B;  3O6X A;  3TD7 A;  3DD7 A;  1ZU4 A;  4BEJ A;  1NU7 D;  2QTV A;  1ZHX A;  4LER A;  2G3V A;  4P6I C;  5DS6 A;  1D1A A;  5L3Q A;  4U5E E;  3EGD A;  3WG7 C;  3SYN A;  3FDQ A;  2IOQ A;  4CSA C;  2R7U A;  4JUR I;  2ZPA A;  3N2Z B;  4IAO A;  4G7Z F;  2H7V C;  3EG9 A;  3JYH A;  4AE4 B;  2EIL C;  3IEE A;  3VAY A;  2WZG A;  3KMI A;  3LS1 A;  2CGE A;  3Q6M A;  4PJL A;  4IRU A;  1D0Y A;  3B0V C;  3EG9 B;  3ECS A;  3RIP A;  3LAY A;  4RBN A;  2DYR C;  3E70 C;  3PMR A;  2LSE A;  4K7B A;  2VAS A;  3HTK C;  4O6Y A;  4QI0 A;  4CS9 A;  2R7X A;  5T1D B;  2XXA B;  4BJ1 A;  5B3S C;  3AQB A;  2PP4 A;  1WGW A;  4W8K A;  1TWG A;  3EZH A;  1LVK A;  1J8M F;  2FGY A;  1QZX A;  3AG4 C;  3I5Q A;  4XTK A;  1LS1 A;  2O9X A;  2WVQ A;  4BJT A;  3T6B A;  2KGO A;  4BG0 A;  5F5F A;  3ASO C;  4ZLD A;  4DOZ A;  3RYL A;  1ZYR F;  3EFO A;  3RFY A;  3KKB A;  1TKN A;  1O5H A;  2CDQ A;  3K1I C;  2Z15 A;  4CIH A;  4OIR F;  4JJF A;  4NY3 A;  1JPN A;  3MLG A;  2HV7 A;  3LNR A;  1J8Y F;  3N24 A;  2R7Q A;  1O87 A;  1ZHW A;  2KNH A;  1SZI A;  2ZXP A;  1FMV A;  3JRT A;  2W45 A;  1MNE A;  1MMG A;  2DGJ A;  5CI9 A;  5E2Q A;  1M2O A;  3EFO B;  1ST6 A;  4CS7 A;  3RKO F;  3T4R A;  2P6V A;  2KJG A;  1OCR C;  3M1C B;  4HFK B;  3UR3 C;  4KI2 A;  4C7O A;  3LEV A;  4FX5 A;  4J32 B;  4C3E A;  1FFH A;  1Z5Z A;  2IXP A;  2IXO A;  4XWJ A;  1OCZ C;  2J45 A;  4JW1 A;  3LJB A;  2WZF A;  3Q7L A;  4GYT A;  3POV A;  3HLZ A;  4M63 A;  2WVO A;  2V3C C;  1MMA A;  4F4B A;  2QY9 A;  1BR1 A;  2EIM C;  1MMN A;  3EGX A;  4PJM A;  5KYW A;  1M57 C;  4YN0 B;  4ANJ A;  3K1H A;  1M2V B;  5KYX A;  2Q9C A;  5HSW A;  3HJC A;  3X2Q C;  1S7Z A;  4CS8 C;  3L0I A;  4PFP A;  1OCC C;  2W4B A;  5KYW B;  2PX0 A;  3ZSU A;  3S27 A;  3PHF 2;  2NUT A;  3UGO A;  2ZXW C;  2PFD A;  2KQ9 A;  4CS9 C;  3LLI A;  2J0W A;  1QLE C;  2ZXR A;  4WJ0 A;  3DM5 A;  3V7O A;  1VYI A;  4HE8 D;  4E7Z A;  2W4M A;  1TWA A;  3OA1 A;  4BJ5 C;  5E3A A;  3OEO A;  4O79 A;  4OIN F;  3EHN A;  4Q5S F;  2J7P D;  4YT4 A;  2A68 F;  4DVY P;  4I1M A;  4YT2 A;  3UGP A;  5B1A C;  3EZI A;  3EJN A;  5L3V A;  2PX3 A;  3SP1 A;  4U5F E;  3EGD B;  1TWC A;  4O7G A;  2Y3D A;  3NKD A;  4C3D A;  3QMK A;  5E3C A;  2R7T A;  2EIN C;  3AG2 C;  3H65 A;  1Z23 A;  4HFF B;  2CW0 F;  4CS8 A;  1TR2 A;  2H7O A;  2V26 A;  2MYS A;  3NYL A;  3OWT A;  1M56 C;  4JZA A;  1MND A;  4FWV A;  1ZHY A;  2JD3 A;  4ULW A;  4KBL A;  3GAN A;  1TWH A;  4GEH A;  3N0T A;  3Q6N A;  4BJ5 A;  2E87 A;  4YT8 A;  1D1C A;  3NYM A;  3EH2 A;  4QDL A;  1NG1 A;  3Q7G A;  1SF8 A;  2WVN A;  3KH2 A;  4H4K C;  3K33 A;  2J9W A;  2XSE A;  5T3W A;  2R7S A;  4OD4 A;  2C03 A;  3KL4 A;  2J46 A;  2DYS C;  3LS0 A;  3ABM C;  3ITF A;  3DJU B;  4I1O B;  4JVS A;  2Y3G A;  2WZL A;  4RD9 A;  1ZHZ A;  3ABL C;  5IY5 C;  3L34 A;  4A2N B;  1D1B A;  3WOD F;  3JT1 A;  3DAG A;  4PJJ A;  1VOM A;  1NU9 C;  3QZC A;  3ZIB A;  3ZVR A;  2XRH A;  1V54 C;  4KNW A;  1G8X A;  2GFH A;  4K0D A;  3EHM A;  2NUP A;  1RJ9 A;  2J0X A;  5DVW A;  2J7P A;  4RDA A;  4YWQ A;  5T3T A;  4DBQ A;  3B9Q A;  3UNG C;  4C7O B;  5KYY A;  1OCO C;  3DMD A;  5FCL A;  4IJJ A;  2H7B A;  2Y3H A;  3CZ6 A;  4EBB A;  2EIK C;  3F46 A;  1KU2 A;  5KYU A;  4OIP F;  3NRH A;  3AQC A;  4JCH A;  3EGX B;  2WB7 A;  3DZA A;  4LLC A;  2G3K A;  1IZM A;  3DAF A;  3DJN B;  4U5C E;  3W8H A;  5EGY A;  3B0P A;  5KYX B;  4G0H A;  5B1B C;  3MX3 A;  3K6B A;  3FAJ A;  2WL8 A;  3S28 A;  3GOD A;  5CI8 A;  2VH3 A;  2OG2 A;  5DQZ A;  2A6E F;  2ZXO A;  3LES A;  2YZS A;  1ZU5 A;  3W2V A;  3K66 A;  3CSK A;  2NUT B;  5DS5 A;  2Y69 C;  5D91 A;  3AG3 C;  4FES A;  1OKK D;  1NZE A;  3S0X A;  1MMD A;  3DXJ F;  4IWB A;  3NDB B;  1FFT C;  3JSZ A;  4LLE A;  3ASN C;  2IYL D;  3SNH A;  5BUO A;  3ZC4 A;  4CBE A;  3LLK A;  4OIO F;  2YEV A;  4AE4 A;  2I8B A;  3S29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...