4U5EE

Crystal structure of glua2 t625g, con-ikot-ikot snail toxin, partial agonist ka and postitive modulator (r,r)-2b complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
total genus 25
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5eE00
4U5HA 4U5CE 4U5EE 4U5GA 4U5DE 4U5FE 4U5BE
chains in the Genus database with same CATH superfamily
1NZEA 3US6A 3GM3A 4E17A 3U0CA 4JCHA 5DVWA 5KYXA 2NUTB 3S28A 1VB5A 2CNWD 4JJGA 4KNWA 2XSEA 1M56C 3JZ0A 3SEOA 3PCVA 4CS8C 5T3TA 4CX9A 3KH2A 2OJQA 2Q00A 3K7DA 4XEKA 3ZVRA 2HMZA 2GA0A 2LCHA 3IEEA 4JZAA 1YZAA 2R25A 3U8PA 3VF0A 4OIOF 4MVQA 4BJ5C 4I3MA 3MFNA 3U2LA 4RBNA 4PJJA 4JTAB 3O10A 5BQIA 2Q4FA 4ZLCA 1A7VA 1J8MF 3LEOA 3G4XA 3RKOF 4O79A 1ZW2A 3KMIA 4QDLA 3JT1A 5DS4A 5K0IA 1ZVZA 2DYRC 2JX0A 2W4MA 3E70C 5EGYA 3WHNA 3SXZA 1JOGA 3EGXA 1GGQA 2L6HA 4MS2A 5AGFA 4DXWA 5L0DA 1LM3B 5JT4A 2JPUA 3EGDA 3S9OA 3B71A 3EZIA 3HLZA 3K6BA 3U9JA 1YAUO 5DS5A 3RVZA 2YL0A 5KYWB 4BJ1A 2NSGA 3I5QA 4E18A 2W9YA 4MVSA 1E2XA 1O5HA 2Z15A 4U5GA 3HNIA 2CCYA 2Q3TA 4AL1A 1ZZPA 3GODA 3ITFA 1YZCA 2AWYA 2NG1A 1PD0A 2GDCA 2ZD9A 2OCCC 5B3SC 2R7UA 1G4WR 2J45A 2HFIA 2KSFA 2PNOA 4JTDB 3JYYA 3V5ZA 1W2WA 4YN0B 2XLWA 2RSEB 1ZHYA 3DJUB 3LUTB 3GORA 1H9GA 4CDYA 1NU7D 2W4BA 4KNVA 5KYYA 3K1IA 3DAFA 2G3KA 2QNLA 3CEXA 2L9JA 3RQGA 3IQ5A 3SXKA 1LE2A 1ST6A 4AE4A 3GM2A 4U5FE 1MMGA 1HMOA 4NCQA 3U2MA 2ETSA 2OEXA 2E87A 2HUJA 3U3BA 3JRTA 4MNDA 2AP3A 3OWTA 1T9KA 4H54A 2GFHA 2EPOA 3O6XA 5BQGA 3W8IA 2R7XA 1BDJB 4BJ6C 4LDRA 1NSGB 2Y69C 1OCOC 2NPUA 2XLDA 1DOWA 5F5FA 2PF4E 4DVZA 4FX5A 3DJNB 3T4RA 3GWLA 1MMAA 2EIMC 1YDIA 3VAYA 5JLIA 4Z9HA 3ZDLA 5KYWA 1M2VB 1K40A 1WASA 3C8GB 4CIHA 1LI7A 4YL1A 2P1AA 2H8AA 3SNHA 3T9OA 2YLIA 1RXQA 4CDAA 5KYXB 1N1CA 3EG9B 2CDQA 2IXMA 3L8IA 5JVEA 3HTKC 1IZMA 4GEHA 1QKRA 4PFOA 3QMKA 1UG7A 2NSFA 2YL7A 2M64A 2XM0A 4DRIB 2TMVP 2Y3HA 3L1MA 2Q9AA 4R32A 3W8HA 5L0FA 5L3VA 4G78A 4HEAJ 3NDBB 1HE1A 1VK5A 4U9DA 3EQLF 3EFOA 1K05A 3RF3A 2Q9BA 4MVZA 1D0XA 2YL3A 4XTKA 3LEVA 3GEHA 3FMSA 5TJ5E 3Q6MA 4J32B 1J8YF 2A69F 3IQTA 1OXKA 5F28E 4ONSA 3FXHA 1HY5A 4H4KC 1ZU5A 1TR2A 4U9EA 3ECSA 2HKVA 3DD7A 3VYWA 1K04A 1QSPA 3L34A 1LS4A 5D91A 3Q6NA 4IAOA 3T6BA 3ZQYA 2RD9A 1O87A 3F46A 1RMVA 3JCUQ 2B0JA 5E33A 3SP1A 3F47A 1I5NA 1PD1A 4EWCA 1FR0A 3I4UA 2UUHA 4DRHB 1G5ZA 4CS9A 3K66A 1LPEA 3NKDA 5HSWA 1B68A 1A41A 1NG1A 1CPRA 1TWGA 3QZCA 2QE9A 3EH1A 1V54C 3C8GA 4CS7A 3EHNA 1D1AA 4YT4A 1CGME 4DOZA 3DKAA 1TQGA 4G7ZF 3EGXB 1FTSA 2H7OA 4JJFA 4YT2A 1BBHA 1JPNA 4NC3A 1T6QA 1ZW3A 3EGDB 4F4BA 2VCCA 3RVYA 4YWQA 1ZU4A 1WGWA 3X2QC 1DOVA 3VRCA 1NU9C 4E7SA 1SMYF 2YKZA 3NYJA 4IGGA 2MYSA 4AL0A 4UDVA 4QI0A 1VMAA 1T6IA 3M4CA 4CSAC 1L3PA 2XS1A 3T6GB 1JAFA 2BC5A 3C18A 2EIKC 3NMJA 3DWWA 1VOMA 4U5CE 3GM1A 4ULWA 1Z3IX 1APCA 1FMVA 3BRJA 2BL2A 3I5PA 3V5XA 3TJ5A 4C3DA 2IYLD 4GQHA 1WATA 1E84A 4DRJB 4I1OB 3MX3A 4JC7A 1D1CA 2A1DD 3R7CA 1C02A 3UGOA 4N6HA 4W8PA 3O39A 1XWJA 3O55A 1YA7O 2WVNA 4YK5A 3UMHA 1OR3A 1Q0KA 3KYIA 1R4TA 4AE4B 4MTOA 2AVKA 3AG1C 4XPYA 4O7GA 1H9TA 4XEFA 1RKEA 2YL1A 3EH2A 2L6GA 2GWWA 3HJCA 3NG1A 1Z23A 3UGPA 5EK0A 2HMQA 3FAJA 3RFYA 3S0XA 1KU2A 4G7OF 1U6HA 4I1MA 2ZXRA 3LLIA 2J46A 5COMA 5E3CA 2P6VA 1Q0MA 5COGA 4D4NA 2R02A 2KNHA 3MLGA 4IARA 2BE5F 3M1CB 1MNEA 3E9VA 1OCZC 1V4AA 2EPKX 2XLEA 4JCZA 1OKKA 3G50A 4NY3A 3S29A 4DVYP 2HSBA 2HJ3A 1WWPA 4J7TA 4LACB 3T6JA 2YLGA 4U5HA 5A6AA 4P9TA 1T5OA 3FVYA 3AGTA 1HMDA 256BA 3SZRA 4MVUA 2R9RB 5KYYB 1TFKB 2Y3BA 2XS8A 1BR4A 5JSLA 3RH3A 1MNDA 1AEPA 4EBBA 2XRHA 2LD6A 1LS1A 4O6NA 1HW1A 3KPHA 1OKKD 3C62A 2IM8A 3KL4A 5JUAA 1BR2A 2Y3GA 1JMWA 1OR2A 1TFOB 1S05A 1WOLA 3EJNA 1FAPB 3AQBA 3U9MA 4A2NB 4CS8A 2XM4A 3DI5A 3EFOB 2YQYA 1Y4CA 1ZHZA 3OEOA 2V3CC 1KTMA 1Q0GA 2ASRA 3Q7LA 1G4US 1ORYA 2KK1A 2L81A 2QUPA 4YT8A 4LDQA 3B0PA 1HE9A 1Z5ZA 2J8WA 4JURI 1I4YA 1VYIA 3N0TA 1JRAA 2IXPA 2YEVA 3QW1A 1Y6DA 2R7RA 3SXMA 2Y39A 4CJGA 1QLEC 4XLPF 3DE9A 4W8KA 1E85A 2C04A 4MQ9F 3Q7GA 4EKWA 3JTLO 3W4YA 1GQAA 1OCCC 3LAYA 1T6UA 4ULVA 1PCXA 1RJ9A 3HNKA 2F22A 2J9BA 3ABKC 4JIOA 2LFFA 1ZHWA 4C3EA 1L7CA 4JEBA 4XPXA 3U8VA 4EBKA 1A7EA 3B0UX 4Q7CA 5AC4A 2M4EA 3DZAA 3X1OA 3C7JA 4IRUA 1BZ4A 2QY9A 2KQ9A 3TOLA 5CI9A 1FMWA 1FNTc 3QVYA 2EINC 4MTGA 2WL8A 3CAXA 1M6TA 2J9UA 4PJMA 1SYQA 3OA1A 5B3IA 1VTMP 2ZPAA 2YVKA 3H65A 3A9CA 4MTFA 3RQFA 4O6MA 2Y3DA 5CI8A 5COFA 1QQ3A 4ER9A 3BEHA 1Q0DA 4BJ6A 4L6RA 3M4BA 3PMRA 5B1BC 4DJ9A 2EPNA 2DYSC 1JPJA 2HSQA 4YJWA 2LSEA 4N6CA 2QTVA 4HE8D 4CDVA 3H2VA 1LE4A 1H6GA 2CYDA 3ZQVA 4WJ0A 2P0NA 3WAQA 1RKEB 1YYXA 2FAPB 1EQ1A 5L0GA 2VCBA 4JRZA 5JRAA 2DI3A 4J7YA 4BJTA 1OCRC 1Z7Qc 4MW8A 1EI7A 3IHUA 4M63A 1CPQA 2EPLX 2FGYA 4DBRA 3QVZA 4FAPB 4G0HA 1IW7F 2HV7A 2J9WA 5E3AA 4E0HA 4JW1A 4PFPA 2R7SA 2ZXPA 3V7OA 1OW8A 3DAGA 3TULA 1LVKA 1H7IA 5GPGB 1I4ZA 2HZ8A 1QZXA 2H7VC 5T1DB 5A6KA 3S84A 3FOPA 4Z9IA 3C8ZA 3NRHA 3CSKA 4AX2A 1GS9A 2LFDA 2MHRA 2X51A 4DBQA 2KC3A 2PFDA 1HW2A 1TKNA 2LIGA 2XL8A 2HJMA 2I15A 4OIRF 3N24A 4MW3A 1VLSA 3TOMA 5A6JA 1D1BA 1R5ID 3GANA 4HFKB 4YL3A 4BEMJ 3FDQA 4WGYA 4U5BE 2KJGA 3A11A 4LLEA 5IY5C 2VASA 4LDKA 2KW3C 2ZXWC 3DM5A 3HNJA 4OIQF 3JYHA 1ZHXA 2L7AA 3QW0A 1NBBA 2Q9CA 3TD7A 3AJMA 2WVQA 4C7OA 1OXBA 4N4WA 3ZC4A 2KGOA 4WGZA 2OEVA 4CJOA 3AG3C 3C63A 3RIPA 1WN0A 1YA9A 3TJ6A 2YHSA 3AG4C 3LJBA 3B29A 5E2QA 2OKUA 3U5SA 2C03A 2MWQA 1TWHA 4PR9A 1SF8A 4JVSA 4C3BA 2AU5A 2VCAA 4BG0A 2IXOA 5L0CA 1RJ9B 3IQCA 5DQTA 3PDMP 3EPVA 4JEAA 4EBJA 4CSAA 2ICWG 4GYTA 1ORSC 3K1IC 1RCPA 3TK0A 2XXAA 2P61A 4YL0A 3U3FA 2XLOA 2XLVA 4K0DA 3LNRA 3W2VA 3MYIA 4WABA 1VLTA 4U5EE 1O3UA 4BEJA 1Z63A 4Q5SF 1BR1A 3AGUA 4KBLA 3LS0A 3J06A 1NFNA 4FWVA 1CGOA 3K1HA 3SYNA 1ZHTA 3DM9B 3L8JA 5AC5A 4P6IC 2D5RB 2I8BA 5JP7A 2NUPB 1G8XA 2J7PA 4D4XA 3L0IA 2A0UA 2YZSA 3H2UA 3LESA 1RKCA 1ZYRF 2XL6A 4X0RA 4Z9JA 3LNMB 1C03A 5KYUA 3ATPA 3M79A 2DB4A 3CZ6A 2A6HF 2B0HA 4BJ5A 1FFTC 4IB4A 4BPMA 1QVXA 3KYJA 4XQ1A 3MYFA 2GAQA 4LLCA 2CGEA 3EHMA 3KKBA 3AG2C 5CIVA 1EA8A 2H7BA 2J7PD 2XL4A 2W45A 1TWAA 4FESA 4NTAA 1YYJA 4YT5A 2NUTA 4JE9A 1SR2A 2P7VA 3UMIA 3S90A 1EKYA 1QPUA 3JRMO 3FOOA 4P9FA 2EPMX 1D0ZA 3NYMA 3POVA 5FZTA 5B1AC 3RQEA 1C17M 2A68F 3IPMO 2VB6A 2WZGA 1FFHA 3B9QA 3NKEA 2PBEA 3K33A 4MVMA 5T3WA 4B6IA 1NLXA 4LERA 1YLMA 5FCLA 5BUOA 4U5DE 5L3QA 1M57C 2LP4A 2OU6A 3NMKA 1YARO 4CIPA 2YLDA 2ZXOA 1A0BA 4PJNA 3UMKA 3ASNC 4ZLDA 4OINF 4J30B 3AQCA 1WTYA 4ANJA 4EIYA 2EIJC 2WZLA 3EZHA 3AOUA 2VH3A 1LI5A 2NUPA 3FAPB 5L0HA 3ABLC 2R05A 4NTFA 4K7BA 1SZIA 3ZWIA 5DLJA 4KI2A 1V55C 1T01A 2IXNA 2R7OA 2WZFA 2J9VA 2YRFA 2WVOA 4CS9C 4O6YA 5A6BA 4OIPF 1Q0FA 3UR3C 4IJJA 2Q7RA 3WG7C 1U0BB 2R7VA 1AVOB 2HS5A 2PP4A 3ASOC 3ZTZA 4I44A 2VC9A 4NQFA 3GWNA 4OD4A 1U89A 5L0JA 3RW0A 1TWCA 2G3VA 3GEEA 4IWBA 4XPWA 5EHHA 2R7WA 3HKKA 4RDAA 2OQMA 1AUEA 2G62A 2OJED 2J0WA 4HFFB 4K1OA 3S27A 3GEIA 5L0IA 2KYHA 1OW6A 2D4UA 5A6BD 4C7OB 3R2PA 2DGJA 2R7QA 4N06A 3NMIA 3IQ6A 2YWAA 3LS1A 2IOQA 1E83A 4XEVA 1JR8A 2X0CA 4EHPA 5F5HA 2OOCA 1MQVA 4JKVA 1XZQA 3JSZA 4IAQA 3DMDA 3ZSUA 2J0XA 2V26A 3JSEO 3DE8A 4PACA 2R7TA 2CW0F 1LKXA 3VM6A 4MVOA 5BQHA 3W2WA 2HV6A 2O9XA 3FHDA 4QI2A 4JTCB 3M15A 4XWJA 1D0YA 4MVRA 2OG2A 3DXJF 3N2ZB 4NTBA 2XXAB 1VYKA 4G7HF 3B0VC 1OW7A 1CGNA 4PJLA 3NYLA 1A7DA 2XLMA 2L6FA 2A6EF 1MMNA 5DQZA 5A69A 2PX0A 3QTHA 4OD5A 3G4ZA 3RYLA 4KC9A 4Q4ZF 1M2VA 1PV3A 2JD3A 5KYNA 4AK9A 1UFBA 3WODF 1E86A 1V74B 2FFHA 1LIHA 1YJGA 2IBFA 2UUIA 1Z6AA 3HNLA 3MBGA 3TQOA 4A4AA 4EUKB 3EG9A 4E7ZA 5DS6A 1NFOA 3PHF2 2A0BA 1ORJA 3ABMC 4RD9A 3V5YA 3ZG1A 1F1MA 3LLKA 5KYUB 1XZPA 3SXYA 1M2OA 3CQZA 3ZIBA 1OQCA 2CNWA 3ZTMA 2R03A 5HV9A 1KNYA 2AWCA 3UNGC 5JS5A 4E0IA 4XLNF 1S7ZA 2EILC 1YVIA 2XLHA 2PX3A 2LQGA 2WB7A 3C8GD 4CBEA 2QLAA 5D92A 4PK4A 1GM5A 2LK4A 1MMDA
chains in the Genus database with same CATH topology
1NZEA 4JCHA 5DVWA 2NUTB 3S28A 2CNWD 4JJGA 4KNWA 2XSEA 1M56C 3SEOA 4CS8C 5T3TA 3KH2A 3K7DA 3ZVRA 3IEEA 4JZAA 4OIOF 4BJ5C 4I3MA 4RBNA 4PJJA 4ZLCA 1J8MF 5L3VA 3RKOF 4O79A 3KMIA 4QDLA 3JT1A 5DS4A 2DYRC 2W4MA 3E70C 5EGYA 3EGXA 3EGDA 3EZIA 3HLZA 3K6BA 5DS5A 5KYWB 4BJ1A 3I5QA 2W9YA 1O5HA 2Z15A 4U5GA 2Q3TA 3GODA 3ITFA 2NG1A 1PD0A 5B3SC 2OCCC 2R7UA 2J45A 1W2WA 4YN0B 1ZHYA 3DJUB 1NU7D 2W4BA 4KNVA 5KYYA 3DAFA 2G3KA 2L9JA 1ST6A 4AE4A 4U5FE 1MMGA 2E87A 3JRTA 4MNDA 3OWTA 2GFHA 3O6XA 3W8IA 2R7XA 4BJ6C 2Y69C 1OCOC 5F5FA 2PF4E 4DVZA 4FX5A 3DJNB 3T4RA 1MMAA 2EIMC 3VAYA 5KYWA 1M2VB 4CIHA 3SNHA 5KYXB 1N1CA 3EG9B 2CDQA 2IXMA 3HTKC 1IZMA 4GEHA 4PFOA 3QMKA 2Y3HA 2Q9AA 3W8HA 4HEAJ 3NDBB 1VK5A 3EQLF 3EFOA 2Q9BA 1D0XA 4XTKA 3LEVA 3Q6MA 4J32B 1J8YF 2A69F 4H4KC 1ZU5A 1TR2A 3ECSA 3DD7A 3VYWA 3L34A 5D91A 3Q6NA 4IAOA 3T6BA 3F46A 1O87A 3JCUQ 2B0JA 5E33A 3SP1A 3F47A 1PD1A 4EWCA 3I4UA 4CS9A 3K66A 3NKDA 5HSWA 1TWGA 1NG1A 3QZCA 3EH1A 1V54C 4CS7A 3EHNA 1D1AA 4YT4A 4DOZA 4G7ZF 3EGXB 1FTSA 2H7OA 4JJFA 4YT2A 1JPNA 3EGDB 4F4BA 4YWQA 1ZU4A 1WGWA 3X2QC 4E7SA 1NU9C 1SMYF 3NYJA 2MYSA 4QI0A 1VMAA 4CSAC 2EIKC 4U5CE 1VOMA 4AX2A 4ULWA 1Z3IX 1FMVA 4C3DA 3I5PA 2IYLD 4I1OB 3MX3A 1D1CA 2A1DD 3UGOA 5KYYB 3O39A 3UMHA 2WVNA 4AE4B 3AG1C 4O7GA 3EH2A 3HJCA 3NG1A 1Z23A 3UGPA 3RFYA 3FAJA 3S0XA 1KU2A 4G7OF 4I1MA 2ZXRA 3LLIA 2J46A 5E3CA 2P6VA 2KNHA 3MLGA 2BE5F 3M1CB 1MNEA 3E9VA 1OCZC 1OKKA 4NY3A 3S29A 4DVYP 4LACB 3T6JA 4U5HA 3FVYA 3SZRA 2Y3BA 1BR4A 3RH3A 1MNDA 4EBBA 2XRHA 1LS1A 4O6NA 1OKKD 3KL4A 1BR2A 2Y3GA 3EJNA 4CS8A 3AQBA 4A2NB 3EFOB 1ZHZA 3OEOA 2V3CC 3Q7LA 4YT8A 2L81A 3B0PA 4JURI 1Z5ZA 1VYIA 3N0TA 2IXPA 2YEVA 2R7RA 2Y39A 4XLPF 1QLEC 4W8KA 2C04A 4MQ9F 3Q7GA 3LAYA 1OCCC 1PCXA 1RJ9A 3ABKC 1ZHWA 4C3EA 3B0UX 4Q7CA 2M4EA 3DZAA 3X1OA 4IRUA 2QY9A 2KQ9A 5CI9A 1FMWA 2EINC 2WL8A 2J9UA 4PJMA 3OA1A 2ZPAA 3H65A 4O6MA 2Y3DA 5CI8A 4BJ6A 3PMRA 5B1BC 4YJWA 2DYSC 1JPJA 2LSEA 2QTVA 4HE8D 4WJ0A 4BJTA 1OCRC 4M63A 2FGYA 4DBRA 4G0HA 1IW7F 2HV7A 2J9WA 5E3AA 4JW1A 4PFPA 2R7SA 2ZXPA 3V7OA 3DAGA 1LVKA 1QZXA 2H7VC 5T1DB 3NRHA 3CSKA 2X51A 4DBQA 2PFDA 1TKNA 4OIRF 3N24A 1D1BA 3GANA 4HFKB 3FDQA 4U5BE 2KJGA 4LLEA 5IY5C 2VASA 2KW3C 2ZXWC 3DM5A 4OIQF 3JYHA 1ZHXA 2Q9CA 3TD7A 2WVQA 4C7OA 3ZC4A 2KGOA 3AG3C 3RIPA 2YHSA 3AG4C 3LJBA 5E2QA 2C03A 2MWQA 1TWHA 1SF8A 4JVSA 4C3BA 4BG0A 2IXOA 1RJ9B 5DQTA 3EPVA 4CSAA 4GYTA 3K1IC 2XXAA 4K0DA 3LNRA 3W2VA 1Z63A 4U5EE 4BEJA 4Q5SF 1BR1A 4KBLA 3LS0A 4FWVA 3K1HA 3SYNA 1ZHTA 3DM9B 4P6IC 2D5RB 2I8BA 2NUPB 2J7PA 1G8XA 3L0IA 2YZSA 3LESA 1ZYRF 4X0RA 5KYUA 3CZ6A 2A6HF 4BJ5A 1FFTC 4LLCA 2CGEA 3EHMA 3KKBA 3AG2C 2H7BA 2J7PD 2XL4A 2W45A 1TWAA 4FESA 4YT5A 2NUTA 2P7VA 3UMIA 1D0ZA 3NYMA 3POVA 5B1AC 2A68F 2VB6A 2WZGA 1FFHA 3B9QA 3NKEA 3K33A 5T3WA 4B6IA 4LERA 5FCLA 5BUOA 4U5DE 5L3QA 1M57C 2ZXOA 4PJNA 3UMKA 3ASNC 4ZLDA 4OINF 4J30B 3AQCA 4ANJA 3EZHA 2EIJC 2WZLA 2VH3A 2NUPA 3ABLC 4K7BA 1SZIA 5DLJA 4KI2A 1V55C 2IXNA 2R7OA 2WZFA 2J9VA 4CS9C 2WVOA 4O6YA 4OIPF 3UR3C 2R7VA 4IJJA 3WG7C 2PP4A 3ASOC 4I44A 4OD4A 1TWCA 2G3VA 4IWBA 5EHHA 2R7WA 4RDAA 2G62A 4HFFB 3S27A 2J0WA 4C7OB 2DGJA 2R7QA 4N06A 3LS1A 2IOQA 5F5HA 3JSZA 3ZSUA 3DMDA 2J0XA 2V26A 2R7TA 2CW0F 1LKXA 3W2WA 2HV6A 2O9XA 3FHDA 4QI2A 4XWJA 1D0YA 2OG2A 3DXJF 3N2ZB 2XXAB 1VYKA 4G7HF 3B0VC 4PJLA 3NYLA 2A6EF 1MMNA 5DQZA 2PX0A 4OD5A 3RYLA 4KC9A 4Q4ZF 1M2VA 2JD3A 5KYNA 4AK9A 3WODF 2FFHA 5KYXA 1Z6AA 4E7ZA 5DS6A 3EG9A 3PHF2 4RD9A 3ABMC 3ZG1A 3LLKA 5KYUB 1M2OA 3CQZA 3ZIBA 2CNWA 3UNGC 4XLNF 1S7ZA 2EILC 2PX3A 2WB7A 4CBEA 5D92A 4PK4A 1MMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5H A;  4U5C E;  4U5E E;  4U5G A;  4U5D E;  4U5F E;  4U5B E; 
#chains in the Genus database with same CATH topology
 1NZE A;  3US6 A;  3GM3 A;  4E17 A;  3U0C A;  4JCH A;  5DVW A;  5KYX A;  2NUT B;  3S28 A;  1VB5 A;  2CNW D;  4JJG A;  4KNW A;  2XSE A;  1M56 C;  3JZ0 A;  3SEO A;  3PCV A;  4CS8 C;  5T3T A;  4CX9 A;  3KH2 A;  2OJQ A;  2Q00 A;  3K7D A;  4XEK A;  3ZVR A;  2HMZ A;  2GA0 A;  2LCH A;  3IEE A;  4JZA A;  1YZA A;  2R25 A;  3U8P A;  3VF0 A;  4OIO F;  4MVQ A;  4BJ5 C;  4I3M A;  3MFN A;  3U2L A;  4RBN A;  4PJJ A;  4JTA B;  3O10 A;  5BQI A;  2Q4F A;  4ZLC A;  1A7V A;  1J8M F;  3LEO A;  3G4X A;  3RKO F;  4O79 A;  1ZW2 A;  3KMI A;  4QDL A;  3JT1 A;  5DS4 A;  5K0I A;  1ZVZ A;  2DYR C;  2JX0 A;  2W4M A;  3E70 C;  5EGY A;  3WHN A;  3SXZ A;  1JOG A;  3EGX A;  1GGQ A;  2L6H A;  4MS2 A;  5AGF A;  4DXW A;  5L0D A;  1LM3 B;  5JT4 A;  2JPU A;  3EGD A;  3S9O A;  3B71 A;  3EZI A;  3HLZ A;  3K6B A;  3U9J A;  1YAU O;  5DS5 A;  3RVZ A;  2YL0 A;  5KYW B;  4BJ1 A;  2NSG A;  3I5Q A;  4E18 A;  2W9Y A;  4MVS A;  1E2X A;  1O5H A;  2Z15 A;  4U5G A;  3HNI A;  2CCY A;  2Q3T A;  4AL1 A;  1ZZP A;  3GOD A;  3ITF A;  1YZC A;  2AWY A;  2NG1 A;  1PD0 A;  2GDC A;  2ZD9 A;  2OCC C;  5B3S C;  2R7U A;  1G4W R;  2J45 A;  2HFI A;  2KSF A;  2PNO A;  4JTD B;  3JYY A;  3V5Z A;  1W2W A;  4YN0 B;  2XLW A;  2RSE B;  1ZHY A;  3DJU B;  3LUT B;  3GOR A;  1H9G A;  4CDY A;  1NU7 D;  2W4B A;  4KNV A;  5KYY A;  3K1I A;  3DAF A;  2G3K A;  2QNL A;  3CEX A;  2L9J A;  3RQG A;  3IQ5 A;  3SXK A;  1LE2 A;  1ST6 A;  4AE4 A;  3GM2 A;  4U5F E;  1MMG A;  1HMO A;  4NCQ A;  3U2M A;  2ETS A;  2OEX A;  2E87 A;  2HUJ A;  3U3B A;  3JRT A;  4MND A;  2AP3 A;  3OWT A;  1T9K A;  4H54 A;  2GFH A;  2EPO A;  3O6X A;  5BQG A;  3W8I A;  2R7X A;  1BDJ B;  4BJ6 C;  4LDR A;  1NSG B;  2Y69 C;  1OCO C;  2NPU A;  2XLD A;  1DOW A;  5F5F A;  2PF4 E;  4DVZ A;  4FX5 A;  3DJN B;  3T4R A;  3GWL A;  1MMA A;  2EIM C;  1YDI A;  3VAY A;  5JLI A;  4Z9H A;  3ZDL A;  5KYW A;  1M2V B;  1K40 A;  1WAS A;  3C8G B;  4CIH A;  1LI7 A;  4YL1 A;  2P1A A;  2H8A A;  3SNH A;  3T9O A;  2YLI A;  1RXQ A;  4CDA A;  5KYX B;  1N1C A;  3EG9 B;  2CDQ A;  2IXM A;  3L8I A;  5JVE A;  3HTK C;  1IZM A;  4GEH A;  1QKR A;  4PFO A;  3QMK A;  1UG7 A;  2NSF A;  2YL7 A;  2M64 A;  2XM0 A;  4DRI B;  2TMV P;  2Y3H A;  3L1M A;  2Q9A A;  4R32 A;  3W8H A;  5L0F A;  5L3V A;  4G78 A;  4HEA J;  3NDB B;  1HE1 A;  1VK5 A;  4U9D A;  3EQL F;  3EFO A;  1K05 A;  3RF3 A;  2Q9B A;  4MVZ A;  1D0X A;  2YL3 A;  4XTK A;  3LEV A;  3GEH A;  3FMS A;  5TJ5 E;  3Q6M A;  4J32 B;  1J8Y F;  2A69 F;  3IQT A;  1OXK A;  5F28 E;  4ONS A;  3FXH A;  1HY5 A;  4H4K C;  1ZU5 A;  1TR2 A;  4U9E A;  3ECS A;  2HKV A;  3DD7 A;  3VYW A;  1K04 A;  1QSP A;  3L34 A;  1LS4 A;  5D91 A;  3Q6N A;  4IAO A;  3T6B A;  3ZQY A;  2RD9 A;  1O87 A;  3F46 A;  1RMV A;  3JCU Q;  2B0J A;  5E33 A;  3SP1 A;  3F47 A;  1I5N A;  1PD1 A;  4EWC A;  1FR0 A;  3I4U A;  2UUH A;  4DRH B;  1G5Z A;  4CS9 A;  3K66 A;  1LPE A;  3NKD A;  5HSW A;  1B68 A;  1A41 A;  1NG1 A;  1CPR A;  1TWG A;  3QZC A;  2QE9 A;  3EH1 A;  1V54 C;  3C8G A;  4CS7 A;  3EHN A;  1D1A A;  4YT4 A;  1CGM E;  4DOZ A;  3DKA A;  1TQG A;  4G7Z F;  3EGX B;  1FTS A;  2H7O A;  4JJF A;  4YT2 A;  1BBH A;  1JPN A;  4NC3 A;  1T6Q A;  1ZW3 A;  3EGD B;  4F4B A;  2VCC A;  3RVY A;  4YWQ A;  1ZU4 A;  1WGW A;  3X2Q C;  1DOV A;  3VRC A;  1NU9 C;  4E7S A;  1SMY F;  2YKZ A;  3NYJ A;  4IGG A;  2MYS A;  4AL0 A;  4UDV A;  4QI0 A;  1VMA A;  1T6I A;  3M4C A;  4CSA C;  1L3P A;  2XS1 A;  3T6G B;  1JAF A;  2BC5 A;  3C18 A;  2EIK C;  3NMJ A;  3DWW A;  1VOM A;  4U5C E;  3GM1 A;  4ULW A;  1Z3I X;  1APC A;  1FMV A;  3BRJ A;  2BL2 A;  3I5P A;  3V5X A;  3TJ5 A;  4C3D A;  2IYL D;  4GQH A;  1WAT A;  1E84 A;  4DRJ B;  4I1O B;  3MX3 A;  4JC7 A;  1D1C A;  2A1D D;  3R7C A;  1C02 A;  3UGO A;  4N6H A;  4W8P A;  3O39 A;  1XWJ A;  3O55 A;  1YA7 O;  2WVN A;  4YK5 A;  3UMH A;  1OR3 A;  1Q0K A;  3KYI A;  1R4T A;  4AE4 B;  4MTO A;  2AVK A;  3AG1 C;  4XPY A;  4O7G A;  1H9T A;  4XEF A;  1RKE A;  2YL1 A;  3EH2 A;  2L6G A;  2GWW A;  3HJC A;  3NG1 A;  1Z23 A;  3UGP A;  5EK0 A;  2HMQ A;  3FAJ A;  3RFY A;  3S0X A;  1KU2 A;  4G7O F;  1U6H A;  4I1M A;  2ZXR A;  3LLI A;  2J46 A;  5COM A;  5E3C A;  2P6V A;  1Q0M A;  5COG A;  4D4N A;  2R02 A;  2KNH A;  3MLG A;  4IAR A;  2BE5 F;  3M1C B;  1MNE A;  3E9V A;  1OCZ C;  1V4A A;  2EPK X;  2XLE A;  4JCZ A;  1OKK A;  3G50 A;  4NY3 A;  3S29 A;  4DVY P;  2HSB A;  2HJ3 A;  1WWP A;  4J7T A;  4LAC B;  3T6J A;  2YLG A;  4U5H A;  5A6A A;  4P9T A;  1T5O A;  3FVY A;  3AGT A;  1HMD A;  256B A;  3SZR A;  4MVU A;  2R9R B;  5KYY B;  1TFK B;  2Y3B A;  2XS8 A;  1BR4 A;  5JSL A;  3RH3 A;  1MND A;  1AEP A;  4EBB A;  2XRH A;  2LD6 A;  1LS1 A;  4O6N A;  1HW1 A;  3KPH A;  1OKK D;  3C62 A;  2IM8 A;  3KL4 A;  5JUA A;  1BR2 A;  2Y3G A;  1JMW A;  1OR2 A;  1TFO B;  1S05 A;  1WOL A;  3EJN A;  1FAP B;  3AQB A;  3U9M A;  4A2N B;  4CS8 A;  2XM4 A;  3DI5 A;  3EFO B;  2YQY A;  1Y4C A;  1ZHZ A;  3OEO A;  2V3C C;  1KTM A;  1Q0G A;  2ASR A;  3Q7L A;  1G4U S;  1ORY A;  2KK1 A;  2L81 A;  2QUP A;  4YT8 A;  4LDQ A;  3B0P A;  1HE9 A;  1Z5Z A;  2J8W A;  4JUR I;  1I4Y A;  1VYI A;  3N0T A;  1JRA A;  2IXP A;  2YEV A;  3QW1 A;  1Y6D A;  2R7R A;  3SXM A;  2Y39 A;  4CJG A;  1QLE C;  4XLP F;  3DE9 A;  4W8K A;  1E85 A;  2C04 A;  4MQ9 F;  3Q7G A;  4EKW A;  3JTL O;  3W4Y A;  1GQA A;  1OCC C;  3LAY A;  1T6U A;  4ULV A;  1PCX A;  1RJ9 A;  3HNK A;  2F22 A;  2J9B A;  3ABK C;  4JIO A;  2LFF A;  1ZHW A;  4C3E A;  1L7C A;  4JEB A;  4XPX A;  3U8V A;  4EBK A;  1A7E A;  3B0U X;  4Q7C A;  5AC4 A;  2M4E A;  3DZA A;  3X1O A;  3C7J A;  4IRU A;  1BZ4 A;  2QY9 A;  2KQ9 A;  3TOL A;  5CI9 A;  1FMW A;  1FNT c;  3QVY A;  2EIN C;  4MTG A;  2WL8 A;  3CAX A;  1M6T A;  2J9U A;  4PJM A;  1SYQ A;  3OA1 A;  5B3I A;  1VTM P;  2ZPA A;  2YVK A;  3H65 A;  3A9C A;  4MTF A;  3RQF A;  4O6M A;  2Y3D A;  5CI8 A;  5COF A;  1QQ3 A;  4ER9 A;  3BEH A;  1Q0D A;  4BJ6 A;  4L6R A;  3M4B A;  3PMR A;  5B1B C;  4DJ9 A;  2EPN A;  2DYS C;  1JPJ A;  2HSQ A;  4YJW A;  2LSE A;  4N6C A;  2QTV A;  4HE8 D;  4CDV A;  3H2V A;  1LE4 A;  1H6G A;  2CYD A;  3ZQV A;  4WJ0 A;  2P0N A;  3WAQ A;  1RKE B;  1YYX A;  2FAP B;  1EQ1 A;  5L0G A;  2VCB A;  4JRZ A;  5JRA A;  2DI3 A;  4J7Y A;  4BJT A;  1OCR C;  1Z7Q c;  4MW8 A;  1EI7 A;  3IHU A;  4M63 A;  1CPQ A;  2EPL X;  2FGY A;  4DBR A;  3QVZ A;  4FAP B;  4G0H A;  1IW7 F;  2HV7 A;  2J9W A;  5E3A A;  4E0H A;  4JW1 A;  4PFP A;  2R7S A;  2ZXP A;  3V7O A;  1OW8 A;  3DAG A;  3TUL A;  1LVK A;  1H7I A;  5GPG B;  1I4Z A;  2HZ8 A;  1QZX A;  2H7V C;  5T1D B;  5A6K A;  3S84 A;  3FOP A;  4Z9I A;  3C8Z A;  3NRH A;  3CSK A;  4AX2 A;  1GS9 A;  2LFD A;  2MHR A;  2X51 A;  4DBQ A;  2KC3 A;  2PFD A;  1HW2 A;  1TKN A;  2LIG A;  2XL8 A;  2HJM A;  2I15 A;  4OIR F;  3N24 A;  4MW3 A;  1VLS A;  3TOM A;  5A6J A;  1D1B A;  1R5I D;  3GAN A;  4HFK B;  4YL3 A;  4BEM J;  3FDQ A;  4WGY A;  4U5B E;  2KJG A;  3A11 A;  4LLE A;  5IY5 C;  2VAS A;  4LDK A;  2KW3 C;  2ZXW C;  3DM5 A;  3HNJ A;  4OIQ F;  3JYH A;  1ZHX A;  2L7A A;  3QW0 A;  1NBB A;  2Q9C A;  3TD7 A;  3AJM A;  2WVQ A;  4C7O A;  1OXB A;  4N4W A;  3ZC4 A;  2KGO A;  4WGZ A;  2OEV A;  4CJO A;  3AG3 C;  3C63 A;  3RIP A;  1WN0 A;  1YA9 A;  3TJ6 A;  2YHS A;  3AG4 C;  3LJB A;  3B29 A;  5E2Q A;  2OKU A;  3U5S A;  2C03 A;  2MWQ A;  1TWH A;  4PR9 A;  1SF8 A;  4JVS A;  4C3B A;  2AU5 A;  2VCA A;  4BG0 A;  2IXO A;  5L0C A;  1RJ9 B;  3IQC A;  5DQT A;  3PDM P;  3EPV A;  4JEA A;  4EBJ A;  4CSA A;  2ICW G;  4GYT A;  1ORS C;  3K1I C;  1RCP A;  3TK0 A;  2XXA A;  2P61 A;  4YL0 A;  3U3F A;  2XLO A;  2XLV A;  4K0D A;  3LNR A;  3W2V A;  3MYI A;  4WAB A;  1VLT A;  4U5E E;  1O3U A;  4BEJ A;  1Z63 A;  4Q5S F;  1BR1 A;  3AGU A;  4KBL A;  3LS0 A;  3J06 A;  1NFN A;  4FWV A;  1CGO A;  3K1H A;  3SYN A;  1ZHT A;  3DM9 B;  3L8J A;  5AC5 A;  4P6I C;  2D5R B;  2I8B A;  5JP7 A;  2NUP B;  1G8X A;  2J7P A;  4D4X A;  3L0I A;  2A0U A;  2YZS A;  3H2U A;  3LES A;  1RKC A;  1ZYR F;  2XL6 A;  4X0R A;  4Z9J A;  3LNM B;  1C03 A;  5KYU A;  3ATP A;  3M79 A;  2DB4 A;  3CZ6 A;  2A6H F;  2B0H A;  4BJ5 A;  1FFT C;  4IB4 A;  4BPM A;  1QVX A;  3KYJ A;  4XQ1 A;  3MYF A;  2GAQ A;  4LLC A;  2CGE A;  3EHM A;  3KKB A;  3AG2 C;  5CIV A;  1EA8 A;  2H7B A;  2J7P D;  2XL4 A;  2W45 A;  1TWA A;  4FES A;  4NTA A;  1YYJ A;  4YT5 A;  2NUT A;  4JE9 A;  1SR2 A;  2P7V A;  3UMI A;  3S90 A;  1EKY A;  1QPU A;  3JRM O;  3FOO A;  4P9F A;  2EPM X;  1D0Z A;  3NYM A;  3POV A;  5FZT A;  5B1A C;  3RQE A;  1C17 M;  2A68 F;  3IPM O;  2VB6 A;  2WZG A;  1FFH A;  3B9Q A;  3NKE A;  2PBE A;  3K33 A;  4MVM A;  5T3W A;  4B6I A;  1NLX A;  4LER A;  1YLM A;  5FCL A;  5BUO A;  4U5D E;  5L3Q A;  1M57 C;  2LP4 A;  2OU6 A;  3NMK A;  1YAR O;  4CIP A;  2YLD A;  2ZXO A;  1A0B A;  4PJN A;  3UMK A;  3ASN C;  4ZLD A;  4OIN F;  4J30 B;  3AQC A;  1WTY A;  4ANJ A;  4EIY A;  2EIJ C;  2WZL A;  3EZH A;  3AOU A;  2VH3 A;  1LI5 A;  2NUP A;  3FAP B;  5L0H A;  3ABL C;  2R05 A;  4NTF A;  4K7B A;  1SZI A;  3ZWI A;  5DLJ A;  4KI2 A;  1V55 C;  1T01 A;  2IXN A;  2R7O A;  2WZF A;  2J9V A;  2YRF A;  2WVO A;  4CS9 C;  4O6Y A;  5A6B A;  4OIP F;  1Q0F A;  3UR3 C;  4IJJ A;  2Q7R A;  3WG7 C;  1U0B B;  2R7V A;  1AVO B;  2HS5 A;  2PP4 A;  3ASO C;  3ZTZ A;  4I44 A;  2VC9 A;  4NQF A;  3GWN A;  4OD4 A;  1U89 A;  5L0J A;  3RW0 A;  1TWC A;  2G3V A;  3GEE A;  4IWB A;  4XPW A;  5EHH A;  2R7W A;  3HKK A;  4RDA A;  2OQM A;  1AUE A;  2G62 A;  2OJE D;  2J0W A;  4HFF B;  4K1O A;  3S27 A;  3GEI A;  5L0I A;  2KYH A;  1OW6 A;  2D4U A;  5A6B D;  4C7O B;  3R2P A;  2DGJ A;  2R7Q A;  4N06 A;  3NMI A;  3IQ6 A;  2YWA A;  3LS1 A;  2IOQ A;  1E83 A;  4XEV A;  1JR8 A;  2X0C A;  4EHP A;  5F5H A;  2OOC A;  1MQV A;  4JKV A;  1XZQ A;  3JSZ A;  4IAQ A;  3DMD A;  3ZSU A;  2J0X A;  2V26 A;  3JSE O;  3DE8 A;  4PAC A;  2R7T A;  2CW0 F;  1LKX A;  3VM6 A;  4MVO A;  5BQH A;  3W2W A;  2HV6 A;  2O9X A;  3FHD A;  4QI2 A;  4JTC B;  3M15 A;  4XWJ A;  1D0Y A;  4MVR A;  2OG2 A;  3DXJ F;  3N2Z B;  4NTB A;  2XXA B;  1VYK A;  4G7H F;  3B0V C;  1OW7 A;  1CGN A;  4PJL A;  3NYL A;  1A7D A;  2XLM A;  2L6F A;  2A6E F;  1MMN A;  5DQZ A;  5A69 A;  2PX0 A;  3QTH A;  4OD5 A;  3G4Z A;  3RYL A;  4KC9 A;  4Q4Z F;  1M2V A;  1PV3 A;  2JD3 A;  5KYN A;  4AK9 A;  1UFB A;  3WOD F;  1E86 A;  1V74 B;  2FFH A;  1LIH A;  1YJG A;  2IBF A;  2UUI A;  1Z6A A;  3HNL A;  3MBG A;  3TQO A;  4A4A A;  4EUK B;  3EG9 A;  4E7Z A;  5DS6 A;  1NFO A;  3PHF 2;  2A0B A;  1ORJ A;  3ABM C;  4RD9 A;  3V5Y A;  3ZG1 A;  1F1M A;  3LLK A;  5KYU B;  1XZP A;  3SXY A;  1M2O A;  3CQZ A;  3ZIB A;  1OQC A;  2CNW A;  3ZTM A;  2R03 A;  5HV9 A;  1KNY A;  2AWC A;  3UNG C;  5JS5 A;  4E0I A;  4XLN F;  1S7Z A;  2EIL C;  1YVI A;  2XLH A;  2PX3 A;  2LQG A;  2WB7 A;  3C8G D;  4CBE A;  2QLA A;  5D92 A;  4PK4 A;  1GM5 A;  2LK4 A;  1MMD A; 
#chains in the Genus database with same CATH homology
 1NZE A;  4JCH A;  5DVW A;  2NUT B;  3S28 A;  2CNW D;  4JJG A;  4KNW A;  2XSE A;  1M56 C;  3SEO A;  4CS8 C;  5T3T A;  3KH2 A;  3K7D A;  3ZVR A;  3IEE A;  4JZA A;  4OIO F;  4BJ5 C;  4I3M A;  4RBN A;  4PJJ A;  4ZLC A;  1J8M F;  5L3V A;  3RKO F;  4O79 A;  3KMI A;  4QDL A;  3JT1 A;  5DS4 A;  2DYR C;  2W4M A;  3E70 C;  5EGY A;  3EGX A;  3EGD A;  3EZI A;  3HLZ A;  3K6B A;  5DS5 A;  5KYW B;  4BJ1 A;  3I5Q A;  2W9Y A;  1O5H A;  2Z15 A;  4U5G A;  2Q3T A;  3GOD A;  3ITF A;  2NG1 A;  1PD0 A;  5B3S C;  2OCC C;  2R7U A;  2J45 A;  1W2W A;  4YN0 B;  1ZHY A;  3DJU B;  1NU7 D;  2W4B A;  4KNV A;  5KYY A;  3DAF A;  2G3K A;  2L9J A;  1ST6 A;  4AE4 A;  4U5F E;  1MMG A;  2E87 A;  3JRT A;  4MND A;  3OWT A;  2GFH A;  3O6X A;  3W8I A;  2R7X A;  4BJ6 C;  2Y69 C;  1OCO C;  5F5F A;  2PF4 E;  4DVZ A;  4FX5 A;  3DJN B;  3T4R A;  1MMA A;  2EIM C;  3VAY A;  5KYW A;  1M2V B;  4CIH A;  3SNH A;  5KYX B;  1N1C A;  3EG9 B;  2CDQ A;  2IXM A;  3HTK C;  1IZM A;  4GEH A;  4PFO A;  3QMK A;  2Y3H A;  2Q9A A;  3W8H A;  4HEA J;  3NDB B;  1VK5 A;  3EQL F;  3EFO A;  2Q9B A;  1D0X A;  4XTK A;  3LEV A;  3Q6M A;  4J32 B;  1J8Y F;  2A69 F;  4H4K C;  1ZU5 A;  1TR2 A;  3ECS A;  3DD7 A;  3VYW A;  3L34 A;  5D91 A;  3Q6N A;  4IAO A;  3T6B A;  3F46 A;  1O87 A;  3JCU Q;  2B0J A;  5E33 A;  3SP1 A;  3F47 A;  1PD1 A;  4EWC A;  3I4U A;  4CS9 A;  3K66 A;  3NKD A;  5HSW A;  1TWG A;  1NG1 A;  3QZC A;  3EH1 A;  1V54 C;  4CS7 A;  3EHN A;  1D1A A;  4YT4 A;  4DOZ A;  4G7Z F;  3EGX B;  1FTS A;  2H7O A;  4JJF A;  4YT2 A;  1JPN A;  3EGD B;  4F4B A;  4YWQ A;  1ZU4 A;  1WGW A;  3X2Q C;  4E7S A;  1NU9 C;  1SMY F;  3NYJ A;  2MYS A;  4QI0 A;  1VMA A;  4CSA C;  2EIK C;  4U5C E;  1VOM A;  4AX2 A;  4ULW A;  1Z3I X;  1FMV A;  4C3D A;  3I5P A;  2IYL D;  4I1O B;  3MX3 A;  1D1C A;  2A1D D;  3UGO A;  5KYY B;  3O39 A;  3UMH A;  2WVN A;  4AE4 B;  3AG1 C;  4O7G A;  3EH2 A;  3HJC A;  3NG1 A;  1Z23 A;  3UGP A;  3RFY A;  3FAJ A;  3S0X A;  1KU2 A;  4G7O F;  4I1M A;  2ZXR A;  3LLI A;  2J46 A;  5E3C A;  2P6V A;  2KNH A;  3MLG A;  2BE5 F;  3M1C B;  1MNE A;  3E9V A;  1OCZ C;  1OKK A;  4NY3 A;  3S29 A;  4DVY P;  4LAC B;  3T6J A;  4U5H A;  3FVY A;  3SZR A;  2Y3B A;  1BR4 A;  3RH3 A;  1MND A;  4EBB A;  2XRH A;  1LS1 A;  4O6N A;  1OKK D;  3KL4 A;  1BR2 A;  2Y3G A;  3EJN A;  4CS8 A;  3AQB A;  4A2N B;  3EFO B;  1ZHZ A;  3OEO A;  2V3C C;  3Q7L A;  4YT8 A;  2L81 A;  3B0P A;  4JUR I;  1Z5Z A;  1VYI A;  3N0T A;  2IXP A;  2YEV A;  2R7R A;  2Y39 A;  4XLP F;  1QLE C;  4W8K A;  2C04 A;  4MQ9 F;  3Q7G A;  3LAY A;  1OCC C;  1PCX A;  1RJ9 A;  3ABK C;  1ZHW A;  4C3E A;  3B0U X;  4Q7C A;  2M4E A;  3DZA A;  3X1O A;  4IRU A;  2QY9 A;  2KQ9 A;  5CI9 A;  1FMW A;  2EIN C;  2WL8 A;  2J9U A;  4PJM A;  3OA1 A;  2ZPA A;  3H65 A;  4O6M A;  2Y3D A;  5CI8 A;  4BJ6 A;  3PMR A;  5B1B C;  4YJW A;  2DYS C;  1JPJ A;  2LSE A;  2QTV A;  4HE8 D;  4WJ0 A;  4BJT A;  1OCR C;  4M63 A;  2FGY A;  4DBR A;  4G0H A;  1IW7 F;  2HV7 A;  2J9W A;  5E3A A;  4JW1 A;  4PFP A;  2R7S A;  2ZXP A;  3V7O A;  3DAG A;  1LVK A;  1QZX A;  2H7V C;  5T1D B;  3NRH A;  3CSK A;  2X51 A;  4DBQ A;  2PFD A;  1TKN A;  4OIR F;  3N24 A;  1D1B A;  3GAN A;  4HFK B;  3FDQ A;  4U5B E;  2KJG A;  4LLE A;  5IY5 C;  2VAS A;  2KW3 C;  2ZXW C;  3DM5 A;  4OIQ F;  3JYH A;  1ZHX A;  2Q9C A;  3TD7 A;  2WVQ A;  4C7O A;  3ZC4 A;  2KGO A;  3AG3 C;  3RIP A;  2YHS A;  3AG4 C;  3LJB A;  5E2Q A;  2C03 A;  2MWQ A;  1TWH A;  1SF8 A;  4JVS A;  4C3B A;  4BG0 A;  2IXO A;  1RJ9 B;  5DQT A;  3EPV A;  4CSA A;  4GYT A;  3K1I C;  2XXA A;  4K0D A;  3LNR A;  3W2V A;  1Z63 A;  4U5E E;  4BEJ A;  4Q5S F;  1BR1 A;  4KBL A;  3LS0 A;  4FWV A;  3K1H A;  3SYN A;  1ZHT A;  3DM9 B;  4P6I C;  2D5R B;  2I8B A;  2NUP B;  2J7P A;  1G8X A;  3L0I A;  2YZS A;  3LES A;  1ZYR F;  4X0R A;  5KYU A;  3CZ6 A;  2A6H F;  4BJ5 A;  1FFT C;  4LLC A;  2CGE A;  3EHM A;  3KKB A;  3AG2 C;  2H7B A;  2J7P D;  2XL4 A;  2W45 A;  1TWA A;  4FES A;  4YT5 A;  2NUT A;  2P7V A;  3UMI A;  1D0Z A;  3NYM A;  3POV A;  5B1A C;  2A68 F;  2VB6 A;  2WZG A;  1FFH A;  3B9Q A;  3NKE A;  3K33 A;  5T3W A;  4B6I A;  4LER A;  5FCL A;  5BUO A;  4U5D E;  5L3Q A;  1M57 C;  2ZXO A;  4PJN A;  3UMK A;  3ASN C;  4ZLD A;  4OIN F;  4J30 B;  3AQC A;  4ANJ A;  3EZH A;  2EIJ C;  2WZL A;  2VH3 A;  2NUP A;  3ABL C;  4K7B A;  1SZI A;  5DLJ A;  4KI2 A;  1V55 C;  2IXN A;  2R7O A;  2WZF A;  2J9V A;  4CS9 C;  2WVO A;  4O6Y A;  4OIP F;  3UR3 C;  2R7V A;  4IJJ A;  3WG7 C;  2PP4 A;  3ASO C;  4I44 A;  4OD4 A;  1TWC A;  2G3V A;  4IWB A;  5EHH A;  2R7W A;  4RDA A;  2G62 A;  4HFF B;  3S27 A;  2J0W A;  4C7O B;  2DGJ A;  2R7Q A;  4N06 A;  3LS1 A;  2IOQ A;  5F5H A;  3JSZ A;  3ZSU A;  3DMD A;  2J0X A;  2V26 A;  2R7T A;  2CW0 F;  1LKX A;  3W2W A;  2HV6 A;  2O9X A;  3FHD A;  4QI2 A;  4XWJ A;  1D0Y A;  2OG2 A;  3DXJ F;  3N2Z B;  2XXA B;  1VYK A;  4G7H F;  3B0V C;  4PJL A;  3NYL A;  2A6E F;  1MMN A;  5DQZ A;  2PX0 A;  4OD5 A;  3RYL A;  4KC9 A;  4Q4Z F;  1M2V A;  2JD3 A;  5KYN A;  4AK9 A;  3WOD F;  2FFH A;  5KYX A;  1Z6A A;  4E7Z A;  5DS6 A;  3EG9 A;  3PHF 2;  4RD9 A;  3ABM C;  3ZG1 A;  3LLK A;  5KYU B;  1M2O A;  3CQZ A;  3ZIB A;  2CNW A;  3UNG C;  4XLN F;  1S7Z A;  2EIL C;  2PX3 A;  2WB7 A;  4CBE A;  5D92 A;  4PK4 A;  1MMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...