4U5EE

Crystal structure of glua2 t625g, con-ikot-ikot snail toxin, partial agonist ka and postitive modulator (r,r)-2b complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
total genus 25
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5eE00
4U5GA 4U5FE 4U5HA 4U5BE 4U5DE 4U5EE 4U5CE
chains in the Genus database with same CATH superfamily
2PX3A 3GWLA 1Z7Qc 3G4ZA 3BRJA 4EBJA 1YZCA 1LVKA 1LPEA 3DM5A 3VAYA 3KYJA 1Y4CA 5L0HA 4OIQF 3JRTA 2NUPA 3MX3A 1UG7A 2EILC 5JSLA 2IXOA 2LSEA 4IB4A 4J32B 3FOOA 4D4NA 1RKEB 1T9KA 2Y69C 2B0HA 3DAFA 5KYXB 1I4YA 3LEOA 3NYLA 1YVIA 2DYSC 3CSKA 3EGXB 1QLEC 5DS4A 2YRFA 4KNVA 4PK4A 2R05A 3LS1A 4U5CE 2ZXPA 4C7OB 5T3WA 2WB7A 2I15A 2Y39A 1LE2A 1O3UA 4IWBA 4IGGA 4OINF 2OU6A 3GM1A 3QZCA 3Q7GA 2X0CA 3EG9B 5E33A 3AQBA 5COFA 5DQZA 4EUKB 1XZPA 1YA9A 2J7PA 4XLPF 4MS2A 2Q00A 3ZG1A 1NSGB 4PJLA 3MFNA 4K1OA 4CDAA 2R9RB 1FFHA 2G62A 5KYUA 2A1DD 2H7OA 4LDRA 1V4AA 4U5HA 4AL0A 1YAUO 2YEVA 3GEEA 4ZLCA 1FMVA 2WZGA 4CX9A 3S27A 3K66A 3DAGA 3NYJA 3K7DA 1CGNA 5BQHA 5JUAA 2A0UA 3L8JA 4CSAC 2PNOA 4KBLA 3IQ6A 4IRUA 1DOVA 1C02A 3NMKA 1RMVA 3DE8A 2KYHA 3EZIA 3V5XA 2XS1A 4RDAA 1OW6A 3C62A 4E7SA 3NMIA 4JVSA 4K0DA 4JZAA 1HMOA 3HNKA 1LM3B 2WZLA 4U9EA 4C3DA 3S90A 3IQTA 3I5PA 4JEBA 5HV9A 4IAQA 1Q0FA 2LP4A 2RSEB 1U6HA 2OQMA 2KJGA 5EK0A 1ORJA 2XXAA 2NUTB 4MW8A 2LK4A 4MQ9F 4NQFA 3S28A 4G7OF 4BJ6A 1T01A 2L7AA 3AG3C 4NY3A 4AL1A 2R7VA 5KYWB 4G7HF 2OOCA 1B68A 3QVZA 3DZAA 2QLAA 4DBQA 5JVEA 4C3BA 2YLGA 3M79A 1A41A 2PF4E 2NG1A 4CS8A 1E84A 2HV7A 2A6EF 3K33A 2JX0A 3AG4C 4MTFA 1NFOA 2P7VA 4E7ZA 1ZU4A 3IHUA 3PDMP 4FX5A 1L3PA 2FFHA 1MNEA 1JAFA 1JPJA 5K0IA 1E86A 2CNWD 1JPNA 3UMHA 1TWHA 2XM4A 3RIPA 2GAQA 2XLEA 3GORA 2Z15A 3TK0A 1HE1A 3LLIA 2TMVP 3AJMA 4MVZA 2J9WA 3VYWA 1N1CA 2XRHA 4OIOF 5CI8A 3MLGA 3L34A 3GODA 4OIPF 2G3KA 1M2VA 4U9DA 4MVSA 2A6HF 1LE4A 2YVKA 2YLDA 2JPUA 3ABLC 3HNLA 2OKUA 1CGME 3C63A 2UUIA 3EH2A 4EWCA 1OXKA 1CGOA 1O5HA 4BG0A 5F5FA 3T6GB 1M56C 5KYYA 2A0BA 1OXBA 2ICWG 3DMDA 4ONSA 5HSWA 1FMWA 1MNDA 256BA 3US6A 4EBKA 4HEAJ 4DVYP 2IYLD 2W9YA 2KGOA 1C03A 4Q7CA 4XLNF 3RQEA 2Q3TA 2W4BA 2ZPAA 1SF8A 3U8VA 4JTCB 4I1MA 3S9OA 4A4AA 4QI2A 1AUEA 1OQCA 3DWWA 1LKXA 5KYNA 1G8XA 5E2QA 1CPQA 2L6FA 2LIGA 3SNHA 3MYIA 3EQLF 4RD9A 1VOMA 4PR9A 2J7PD 3GEIA 2M4EA 2J0WA 3KL4A 3B0UX 4JCZA 1V54C 1OCCC 2Y3DA 3NYMA 4XQ1A 3RW0A 3POVA 3IQ5A 3S84A 2NSGA 1FNTc 1WATA 4BJ5A 3WG7C 3DJUB 3E70C 4CIHA 5A6JA 1D1BA 2P1AA 5COMA 5D92A 1HE9A 3ZVRA 1ZHZA 2Q9CA 3AOUA 4U5GA 3W8HA 2IBFA 2EPKX 5KYUB 4UDVA 2Q9AA 3UR3C 4GEHA 3KYIA 2J45A 4WJ0A 1HW2A 1H6GA 2P61A 3NDBB 2R7QA 3ZQYA 4BEJA 1NZEA 2XM0A 2NSFA 1TWGA 3K1IA 1MMAA 4GQHA 1VLTA 2UUHA 3JRMO 1V55C 3ZDLA 4HE8D 2XLHA 1JOGA 2I8BA 3M15A 3TD7A 1JRAA 1L7CA 1TKNA 2Q4FA 3GEHA 3PCVA 1SYQA 3N2ZB 4MTGA 4YN0B 1EI7A 1WGWA 2VCCA 2WVNA 2AWYA 2VC9A 2YQYA 3ZSUA 3V7OA 4OIRF 2R03A 4ZLDA 2Q9BA 3G50A 4WGYA 1J8YF 1TQGA 5A6KA 2HJ3A 4JCHA 4EBBA 5L0FA 1SR2A 3ASOC 2HSQA 2H8AA 1AEPA 1Q0DA 4E18A 5DLJA 1YARO 2A69F 3QTHA 4H4KC 2XXAB 5DS5A 3FHDA 3V5YA 3FOPA 3RQGA 5AC4A 3QMKA 4I1OB 4KI2A 1A0BA 3NKDA 1D0ZA 1LS1A 2YL3A 4FWVA 4MW3A 3RVZA 2KQ9A 2GDCA 5JRAA 2R7XA 4AE4A 4DRJB 1K40A 2Y3GA 3NRHA 1T6IA 1YDIA 3A11A 3KKBA 2QE9A 3IPMO 5BQGA 4W8PA 1G5ZA 2F22A 5FZTA 2MWQA 1ZZPA 2WVQA 4EKWA 4BEMJ 5E3AA 1K05A 1DOWA 2CDQA 1JMWA 3TOLA 4LDKA 2P0NA 3HNIA 1TFKB 1CPRA 3T6JA 3OEOA 3WHNA 1GS9A 1PD0A 3DXJF 1RXQA 3SXYA 3HNJA 5AC5A 2OEXA 2LFFA 3C18A 1LI5A 4MVQA 1SMYF 2BE5F 4XPWA 4FESA 1SZIA 4XWJA 1LI7A 3HTKC 2PX0A 1Z5ZA 2IM8A 2R7RA 1MMNA 4CDVA 4OD4A 4BJ1A 4HFKB 2PBEA 4B6IA 4MNDA 3ITFA 3KH2A 3SEOA 2ETSA 1M2VB 1WOLA 2BL2A 1TWAA 2ZD9A 3IQCA 5BUOA 5JP7A 3OWTA 5CIVA 3LLKA 5L3QA 3U3FA 2GA0A 1VYKA 1XZQA 3UMKA 1KU2A 4I3MA 3C7JA 4Z9HA 4CJOA 1GGQA 3H2UA 2GFHA 1VB5A 4NTAA 4BJTA 4CSAA 1A7DA 2BC5A 1Z23A 4N06A 2KNHA 1BR4A 3EFOA 4JJFA 3VF0A 4EHPA 4Q4ZF 2J0XA 3B0VC 3VRCA 5IY5C 5L3VA 4G78A 1V74B 3X2QC 2KK1A 3HLZA 4YT4A 4FAPB 1G4US 2AWCA 2J9VA 2RD9A 2XS8A 1W2WA 4YL1A 5L0DA 3RVYA 4DBRA 4YL0A 3DJNB 4JE9A 4QI0A 2EINC 2IXNA 4DRHB 3L0IA 1OCRC 3QW1A 4RBNA 2OEVA 3JTLO 3NMJA 4MVUA 4O6NA 1KTMA 1OKKA 2VCBA 4W8KA 1EA8A 2MHRA 4EIYA 1QVXA 5EGYA 2R7SA 1APCA 1O87A 1OW7A 2FGYA 1HMDA 5D91A 5B1BC 5T3TA 5L0GA 5CI9A 2H7BA 2D4UA 3AGUA 4AK9A 5B3IA 2VB6A 2R7WA 3O6XA 3U0CA 4LACB 3JZ0A 5JS5A 3FXHA 1TFOB 3L8IA 1D0XA 2QTVA 4N6HA 5B1AC 3OA1A 3U2LA 4D4XA 2JD3A 2EIKC 3RQFA 4A2NB 3LNMB 3H2VA 3JSZA 1R5ID 2J46A 3LAYA 4IARA 2OCCC 3Q6NA 1MQVA 2R02A 1HW1A 3E9VA 3ZQVA 3K6BA 3T9OA 2IOQA 4XEFA 2QNLA 3ZTMA 5L0CA 1R4TA 5GPGB 4K7BA 4AX2A 3AGTA 3W2VA 1JR8A 5JT4A 2L6HA 1I4ZA 4O6YA 1ZHYA 3LS0A 3J06A 1MMGA 3EPVA 3LESA 5KYYB 1FTSA 2G3VA 1LS4A 2XL4A 2IXMA 3DE9A 1VTMP 2YL7A 3I4UA 2YLIA 3U9MA 2HS5A 3U9JA 3T6BA 4CDYA 2OJQA 5DS6A 4YT5A 3EHNA 2XLDA 4JEAA 1UFBA 2YZSA 2Y3BA 3JYHA 4CS9C 3TOMA 4DXWA 4IAOA 3U5SA 3KPHA 1Q0MA 3N24A 4PFPA 4AE4B 3RKOF 1YA7O 1PD1A 4I44A 1OR2A 1VLSA 2EPMX 5TJ5E 5AGFA 1QSPA 3B71A 1TR2A 3DM9B 4JRZA 1ZU5A 2AU5A 2KW3C 2QY9A 2HMZA 3ZC4A 2KSFA 2E87A 2YWAA 3JSEO 1RJ9A 1WTYA 5L0IA 1T5OA 1XWJA 3EH1A 1H7IA 2KC3A 4H54A 5L0JA 2EPOA 4CIPA 1K04A 4U5EE 3CQZA 4XEVA 2R25A 3FAPB 3ZWIA 4E0HA 4JKVA 5EHHA 1E85A 4C3EA 1A7EA 1FFTC 1WWPA 4P9TA 1OCZC 1YYXA 2FAPB 3AG2C 4N4WA 1NLXA 1ZHWA 5JLIA 5DVWA 3FMSA 4IJJA 2HUJA 2PFDA 5E3CA 3TJ5A 1BDJB 2R7UA 4O79A 3ZIBA 3MBGA 2XLWA 4Q5SF 2ZXRA 1M6TA 2LFDA 3CEXA 4NC3A 3HJCA 3TULA 3O10A 2HSBA 2GWWA 2LCHA 2C04A 2C03A 1BR2A 4PJMA 4ULVA 4JJGA 1T6UA 2EPLX 4N6CA 3L1MA 3EFOB 4GYTA 1C17M 3QVYA 3G4XA 1NFNA 3C8ZA 3DD7A 2X51A 2YL1A 4LLCA 5T1DB 3EGDA 2HMQA 3UNGC 2Y3HA 5DQTA 2WVOA 1H9TA 4ER9A 3M1CB 1OKKD 2W45A 1ORYA 3IEEA 2W4MA 5FCLA 1VYIA 4JTDB 1T6QA 2H7VC 2QUPA 2YL0A 3B9QA 2J8WA 4NTFA 1TWCA 2LQGA 4WABA 1QZXA 5F28E 1PCXA 2MYSA 3O39A 1NG1A 3HKKA 4LDQA 1EQ1A 1YYJA 1M57C 2YHSA 3WODF 1S05A 3GM2A 1IZMA 3SXZA 3C8GA 4JURI 4DJ9A 2CGEA 4JC7A 3S29A 4WGZA 1ZW3A 3SYNA 5A6BA 3X1OA 3DI5A 3GWNA 4MTOA 3M4BA 3B0PA 2VH3A 3MYFA 4MVOA 5A69A 2V3CC 2M64A 4M63A 1ZYRF 4NTBA 2IXPA 3RH3A 2VASA 2PP4A 4CBEA 4Z9IA 3Q7LA 4OD5A 3PHF2 3NG1A 4J30B 3BEHA 3H65A 1EKYA 4X0RA 2CYDA 1OR3A 4CS7A 1IW7F 2ZXOA 4DOZA 4F4BA 3V5ZA 2OJED 2CCYA 4BJ6C 2DYRC 3RF3A 3U2MA 4KC9A 1VMAA 2EPNA 2HJMA 2P6VA 1YZAA 3GM3A 3SXKA 1QKRA 1ORSC 3ATPA 1GQAA 1Z6AA 3DKAA 1D1CA 4U5FE 3W4YA 1ST6A 3FAJA 1OW8A 4NCQA 1RKEA 1Z3IX 1ZW2A 4ULWA 4Z9JA 5KYXA 4CS8C 3R7CA 2L9JA 2DB4A 1WASA 3AQCA 2OG2A 3EGXA 2XL6A 2D5RB 2R7TA 4U5BE 4C7OA 1KNYA 3ZTZA 3UGOA 2AVKA 3JT1A 1E2XA 2LD6A 2XL8A 3T4RA 4YT2A 3UGPA 3EG9A 4YT8A 1U0BB 1J8MF 1ZVZA 4G7ZF 3R2PA 4KNWA 5BQIA 3GANA 3ABMC 3RYLA 3EHMA 3TQOA 3W2WA 3ABKC 1ZHXA 2V26A 3N0TA 5B3SC 4YL3A 1WN0A 4CJGA 3K1HA 1BZ4A 4R32A 2YKZA 1BBHA 2R7OA 2J9UA 3NKEA 1RJ9B 4HFFB 1NBBA 1PV3A 2L81A 4XEKA 3KMIA 4MVRA 4DVZA 2DGJA 1Y6DA 2ASRA 3W8IA 2ZXWC 3I5QA 1I5NA 2XSEA 3B29A 3QW0A 4YK5A 1AVOB 2HZ8A 3U3BA 3RFYA 1D0YA 3M4CA 1BR1A 2XLMA 4XPXA 3UMIA 1YLMA 2EIJC 3F46A 3LUTB 2NPUA 2XLOA 4PJJA 1F1MA 4PFOA 2Q7RA 1YJGA 3JCUQ 5A6AA 4J7TA 2DI3A 3O55A 5COGA 4O7GA 1E83A 1VK5A 1GM5A 1A7VA 4G0HA 3PMRA 3JYYA 4PJNA 3ASNC 4U5DE 3F47A 3WAQA 1RCPA 1Z63A 4E17A 1LIHA 2XLVA 3EZHA 1FAPB 4O6MA 4XPYA 4P6IC 1U89A 3ECSA 3SXMA 2NUTA 4LERA 4BJ5C 4P9FA 2CW0F 3EJNA 4YWQA 1NU7D 2NUPB 3EGDB 1M2OA 3A9CA 5KYWA 2VCAA 1Q0KA 2B0JA 3AG1C 4LLEA 5F5HA 4DRIB 1Q0GA 3CZ6A 1RKCA 3C8GD 3LEVA 2AP3A 3U8PA 4PACA 2WL8A 1D1AA 3S0XA 2EIMC 4XTKA 4MVMA 4ANJA 5A6BD 3LNRA 4YJWA 1G4WR 2O9XA 3K1IC 3SP1A 2HKVA 1FR0A 1QPUA 3C8GB 1OCOC 1ZHTA 4JTAB 4CS9A 2HV6A 4JIOA 3VM6A 3FVYA 4J7YA 4QDLA 1MMDA 3FDQA 4BPMA 3SZRA 1NU9C 3LJBA 1HY5A 3Q6MA 1QQ3A 2A68F 2J9BA 2WZFA 4E0IA 2HFIA 4L6RA 3TJ6A 2CNWA 2L6GA 1H9GA 1S7ZA 3CAXA 4JW1A
chains in the Genus database with same CATH topology
2PX3A 1LVKA 3DM5A 3VAYA 4OIQF 3JRTA 2NUPA 3MX3A 2EILC 2IXOA 2LSEA 4J32B 2Y69C 5KYXB 3DAFA 3NYLA 2DYSC 3CSKA 3EGXB 1QLEC 5DS4A 4KNVA 4PK4A 4C7OB 3LS1A 4U5CE 2ZXPA 5T3WA 2WB7A 2Y39A 4IWBA 4OINF 3QZCA 3Q7GA 3EG9B 5E33A 3AQBA 5DQZA 2J7PA 4XLPF 3ZG1A 4PJLA 1FFHA 2G62A 5KYUA 2A1DD 2H7OA 4U5HA 2YEVA 4ZLCA 1FMVA 2WZGA 3K66A 3DAGA 3NYJA 3K7DA 4CSAC 4KBLA 4IRUA 3EZIA 4RDAA 4E7SA 4JVSA 4K0DA 4JZAA 4C3DA 2WZLA 3I5PA 2KJGA 2XXAA 2NUTB 4MQ9F 3S28A 4G7OF 4BJ6A 4NY3A 3AG3C 5KYWB 4G7HF 4DBQA 3DZAA 4C3BA 2PF4E 2NG1A 4CS8A 2HV7A 2A6EF 3K33A 3AG4C 2P7VA 4E7ZA 1ZU4A 4FX5A 1MNEA 2FFHA 1JPJA 2CNWD 1JPNA 3UMHA 1TWHA 3RIPA 2Z15A 3LLIA 2J9WA 3VYWA 1N1CA 2XRHA 4OIOF 5CI8A 3MLGA 3L34A 3GODA 4OIPF 2G3KA 1M2VA 2A6HF 3ABLC 3EH2A 4EWCA 4BG0A 1O5HA 5F5FA 1M56C 5KYYA 3DMDA 5HSWA 1FMWA 1MNDA 4DVYP 4HEAJ 2IYLD 2W9YA 2KGOA 4Q7CA 4XLNF 2Q3TA 2W4BA 2ZPAA 1SF8A 4I1MA 4QI2A 5KYNA 1LKXA 1G8XA 5E2QA 3SNHA 3EQLF 4RD9A 1VOMA 2J7PD 2M4EA 2J0WA 3KL4A 3B0UX 1V54C 1OCCC 2Y3DA 3NYMA 3POVA 4BJ5A 3WG7C 3DJUB 3E70C 4CIHA 1D1BA 5D92A 3ZVRA 1ZHZA 2Q9CA 4U5GA 3W8HA 5KYUB 2Q9AA 3UR3C 4GEHA 2J45A 4WJ0A 3NDBB 2R7QA 4BEJA 1NZEA 1TWGA 1MMAA 1V55C 4HE8D 2I8BA 3TD7A 1TKNA 3N2ZB 4YN0B 1WGWA 2WVNA 3ZSUA 3V7OA 4OIRF 4ZLDA 2Q9BA 1J8YF 4JCHA 4EBBA 3ASOC 5DLJA 2A69F 4H4KC 2XXAB 5DS5A 3FHDA 3QMKA 4I1OB 4KI2A 3NKDA 1D0ZA 1LS1A 4FWVA 2KQ9A 2R7XA 4AE4A 2Y3GA 3NRHA 3KKBA 2MWQA 2WVQA 5E3AA 2CDQA 3T6JA 3OEOA 3DXJF 1PD0A 1SMYF 2BE5F 4FESA 1SZIA 3HTKC 2PX0A 1Z5ZA 2R7RA 1MMNA 4OD4A 4BJ1A 4HFKB 4B6IA 4MNDA 3ITFA 3KH2A 3SEOA 1M2VB 1TWAA 5BUOA 3OWTA 3LLKA 5L3QA 1VYKA 3UMKA 1KU2A 4I3MA 5KYYB 2GFHA 4BJTA 4CSAA 1Z23A 4N06A 2KNHA 1BR4A 3EFOA 4JJFA 4Q4ZF 2J0XA 3B0VC 5IY5C 5L3VA 3X2QC 3HLZA 4YT4A 2J9VA 1W2WA 4DBRA 3DJNB 4QI0A 2EINC 2IXNA 3L0IA 1OCRC 4RBNA 4O6NA 1OKKA 4W8KA 2R7SA 5EGYA 1O87A 2FGYA 5D91A 5B1BC 5T3TA 5CI9A 2H7BA 4AK9A 2VB6A 2R7WA 3O6XA 4LACB 1D0XA 2QTVA 5B1AC 3OA1A 2JD3A 2EIKC 4A2NB 3JSZA 2J46A 3LAYA 2OCCC 3Q6NA 3E9VA 3K6BA 2IOQA 4K7BA 4AX2A 3W2VA 4O6YA 1ZHYA 3LS0A 1MMGA 3EPVA 3LESA 1FTSA 2G3VA 2XL4A 2IXMA 3I4UA 3T6BA 5DS6A 4YT5A 3EHNA 3JYHA 2YZSA 2Y3BA 4CS9C 4IAOA 4AE4B 3N24A 4PFPA 3RKOF 1PD1A 4I44A 1TR2A 3DM9B 1ZU5A 2KW3C 2QY9A 3ZC4A 2E87A 1RJ9A 3EH1A 4U5EE 3CQZA 5EHHA 4C3EA 1FFTC 1OCZC 3AG2C 1ZHWA 5DVWA 4IJJA 2PFDA 5E3CA 2R7UA 4O79A 3ZIBA 4Q5SF 2ZXRA 3HJCA 2C04A 2C03A 1BR2A 4PJMA 4JJGA 3EFOB 4GYTA 4LLCA 3DD7A 2X51A 5T1DB 3EGDA 3UNGC 2Y3HA 5DQTA 2WVOA 3M1CB 1OKKD 2W45A 3IEEA 5FCLA 2W4MA 1VYIA 4XWJA 2H7VC 3S27A 3B9QA 1TWCA 1QZXA 1PCXA 2MYSA 3O39A 1NG1A 3WODF 1M57C 2YHSA 1IZMA 4JURI 2CGEA 3S29A 3SYNA 3X1OA 3B0PA 2VH3A 2V3CC 4M63A 1ZYRF 2IXPA 3RH3A 2VASA 2PP4A 4CBEA 3Q7LA 4OD5A 3PHF2 3NG1A 4J30B 3H65A 4X0RA 4CS7A 1IW7F 2ZXOA 4DOZA 4F4BA 4BJ6C 2DYRC 4KC9A 1VMAA 2P6VA 4U5FE 1Z6AA 1D1CA 1ST6A 3FAJA 4ULWA 1Z3IX 2R7VA 5KYXA 4CS8C 2L9JA 3AQCA 2OG2A 3EGXA 2D5RB 2R7TA 4U5BE 4C7OA 3UGOA 3JT1A 4YT2A 3T4RA 3UGPA 3EG9A 4YT8A 1J8MF 4G7ZF 4KNWA 3GANA 3ABMC 3RYLA 3EHMA 3W2WA 3ABKC 1ZHXA 2V26A 3N0TA 5B3SC 3K1HA 2R7OA 2J9UA 3NKEA 1RJ9B 4HFFB 2L81A 3KMIA 4DVZA 2DGJA 3W8IA 2ZXWC 3I5QA 2XSEA 3RFYA 1D0YA 1BR1A 3UMIA 2EIJC 3F46A 4PJJA 4PFOA 3JCUQ 4O7GA 1VK5A 4G0HA 3PMRA 4PJNA 4U5DE 3ASNC 1Z63A 3F47A 3EZHA 4O6MA 4P6IC 3ECSA 2NUTA 4LERA 4BJ5C 2CW0F 3EJNA 4YWQA 1NU7D 2NUPB 3EGDB 1M2OA 5KYWA 3AG1C 2B0JA 4LLEA 5F5HA 3CZ6A 3LEVA 2WL8A 1D1AA 3S0XA 2EIMC 4XTKA 4ANJA 3LNRA 4YJWA 2O9XA 3K1IC 3SP1A 1OCOC 1ZHTA 4CS9A 2HV6A 3FVYA 4QDLA 1MMDA 3FDQA 3SZRA 1NU9C 3LJBA 3Q6MA 2A68F 2WZFA 2CNWA 1S7ZA 4JW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5G A;  4U5F E;  4U5H A;  4U5B E;  4U5D E;  4U5E E;  4U5C E; 
#chains in the Genus database with same CATH topology
 2PX3 A;  3GWL A;  1Z7Q c;  3G4Z A;  3BRJ A;  4EBJ A;  1YZC A;  1LVK A;  1LPE A;  3DM5 A;  3VAY A;  3KYJ A;  1Y4C A;  5L0H A;  4OIQ F;  3JRT A;  2NUP A;  3MX3 A;  1UG7 A;  2EIL C;  5JSL A;  2IXO A;  2LSE A;  4IB4 A;  4J32 B;  3FOO A;  4D4N A;  1RKE B;  1T9K A;  2Y69 C;  2B0H A;  3DAF A;  5KYX B;  1I4Y A;  3LEO A;  3NYL A;  1YVI A;  2DYS C;  3CSK A;  3EGX B;  1QLE C;  5DS4 A;  2YRF A;  4KNV A;  4PK4 A;  2R05 A;  3LS1 A;  4U5C E;  2ZXP A;  4C7O B;  5T3W A;  2WB7 A;  2I15 A;  2Y39 A;  1LE2 A;  1O3U A;  4IWB A;  4IGG A;  4OIN F;  2OU6 A;  3GM1 A;  3QZC A;  3Q7G A;  2X0C A;  3EG9 B;  5E33 A;  3AQB A;  5COF A;  5DQZ A;  4EUK B;  1XZP A;  1YA9 A;  2J7P A;  4XLP F;  4MS2 A;  2Q00 A;  3ZG1 A;  1NSG B;  4PJL A;  3MFN A;  4K1O A;  4CDA A;  2R9R B;  1FFH A;  2G62 A;  5KYU A;  2A1D D;  2H7O A;  4LDR A;  1V4A A;  4U5H A;  4AL0 A;  1YAU O;  2YEV A;  3GEE A;  4ZLC A;  1FMV A;  2WZG A;  4CX9 A;  3S27 A;  3K66 A;  3DAG A;  3NYJ A;  3K7D A;  1CGN A;  5BQH A;  5JUA A;  2A0U A;  3L8J A;  4CSA C;  2PNO A;  4KBL A;  3IQ6 A;  4IRU A;  1DOV A;  1C02 A;  3NMK A;  1RMV A;  3DE8 A;  2KYH A;  3EZI A;  3V5X A;  2XS1 A;  4RDA A;  1OW6 A;  3C62 A;  4E7S A;  3NMI A;  4JVS A;  4K0D A;  4JZA A;  1HMO A;  3HNK A;  1LM3 B;  2WZL A;  4U9E A;  4C3D A;  3S90 A;  3IQT A;  3I5P A;  4JEB A;  5HV9 A;  4IAQ A;  1Q0F A;  2LP4 A;  2RSE B;  1U6H A;  2OQM A;  2KJG A;  5EK0 A;  1ORJ A;  2XXA A;  2NUT B;  4MW8 A;  2LK4 A;  4MQ9 F;  4NQF A;  3S28 A;  4G7O F;  4BJ6 A;  1T01 A;  2L7A A;  3AG3 C;  4NY3 A;  4AL1 A;  2R7V A;  5KYW B;  4G7H F;  2OOC A;  1B68 A;  3QVZ A;  3DZA A;  2QLA A;  4DBQ A;  5JVE A;  4C3B A;  2YLG A;  3M79 A;  1A41 A;  2PF4 E;  2NG1 A;  4CS8 A;  1E84 A;  2HV7 A;  2A6E F;  3K33 A;  2JX0 A;  3AG4 C;  4MTF A;  1NFO A;  2P7V A;  4E7Z A;  1ZU4 A;  3IHU A;  3PDM P;  4FX5 A;  1L3P A;  2FFH A;  1MNE A;  1JAF A;  1JPJ A;  5K0I A;  1E86 A;  2CNW D;  1JPN A;  3UMH A;  1TWH A;  2XM4 A;  3RIP A;  2GAQ A;  2XLE A;  3GOR A;  2Z15 A;  3TK0 A;  1HE1 A;  3LLI A;  2TMV P;  3AJM A;  4MVZ A;  2J9W A;  3VYW A;  1N1C A;  2XRH A;  4OIO F;  5CI8 A;  3MLG A;  3L34 A;  3GOD A;  4OIP F;  2G3K A;  1M2V A;  4U9D A;  4MVS A;  2A6H F;  1LE4 A;  2YVK A;  2YLD A;  2JPU A;  3ABL C;  3HNL A;  2OKU A;  1CGM E;  3C63 A;  2UUI A;  3EH2 A;  4EWC A;  1OXK A;  1CGO A;  1O5H A;  4BG0 A;  5F5F A;  3T6G B;  1M56 C;  5KYY A;  2A0B A;  1OXB A;  2ICW G;  3DMD A;  4ONS A;  5HSW A;  1FMW A;  1MND A;  256B A;  3US6 A;  4EBK A;  4HEA J;  4DVY P;  2IYL D;  2W9Y A;  2KGO A;  1C03 A;  4Q7C A;  4XLN F;  3RQE A;  2Q3T A;  2W4B A;  2ZPA A;  1SF8 A;  3U8V A;  4JTC B;  4I1M A;  3S9O A;  4A4A A;  4QI2 A;  1AUE A;  1OQC A;  3DWW A;  1LKX A;  5KYN A;  1G8X A;  5E2Q A;  1CPQ A;  2L6F A;  2LIG A;  3SNH A;  3MYI A;  3EQL F;  4RD9 A;  1VOM A;  4PR9 A;  2J7P D;  3GEI A;  2M4E A;  2J0W A;  3KL4 A;  3B0U X;  4JCZ A;  1V54 C;  1OCC C;  2Y3D A;  3NYM A;  4XQ1 A;  3RW0 A;  3POV A;  3IQ5 A;  3S84 A;  2NSG A;  1FNT c;  1WAT A;  4BJ5 A;  3WG7 C;  3DJU B;  3E70 C;  4CIH A;  5A6J A;  1D1B A;  2P1A A;  5COM A;  5D92 A;  1HE9 A;  3ZVR A;  1ZHZ A;  2Q9C A;  3AOU A;  4U5G A;  3W8H A;  2IBF A;  2EPK X;  5KYU B;  4UDV A;  2Q9A A;  3UR3 C;  4GEH A;  3KYI A;  2J45 A;  4WJ0 A;  1HW2 A;  1H6G A;  2P61 A;  3NDB B;  2R7Q A;  3ZQY A;  4BEJ A;  1NZE A;  2XM0 A;  2NSF A;  1TWG A;  3K1I A;  1MMA A;  4GQH A;  1VLT A;  2UUH A;  3JRM O;  1V55 C;  3ZDL A;  4HE8 D;  2XLH A;  1JOG A;  2I8B A;  3M15 A;  3TD7 A;  1JRA A;  1L7C A;  1TKN A;  2Q4F A;  3GEH A;  3PCV A;  1SYQ A;  3N2Z B;  4MTG A;  4YN0 B;  1EI7 A;  1WGW A;  2VCC A;  2WVN A;  2AWY A;  2VC9 A;  2YQY A;  3ZSU A;  3V7O A;  4OIR F;  2R03 A;  4ZLD A;  2Q9B A;  3G50 A;  4WGY A;  1J8Y F;  1TQG A;  5A6K A;  2HJ3 A;  4JCH A;  4EBB A;  5L0F A;  1SR2 A;  3ASO C;  2HSQ A;  2H8A A;  1AEP A;  1Q0D A;  4E18 A;  5DLJ A;  1YAR O;  2A69 F;  3QTH A;  4H4K C;  2XXA B;  5DS5 A;  3FHD A;  3V5Y A;  3FOP A;  3RQG A;  5AC4 A;  3QMK A;  4I1O B;  4KI2 A;  1A0B A;  3NKD A;  1D0Z A;  1LS1 A;  2YL3 A;  4FWV A;  4MW3 A;  3RVZ A;  2KQ9 A;  2GDC A;  5JRA A;  2R7X A;  4AE4 A;  4DRJ B;  1K40 A;  2Y3G A;  3NRH A;  1T6I A;  1YDI A;  3A11 A;  3KKB A;  2QE9 A;  3IPM O;  5BQG A;  4W8P A;  1G5Z A;  2F22 A;  5FZT A;  2MWQ A;  1ZZP A;  2WVQ A;  4EKW A;  4BEM J;  5E3A A;  1K05 A;  1DOW A;  2CDQ A;  1JMW A;  3TOL A;  4LDK A;  2P0N A;  3HNI A;  1TFK B;  1CPR A;  3T6J A;  3OEO A;  3WHN A;  1GS9 A;  1PD0 A;  3DXJ F;  1RXQ A;  3SXY A;  3HNJ A;  5AC5 A;  2OEX A;  2LFF A;  3C18 A;  1LI5 A;  4MVQ A;  1SMY F;  2BE5 F;  4XPW A;  4FES A;  1SZI A;  4XWJ A;  1LI7 A;  3HTK C;  2PX0 A;  1Z5Z A;  2IM8 A;  2R7R A;  1MMN A;  4CDV A;  4OD4 A;  4BJ1 A;  4HFK B;  2PBE A;  4B6I A;  4MND A;  3ITF A;  3KH2 A;  3SEO A;  2ETS A;  1M2V B;  1WOL A;  2BL2 A;  1TWA A;  2ZD9 A;  3IQC A;  5BUO A;  5JP7 A;  3OWT A;  5CIV A;  3LLK A;  5L3Q A;  3U3F A;  2GA0 A;  1VYK A;  1XZQ A;  3UMK A;  1KU2 A;  4I3M A;  3C7J A;  4Z9H A;  4CJO A;  1GGQ A;  3H2U A;  2GFH A;  1VB5 A;  4NTA A;  4BJT A;  4CSA A;  1A7D A;  2BC5 A;  1Z23 A;  4N06 A;  2KNH A;  1BR4 A;  3EFO A;  4JJF A;  3VF0 A;  4EHP A;  4Q4Z F;  2J0X A;  3B0V C;  3VRC A;  5IY5 C;  5L3V A;  4G78 A;  1V74 B;  3X2Q C;  2KK1 A;  3HLZ A;  4YT4 A;  4FAP B;  1G4U S;  2AWC A;  2J9V A;  2RD9 A;  2XS8 A;  1W2W A;  4YL1 A;  5L0D A;  3RVY A;  4DBR A;  4YL0 A;  3DJN B;  4JE9 A;  4QI0 A;  2EIN C;  2IXN A;  4DRH B;  3L0I A;  1OCR C;  3QW1 A;  4RBN A;  2OEV A;  3JTL O;  3NMJ A;  4MVU A;  4O6N A;  1KTM A;  1OKK A;  2VCB A;  4W8K A;  1EA8 A;  2MHR A;  4EIY A;  1QVX A;  5EGY A;  2R7S A;  1APC A;  1O87 A;  1OW7 A;  2FGY A;  1HMD A;  5D91 A;  5B1B C;  5T3T A;  5L0G A;  5CI9 A;  2H7B A;  2D4U A;  3AGU A;  4AK9 A;  5B3I A;  2VB6 A;  2R7W A;  3O6X A;  3U0C A;  4LAC B;  3JZ0 A;  5JS5 A;  3FXH A;  1TFO B;  3L8I A;  1D0X A;  2QTV A;  4N6H A;  5B1A C;  3OA1 A;  3U2L A;  4D4X A;  2JD3 A;  2EIK C;  3RQF A;  4A2N B;  3LNM B;  3H2V A;  3JSZ A;  1R5I D;  2J46 A;  3LAY A;  4IAR A;  2OCC C;  3Q6N A;  1MQV A;  2R02 A;  1HW1 A;  3E9V A;  3ZQV A;  3K6B A;  3T9O A;  2IOQ A;  4XEF A;  2QNL A;  3ZTM A;  5L0C A;  1R4T A;  5GPG B;  4K7B A;  4AX2 A;  3AGT A;  3W2V A;  1JR8 A;  5JT4 A;  2L6H A;  1I4Z A;  4O6Y A;  1ZHY A;  3LS0 A;  3J06 A;  1MMG A;  3EPV A;  3LES A;  5KYY B;  1FTS A;  2G3V A;  1LS4 A;  2XL4 A;  2IXM A;  3DE9 A;  1VTM P;  2YL7 A;  3I4U A;  2YLI A;  3U9M A;  2HS5 A;  3U9J A;  3T6B A;  4CDY A;  2OJQ A;  5DS6 A;  4YT5 A;  3EHN A;  2XLD A;  4JEA A;  1UFB A;  2YZS A;  2Y3B A;  3JYH A;  4CS9 C;  3TOM A;  4DXW A;  4IAO A;  3U5S A;  3KPH A;  1Q0M A;  3N24 A;  4PFP A;  4AE4 B;  3RKO F;  1YA7 O;  1PD1 A;  4I44 A;  1OR2 A;  1VLS A;  2EPM X;  5TJ5 E;  5AGF A;  1QSP A;  3B71 A;  1TR2 A;  3DM9 B;  4JRZ A;  1ZU5 A;  2AU5 A;  2KW3 C;  2QY9 A;  2HMZ A;  3ZC4 A;  2KSF A;  2E87 A;  2YWA A;  3JSE O;  1RJ9 A;  1WTY A;  5L0I A;  1T5O A;  1XWJ A;  3EH1 A;  1H7I A;  2KC3 A;  4H54 A;  5L0J A;  2EPO A;  4CIP A;  1K04 A;  4U5E E;  3CQZ A;  4XEV A;  2R25 A;  3FAP B;  3ZWI A;  4E0H A;  4JKV A;  5EHH A;  1E85 A;  4C3E A;  1A7E A;  1FFT C;  1WWP A;  4P9T A;  1OCZ C;  1YYX A;  2FAP B;  3AG2 C;  4N4W A;  1NLX A;  1ZHW A;  5JLI A;  5DVW A;  3FMS A;  4IJJ A;  2HUJ A;  2PFD A;  5E3C A;  3TJ5 A;  1BDJ B;  2R7U A;  4O79 A;  3ZIB A;  3MBG A;  2XLW A;  4Q5S F;  2ZXR A;  1M6T A;  2LFD A;  3CEX A;  4NC3 A;  3HJC A;  3TUL A;  3O10 A;  2HSB A;  2GWW A;  2LCH A;  2C04 A;  2C03 A;  1BR2 A;  4PJM A;  4ULV A;  4JJG A;  1T6U A;  2EPL X;  4N6C A;  3L1M A;  3EFO B;  4GYT A;  1C17 M;  3QVY A;  3G4X A;  1NFN A;  3C8Z A;  3DD7 A;  2X51 A;  2YL1 A;  4LLC A;  5T1D B;  3EGD A;  2HMQ A;  3UNG C;  2Y3H A;  5DQT A;  2WVO A;  1H9T A;  4ER9 A;  3M1C B;  1OKK D;  2W45 A;  1ORY A;  3IEE A;  2W4M A;  5FCL A;  1VYI A;  4JTD B;  1T6Q A;  2H7V C;  2QUP A;  2YL0 A;  3B9Q A;  2J8W A;  4NTF A;  1TWC A;  2LQG A;  4WAB A;  1QZX A;  5F28 E;  1PCX A;  2MYS A;  3O39 A;  1NG1 A;  3HKK A;  4LDQ A;  1EQ1 A;  1YYJ A;  1M57 C;  2YHS A;  3WOD F;  1S05 A;  3GM2 A;  1IZM A;  3SXZ A;  3C8G A;  4JUR I;  4DJ9 A;  2CGE A;  4JC7 A;  3S29 A;  4WGZ A;  1ZW3 A;  3SYN A;  5A6B A;  3X1O A;  3DI5 A;  3GWN A;  4MTO A;  3M4B A;  3B0P A;  2VH3 A;  3MYF A;  4MVO A;  5A69 A;  2V3C C;  2M64 A;  4M63 A;  1ZYR F;  4NTB A;  2IXP A;  3RH3 A;  2VAS A;  2PP4 A;  4CBE A;  4Z9I A;  3Q7L A;  4OD5 A;  3PHF 2;  3NG1 A;  4J30 B;  3BEH A;  3H65 A;  1EKY A;  4X0R A;  2CYD A;  1OR3 A;  4CS7 A;  1IW7 F;  2ZXO A;  4DOZ A;  4F4B A;  3V5Z A;  2OJE D;  2CCY A;  4BJ6 C;  2DYR C;  3RF3 A;  3U2M A;  4KC9 A;  1VMA A;  2EPN A;  2HJM A;  2P6V A;  1YZA A;  3GM3 A;  3SXK A;  1QKR A;  1ORS C;  3ATP A;  1GQA A;  1Z6A A;  3DKA A;  1D1C A;  4U5F E;  3W4Y A;  1ST6 A;  3FAJ A;  1OW8 A;  4NCQ A;  1RKE A;  1Z3I X;  1ZW2 A;  4ULW A;  4Z9J A;  5KYX A;  4CS8 C;  3R7C A;  2L9J A;  2DB4 A;  1WAS A;  3AQC A;  2OG2 A;  3EGX A;  2XL6 A;  2D5R B;  2R7T A;  4U5B E;  4C7O A;  1KNY A;  3ZTZ A;  3UGO A;  2AVK A;  3JT1 A;  1E2X A;  2LD6 A;  2XL8 A;  3T4R A;  4YT2 A;  3UGP A;  3EG9 A;  4YT8 A;  1U0B B;  1J8M F;  1ZVZ A;  4G7Z F;  3R2P A;  4KNW A;  5BQI A;  3GAN A;  3ABM C;  3RYL A;  3EHM A;  3TQO A;  3W2W A;  3ABK C;  1ZHX A;  2V26 A;  3N0T A;  5B3S C;  4YL3 A;  1WN0 A;  4CJG A;  3K1H A;  1BZ4 A;  4R32 A;  2YKZ A;  1BBH A;  2R7O A;  2J9U A;  3NKE A;  1RJ9 B;  4HFF B;  1NBB A;  1PV3 A;  2L81 A;  4XEK A;  3KMI A;  4MVR A;  4DVZ A;  2DGJ A;  1Y6D A;  2ASR A;  3W8I A;  2ZXW C;  3I5Q A;  1I5N A;  2XSE A;  3B29 A;  3QW0 A;  4YK5 A;  1AVO B;  2HZ8 A;  3U3B A;  3RFY A;  1D0Y A;  3M4C A;  1BR1 A;  2XLM A;  4XPX A;  3UMI A;  1YLM A;  2EIJ C;  3F46 A;  3LUT B;  2NPU A;  2XLO A;  4PJJ A;  1F1M A;  4PFO A;  2Q7R A;  1YJG A;  3JCU Q;  5A6A A;  4J7T A;  2DI3 A;  3O55 A;  5COG A;  4O7G A;  1E83 A;  1VK5 A;  1GM5 A;  1A7V A;  4G0H A;  3PMR A;  3JYY A;  4PJN A;  3ASN C;  4U5D E;  3F47 A;  3WAQ A;  1RCP A;  1Z63 A;  4E17 A;  1LIH A;  2XLV A;  3EZH A;  1FAP B;  4O6M A;  4XPY A;  4P6I C;  1U89 A;  3ECS A;  3SXM A;  2NUT A;  4LER A;  4BJ5 C;  4P9F A;  2CW0 F;  3EJN A;  4YWQ A;  1NU7 D;  2NUP B;  3EGD B;  1M2O A;  3A9C A;  5KYW A;  2VCA A;  1Q0K A;  2B0J A;  3AG1 C;  4LLE A;  5F5H A;  4DRI B;  1Q0G A;  3CZ6 A;  1RKC A;  3C8G D;  3LEV A;  2AP3 A;  3U8P A;  4PAC A;  2WL8 A;  1D1A A;  3S0X A;  2EIM C;  4XTK A;  4MVM A;  4ANJ A;  5A6B D;  3LNR A;  4YJW A;  1G4W R;  2O9X A;  3K1I C;  3SP1 A;  2HKV A;  1FR0 A;  1QPU A;  3C8G B;  1OCO C;  1ZHT A;  4JTA B;  4CS9 A;  2HV6 A;  4JIO A;  3VM6 A;  3FVY A;  4J7Y A;  4QDL A;  1MMD A;  3FDQ A;  4BPM A;  3SZR A;  1NU9 C;  3LJB A;  1HY5 A;  3Q6M A;  1QQ3 A;  2A68 F;  2J9B A;  2WZF A;  4E0I A;  2HFI A;  4L6R A;  3TJ6 A;  2CNW A;  2L6G A;  1H9G A;  1S7Z A;  3CAX A;  4JW1 A; 
#chains in the Genus database with same CATH homology
 2PX3 A;  1LVK A;  3DM5 A;  3VAY A;  4OIQ F;  3JRT A;  2NUP A;  3MX3 A;  2EIL C;  2IXO A;  2LSE A;  4J32 B;  2Y69 C;  5KYX B;  3DAF A;  3NYL A;  2DYS C;  3CSK A;  3EGX B;  1QLE C;  5DS4 A;  4KNV A;  4PK4 A;  4C7O B;  3LS1 A;  4U5C E;  2ZXP A;  5T3W A;  2WB7 A;  2Y39 A;  4IWB A;  4OIN F;  3QZC A;  3Q7G A;  3EG9 B;  5E33 A;  3AQB A;  5DQZ A;  2J7P A;  4XLP F;  3ZG1 A;  4PJL A;  1FFH A;  2G62 A;  5KYU A;  2A1D D;  2H7O A;  4U5H A;  2YEV A;  4ZLC A;  1FMV A;  2WZG A;  3K66 A;  3DAG A;  3NYJ A;  3K7D A;  4CSA C;  4KBL A;  4IRU A;  3EZI A;  4RDA A;  4E7S A;  4JVS A;  4K0D A;  4JZA A;  4C3D A;  2WZL A;  3I5P A;  2KJG A;  2XXA A;  2NUT B;  4MQ9 F;  3S28 A;  4G7O F;  4BJ6 A;  4NY3 A;  3AG3 C;  5KYW B;  4G7H F;  4DBQ A;  3DZA A;  4C3B A;  2PF4 E;  2NG1 A;  4CS8 A;  2HV7 A;  2A6E F;  3K33 A;  3AG4 C;  2P7V A;  4E7Z A;  1ZU4 A;  4FX5 A;  1MNE A;  2FFH A;  1JPJ A;  2CNW D;  1JPN A;  3UMH A;  1TWH A;  3RIP A;  2Z15 A;  3LLI A;  2J9W A;  3VYW A;  1N1C A;  2XRH A;  4OIO F;  5CI8 A;  3MLG A;  3L34 A;  3GOD A;  4OIP F;  2G3K A;  1M2V A;  2A6H F;  3ABL C;  3EH2 A;  4EWC A;  4BG0 A;  1O5H A;  5F5F A;  1M56 C;  5KYY A;  3DMD A;  5HSW A;  1FMW A;  1MND A;  4DVY P;  4HEA J;  2IYL D;  2W9Y A;  2KGO A;  4Q7C A;  4XLN F;  2Q3T A;  2W4B A;  2ZPA A;  1SF8 A;  4I1M A;  4QI2 A;  5KYN A;  1LKX A;  1G8X A;  5E2Q A;  3SNH A;  3EQL F;  4RD9 A;  1VOM A;  2J7P D;  2M4E A;  2J0W A;  3KL4 A;  3B0U X;  1V54 C;  1OCC C;  2Y3D A;  3NYM A;  3POV A;  4BJ5 A;  3WG7 C;  3DJU B;  3E70 C;  4CIH A;  1D1B A;  5D92 A;  3ZVR A;  1ZHZ A;  2Q9C A;  4U5G A;  3W8H A;  5KYU B;  2Q9A A;  3UR3 C;  4GEH A;  2J45 A;  4WJ0 A;  3NDB B;  2R7Q A;  4BEJ A;  1NZE A;  1TWG A;  1MMA A;  1V55 C;  4HE8 D;  2I8B A;  3TD7 A;  1TKN A;  3N2Z B;  4YN0 B;  1WGW A;  2WVN A;  3ZSU A;  3V7O A;  4OIR F;  4ZLD A;  2Q9B A;  1J8Y F;  4JCH A;  4EBB A;  3ASO C;  5DLJ A;  2A69 F;  4H4K C;  2XXA B;  5DS5 A;  3FHD A;  3QMK A;  4I1O B;  4KI2 A;  3NKD A;  1D0Z A;  1LS1 A;  4FWV A;  2KQ9 A;  2R7X A;  4AE4 A;  2Y3G A;  3NRH A;  3KKB A;  2MWQ A;  2WVQ A;  5E3A A;  2CDQ A;  3T6J A;  3OEO A;  3DXJ F;  1PD0 A;  1SMY F;  2BE5 F;  4FES A;  1SZI A;  3HTK C;  2PX0 A;  1Z5Z A;  2R7R A;  1MMN A;  4OD4 A;  4BJ1 A;  4HFK B;  4B6I A;  4MND A;  3ITF A;  3KH2 A;  3SEO A;  1M2V B;  1TWA A;  5BUO A;  3OWT A;  3LLK A;  5L3Q A;  1VYK A;  3UMK A;  1KU2 A;  4I3M A;  5KYY B;  2GFH A;  4BJT A;  4CSA A;  1Z23 A;  4N06 A;  2KNH A;  1BR4 A;  3EFO A;  4JJF A;  4Q4Z F;  2J0X A;  3B0V C;  5IY5 C;  5L3V A;  3X2Q C;  3HLZ A;  4YT4 A;  2J9V A;  1W2W A;  4DBR A;  3DJN B;  4QI0 A;  2EIN C;  2IXN A;  3L0I A;  1OCR C;  4RBN A;  4O6N A;  1OKK A;  4W8K A;  2R7S A;  5EGY A;  1O87 A;  2FGY A;  5D91 A;  5B1B C;  5T3T A;  5CI9 A;  2H7B A;  4AK9 A;  2VB6 A;  2R7W A;  3O6X A;  4LAC B;  1D0X A;  2QTV A;  5B1A C;  3OA1 A;  2JD3 A;  2EIK C;  4A2N B;  3JSZ A;  2J46 A;  3LAY A;  2OCC C;  3Q6N A;  3E9V A;  3K6B A;  2IOQ A;  4K7B A;  4AX2 A;  3W2V A;  4O6Y A;  1ZHY A;  3LS0 A;  1MMG A;  3EPV A;  3LES A;  1FTS A;  2G3V A;  2XL4 A;  2IXM A;  3I4U A;  3T6B A;  5DS6 A;  4YT5 A;  3EHN A;  3JYH A;  2YZS A;  2Y3B A;  4CS9 C;  4IAO A;  4AE4 B;  3N24 A;  4PFP A;  3RKO F;  1PD1 A;  4I44 A;  1TR2 A;  3DM9 B;  1ZU5 A;  2KW3 C;  2QY9 A;  3ZC4 A;  2E87 A;  1RJ9 A;  3EH1 A;  4U5E E;  3CQZ A;  5EHH A;  4C3E A;  1FFT C;  1OCZ C;  3AG2 C;  1ZHW A;  5DVW A;  4IJJ A;  2PFD A;  5E3C A;  2R7U A;  4O79 A;  3ZIB A;  4Q5S F;  2ZXR A;  3HJC A;  2C04 A;  2C03 A;  1BR2 A;  4PJM A;  4JJG A;  3EFO B;  4GYT A;  4LLC A;  3DD7 A;  2X51 A;  5T1D B;  3EGD A;  3UNG C;  2Y3H A;  5DQT A;  2WVO A;  3M1C B;  1OKK D;  2W45 A;  3IEE A;  5FCL A;  2W4M A;  1VYI A;  4XWJ A;  2H7V C;  3S27 A;  3B9Q A;  1TWC A;  1QZX A;  1PCX A;  2MYS A;  3O39 A;  1NG1 A;  3WOD F;  1M57 C;  2YHS A;  1IZM A;  4JUR I;  2CGE A;  3S29 A;  3SYN A;  3X1O A;  3B0P A;  2VH3 A;  2V3C C;  4M63 A;  1ZYR F;  2IXP A;  3RH3 A;  2VAS A;  2PP4 A;  4CBE A;  3Q7L A;  4OD5 A;  3PHF 2;  3NG1 A;  4J30 B;  3H65 A;  4X0R A;  4CS7 A;  1IW7 F;  2ZXO A;  4DOZ A;  4F4B A;  4BJ6 C;  2DYR C;  4KC9 A;  1VMA A;  2P6V A;  4U5F E;  1Z6A A;  1D1C A;  1ST6 A;  3FAJ A;  4ULW A;  1Z3I X;  2R7V A;  5KYX A;  4CS8 C;  2L9J A;  3AQC A;  2OG2 A;  3EGX A;  2D5R B;  2R7T A;  4U5B E;  4C7O A;  3UGO A;  3JT1 A;  4YT2 A;  3T4R A;  3UGP A;  3EG9 A;  4YT8 A;  1J8M F;  4G7Z F;  4KNW A;  3GAN A;  3ABM C;  3RYL A;  3EHM A;  3W2W A;  3ABK C;  1ZHX A;  2V26 A;  3N0T A;  5B3S C;  3K1H A;  2R7O A;  2J9U A;  3NKE A;  1RJ9 B;  4HFF B;  2L81 A;  3KMI A;  4DVZ A;  2DGJ A;  3W8I A;  2ZXW C;  3I5Q A;  2XSE A;  3RFY A;  1D0Y A;  1BR1 A;  3UMI A;  2EIJ C;  3F46 A;  4PJJ A;  4PFO A;  3JCU Q;  4O7G A;  1VK5 A;  4G0H A;  3PMR A;  4PJN A;  4U5D E;  3ASN C;  1Z63 A;  3F47 A;  3EZH A;  4O6M A;  4P6I C;  3ECS A;  2NUT A;  4LER A;  4BJ5 C;  2CW0 F;  3EJN A;  4YWQ A;  1NU7 D;  2NUP B;  3EGD B;  1M2O A;  5KYW A;  3AG1 C;  2B0J A;  4LLE A;  5F5H A;  3CZ6 A;  3LEV A;  2WL8 A;  1D1A A;  3S0X A;  2EIM C;  4XTK A;  4ANJ A;  3LNR A;  4YJW A;  2O9X A;  3K1I C;  3SP1 A;  1OCO C;  1ZHT A;  4CS9 A;  2HV6 A;  3FVY A;  4QDL A;  1MMD A;  3FDQ A;  3SZR A;  1NU9 C;  3LJB A;  3Q6M A;  2A68 F;  2WZF A;  2CNW A;  1S7Z A;  4JW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...