4U5EE

Crystal structure of glua2 t625g, con-ikot-ikot snail toxin, partial agonist ka and postitive modulator (r,r)-2b complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
b'GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
total genus 25
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5eE00
4U5BE 4U5HA 4U5FE 4U5CE 4U5GA 4U5EE 4U5DE
chains in the Genus database with same CATH superfamily
4MVUA 1NU9C 3JYHA 5EK0A 4IJJA 2R9RB 3SXYA 1ZVZA 5T3WA 2VCCA 3JTLO 2R7UA 3QW0A 4U5GA 4NC3A 2YL3A 3I4UA 4WGZA 3N0TA 5E3AA 3LUTB 5BQHA 3O6XA 4E7SA 3VM6A 1QKRA 3MLGA 1AVOB 3NKDA 4JZAA 3K7DA 1C03A 4MVQA 5KYYB 3B0PA 1SZIA 4JE9A 3US6A 2NSFA 4C3BA 3QVZA 4H4KC 4HEAJ 3ZDLA 4E17A 1FR0A 1MQVA 4JJGA 1LI5A 2ZPAA 1J8YF 2B0HA 3FXHA 4X0RA 5F28E 1CPQA 4JC7A 1E85A 1EKYA 3DM9B 2WL8A 3N24A 2P0NA 3EH2A 1BR2A 2J45A 2PFDA 3GM3A 1VTMP 4I3MA 2YHSA 2AWCA 4AK9A 3IQTA 1WTYA 4N4WA 4A2NB 1YA9A 2NUPB 3EGDA 3OWTA 1TKNA 3LEOA 3U9MA 4PJJA 4YK5A 3C8GB 3DAFA 1O3UA 2Y3HA 2NUTB 3QMKA 1FFTC 3ATPA 4MNDA 2HS5A 5F5HA 1CGME 2OJQA 2HKVA 1V55C 3RKOF 1U0BB 1YARO 3AQCA 2Y3GA 1TQGA 2KNHA 3G50A 1H9GA 4P9FA 3RYLA 5FCLA 2R7TA 5EHHA 3DI5A 3ZTZA 2JD3A 3U3FA 3KPHA 2AU5A 2J7PD 1OCZC 3GEEA 1H6GA 3NKEA 2R7WA 2J7PA 1UG7A 2HZ8A 4JCHA 3AG3C 3UMKA 3X2QC 4PFOA 2XL8A 2CW0F 2Y3BA 3K1IA 3RVZA 4DBQA 4RDAA 2L6GA 3U2MA 1UFBA 3DE9A 4JVSA 4PJNA 3UNGC 1C02A 1M56C 2LQGA 3TQOA 1ZU4A 2IBFA 1M2OA 2GWWA 2CYDA 2LCHA 2OCCC 1AEPA 1NLXA 4MS2A 3NMKA 4K1OA 1TFOB 4XEKA 3S29A 5A6BA 1Z3IX 3EFOB 3LLIA 4BEJA 1U89A 4MW3A 2LP4A 1OKKD 1IW7F 1KU2A 2FAPB 1HMDA 4IWBA 3TULA 2J9BA 1ZW3A 3J06A 2L7AA 1WATA 2IM8A 2VC9A 2G62A 1L7CA 1VMAA 1O87A 3A11A 5COFA 2I15A 3LESA 2DYSC 3L34A 4GQHA 4JTAB 2J0XA 3AGUA 1V54C 1W2WA 4XWJA 1ZHZA 3GM1A 4O6NA 3EZHA 3EGDB 5KYUA 4JEAA 3WHNA 1U6HA 2KQ9A 3B9QA 3E70C 4P6IC 2XXAA 2MWQA 3ASOC 2WVNA 5EGYA 1ORJA 3C63A 1KNYA 2A6EF 2ZD9A 2DGJA 3H2VA 3A9CA 1JR8A 2WB7A 5B3IA 1NZEA 2KYHA 2QLAA 1V4AA 3TD7A 4OD4A 3DKAA 1PD1A 4B6IA 2WVOA 5L0DA 2XM4A 1JRAA 2Q9CA 4YT5A 4OIOF 2PNOA 3ITFA 3NYMA 1LS4A 2YL0A 3CZ6A 3NMIA 5BQIA 3V5XA 5DS5A 4IARA 3U3BA 4CS9A 3DXJF 2P1AA 3TK0A 1D1AA 2D5RB 3I5QA 5JT4A 4G7ZF 4C7OB 4BJ5A 1OCCC 3UMIA 1YYXA 1APCA 2PBEA 4QI0A 4BJTA 3HNLA 1TWAA 4DRHB 4EUKB 4YT8A 4KBLA 5HSWA 2DI3A 2XLDA 4AE4A 2XS8A 4DRIB 4G7OF 1JPJA 1GM5A 1GS9A 4ONSA 1LKXA 1M2VB 3FOPA 1RKCA 4YWQA 1NBBA 3JCUQ 4J7TA 1G4US 2LK4A 4GYTA 4ANJA 1LS1A 3ASNC 4XPYA 3W8HA 4MVOA 3K6BA 2MYSA 4OINF 3HLZA 2VB6A 2Z15A 2AP3A 3JRMO 1BBHA 4EKWA 3MFNA 1OQCA 2GDCA 2XLEA 4M63A 3AGTA 1JAFA 1ST6A 1NU7D 3U2LA 4LERA 3TJ6A 2HFIA 2IYLD 4E0IA 3HNIA 3BRJA 4BPMA 3T6GB 1J8MF 2P7VA 4EBKA 5A6KA 4FWVA 2UUIA 3W2WA 3L8IA 2OJED 5L3QA 1D1BA 4XQ1A 3DM5A 2GA0A 5L0JA 2AVKA 4PJMA 1ZU5A 1S7ZA 2Q9BA 1HW1A 3E9VA 3GODA 4JJFA 4K0DA 3UGPA 2EIJC 2EPMX 1ZHWA 4RBNA 3IQCA 1CPRA 3IPMO 3RW0A 2KGOA 2C04A 4CIHA 4E18A 5F5FA 3RQEA 1BR1A 2Y3DA 1WWPA 3EFOA 5COMA 4IB4A 2J46A 4G78A 5JVEA 2R7QA 1LE4A 1QQ3A 1Q0KA 3U9JA 4Z9IA 3TOMA 5DQZA 4PFPA 1BR4A 3QTHA 4OIRF 4BEMJ 5B1AC 1RCPA 2VASA 4U5DE 1LI7A 3SZRA 4D4XA 5L0FA 3FDQA 3HNKA 2A69F 4YL3A 3DD7A 1I4ZA 4JTCB 1PV3A 3V5ZA 1LVKA 1XZPA 1ZYRF 2KC3A 2HMQA 2XLWA 3CAXA 4MVSA 3SEOA 4YT2A 4AE4B 4KI2A 3S27A 3GWLA 3FHDA 1TFKB 2YLDA 3W2VA 3AG4C 1JMWA 3U5SA 4DXWA 2CNWD 3QW1A 2CNWA 2H7BA 3HJCA 4F4BA 1MMDA 2XLMA 1I4YA 4O79A 1G4WR 5BQGA 4Q7CA 2NG1A 3POVA 1HY5A 3RFYA 3UR3C 3PHF2 1D0ZA 1OW8A 3ABKC 3W8IA 2ASRA 4CS9C 2H7VC 3GEHA 4EBJA 1Z5ZA 4XLPF 3IQ5A 1ZW2A 1Z23A 2PX3A 2G3KA 5DS4A 1TR2A 4MQ9F 2JX0A 4PK4A 3QZCA 3UMHA 3O55A 3FVYA 5DQTA 2FFHA 2R25A 3H65A 4J30B 5CI8A 1I5NA 4CBEA 2BE5F 4JURI 4C3EA 3KH2A 2XSEA 3M15A 2YEVA 2YL7A 4U5FE 5IY5C 4FESA 5L0HA 4C7OA 2W4MA 4C3DA 3M1CB 3LNMB 3H2UA 1T9KA 2W4BA 2Q7RA 4E7ZA 1ZZPA 3EGXB 2DYRC 1FAPB 4FX5A 1EA8A 1M2VA 2XRHA 1S05A 1NFOA 1HE9A 2A6HF 4O7GA 1B68A 1OW6A 3PMRA 3LNRA 1OKKA 1YYJA 2YLIA 3IQ6A 2E87A 2ETSA 1OXKA 2QUPA 3SNHA 2A68F 1Y6DA 3LJBA 2OEVA 2XS1A 4U5CE 4BJ6C 1NSGB 4KNVA 2EPOA 2IXMA 3S28A 2ICWG 2J8WA 3TOLA 2XLHA 4ZLDA 1N1CA 4E0HA 1YJGA 3DZAA 4U5EE 2LIGA 3RQFA 5CI9A 3EG9A 3L1MA 1WGWA 3PDMP 5T1DB 2YRFA 2YVKA 3F47A 3VAYA 2QNLA 2M64A 4QI2A 4NTFA 4OIPF 4MTOA 5JRAA 1YDIA 3MBGA 2CCYA 2Q3TA 3EH1A 1Z63A 2R7OA 2YKZA 1G5ZA 5KYXB 3FMSA 1Q0DA 1SYQA 5JP7A 4CDVA 1ZHXA 3B0VC 2IXNA 2HJMA 3G4ZA 5L0IA 1GGQA 4XTKA 2EIKC 3KKBA 1FNTc 4NTAA 2C03A 2YWAA 3VF0A 5DLJA 1G8XA 2WZFA 256BA 2YQYA 3HTKC 4O6MA 3U8VA 5JLIA 3EHNA 2RSEB 3NYLA 2YLGA 3SXMA 3AG2C 3GWNA 1T6QA 2GAQA 2EPLX 3LS1A 4I1OB 2BC5A 3DAGA 3JYYA 1YA7O 1Q0GA 1MMAA 1M6TA 2I8BA 2IXOA 2JPUA 3DJNB 3VYWA 4AL1A 3R2PA 3IEEA 4RD9A 4LDRA 1FMVA 5L0GA 3U0CA 3AJMA 1GQAA 3C62A 1T6UA 2WZLA 4JTDB 1XZQA 1Z7Qc 1F1MA 1K04A 3KYJA 2B0JA 1A7EA 3T6JA 5JSLA 1LE2A 3LLKA 4QDLA 3OEOA 2BL2A 2FGYA 1PD0A 1QLEC 2J9WA 5L0CA 2HV7A 4J32B 2M4EA 3DE8A 1YZCA 3K1IC 3B29A 4CS8A 4EBBA 4G7HF 1CGNA 1QVXA 4CS7A 4LLCA 2WVQA 2LFFA 3O39A 4XEFA 4LACB 3JT1A 3NRHA 1VLSA 2OKUA 1H9TA 4ULVA 4MVMA 2Q4FA 3RH3A 1SF8A 3EG9B 1RKEA 2X51A 5DVWA 5L3VA 1T5OA 4I44A 2Y69C 1IZMA 1R5ID 1ORSC 1YVIA 1DOWA 4HE8D 1LIHA 1VYIA 2H7OA 1MMNA 3V7OA 4CJGA 4J7YA 2PP4A 4N6CA 3EGXA 3RVYA 1FMWA 3W4YA 4JKVA 4PR9A 2TMVP 2XLOA 4XEVA 4JCZA 2ZXOA 2R7SA 4Q4ZF 2VCBA 3SXZA 1WN0A 1D0YA 5FZTA 3EQLF 1E84A 3TJ5A 3ABLC 3LEVA 2HSQA 1C17M 3T9OA 3ZC4A 3WAQA 3V5YA 3AQBA 1M57C 2L81A 1OCRC 2HMZA 3C18A 3GM2A 4YL0A 4Z9JA 3ZIBA 5DS6A 4JRZA 5KYWB 2R02A 4PACA 4FAPB 4WGYA 4N6HA 2HJ3A 1OXBA 3B71A 2R05A 2ZXRA 1RXQA 4ER9A 3O10A 3EPVA 1EQ1A 3CSKA 3KL4A 4GEHA 1JPNA 2HUJA 4O6YA 4JW1A 1SMYF 2PX0A 4HFFB 3ZVRA 5JUAA 2EIMC 4MVRA 5KYXA 3Q7GA 2ZXPA 2KW3C 3AG1C 4W8KA 4AL0A 4BJ5C 2VH3A 3L0IA 3LAYA 2Q9AA 4Z9HA 1H7IA 3FOOA 4P9TA 2V26A 1FTSA 1A0BA 3CEXA 3T6BA 3WODF 2R7XA 3QVYA 1T6IA 5D91A 3M79A 1MNDA 2CDQA 2J9VA 1RKEB 2AWYA 3IHUA 3MX3A 1A7DA 2W45A 4YL1A 3SP1A 3OA1A 1AUEA 5JS5A 2OG2A 3DJUB 1O5HA 4LLEA 1NG1A 2O9XA 4KNWA 3JRTA 4IRUA 3K33A 5GPGB 2EPNA 1VLTA 4CS8C 3JSEO 3HNJA 4DVYP 1R4TA 4DVZA 3Q6NA 3VRCA 2XM0A 4I1MA 3FAJA 1ZHTA 1XWJA 4U5HA 2IOQA 2X0CA 4BG0A 4ZLCA 4EWCA 2EPKX 3L8JA 1Q0FA 2LD6A 4HFKB 5AC4A 4MTFA 1Q0MA 4MVZA 5D92A 5E2QA 3DMDA 3EZIA 4WJ0A 2A0BA 3S84A 2MHRA 1TWCA 2QE9A 2VCAA 4U5BE 4K7BA 3CQZA 4XPWA 2OU6A 3KMIA 3NMJA 3AOUA 4PJLA 3ZG1A 3ZTMA 1OR3A 2QTVA 4NTBA 5AGFA 1ZHYA 2D4UA 4MTGA 4BJ1A 2J0WA 4DOZA 2R7RA 3ABMC 3BEHA 2W9YA 3JSZA 5B1BC 4MW8A 3S9OA 3U8PA 1VK5A 1YZAA 4CX9A 1A41A 2H8AA 2YZSA 4LDKA 2A1DD 3S0XA 5T3TA 1BZ4A 1EI7A 2UUHA 2ZXWC 2OOCA 1Y4CA 1MNEA 1TWGA 2WZGA 3Q7LA 3RF3A 3S90A 5AC5A 3UGOA 2Q00A 4CDYA 1WOLA 4UDVA 1RMVA 2L6HA 3F46A 2IXPA 2LSEA 3MYFA 4DJ9A 1PCXA 3N2ZB 4H54A 4KC9A 3G4XA 1JOGA 2R03A 1OR2A 3K66A 4XPXA 3R7CA 1V74B 1RJ9A 5A6AA 5E33A 2XL6A 4W8PA 1D0XA 2G3VA 4EHPA 5HV9A 3SYNA 2LFDA 1NFNA 1FFHA 2A0UA 4G0HA 4JEBA 1DOVA 1E83A 4WABA 3NDBB 1WASA 1HE1A 2OQMA 4R32A 5KYWA 3ZQVA 2NSGA 4OIQF 2HV6A 3ECSA 2NPUA 4N06A 1YLMA 1ORYA 1QZXA 3SXKA 1YAUO 4LDQA 2CGEA 2RD9A 4YN0B 5KYNA 4Q5SF 3C8ZA 2L9JA 4CIPA 1E2XA 3B0UX 3M4BA 3JZ0A 4AX2A 2F22A 1QPUA 5COGA 3ZSUA 5KYYA 3NG1A 5K0IA 4CSAA 1VOMA 2P6VA 3K1HA 1HMOA 1A7VA 5E3CA 4CDAA 1L3PA 2YL1A 3X1OA 1E86A 3EJNA 4NY3A 1T01A 2Y39A 3NYJA 4U9EA 4DBRA 5A6JA 3I5PA 3RQGA 2KSFA 4NQFA 2PF4E 5A69A 2XLVA 4OD5A 4U9DA 4IGGA 2GFHA 2P61A 3C7JA 4D4NA 3GANA 2XL4A 4YT4A 3Q6MA 2J9UA 3ZWIA 3MYIA 4DRJB 2NUPA 3FAPB 1OCOC 4NCQA 3M4CA 1TWHA 3C8GD 5B3SC 3T4RA 1D1CA 1K05A 1LM3B 1VYKA 3C8GA 3LS0A 4CSAC 1MMGA 2NUTA 5TJ5E 3KYIA 2KJGA 4L6RA 1HW2A 5CIVA 1KTMA 1K40A 4EIYA 4XLNF 4CJOA 2KK1A 1BDJB 3EHMA 3GEIA 3WG7C 2V3CC 3GORA 2OEXA 1OW7A 4ULWA 1RJ9B 1VB5A 4IAOA 4JIOA 1SR2A 2HSBA 1Z6AA 3DWWA 1LPEA 3PCVA 1CGOA 4IAQA 3RIPA 1QSPA 2L6FA 3HKKA 3ZQYA 4A4AA 2R7VA 5KYUB 2QY9A 4YJWA 5BUOA 5A6BD 2DB4A 2XXAB 2EILC 4BJ6A 2EINC
chains in the Genus database with same CATH topology
1NU9C 3JYHA 4IJJA 5T3WA 2R7UA 4U5GA 3I4UA 5E3AA 3N0TA 3O6XA 4E7SA 3MLGA 3NKDA 4JZAA 3K7DA 5KYYB 3B0PA 1SZIA 4C3BA 4HEAJ 4H4KC 4JJGA 2ZPAA 1J8YF 4X0RA 3DM9B 2WL8A 3N24A 3EH2A 1BR2A 2J45A 2PFDA 4I3MA 2YHSA 4AK9A 4A2NB 2NUPB 3EGDA 3OWTA 1TKNA 4PJJA 3DAFA 2Y3HA 2NUTB 3QMKA 1FFTC 4MNDA 5F5HA 1V55C 3RKOF 3AQCA 2Y3GA 2R7TA 2KNHA 3RYLA 5FCLA 5EHHA 2JD3A 2J7PD 3NKEA 1OCZC 2R7WA 2J7PA 4JCHA 3AG3C 3UMKA 3X2QC 4PFOA 2Y3BA 2CW0F 4DBQA 4RDAA 4JVSA 4PJNA 3UNGC 1M56C 1ZU4A 1M2OA 2OCCC 3S29A 1Z3IX 3EFOB 3LLIA 4BEJA 1OKKD 1IW7F 1KU2A 4IWBA 2G62A 1VMAA 1O87A 3LESA 2DYSC 3L34A 2J0XA 1V54C 1W2WA 4XWJA 1ZHZA 4O6NA 3EZHA 3EGDB 5KYUA 2KQ9A 3B9QA 3E70C 4P6IC 2XXAA 2MWQA 3ASOC 2WVNA 5EGYA 2A6EF 2DGJA 2WB7A 1NZEA 3TD7A 4OD4A 1PD1A 4B6IA 2WVOA 2Q9CA 4YT5A 3ITFA 3NYMA 3CZ6A 5DS5A 4CS9A 3DXJF 4C7OB 1D1AA 2D5RB 3I5QA 4G7ZF 4BJ5A 1OCCC 3UMIA 4QI0A 4BJTA 4YT8A 1TWAA 5HSWA 4KBLA 4AE4A 4G7OF 1JPJA 1LKXA 1M2VB 4YWQA 3JCUQ 4GYTA 4ANJA 1LS1A 3ASNC 3W8HA 3K6BA 2MYSA 4OINF 3HLZA 2VB6A 2Z15A 4M63A 1ST6A 1NU7D 4LERA 2IYLD 1J8MF 2P7VA 4FWVA 3W2WA 5L3QA 1D1BA 3DM5A 4PJMA 1ZU5A 1S7ZA 2Q9BA 3E9VA 3GODA 4JJFA 4K0DA 3UGPA 2EIJC 1ZHWA 4RBNA 2KGOA 2C04A 4CIHA 5F5FA 1BR1A 2Y3DA 3EFOA 2J46A 2R7QA 5DQZA 4PFPA 1BR4A 4OIRF 5B1AC 2VASA 4U5DE 3SZRA 3FDQA 2A69F 3DD7A 1LVKA 1ZYRF 3SEOA 4YT2A 4AE4B 4KI2A 3S27A 3W2VA 3FHDA 3AG4C 2CNWD 2CNWA 2H7BA 3HJCA 4F4BA 1MMDA 4CSAC 4O79A 4OIOF 4Q7CA 2NG1A 3POVA 3RFYA 3UR3C 3PHF2 1D0ZA 3ABKC 3W8IA 4CS9C 2H7VC 1Z5ZA 4XLPF 1Z23A 2PX3A 2G3KA 5DS4A 1TR2A 4MQ9F 4PK4A 3QZCA 3UMHA 3FVYA 5DQTA 2FFHA 3H65A 4J30B 5CI8A 4CBEA 2BE5F 4JURI 4C3EA 3KH2A 2XSEA 4U5FE 2YEVA 5IY5C 4C7OA 4FESA 2W4MA 4C3DA 3M1CB 2W4BA 4E7ZA 3EGXB 2DYRC 4FX5A 1M2VA 2XRHA 2A6HF 4O7GA 3PMRA 3LNRA 1OKKA 2E87A 3SNHA 2A68F 3LJBA 4U5CE 4BJ6C 4KNVA 2IXMA 3S28A 4ZLDA 1N1CA 3DZAA 4U5EE 5CI9A 3EG9A 1WGWA 5T1DB 3F47A 3VAYA 4QI2A 4OIPF 2Q3TA 3EH1A 1Z63A 2R7OA 5KYXB 1ZHXA 3B0VC 2IXNA 4XTKA 2EIKC 3KKBA 2C03A 5DLJA 1G8XA 2WZFA 3HTKC 4O6MA 3EHNA 3NYLA 3AG2C 3LS1A 4I1OB 3DAGA 2I8BA 3DJNB 1MMAA 3VYWA 2IXOA 3IEEA 4RD9A 1FMVA 2WZLA 2B0JA 3T6JA 3LLKA 4QDLA 3OEOA 2FGYA 1PD0A 1QLEC 2J9WA 2HV7A 4J32B 2M4EA 3K1IC 4CS8A 4EBBA 4G7HF 4CS7A 4LLCA 2WVQA 3O39A 4LACB 3JT1A 3NRHA 3RH3A 1SF8A 3EG9B 2X51A 5DVWA 4I44A 2Y69C 1IZMA 4HE8D 2H7OA 1VYIA 3V7OA 1MMNA 2PP4A 3EGXA 1FMWA 2ZXOA 2R7SA 4Q4ZF 1D0YA 3EQLF 3ABLC 3LEVA 3ZC4A 3AQBA 1M57C 2L81A 1OCRC 3ZIBA 5DS6A 5KYWB 2ZXRA 3EPVA 3CSKA 3KL4A 4GEHA 1JPNA 4O6YA 4JW1A 1SMYF 2PX0A 4HFFB 3ZVRA 2EIMC 5KYXA 3Q7GA 2ZXPA 2KW3C 3AG1C 4W8KA 4BJ5C 2VH3A 3L0IA 3LAYA 2Q9AA 2V26A 1FTSA 3T6BA 3WODF 2R7XA 5D91A 1MNDA 2CDQA 2J9VA 3MX3A 3SP1A 2W45A 3OA1A 2OG2A 3DJUB 1O5HA 4LLEA 1NG1A 2O9XA 4KNWA 3JRTA 4IRUA 3K33A 4DVYP 4CS8C 4DVZA 3Q6NA 4I1MA 3FAJA 1ZHTA 4U5HA 2IOQA 4BG0A 4ZLCA 4EWCA 4HFKB 5D92A 5E2QA 3DMDA 3EZIA 4WJ0A 1TWCA 4U5BE 4K7BA 3CQZA 3KMIA 3ZG1A 4PJLA 5L3VA 4BJ1A 2QTVA 1ZHYA 4DOZA 2J0WA 2R7RA 3ABMC 2W9YA 3JSZA 5B1BC 1VK5A 2YZSA 2A1DD 3S0XA 5T3TA 2ZXWC 3UGOA 1MNEA 1TWGA 2WZGA 3Q7LA 3F46A 2IXPA 2LSEA 1PCXA 3N2ZB 4KC9A 3K66A 1RJ9A 5E33A 1D0XA 2G3VA 3SYNA 1FFHA 4G0HA 3NDBB 5KYWA 4OIQF 2HV6A 3ECSA 4N06A 1QZXA 2CGEA 4YN0B 4Q5SF 5KYNA 3B0UX 2L9JA 4AX2A 3ZSUA 5KYYA 3NG1A 4CSAA 1VOMA 2P6VA 3K1HA 5E3CA 3X1OA 3EJNA 4NY3A 4DBRA 2Y39A 3NYJA 3I5PA 2PF4E 4OD5A 2GFHA 3GANA 2XL4A 4YT4A 3Q6MA 2J9UA 2NUPA 1OCOC 1TWHA 5B3SC 3T4RA 1D1CA 3LS0A 1VYKA 1MMGA 2NUTA 2KJGA 4XLNF 3EHMA 3WG7C 2V3CC 4ULWA 1RJ9B 4IAOA 1Z6AA 3RIPA 2R7VA 5KYUB 2QY9A 4YJWA 5BUOA 2XXAB 2EILC 4BJ6A 2EINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5B E;  4U5H A;  4U5F E;  4U5C E;  4U5G A;  4U5E E;  4U5D E; 
#chains in the Genus database with same CATH topology
 4MVU A;  1NU9 C;  3JYH A;  5EK0 A;  4IJJ A;  2R9R B;  3SXY A;  1ZVZ A;  5T3W A;  2VCC A;  3JTL O;  2R7U A;  3QW0 A;  4U5G A;  4NC3 A;  2YL3 A;  3I4U A;  4WGZ A;  3N0T A;  5E3A A;  3LUT B;  5BQH A;  3O6X A;  4E7S A;  3VM6 A;  1QKR A;  3MLG A;  1AVO B;  3NKD A;  4JZA A;  3K7D A;  1C03 A;  4MVQ A;  5KYY B;  3B0P A;  1SZI A;  4JE9 A;  3US6 A;  2NSF A;  4C3B A;  3QVZ A;  4H4K C;  4HEA J;  3ZDL A;  4E17 A;  1FR0 A;  1MQV A;  4JJG A;  1LI5 A;  2ZPA A;  1J8Y F;  2B0H A;  3FXH A;  4X0R A;  5F28 E;  1CPQ A;  4JC7 A;  1E85 A;  1EKY A;  3DM9 B;  2WL8 A;  3N24 A;  2P0N A;  3EH2 A;  1BR2 A;  2J45 A;  2PFD A;  3GM3 A;  1VTM P;  4I3M A;  2YHS A;  2AWC A;  4AK9 A;  3IQT A;  1WTY A;  4N4W A;  4A2N B;  1YA9 A;  2NUP B;  3EGD A;  3OWT A;  1TKN A;  3LEO A;  3U9M A;  4PJJ A;  4YK5 A;  3C8G B;  3DAF A;  1O3U A;  2Y3H A;  2NUT B;  3QMK A;  1FFT C;  3ATP A;  4MND A;  2HS5 A;  5F5H A;  1CGM E;  2OJQ A;  2HKV A;  1V55 C;  3RKO F;  1U0B B;  1YAR O;  3AQC A;  2Y3G A;  1TQG A;  2KNH A;  3G50 A;  1H9G A;  4P9F A;  3RYL A;  5FCL A;  2R7T A;  5EHH A;  3DI5 A;  3ZTZ A;  2JD3 A;  3U3F A;  3KPH A;  2AU5 A;  2J7P D;  1OCZ C;  3GEE A;  1H6G A;  3NKE A;  2R7W A;  2J7P A;  1UG7 A;  2HZ8 A;  4JCH A;  3AG3 C;  3UMK A;  3X2Q C;  4PFO A;  2XL8 A;  2CW0 F;  2Y3B A;  3K1I A;  3RVZ A;  4DBQ A;  4RDA A;  2L6G A;  3U2M A;  1UFB A;  3DE9 A;  4JVS A;  4PJN A;  3UNG C;  1C02 A;  1M56 C;  2LQG A;  3TQO A;  1ZU4 A;  2IBF A;  1M2O A;  2GWW A;  2CYD A;  2LCH A;  2OCC C;  1AEP A;  1NLX A;  4MS2 A;  3NMK A;  4K1O A;  1TFO B;  4XEK A;  3S29 A;  5A6B A;  1Z3I X;  3EFO B;  3LLI A;  4BEJ A;  1U89 A;  4MW3 A;  2LP4 A;  1OKK D;  1IW7 F;  1KU2 A;  2FAP B;  1HMD A;  4IWB A;  3TUL A;  2J9B A;  1ZW3 A;  3J06 A;  2L7A A;  1WAT A;  2IM8 A;  2VC9 A;  2G62 A;  1L7C A;  1VMA A;  1O87 A;  3A11 A;  5COF A;  2I15 A;  3LES A;  2DYS C;  3L34 A;  4GQH A;  4JTA B;  2J0X A;  3AGU A;  1V54 C;  1W2W A;  4XWJ A;  1ZHZ A;  3GM1 A;  4O6N A;  3EZH A;  3EGD B;  5KYU A;  4JEA A;  3WHN A;  1U6H A;  2KQ9 A;  3B9Q A;  3E70 C;  4P6I C;  2XXA A;  2MWQ A;  3ASO C;  2WVN A;  5EGY A;  1ORJ A;  3C63 A;  1KNY A;  2A6E F;  2ZD9 A;  2DGJ A;  3H2V A;  3A9C A;  1JR8 A;  2WB7 A;  5B3I A;  1NZE A;  2KYH A;  2QLA A;  1V4A A;  3TD7 A;  4OD4 A;  3DKA A;  1PD1 A;  4B6I A;  2WVO A;  5L0D A;  2XM4 A;  1JRA A;  2Q9C A;  4YT5 A;  4OIO F;  2PNO A;  3ITF A;  3NYM A;  1LS4 A;  2YL0 A;  3CZ6 A;  3NMI A;  5BQI A;  3V5X A;  5DS5 A;  4IAR A;  3U3B A;  4CS9 A;  3DXJ F;  2P1A A;  3TK0 A;  1D1A A;  2D5R B;  3I5Q A;  5JT4 A;  4G7Z F;  4C7O B;  4BJ5 A;  1OCC C;  3UMI A;  1YYX A;  1APC A;  2PBE A;  4QI0 A;  4BJT A;  3HNL A;  1TWA A;  4DRH B;  4EUK B;  4YT8 A;  4KBL A;  5HSW A;  2DI3 A;  2XLD A;  4AE4 A;  2XS8 A;  4DRI B;  4G7O F;  1JPJ A;  1GM5 A;  1GS9 A;  4ONS A;  1LKX A;  1M2V B;  3FOP A;  1RKC A;  4YWQ A;  1NBB A;  3JCU Q;  4J7T A;  1G4U S;  2LK4 A;  4GYT A;  4ANJ A;  1LS1 A;  3ASN C;  4XPY A;  3W8H A;  4MVO A;  3K6B A;  2MYS A;  4OIN F;  3HLZ A;  2VB6 A;  2Z15 A;  2AP3 A;  3JRM O;  1BBH A;  4EKW A;  3MFN A;  1OQC A;  2GDC A;  2XLE A;  4M63 A;  3AGT A;  1JAF A;  1ST6 A;  1NU7 D;  3U2L A;  4LER A;  3TJ6 A;  2HFI A;  2IYL D;  4E0I A;  3HNI A;  3BRJ A;  4BPM A;  3T6G B;  1J8M F;  2P7V A;  4EBK A;  5A6K A;  4FWV A;  2UUI A;  3W2W A;  3L8I A;  2OJE D;  5L3Q A;  1D1B A;  4XQ1 A;  3DM5 A;  2GA0 A;  5L0J A;  2AVK A;  4PJM A;  1ZU5 A;  1S7Z A;  2Q9B A;  1HW1 A;  3E9V A;  3GOD A;  4JJF A;  4K0D A;  3UGP A;  2EIJ C;  2EPM X;  1ZHW A;  4RBN A;  3IQC A;  1CPR A;  3IPM O;  3RW0 A;  2KGO A;  2C04 A;  4CIH A;  4E18 A;  5F5F A;  3RQE A;  1BR1 A;  2Y3D A;  1WWP A;  3EFO A;  5COM A;  4IB4 A;  2J46 A;  4G78 A;  5JVE A;  2R7Q A;  1LE4 A;  1QQ3 A;  1Q0K A;  3U9J A;  4Z9I A;  3TOM A;  5DQZ A;  4PFP A;  1BR4 A;  3QTH A;  4OIR F;  4BEM J;  5B1A C;  1RCP A;  2VAS A;  4U5D E;  1LI7 A;  3SZR A;  4D4X A;  5L0F A;  3FDQ A;  3HNK A;  2A69 F;  4YL3 A;  3DD7 A;  1I4Z A;  4JTC B;  1PV3 A;  3V5Z A;  1LVK A;  1XZP A;  1ZYR F;  2KC3 A;  2HMQ A;  2XLW A;  3CAX A;  4MVS A;  3SEO A;  4YT2 A;  4AE4 B;  4KI2 A;  3S27 A;  3GWL A;  3FHD A;  1TFK B;  2YLD A;  3W2V A;  3AG4 C;  1JMW A;  3U5S A;  4DXW A;  2CNW D;  3QW1 A;  2CNW A;  2H7B A;  3HJC A;  4F4B A;  1MMD A;  2XLM A;  1I4Y A;  4O79 A;  1G4W R;  5BQG A;  4Q7C A;  2NG1 A;  3POV A;  1HY5 A;  3RFY A;  3UR3 C;  3PHF 2;  1D0Z A;  1OW8 A;  3ABK C;  3W8I A;  2ASR A;  4CS9 C;  2H7V C;  3GEH A;  4EBJ A;  1Z5Z A;  4XLP F;  3IQ5 A;  1ZW2 A;  1Z23 A;  2PX3 A;  2G3K A;  5DS4 A;  1TR2 A;  4MQ9 F;  2JX0 A;  4PK4 A;  3QZC A;  3UMH A;  3O55 A;  3FVY A;  5DQT A;  2FFH A;  2R25 A;  3H65 A;  4J30 B;  5CI8 A;  1I5N A;  4CBE A;  2BE5 F;  4JUR I;  4C3E A;  3KH2 A;  2XSE A;  3M15 A;  2YEV A;  2YL7 A;  4U5F E;  5IY5 C;  4FES A;  5L0H A;  4C7O A;  2W4M A;  4C3D A;  3M1C B;  3LNM B;  3H2U A;  1T9K A;  2W4B A;  2Q7R A;  4E7Z A;  1ZZP A;  3EGX B;  2DYR C;  1FAP B;  4FX5 A;  1EA8 A;  1M2V A;  2XRH A;  1S05 A;  1NFO A;  1HE9 A;  2A6H F;  4O7G A;  1B68 A;  1OW6 A;  3PMR A;  3LNR A;  1OKK A;  1YYJ A;  2YLI A;  3IQ6 A;  2E87 A;  2ETS A;  1OXK A;  2QUP A;  3SNH A;  2A68 F;  1Y6D A;  3LJB A;  2OEV A;  2XS1 A;  4U5C E;  4BJ6 C;  1NSG B;  4KNV A;  2EPO A;  2IXM A;  3S28 A;  2ICW G;  2J8W A;  3TOL A;  2XLH A;  4ZLD A;  1N1C A;  4E0H A;  1YJG A;  3DZA A;  4U5E E;  2LIG A;  3RQF A;  5CI9 A;  3EG9 A;  3L1M A;  1WGW A;  3PDM P;  5T1D B;  2YRF A;  2YVK A;  3F47 A;  3VAY A;  2QNL A;  2M64 A;  4QI2 A;  4NTF A;  4OIP F;  4MTO A;  5JRA A;  1YDI A;  3MBG A;  2CCY A;  2Q3T A;  3EH1 A;  1Z63 A;  2R7O A;  2YKZ A;  1G5Z A;  5KYX B;  3FMS A;  1Q0D A;  1SYQ A;  5JP7 A;  4CDV A;  1ZHX A;  3B0V C;  2IXN A;  2HJM A;  3G4Z A;  5L0I A;  1GGQ A;  4XTK A;  2EIK C;  3KKB A;  1FNT c;  4NTA A;  2C03 A;  2YWA A;  3VF0 A;  5DLJ A;  1G8X A;  2WZF A;  256B A;  2YQY A;  3HTK C;  4O6M A;  3U8V A;  5JLI A;  3EHN A;  2RSE B;  3NYL A;  2YLG A;  3SXM A;  3AG2 C;  3GWN A;  1T6Q A;  2GAQ A;  2EPL X;  3LS1 A;  4I1O B;  2BC5 A;  3DAG A;  3JYY A;  1YA7 O;  1Q0G A;  1MMA A;  1M6T A;  2I8B A;  2IXO A;  2JPU A;  3DJN B;  3VYW A;  4AL1 A;  3R2P A;  3IEE A;  4RD9 A;  4LDR A;  1FMV A;  5L0G A;  3U0C A;  3AJM A;  1GQA A;  3C62 A;  1T6U A;  2WZL A;  4JTD B;  1XZQ A;  1Z7Q c;  1F1M A;  1K04 A;  3KYJ A;  2B0J A;  1A7E A;  3T6J A;  5JSL A;  1LE2 A;  3LLK A;  4QDL A;  3OEO A;  2BL2 A;  2FGY A;  1PD0 A;  1QLE C;  2J9W A;  5L0C A;  2HV7 A;  4J32 B;  2M4E A;  3DE8 A;  1YZC A;  3K1I C;  3B29 A;  4CS8 A;  4EBB A;  4G7H F;  1CGN A;  1QVX A;  4CS7 A;  4LLC A;  2WVQ A;  2LFF A;  3O39 A;  4XEF A;  4LAC B;  3JT1 A;  3NRH A;  1VLS A;  2OKU A;  1H9T A;  4ULV A;  4MVM A;  2Q4F A;  3RH3 A;  1SF8 A;  3EG9 B;  1RKE A;  2X51 A;  5DVW A;  5L3V A;  1T5O A;  4I44 A;  2Y69 C;  1IZM A;  1R5I D;  1ORS C;  1YVI A;  1DOW A;  4HE8 D;  1LIH A;  1VYI A;  2H7O A;  1MMN A;  3V7O A;  4CJG A;  4J7Y A;  2PP4 A;  4N6C A;  3EGX A;  3RVY A;  1FMW A;  3W4Y A;  4JKV A;  4PR9 A;  2TMV P;  2XLO A;  4XEV A;  4JCZ A;  2ZXO A;  2R7S A;  4Q4Z F;  2VCB A;  3SXZ A;  1WN0 A;  1D0Y A;  5FZT A;  3EQL F;  1E84 A;  3TJ5 A;  3ABL C;  3LEV A;  2HSQ A;  1C17 M;  3T9O A;  3ZC4 A;  3WAQ A;  3V5Y A;  3AQB A;  1M57 C;  2L81 A;  1OCR C;  2HMZ A;  3C18 A;  3GM2 A;  4YL0 A;  4Z9J A;  3ZIB A;  5DS6 A;  4JRZ A;  5KYW B;  2R02 A;  4PAC A;  4FAP B;  4WGY A;  4N6H A;  2HJ3 A;  1OXB A;  3B71 A;  2R05 A;  2ZXR A;  1RXQ A;  4ER9 A;  3O10 A;  3EPV A;  1EQ1 A;  3CSK A;  3KL4 A;  4GEH A;  1JPN A;  2HUJ A;  4O6Y A;  4JW1 A;  1SMY F;  2PX0 A;  4HFF B;  3ZVR A;  5JUA A;  2EIM C;  4MVR A;  5KYX A;  3Q7G A;  2ZXP A;  2KW3 C;  3AG1 C;  4W8K A;  4AL0 A;  4BJ5 C;  2VH3 A;  3L0I A;  3LAY A;  2Q9A A;  4Z9H A;  1H7I A;  3FOO A;  4P9T A;  2V26 A;  1FTS A;  1A0B A;  3CEX A;  3T6B A;  3WOD F;  2R7X A;  3QVY A;  1T6I A;  5D91 A;  3M79 A;  1MND A;  2CDQ A;  2J9V A;  1RKE B;  2AWY A;  3IHU A;  3MX3 A;  1A7D A;  2W45 A;  4YL1 A;  3SP1 A;  3OA1 A;  1AUE A;  5JS5 A;  2OG2 A;  3DJU B;  1O5H A;  4LLE A;  1NG1 A;  2O9X A;  4KNW A;  3JRT A;  4IRU A;  3K33 A;  5GPG B;  2EPN A;  1VLT A;  4CS8 C;  3JSE O;  3HNJ A;  4DVY P;  1R4T A;  4DVZ A;  3Q6N A;  3VRC A;  2XM0 A;  4I1M A;  3FAJ A;  1ZHT A;  1XWJ A;  4U5H A;  2IOQ A;  2X0C A;  4BG0 A;  4ZLC A;  4EWC A;  2EPK X;  3L8J A;  1Q0F A;  2LD6 A;  4HFK B;  5AC4 A;  4MTF A;  1Q0M A;  4MVZ A;  5D92 A;  5E2Q A;  3DMD A;  3EZI A;  4WJ0 A;  2A0B A;  3S84 A;  2MHR A;  1TWC A;  2QE9 A;  2VCA A;  4U5B E;  4K7B A;  3CQZ A;  4XPW A;  2OU6 A;  3KMI A;  3NMJ A;  3AOU A;  4PJL A;  3ZG1 A;  3ZTM A;  1OR3 A;  2QTV A;  4NTB A;  5AGF A;  1ZHY A;  2D4U A;  4MTG A;  4BJ1 A;  2J0W A;  4DOZ A;  2R7R A;  3ABM C;  3BEH A;  2W9Y A;  3JSZ A;  5B1B C;  4MW8 A;  3S9O A;  3U8P A;  1VK5 A;  1YZA A;  4CX9 A;  1A41 A;  2H8A A;  2YZS A;  4LDK A;  2A1D D;  3S0X A;  5T3T A;  1BZ4 A;  1EI7 A;  2UUH A;  2ZXW C;  2OOC A;  1Y4C A;  1MNE A;  1TWG A;  2WZG A;  3Q7L A;  3RF3 A;  3S90 A;  5AC5 A;  3UGO A;  2Q00 A;  4CDY A;  1WOL A;  4UDV A;  1RMV A;  2L6H A;  3F46 A;  2IXP A;  2LSE A;  3MYF A;  4DJ9 A;  1PCX A;  3N2Z B;  4H54 A;  4KC9 A;  3G4X A;  1JOG A;  2R03 A;  1OR2 A;  3K66 A;  4XPX A;  3R7C A;  1V74 B;  1RJ9 A;  5A6A A;  5E33 A;  2XL6 A;  4W8P A;  1D0X A;  2G3V A;  4EHP A;  5HV9 A;  3SYN A;  2LFD A;  1NFN A;  1FFH A;  2A0U A;  4G0H A;  4JEB A;  1DOV A;  1E83 A;  4WAB A;  3NDB B;  1WAS A;  1HE1 A;  2OQM A;  4R32 A;  5KYW A;  3ZQV A;  2NSG A;  4OIQ F;  2HV6 A;  3ECS A;  2NPU A;  4N06 A;  1YLM A;  1ORY A;  1QZX A;  3SXK A;  1YAU O;  4LDQ A;  2CGE A;  2RD9 A;  4YN0 B;  5KYN A;  4Q5S F;  3C8Z A;  2L9J A;  4CIP A;  1E2X A;  3B0U X;  3M4B A;  3JZ0 A;  4AX2 A;  2F22 A;  1QPU A;  5COG A;  3ZSU A;  5KYY A;  3NG1 A;  5K0I A;  4CSA A;  1VOM A;  2P6V A;  3K1H A;  1HMO A;  1A7V A;  5E3C A;  4CDA A;  1L3P A;  2YL1 A;  3X1O A;  1E86 A;  3EJN A;  4NY3 A;  1T01 A;  2Y39 A;  3NYJ A;  4U9E A;  4DBR A;  5A6J A;  3I5P A;  3RQG A;  2KSF A;  4NQF A;  2PF4 E;  5A69 A;  2XLV A;  4OD5 A;  4U9D A;  4IGG A;  2GFH A;  2P61 A;  3C7J A;  4D4N A;  3GAN A;  2XL4 A;  4YT4 A;  3Q6M A;  2J9U A;  3ZWI A;  3MYI A;  4DRJ B;  2NUP A;  3FAP B;  1OCO C;  4NCQ A;  3M4C A;  1TWH A;  3C8G D;  5B3S C;  3T4R A;  1D1C A;  1K05 A;  1LM3 B;  1VYK A;  3C8G A;  3LS0 A;  4CSA C;  1MMG A;  2NUT A;  5TJ5 E;  3KYI A;  2KJG A;  4L6R A;  1HW2 A;  5CIV A;  1KTM A;  1K40 A;  4EIY A;  4XLN F;  4CJO A;  2KK1 A;  1BDJ B;  3EHM A;  3GEI A;  3WG7 C;  2V3C C;  3GOR A;  2OEX A;  1OW7 A;  4ULW A;  1RJ9 B;  1VB5 A;  4IAO A;  4JIO A;  1SR2 A;  2HSB A;  1Z6A A;  3DWW A;  1LPE A;  3PCV A;  1CGO A;  4IAQ A;  3RIP A;  1QSP A;  2L6F A;  3HKK A;  3ZQY A;  4A4A A;  2R7V A;  5KYU B;  2QY9 A;  4YJW A;  5BUO A;  5A6B D;  2DB4 A;  2XXA B;  2EIL C;  4BJ6 A;  2EIN C; 
#chains in the Genus database with same CATH homology
 1NU9 C;  3JYH A;  4IJJ A;  5T3W A;  2R7U A;  4U5G A;  3I4U A;  5E3A A;  3N0T A;  3O6X A;  4E7S A;  3MLG A;  3NKD A;  4JZA A;  3K7D A;  5KYY B;  3B0P A;  1SZI A;  4C3B A;  4HEA J;  4H4K C;  4JJG A;  2ZPA A;  1J8Y F;  4X0R A;  3DM9 B;  2WL8 A;  3N24 A;  3EH2 A;  1BR2 A;  2J45 A;  2PFD A;  4I3M A;  2YHS A;  4AK9 A;  4A2N B;  2NUP B;  3EGD A;  3OWT A;  1TKN A;  4PJJ A;  3DAF A;  2Y3H A;  2NUT B;  3QMK A;  1FFT C;  4MND A;  5F5H A;  1V55 C;  3RKO F;  3AQC A;  2Y3G A;  2R7T A;  2KNH A;  3RYL A;  5FCL A;  5EHH A;  2JD3 A;  2J7P D;  3NKE A;  1OCZ C;  2R7W A;  2J7P A;  4JCH A;  3AG3 C;  3UMK A;  3X2Q C;  4PFO A;  2Y3B A;  2CW0 F;  4DBQ A;  4RDA A;  4JVS A;  4PJN A;  3UNG C;  1M56 C;  1ZU4 A;  1M2O A;  2OCC C;  3S29 A;  1Z3I X;  3EFO B;  3LLI A;  4BEJ A;  1OKK D;  1IW7 F;  1KU2 A;  4IWB A;  2G62 A;  1VMA A;  1O87 A;  3LES A;  2DYS C;  3L34 A;  2J0X A;  1V54 C;  1W2W A;  4XWJ A;  1ZHZ A;  4O6N A;  3EZH A;  3EGD B;  5KYU A;  2KQ9 A;  3B9Q A;  3E70 C;  4P6I C;  2XXA A;  2MWQ A;  3ASO C;  2WVN A;  5EGY A;  2A6E F;  2DGJ A;  2WB7 A;  1NZE A;  3TD7 A;  4OD4 A;  1PD1 A;  4B6I A;  2WVO A;  2Q9C A;  4YT5 A;  3ITF A;  3NYM A;  3CZ6 A;  5DS5 A;  4CS9 A;  3DXJ F;  4C7O B;  1D1A A;  2D5R B;  3I5Q A;  4G7Z F;  4BJ5 A;  1OCC C;  3UMI A;  4QI0 A;  4BJT A;  4YT8 A;  1TWA A;  5HSW A;  4KBL A;  4AE4 A;  4G7O F;  1JPJ A;  1LKX A;  1M2V B;  4YWQ A;  3JCU Q;  4GYT A;  4ANJ A;  1LS1 A;  3ASN C;  3W8H A;  3K6B A;  2MYS A;  4OIN F;  3HLZ A;  2VB6 A;  2Z15 A;  4M63 A;  1ST6 A;  1NU7 D;  4LER A;  2IYL D;  1J8M F;  2P7V A;  4FWV A;  3W2W A;  5L3Q A;  1D1B A;  3DM5 A;  4PJM A;  1ZU5 A;  1S7Z A;  2Q9B A;  3E9V A;  3GOD A;  4JJF A;  4K0D A;  3UGP A;  2EIJ C;  1ZHW A;  4RBN A;  2KGO A;  2C04 A;  4CIH A;  5F5F A;  1BR1 A;  2Y3D A;  3EFO A;  2J46 A;  2R7Q A;  5DQZ A;  4PFP A;  1BR4 A;  4OIR F;  5B1A C;  2VAS A;  4U5D E;  3SZR A;  3FDQ A;  2A69 F;  3DD7 A;  1LVK A;  1ZYR F;  3SEO A;  4YT2 A;  4AE4 B;  4KI2 A;  3S27 A;  3W2V A;  3FHD A;  3AG4 C;  2CNW D;  2CNW A;  2H7B A;  3HJC A;  4F4B A;  1MMD A;  4CSA C;  4O79 A;  4OIO F;  4Q7C A;  2NG1 A;  3POV A;  3RFY A;  3UR3 C;  3PHF 2;  1D0Z A;  3ABK C;  3W8I A;  4CS9 C;  2H7V C;  1Z5Z A;  4XLP F;  1Z23 A;  2PX3 A;  2G3K A;  5DS4 A;  1TR2 A;  4MQ9 F;  4PK4 A;  3QZC A;  3UMH A;  3FVY A;  5DQT A;  2FFH A;  3H65 A;  4J30 B;  5CI8 A;  4CBE A;  2BE5 F;  4JUR I;  4C3E A;  3KH2 A;  2XSE A;  4U5F E;  2YEV A;  5IY5 C;  4C7O A;  4FES A;  2W4M A;  4C3D A;  3M1C B;  2W4B A;  4E7Z A;  3EGX B;  2DYR C;  4FX5 A;  1M2V A;  2XRH A;  2A6H F;  4O7G A;  3PMR A;  3LNR A;  1OKK A;  2E87 A;  3SNH A;  2A68 F;  3LJB A;  4U5C E;  4BJ6 C;  4KNV A;  2IXM A;  3S28 A;  4ZLD A;  1N1C A;  3DZA A;  4U5E E;  5CI9 A;  3EG9 A;  1WGW A;  5T1D B;  3F47 A;  3VAY A;  4QI2 A;  4OIP F;  2Q3T A;  3EH1 A;  1Z63 A;  2R7O A;  5KYX B;  1ZHX A;  3B0V C;  2IXN A;  4XTK A;  2EIK C;  3KKB A;  2C03 A;  5DLJ A;  1G8X A;  2WZF A;  3HTK C;  4O6M A;  3EHN A;  3NYL A;  3AG2 C;  3LS1 A;  4I1O B;  3DAG A;  2I8B A;  3DJN B;  1MMA A;  3VYW A;  2IXO A;  3IEE A;  4RD9 A;  1FMV A;  2WZL A;  2B0J A;  3T6J A;  3LLK A;  4QDL A;  3OEO A;  2FGY A;  1PD0 A;  1QLE C;  2J9W A;  2HV7 A;  4J32 B;  2M4E A;  3K1I C;  4CS8 A;  4EBB A;  4G7H F;  4CS7 A;  4LLC A;  2WVQ A;  3O39 A;  4LAC B;  3JT1 A;  3NRH A;  3RH3 A;  1SF8 A;  3EG9 B;  2X51 A;  5DVW A;  4I44 A;  2Y69 C;  1IZM A;  4HE8 D;  2H7O A;  1VYI A;  3V7O A;  1MMN A;  2PP4 A;  3EGX A;  1FMW A;  2ZXO A;  2R7S A;  4Q4Z F;  1D0Y A;  3EQL F;  3ABL C;  3LEV A;  3ZC4 A;  3AQB A;  1M57 C;  2L81 A;  1OCR C;  3ZIB A;  5DS6 A;  5KYW B;  2ZXR A;  3EPV A;  3CSK A;  3KL4 A;  4GEH A;  1JPN A;  4O6Y A;  4JW1 A;  1SMY F;  2PX0 A;  4HFF B;  3ZVR A;  2EIM C;  5KYX A;  3Q7G A;  2ZXP A;  2KW3 C;  3AG1 C;  4W8K A;  4BJ5 C;  2VH3 A;  3L0I A;  3LAY A;  2Q9A A;  2V26 A;  1FTS A;  3T6B A;  3WOD F;  2R7X A;  5D91 A;  1MND A;  2CDQ A;  2J9V A;  3MX3 A;  3SP1 A;  2W45 A;  3OA1 A;  2OG2 A;  3DJU B;  1O5H A;  4LLE A;  1NG1 A;  2O9X A;  4KNW A;  3JRT A;  4IRU A;  3K33 A;  4DVY P;  4CS8 C;  4DVZ A;  3Q6N A;  4I1M A;  3FAJ A;  1ZHT A;  4U5H A;  2IOQ A;  4BG0 A;  4ZLC A;  4EWC A;  4HFK B;  5D92 A;  5E2Q A;  3DMD A;  3EZI A;  4WJ0 A;  1TWC A;  4U5B E;  4K7B A;  3CQZ A;  3KMI A;  3ZG1 A;  4PJL A;  5L3V A;  4BJ1 A;  2QTV A;  1ZHY A;  4DOZ A;  2J0W A;  2R7R A;  3ABM C;  2W9Y A;  3JSZ A;  5B1B C;  1VK5 A;  2YZS A;  2A1D D;  3S0X A;  5T3T A;  2ZXW C;  3UGO A;  1MNE A;  1TWG A;  2WZG A;  3Q7L A;  3F46 A;  2IXP A;  2LSE A;  1PCX A;  3N2Z B;  4KC9 A;  3K66 A;  1RJ9 A;  5E33 A;  1D0X A;  2G3V A;  3SYN A;  1FFH A;  4G0H A;  3NDB B;  5KYW A;  4OIQ F;  2HV6 A;  3ECS A;  4N06 A;  1QZX A;  2CGE A;  4YN0 B;  4Q5S F;  5KYN A;  3B0U X;  2L9J A;  4AX2 A;  3ZSU A;  5KYY A;  3NG1 A;  4CSA A;  1VOM A;  2P6V A;  3K1H A;  5E3C A;  3X1O A;  3EJN A;  4NY3 A;  4DBR A;  2Y39 A;  3NYJ A;  3I5P A;  2PF4 E;  4OD5 A;  2GFH A;  3GAN A;  2XL4 A;  4YT4 A;  3Q6M A;  2J9U A;  2NUP A;  1OCO C;  1TWH A;  5B3S C;  3T4R A;  1D1C A;  3LS0 A;  1VYK A;  1MMG A;  2NUT A;  2KJG A;  4XLN F;  3EHM A;  3WG7 C;  2V3C C;  4ULW A;  1RJ9 B;  4IAO A;  1Z6A A;  3RIP A;  2R7V A;  5KYU B;  2QY9 A;  4YJW A;  5BUO A;  2XXA B;  2EIL C;  4BJ6 A;  2EIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...