3E70C

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
318
structure length
307
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVILTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
publication title Structures of the signal recognition particle receptor from the archaeon Pyrococcus furiosus: implications for the targeting step at the membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 105
structure length 307
sequence length 318
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00448 SRP54 SRP54-type protein, GTPase domain
C PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e70C01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3e70C02
2A5GA 2PJRA 2RMKA 3GJ0A 4DXAA 2WPDA 3T1TA 4HLQB 1CP2A 1TQ4A 3I3SR 3PJRA 4DWJA 5JECA 4Z8YA 1G64A 4HDOB 2CHGA 1OIVA 1YVDA 2JDID 3U2QA 2XXAB 1RC8A 4IOMA 3NEYA 4IXMA 3SU8A 4DCSA 1FPMA 2VF8A 1DAHA 3CZPA 1IJEA 2Z4SA 2ZRCA 2HF9A 4IXNA 1VCOA 2MSEB 3W90A 4KVAA 3CKLA 1S3SA 1LFDB 2H17A 1NN3A 3QJYA 2J9RA 3RLFA 4PC1A 1OE0A 2ZUCA 3BGWA 1KO8A 1AQYA 3I1FA 2XB2A 5DN6A 1E9SA 2IHYA 4D4MA 4OHXA 3TUZC 1KI1A 1L4UA 1F2UA 1AK2A 3LQQA 3L0OA 1ESNA 2Q0HA 2RCNA 1VHTA 2BBSA 1G1MA 4X8OA 3CF0A 3IDQA 1NI3A 3D6TB 2XSZD 4RSGA 4UJ5A 5IDVA 3GJ6A 3O47A 4Q9IA 2Y8EA 4A92A 1YZKA 3PUWA 4IFEA 4DBLC 4Q9KA 4LX0A 3EW9A 5FL3A 3U4QB 1S0UA 3O8DA 2G1KA 4P0TA 1KK3A 3TE6A 2SHKA 2ANCA 2KBEA 3T5GA 4BQSA 4BWYA 4E5UA 3DM9B 1IM2A 1A2BA 1FW6A 3RS2A 4TMWA 4AYTA 4JLKA 3LH5A 4N3NA 3CPHA 4FD2A 3U7FB 1H8HA 3P27A 5BQ5A 3MLEA 4U02A 1S1CA 1XMIA 2ZJAA 4OJQA 1RKBA 4M1SA 4QHYA 2QP3A 1X6VA 3ASYA 4Z1MA 3W6OA 4B3FX 3A1SA 2C95A 1ZIPA 2FPLA 1OFIA 1Y3AA 3OIVA 4A4DA 4LJAA 1K5DA 1R2QA 4Y0AA 2VP9A 1P60A 1XEXA 4OJKA 4C9BA 1BS1A 5E3HA 4M0LA 1L7VC 1DELA 5L3QA 1KSHA 5KO2A 2HLDA 5FI1B 4NYIQ 1W4RA 1JEDA 2CHVA 5IK2A 1T0HB 1FP7A 4TMTA 2ONJA 5LB2A 4JVSB 2G83A 2WKQA 4FI3C 4NKRA 4ARZB 5BN4A 3KKOA 1EFRA 4CEIA 1JR3D 1JBKA 2ZRNA 3X1XA 1E2MA 1P73A 1KK1A 1XEWY 1YQTA 2EU8A 2FGJA 2OCBA 2FN4A 2VP5A 2X77A 3RS0A 1N6OA 2XOKD 1JB1A 1ZD8A 1KI3A 3R9XA 2O8CA 3FE2A 2PEZA 2Q3FA 2WKPA 4XVQA 3R7WA 4IW3B 1BMFD 1CTQA 1DAGA 1E2FA 1HT1E 4RVCA 4R71A 5HE8A 1GDDA 2YWGA 1VYUA 2BCGY 1CF4A 3IHWA 2Q9BA 3OFNA 1J99A 3PUXA 1P2VA 3BB3A 4BFUA 1FUKA 1G8HA 2KBFA 1YR6A 1SXJE 4L15A 4LGMA 5EP2A 2CEAA 2QPAA 1G8PA 4PQRA 3GLHB 3K0AA 4EJSB 3AVWA 1JI0A 1N0WA 1W0JA 4I1OA 4JL5A 4BEBA 4Q4HB 2O8DA 3TSWA 4DLYA 3KKNA 2JJ2D 3AF2A 2IYZA 3DVLA 3GJXC 3U3KA 3AVPA 2CHQA 5EE1A 5GJVC 5L3VA 1FX0B 2G9NA 4EDHA 2GEVA 3B13B 1QF9A 4LJ8A 4A8JC 5LB4A 4BLSA 621PA 3UKDA 2RGEA 5KSZA 2WAXA 3EASA 4N1AA 5LDDC 3A1VA 1CXZA 2FFAA 1ZNXA 1DAEA 2NZ8A 2WWXA 1TQDA 4BLTA 4DHEA 1ZM9A 5HTKA 4MGKR 4TSFA 3T5DA 1KI9A 4WW0A 1V43A 1ZAKA 2GCNA 3H2YA 2YJTD 3KKQA 3U44B 1MV5A 3THWB 4O3MA 4TYQA 3TMKA 2GWHA 1SXJD 2RAPA 4XJXA 4KAXA 4KXFB 4TLDA 5LPNA 4JL6A 1UM8A 4KU4A 3KTAA 4B2PA 4BFXA 1KGDA 1PUJA 2GCPA 3RRMA 1ZUHA 1G7SA 3FKSA 1R8SA 1KZGB 1RIFA 3MSXA 3MWKA 5BN5A 3T12A 3FDIA 1XD8A 1ZBDA 4PSKA 4FN5A 3CF6R 1G17A 2N46A 3C16C 1R5BA 3CB4A 4V0KA 4JT4A 1Z0IA 1FZQA 3N70A 3THYA 1XTSA 2D2EA 3SYKA 4LCBA 3RNLA 1M34E 1QHXA 3TAHA 2VPPA 1XB2A 3LLMA 4URUR 4MRNA 4CVNA 5HCIA 1U0JA 4TL8A 3QOFA 5JMTA 5KPDA 2W6ID 4XSGA 1JALA 2GTPA 4HSEA 5EXSA 3ZJYA 5BWMA 4JLAA 4JIMA 3U3RA 3KQLA 4LHXA 4M8NE 4O0MA 3I32A 4D4JA 721PA 2VSXA 4Q1CA 4DIEA 5J4HA 3IEUA 2HXYA 5KU1A 4BUJA 3LX5A 3ADKA 4M1TA 2FOLA 2D7CA 1FFHA 4P3YA 1ZM2A 4OBEA 1W49A 3KUDA 5EXTA 2QORA 3NIBA 5GVSA 1NKTA 1SKYE 4QJ4A 4TMVA 5TY0A 3BFKA 2P6UA 3EIHA 4PO9A 1OXVA 3WNBA 3MG9A 4DLUA 1II8B 1BYIA 4KSCA 1ZP6A 3MD0A 2VHQA 3QKSB 1E2QA 4L4UA 3IBGA 1UEJA 2BMEA 3KUCA 3CR8A 2G88A 2DWPA 1RRGA 5FFMA 2P67A 1SVSA 3SYLA 1ZC3A 5ELXA 2XZLA 3K1JA 2OAP1 1DG3A 2VLIA 2GZDA 4GZLA 5UKDA 2W6JA 4BLQA 2FA9A 4YDHB 2AD5A 2HUPA 4DEYA 1W36D 3LD9A 3MAAC 4FXPA 1U98A 1AS0A 1OW3B 4RZ2A 2RGAA 4YLGA 1EWRA 1MRSA 5GADl 1KSGA 4DDTA 2ERYA 3TBKA 3GD7A 4R2HA 3HWSA 2ZU6A 4GFDA 1LF0A 3F3YA 3B9QA 2IK8A 1KMHA 2BVNA 4LHWA 1JNYA 3PEYA 1YU9A 3E2IA 4D80A 1KO5A 2ZI5A 1K6MA 2E9SA 2FE4A 1VPLA 3A6PC 2AK2A 1LVGA 4PPFA 1YZQA 5C4MA 3RS3A 3VR5A 4PZLA 3L8ZA 4JVLA 4BRWA 3BH7A 3TK1A 4PAQA 1E98A 1WXQA 1P7CA 2VHTA 4O2LA 1Z07A 3SR0A 2WKRA 1O87A 2ZS9A 1CR4A 3B5JA 4TZ0A 1KDRA 4TT3A 1Q21A 3ONWA 4TN1A 2CLSA 5EZ5A 2FU5C 2WMOB 1B0UA 1E69A 1G19A 3GMTA 3UMSA 4C0KA 2QPTA 2VSOA 2AFHE 1RW4A 4Q19A 5JEEA 1X3SA 1H8HD 1DBSA 4UNNA 5L3SB 3GFPA 2VP4A 3RC3A 4CZ2A 4C0AC 1HH4A 4M9QA 1EGAA 4DC9A 5KNDA 1TUIA 4C0JA 3SHWA 2AXNA 1YR9A 3K70B 2CCGA 2E1RA 3ZS9A 1GFIA 3ZIAA 3QEOA 3GLGB 3TSZA 3PUVA 1XF9A 3FMOB 3QUSA 4ESVA 2DFKB 4BFWA 3GLIE 4P4TA 2QMHA 2Q3MA 4UNRA 5KTYA 1ZNYA 2HLDD 3BC1A 3TR0A 3GLIB 4QGGA 1G20E 5TV2A 3TQCA 4PO8A 1Z6TA 1N6HA 1LF5A 3I5XA 1US8B 1EXMA 1U9IC 2ZYWX 1D2NA 2WTUA 3AP2A 2FSHA 2RGDA 2XGJA 1XJQA 1T0JB 2XTNA 4ERNA 5CYPA 1K5GA 4JLNA 1N25A 3TIFA 2IS6A 4RZXA 4EPXA 1JQLB 4AWXA 5DI3A 3RSOA 2RGNA 2DB3A 4RKEA 2IEYA 1X8LA 4BFYA 2MSDB 4C0HA 2ZU0C 3LV8A 2NIPA 4ZO4A 4WVFA 2P5SA 4QGFA 4A0GA 2PCJA 4PHFA 4YQFA 3NBYC 3JZAA 2R62A 2ZS8A 1AM4D 2OUKA 4A6PA 3QKUA 2WJYA 2O8EB 5KNBA 2W0SA 3L82B 5GJBA 1G3QA 4ZIRB 2C9CA 2QSZA 4RFSA 3BFXA 4DB4A 4HZIA 4I99A 2GF9A 2XX3A 4MGZR 4US1R 4G5RA 4A36A 3ZVNA 1Z83A 4X8MA 1TF5A 4Q02A 1TEXA 5AJYA 3U3OA 1S4QA 4ZDIA 1OYWA 1T8TA 1KHTA 3EARA 4D81A 1DARA 4TSFD 2VP2A 1T8UA 5J4LA 4II7A 4D82A 3OEHA 4J0QA 1UKVY 3GFOA 2JJ1D 3AVYA 2DFNA 1DTSA 3U6BA 1VG0B 5AJXA 2AWNA 5FH9A 2FSIA 1ZM3A 4P32A 4D4LA 1N6RA 4UNSA 3K0EA 4UXHA 2YHSA 2HXSA 3QI2A 2QAGB 1TQ2A 4EPWA 2ZJOA 5HKKD 4Q00A 5CK5A 2OESA 3VU9A 2XNDA 4IVPA 4P33A 4I81A 1EESA 2OFOA 4NBSA 5CM9C 5KHOC 1YZTA 2UZ3A 3IQWA 3FKQA 1FP6A 3QBVA 3VHLB 4LHZA 4BLRA 5KSPA 3PUZA 3IBYA 4ZDWA 2ZYVX 1NN5A 1KDPA 1Z47A 1G8GA 4Q47A 4HDCA 2PLRA 4BASA 2JDIA 2ZPTX 1IN8A 1CJVC 4HUQA 3DM5A 4GT1A 4JLBA 3CPEA 3MWLA 3NDPA 3WY9A 1DADA 2VHCA 1XRJA 1J90A 2IBMA 3NG1A 3BD9A 2QP4A 4LJ5A 2A5JA 2WWGA 3LAWA 3OEED 3A1UA 3KFXA 3DL0A 4A0RA 4BFZA 1U8ZA 4GNKA 1GP2A 4OL0A 4RD0A 1KSFX 5TMPA 2FSGA 3NXSA 1J7KA 3RS7A 4UJ3A 3MJHA 5EE5B 2E87A 4F4IA 3RDPA 1JPJA 3LXXA 3VX4A 5L8VA 3ASZA 1RZ3A 4DJTA 4L16A 3A1WA 3I5YA 2C8VA 2ZJBA 4QGHA 1GKIA 5IT5A 2QSYA 1E79D 1N6NA 2J0UA 3I73A 4ON9A 5JZVA 2NZJA 5JHGB 2VIIA 1WP9A 2IXEA 2ONKA 4W7SA 5C4GB 1P9WA 1NLZA 3KX2A 1IAQA 2XSZA 5FI0B 3RWOA 4QKQA 3ADBA 5KDOA 1T3HA 3RVBA 4DIDA 2VHUA 3ZVLA 1JPNA 4E22A 4P4SA 1QZXA 4Q21A 3QKTA 2BDTA 1VCMA 1P5ZB 1II0A 3AB3A 2REXB 4TL9A 4DLRA 5FTLA 3CO5A 4G5OA 1E9FA 1QHHB 4L5BA 4U00A 3TVTA 4HB4A 3EA0A 4URZR 1TU4A 2WSSA 4H9GA 1AQUA 1T5LA 1PLLA 2I1QA 3L0SA 3FPAA 1FMJA 3A58B 1T3LA 1VG8A 4I1SA 4NYJR 3WHKA 5KOYA 4TL6A 2IW3A 1GL9B 3TRFA 3CWZA 2NO9A 4KHZA 1GOTA 2Q21A 4BZPA 4Q9LA 3U7HB 5CM8B 2DPXA 2H92A 2Q9AA 2GZHA 2ZRFA 3DHWC 4AIIA 4D26A 2O0HA 4B75A 1T91A 5FBWB 3LBNA 1Z5ZA 3ZQJA 2J1LA 1CR2A 1E2DA 4B71A 4BECA 4EPVA 1DO0A 2QPOA 2I1VB 4L9SA 3R8FA 3TW4A 1II9A 4O25A 2O8BA 2QEQA 2IXGA 1YR8A 3HU1A 4TZ6A 3ZLJA 5G41A 3BS4A 4HEJA 2AWOA 1S2MA 4PQYA 1SULA 4NONA 4AKEA 2AKAB 2H16A 4EJSC 4FCWA 4QFMA 4B73A 3Q3JB 3GJ4A 4X8LA 2GEDA 4OI4A 2PJZA 1D6JA 1A7JA 3MRSA 1OB5A 1WGWA 2Q6TA 3TNFA 3IUYA 3TW8B 1OXSC 5ANRB 4B34A 1TTTA 4DVGA 3D8BA 4MRRA 3W8NA 2O8FA 2JCSA 2CLDX 3KJEA 5KYKA 3Q5DA 5FBRB 2A30A 4YDSA 2AXPA 2IC5A 2V55B 2VA8A 4PR0A 4C2UA 1JJ7A 2EFDB 2V1UA 2JJ2A 4K46A 4TYPA 1A82A 3GQBA 2CBZA 2QA5A 4A6XA 3B2EA 4A2WA 1W1WA 3G0HA 2V7QD 4OYHA 1YJ5A 3N5CA 4V0NA 3ETLA 2NO0A 1T3SA 5KDDA 2C5LA 3M6AA 3WBJA 3PV0A 1Q1EA 3T15A 4IDHA 2IYSA 4HATA 2ZRGA 2ZSBA 2GVDC 5J40A 2ZI6A 2ZAMA 4CYMA 5JCZA 4C0QC 3LVRE 2A5DA 2FPKA 3U60B 1QBKC 2V9PA 1ZNZA 1OYYA 2A9KA 1JR6A 2HYDA 5CDFE 2GXSA 2BKUA 4W5HA 3OIUA 3ND8A 2OM2A 521PA 1CU1A 2OLJA 5EUMA 4NYIR 4QJ5A 2QT1A 4HI0E 3LWNA 5LBIA 4FW9A 3SNHA 2JLQA 3CNOA 1TL7C 3ZH9B 1CR1A 5DNYB 4QL3A 8OHMA 3VR4A 3UMRA 1DVRA 1E96A 1LTQA 1FNNA 1G7CA 4DSTA 3RS5A 4D6PA 2J87A 4RD1A 3OIYA 1E1RD 2HF8A 1W0KA 1NVVR 4NU0A 2NG1A 4WBSA 3OEHD 2GCOB 4GOJA 4TMKA 4HB3A 1Q1ZA 1U99A 4TYYA 2PEYA 3VKGA 2RGCA 4DLTA 4G5SA 4GI7A 1Z6YA 4RCYA 1E0KA 1KNQA 1NF3A 2QP9X 4V0LA 1VKJA 2GJ8A 1AS2A 1MO3A 2V1XA 3W5IA 2RKOA 3ZZUA 4D0LB 2ZSAA 5JSZB 1ZM7A 3K53A 3MWJA 1F48A 4CEJA 3NBXX 3TVDA 1CRQA 2XNDD 3PUYA 4URWR 2NPIA 5BN3A 3EC2A 1XD9A 2AD1A 3TGPA 1IN5A 4JLVA 5LD2C 3VAAA 2HJVA 3JZMA 4IOLA 4KODA 1KK0A 4G5QA 1ODFA 3ICQB 4GOXA 2ZAOA 3C5CA 3VKHA 4JS0A 1ETUA 1GRQA 4TYWA 3NC0C 1ZW6A 1NVXQ 2CMKA 1EFTA 3C15C 2FGKA 1DE0A 1PJRA 2VO1A 4Q66C 1JAHA 2ZRPA 4RY2A 3IEVA 2IS2A 4EQ6B 2ZRKA 2R6DA 1T6NA 4CT4B 2FDCA 2IYXA 2KSQA 1RRPA 3BOSA 2FV8A 1PV4A 1A2KC 1E2IA 5AWFC 3V4RA 5B64A 4AKIA 3KB2A 4Q4JB 2R8RA 5GJCA 1MABA 2NPFA 4QJ3A 1ZYUA 1XXHA 2DWOA 2ZJYA 3CBQA 4ITRC 4QG7A 3RHFA 2PMKA 3SFVA 1KY3A 2YC4C 2YKGA 3Q7PA 1VMAA 4D0GA 5EP4A 2CL0X 4G1UC 4AURA 1XPOA 2QQEA 5JS7A 1G5PA 2MSCB 3QF4B 1CEEA 2ZR0A 3CRVA 4KO8A 3KZ1E 2CJWB 1HEIA 4LV5B 2QBYB 3AGQA 2QM7A 3DKVA 2QUZA 4G01B 4UXIA 3K70C 5DHAA 4LK2A 3RWMB 2HCJB 4D2IA 4OI2A 5AJWA 2O5VA 3UANA 3X1ZA 2ATXA 1ZVQA 1ZU5A 3RYTC 1QHSA 2WSSD 4M1OA 1P72A 1JR3E 3D7MA 4NCNA 5GVRA 1KI4A 1VYVA 4FMBB 2GETA 2JAQA 2HYIC 2QE7A 3IHLA 4F92B 1KNXA 3ZGXA 4EPTA 3Q5EA 2F9LA 4P31A 2VQSA 3ZZ0A 1YE8A 1XTQA 1M2OB 3QKRB 1W2GA 3KDSE 3IKJA 4DT1A 3GPLA 2DYKA 3M4YA 4ZCIA 2HV8A 4NDZA 4NMMA 5TXGA 1Y63A 1VYTA 2P5TB 4Z54A 5K8UA 3UG6A 3AUXA 4TWZA 3PG5A 3Q8XB 1M7BA 1WA5A 5JI2E 4ACBA 3KJGA 1DS6A 5FTNA 1M8PA 3B1VA 2IF2A 1NBMD 1KAOA 4XTCS 3OHMA 3U5ZB 4I4LA 4NTZA 2IYUA 3L2OB 4MYTA 5F2EA 2AX4A 3WNCA 3A4MA 3I61A 3NHAA 5JWOA 1JXOA 1P75A 4LZZA 2ZM5A 1K8RA 2CLCX 3P1JA 2JATA 5G3YA 4B32A 2CL6X 1G3RA 1P3JA 2BBOA 2EWWA 1CJUC 1GNQA 2OE2A 2V8OA 5DISB 4BEJA 3CNNA 4N0DA 1UAAA 2IXFA 2HT1A 4GRAA 4TYNA 2C77A 3BORA 4AI6A 2WWYA 3UK6A 1XD2B 1OIXA 1Q57A 3C7KA 2EVWX 4M22A 1TADA 4DRZA 2ODBA 2ZJ2A 3MJRA 3NH9A 3FFAA 3L43A 3U3MA 3BE4A 1W5SA 5FTKA 5FL7D 3BK7A 2GJKA 1SXJB 1VIYA 4AG5A 2OT3B 5FOSA 1G5TA 2KB0A 2L0XA 2GF0A 1QVRA 3IQXA 4JBYA 2WAYA 3V4FA 2J0SA 2N1BA 3W3ZB 2OCAA 3H1TA 2EFEB 3NTUA 2BMFA 3ZZTA 2TMKA 5CK4A 4MDEA 3GJ8A 4MKGA 5KSYA 3DOFA 4IJMA 5KUTA 3G82C 2HCBA 5TVKA 4B3BA 2IL1A 1ZCAA 2FWRA 2ODWA 1MO6A 1GAJA 1NG1A 2JJ1A 2OAQ1 4POAA 3GJ3A 4XWAA 2WWIA 4B74A 5DIFA 4LJ6A 4C30A 5D3MB 1MOZA 3UWKA 5TARA 1G7TA 1E0AA 2VF7A 1Z08A 1C4OA 3G5UA 2FH5B 5HKKA 1KI6B 2EW1A 1P9NA 3CNLA 2BEKA 3QXSA 4CF7A 5JHHB 4YMTA 1S3GA 2GK6A 4IDNA 1Z28A 3C4JA 1NP6A 4M1WA 5FBVB 5JBQA 1KJYA 1Z63A 1XTRA 1AJEA 2YNMA 3SOPA 5B58C 3GLFE 3FOZA 3B1ZA 2R6GA 3B7GA 1UBCA 1FUUA 3LY5A 2QT0A 2IHBA 3MFYA 3NH6A 2ASEA 2ORVA 3V9PA 3E70C 4PPGA 4NZYA 3OF5A 1J70A 1FL9A 1W4AA 4K81B 5EP3A 4DKXA 2IUTA 4WZBE 1DAKA 5JJLA 1W0KD 3DOEA 2CCJA 1G3UA 2DY1A 1N6KA 2VP0A 3OEEA 1IN6A 4DUGA 3ECCA 5E7IA 3K9NA 4LOAA 3GEIA 1F2TB 1UKEA 1X8JA 4OI0A 4LWZA 3Q85A 1EK0A 2WJVA 2G77B 4Y0VA 5AUOB 1W36B 3DEFA 2JEOA 4QHTA 1AS3A 4UNQA 1G3MA 3A1TA 3L0IB 5AUQA 4A8JA 3LA6A 1SKYB 4M1KA 1N5IA 1XCMA 2BMDA 4MRVA 5BYJA 2IUUA 1E79A 4IOJA 3M0EA 1WMSA 3I72A 1Z8FA 3BRWD 3MUFA 1OH8A 2H57A 4PTLA 1F2UB 4Q18A 2J45A 1XXHE 4B43A 2ZI9A 2ZRBA 4C3ZA 4R2IA 2ZTSA 2JLYA 4B35A 1NL3A 1UKZA 3MCAA 3AF3A 2WMNB 4JLDA 4LV8B 5DHFA 4WOPA 4MGYR 3KJIA 3RRZA 4B44A 3PEVA 3EX7C 1G18A 1OXXK 4LSGA 3VMFA 5L3RA 4NPHA 2RH5A 2F43A 1SHKA 3O8CA 4BZXA 4F91B 2B7CA 4N0EA 4V0OA 1EFHA 3FGNA 2OCPA 5C46F 3CM0A 1ZNWA 2DWQA 2WHXA 2IUSA 1OHHD 1QHNA 1N5LA 2EQBA 4JVMA 2ZYTX 4MQBA 1BIFA 4AC9A 1CKEA 4W5WA 2UZIR 1IN7A 1MO4A 2EFCB 1UPTA 1F5NA 2N42A 1U94A 5A0FA 2H7VA 4JKYA 1G6OA 4YMVA 1CJMA 4KFUA 5A5GA 1QDEA 4BPBA 2GKSA 1SQ5A 4HLDA 4A82A 3KXLA 1GVNB 4FINA 3SJZA 2AKYA 2JLSA 1XEXB 2HEIA 3LFUA 4LJ9A 3I92A 5KNCA 2C98A 1G9XA 3QE0A 5L3QB 4LBYA 1W46A 1G291 5G53C 4DLXA 1CS4C 1IBRA 2YZ2A 2YWHA 2VHJA 4CDGA 5IRCD 3EWSA 4B6FA 4NCJA 3ZYCA 5AJVB 4B76A 1DOAA 3AGPA 1VECA 4C0SA 3SQWA 4HLUC 4CEIB 1SVLA 4LHVA 1Z2AA 4US2R 1P2UA 5DSZA 5IF9A 1SVOA 3UMFA 1N5JA 2Z4RA 1A5TA 3P4XA 4R98A 2NO7A 3VNUA 1LS1A 1QHIA 2QE7D 3SYNA 1FOEB 3T35A 2J0VA 2JLRA 3S1AA 2ZRMA 3R7WB 3VQTA 4F4JA 3A4NA 2GBLC 4JZKA 4Q9JA 3P32A 2GNOA 2F6RA 5EE3A 2NOAA 3EAQA 2F3TA 3KFVA 1H65A 2QU8A 2WIBA 3B6EA 2FFBA 1QVAA 1ZJ6A 2D62A 3SJCA 3EPHA 2OBLA 4V03A 4M9SA 2V6JA 4PAOA 3QF7A 4H1VA 1XZPA 4OK5A 4URYR 1ZCBA 3FVQA 3K0AB 3LW7A 2V7QA 2O8DB 1OT3A 1GITA 5FOXA 2JA1A 1IXRC 3T06B 4ASUD 3RRYA 2D06A 1OH5A 4OHYA 4WZ6A 4A15A 1T4GA 3OESA 1Z0KA 2NTYC 2OXRA 3SBEA 5FOTA 3X1DA 1U0LA 4YMUA 3CW2A 3A8TA 2J5XA 2J46A 2WWFA 2BCJQ 4M1MA 3WHLA 2K5UA 3B1XA 5AR1A 4CIDA 3H84A 3LNCA 3LXRA 3AVVA 2ZREA 4YC7A 2C78A 4KLNA 1UADA 2ZRHA 1HQYE 2G0TA 3OAAD 5FPSA 4CEHB 4LV6A 2ZXUA 4Q9HA 2ZYUX 3L8YA 3K70D 2QQ0A 3K0FA 3MWYW 3WYGA 1JECA 4QXAA 1XJCA 1E9AA 1JEEA 4R9UC 3KTAB 5FR1A 4OHZA 3B9PA 4PC7A 3X1YA 2BJVA 1SVKA 1WQ1R 2PBRA 5DYGA 1N0VC 1BO6A 1XX6A 4RKFA 1MT0A 1BH2A 1H8EA 4EKDA 3EWAA 2IA5A 4Q1EA 1KAGA 2BEJA 3R8CA 3W6PA 3BBPA 1E1RA 1LB1B 4A2QA 3PENA 2A5YB 2QZ4A 2Q3HA 3CRW1 3AM1A 1P6XA 2GBLA 3I8SA 3BB1A 3THXB 2RHDA 4JL8A 3RAPR 1Z2CA 1YRBA 2CDNA 1HYQA 2WV9A 2VP6A 3CUEF 3PCRB 5AUPB 3H86A 3L0PA 4KBFA 2HT6A 3N2EA 5BW8A 4TLEA 1HA3A 5CJPA 2J59A 2DFTA 1SGWA 5BYKA 1U9IA 1MR3F 4I1UA 4NL4H 1W4CA 1NLFA 1S1MA 4QM6A 1TMKA 3ADCA 1RRCA 4RD2A 2ODNA 5CYOA 3K9HA 3GP8A 1E2LA 4F93B 5FPHA 3NEJA 4GOKA 1SKQA 1XEWX 4LY6A 2X2EA 3B78A 4M2LA 5JS8A 1FMLA 1FTSA 1OV4A 2J0QA 2C9OA 3D31A 3QG1A 2Z5FA 2EYQA 1W5TA 3PQCA 1IY1A 4YMWA 3TQFA 2PX0A 1YZGA 1OIWA 3DMDA 2ZE7A 1KZ7B 1QHYA 2OLKA 2W0MA 4DDUA 4DCTA 4DUGD 3KQUA 1X8KA 3THOA 1EFUA 3WMGA 2D4HA 2DBYA 1Q12A 2CNWD 2X8AA 3ZD7A 2I3BA 2ODEA 4QHSA 4TL7A 4W5JA 1GKUB 3EPJA 2H8KA 4HZUA 1IN4A 4XD7A 1OH6A 4XTRA 3CRQA 1OXUA 1HE1C 5FOVA 2RHMA 4GMDA 4LRWA 3VX3A 2F7SA 2P3SA 4MKHA 5FBQB 1A4RA 4LYAA 2FFQA 1D2MA 1E9EA 1KMHB 2PZEA 2VL7A 4IFBA 2G0NA 2QL6A 2XZOA 1HUQA 1Z22A 4Q4AA 5CJ2A 2GHIA 4V0MA 2AK3A 2YWEA 1U2RA 4GP6A 1NMYA 2ZI7A 3MGCA 1E2GA 4HAYA 4FMDB 2D7DA 4G0NA 1UF9A 5KPJA 1I4TD 3AVTA 4B2IA 1ZUIA 1UDXA 1XNJA 3QIAA 2ZE8A 1MH1A 2XXAA 4M4SA 1XMVA 4W9MC 4KLZA 4NCIA 3RABA 2CXXA 4LBWA 5KDLA 3E5HA 1S8FA 4L8GA 4Q7JB 2YYZA 1GL6A 4QRHA 3E1SA 2V3CC 3CX6A 3B85A 4JT2A 1COWD 4OQNA 1U8YA 1TUEA 4BZQA 3VFDA 4QBHA 3LX8A 2A2ZA 4XVRA 5A4JA 1Q20A 4URXR 2A7QA 1R0WA 4Q1BA 3HR8A 1OH7A 2FPMA 4Q7KA 1U81A 2G6BA 1L8QA 1EWQA 1FNMA 1NBMA 4MUAA 4CEJB 3SZRA 1RYFA 4MYCA 3K9GA 3AQ4A 1RVDA 4TMXA 5J4KA 1J8YF 3BIFA 1X1RA 2F1IA 2ZRIA 4ZPXA 4JLPA 1NY6A 2QI9C 3QVVA 3U4QA 2MMGA 2OSBA 2QBYA 4LUCA 1MRNA 4IVQA 1GILA 4A0HA 5FPYA 2BV3A 3A37A 4JJZA 2IYRA 5DI3B 4QBIA 3KL4A 2D2FA 1WDTA 4Q01A 3K8YA 2OILA 2GXAA 1P61B 4DEXA 5JEDA 5B30A 2OV2A 5FL7A 3ZVRA 3EZ6A 2GAAA 5EQTA 1EX6A 4P4UA 3QENA 1VCIA 2QGNA 2XJ4A 1HV8A 1JJVA 4OKSA 4ZKDA 2OO7A 2IS4A 4PHTA 2W2VA 1ZIOA 1N3BA 1KTVA 4PO1A 2PX3A 3PXGA 4ILEA 4RFSB 2KJQA 2ERXA 2YOHA 2ZETA 3AVOA 2QRNA 1UBFA 4M53A 2FZLA 3REFA 1IY0A 3PEUA 4GPTA 2ZRLA 2C9YA 4NYMQ 1NY5A 4LPSA 4TLCA 4JVNA 4C7OB 2GA8A 3K9LA 1Z6XA 2F55A 4ARZA 3BWDD 4MUBA 4M9ZA 2P65A 1HQCA 1Q0UA 1E2EA 2ZRAA 1R0XA 3AKEA 4DSOA 2F9MA 5F98A 1OXTA 4MH0R 2D74A 3IPXA 4CRWB 1E2HA 2GVZC 2W2TA 4WXPA 5H70A 4K8OA 4XH9B 5AUNB 1GTVA 2IYQA 3NDBB 1XD2A 2BC9A 3TH5A 4PQFA 3QEJA 4NHOA 1XPUA 4XSHA 2H1LA 2R65A 3NVAA 4C0BA 1R8QA 1WRBA 5FUXA 3VU9B 5HZHA 2ZJ5A 3WYFA 2BHRA 1EFCA 3GLHA 2PT5A 3QQ5A 4JBWA 4YONB 4EJSA 1H8ED 2WJIA 3N2IA 4EAQA 4Q4HA 5JFGA 4IOKA 2FX3A 2C2HA 4FMCF 1E1QD 1FX0A 4WIAA 1Z0FA 1NKSA 5SZIA 3CONA 4HUQB 3ZS8A 2NO1A 4Q5IA 5SZKB 1O3YA 3TAUA 4F7WA 3FWYA 1G4UR 3R9IA 2LKDA 3AKYA 3W8RA 2Q9CA 2JLUA 2GXUA 3LVQE 5C1BA 3U44A 3EG5A 3I4LA 1HE8B 5GJWC 5FPKA 3THWA 4KFRA 4A1FA 3TSOA 4ABYA 5HPYB 3HPQA 4H1UA 2DR3A 1G5RA 5CIQA 1UDWA 4IDPA 2EWVA 1W47A 1XMSA 3NBZC 1G4AE 2EFGA 3C8UA 5E7MA 1XCPA 4IKEA 3C14C 3T61A 2J0UB 4RD4A 3BH0A 2PT7A 2XAUA 5EE0A 3X2SA 5J4YA 4ESHA 2R6CA 2R6AA 3KXIA 3ND9A 4GBMA 3WMEA 2ECKA 3W3AA 5FBLB 1KJWA 4NYJQ 5H68A 2Z43A 4P4SB 3B8HA 3IIMA 3AP3A 4WZAE 3UXMA 1E4VA 4AK9A 2GK7A 4FWIB 1XZQA 1KIMA 4UKDA 1RJ9B 4IDQA 3U3JA 3P26A 4KYIB 1Z6AA 2G1JA 2GRJA 4XD7D 4MYUA 1OHHA 1R4AA 5FUYA 1G3IA 2OHFA 4FCVA 1F2TA 2Z6VA 4AY2A 3PITA 4AYWA 1G8FA 1P4SA 2QTHA 2ZR9A 1DO2A 3LBHA 3RSLA 4DCNA 1LS6A 4PC3A 1P2SA 3WRXC 2R44A 1Z3IX 1KKMA 2GXQA 3LLUA 1B23P 4B3DA 2KI5A 1CR0A 1AKEA 4RCZA 4MRSA 2D3WA 4TTPA 2ZVQX 5JLJA 3AVQA 2IT1A 2C96A 2VEDA 2ZRDA 3QXCA 4PFSA 5B2ZA 2IWHA 4HB0A 1R5NA 4PX9A 1NIJA 1S9HA 4ZCLA 1PVOA 1DPFA 1W4BA 1II8A 3QKSA 3AF4A 1IY2A 1NBME 2GEUA 1OLOA 4AYXA 4LYJA 2BWJA 4E09A 4KFTA 2WJJA 2IF0A 2O8BB 4TQUS 1Q1BA 1TF7A 2BBTA 1X1SA 2CE2X 5P21A 1NMZA 5DLQC 2QMOA 1R7RA 3FHTA 2QRZA 3B1YA 2ZVPX 4L9WA 4LJYA 3NWJA 1G16A 4ZDKA 3DO6A 1Z29A 2VSFA 1E9CA 4IHQA 1LY1A 4MA4A 4PSAA 2IWRA 2CE7A 2IYTA 2R2AA 3IO5A 3PR1A 2R9VA 4PHHA 1E9RA 1OFUX 3QXJA 3W34A 4TTQA 3HU2A 3LBIA 4RD3A 3FMFA 1DAFA 1KDTA 2QMUA 2O8FB 4OI1A 3VHXA 3B82A 1G21E 2BM0A 4GP7A 3D3QA 2FNAA 4NH0A 1KOFA 3SS8A 3AKDA 4LC0A 2ATVA 1RFLA 1ESMA 2A5FA 4ASUA 4B48A 4DCUA 3Q9LA 1E2KA 2ZUBA 2YOGA 2J7PA 2B6HA 4LYFA 2CCKA 4IDOA 5KSOA 1Q1QA 3GFTA 2WM9B 1Z06A 3PIRA 2GDJA 2GAOA 5FTJA 4U7DA 1JQJC 3WRYC 4G5GA 1E4YA 2A78A 2CK3A 3JVUA 3SE0A 4XVUA 1ZMXA 4EFNA 1NSFA 5L3SA 3HJNA 3AVUA 1GG2A 2VYFA 4BFVA 4R7ZA 2A3RA 4B3GA 1YZLA 2H5EA 3OAAA 1OKKA 3KQNA 4YMSA 3KKPA 1E2JA 2OXCA 4RFVA 3T1QA 1A1VA 2BM1A 1UJ2A 1QG4A 5FOUA 1R0ZA 5C2JB 1U90A 2NMVA 2NO6A 2QN6A 4XIGS 3TUIC 4ZDJA 2FJUA 1NVVQ 4I1VA 3GLGA 2YWFA 1LV7A 2XITA 2AL7A 3AEZA 1VTKA 3UIEA 5H1YA 2V54A 4KCGA 3GLIA 2QMEA 1SVWA 3HU3A 3IILA 4Q48A 3VTKA 2W83A 1YKSA 1YRAA 1US8A 2QAGC 3GLHE 4CW7A 5DO9A 2OBMA 4NCKA 5F9FA 4PANA 4ZCMA 1JXMA 2JLZA 1YZUA 2FF7A 4JYBA 1NMXA 4JLMA 5HE9A 5EJEA 1DG1G 2ZS7A 3U7EB 1OFHA 3CX8A 3SC3A 4AG6A 2ZSFA 4DLZA 3AVXA 2GILA 4IEIA 2B8TA 2AHOA 2ZSEA 1IXSB 3IGFA 2WJGA 1GUAA 1ZC4A 1JAIA 3OE7A 1J8MF 5H8WA 1HURA 1UBGA 1N6LA 3TJZA 2JLXA 2Z0MA 1G8YA 2W2XA 2FFHA 1S96A 2JJ8A 2XTZA 4B3XA 5AK0A 5K8LA 3GLFB 2O8EA 4CEHA 5CLQA 5K8IA 1BKDR 4PZYA 4ZIRA 4GMXA 5EE9A 2PCLA 2JIZD 4Q7MB 2ZQ5A 3EC1A 4MKFA 1L2TA 1WE2A 5CB6A 3CIOA 5JJIA 2XEXA 3A4LA 3CRMA 2CNWA 1AN0A 4MYHA 5DYIA 1ZRHA 2ZITA 1NG9A 3TLXA 1Z0AA 2G3YA 4KBGA 5SZJA 5JWHA 3BFVA 4Q1FA 4WXRA 2RGXA 4ZI2A 821PA 2JLWA 1P9RA 4F4CA 2J41A 1TQ6A 1YZNA 2IYWA 4M1YA 3BXZA 3REGA 2GJ9A 4OHWA 4M9XA 3THXA 4OK6A 3WXMA 4RJLA 1AZSC 1UBEA 2P6NA 3C5HA 3SDZA 1AGRA 2QAJA 4QM7A 3ICEA 1N2CE 2X19A 3UG7A 2X1VA 3CH4B 4DSUA 4A0FA 2RB4A 3FTQA 3SJAA 1NLYA 4DLVA 4IEEA 1E3MA 1E99A 3SEAA 1E94E 1QHGA 4BLOA 1KI2A 2QAGA 3QY0A 2NQ2C 1MABB 2P0EA 3B60A 5FPTA 4AD8A 3OIWA 1XXHB 1R6BX 1XTIA 4TQAA 1WCV1 2QTFA 4QGAA 5HCNA 4JSTA 2PZGA 3AKCA 2W00A 3IPYA 2ZJ8A 1NSTA 4FWTA 5DH9A 4BFTA 3WMFA 1C1YA 1DAMA 1KO7A 1NVWQ 1SVIA 3NC1C 4HAVA 1TEVA 1TNDA 2BBWA 3FFBA 4YXWD 4TLAA 1NN1A 1WF3A 4MDFA 3SBDA 5JJKA 2RGGA 3KJHA 1WBBA 1AKYA 1W7AA 2DHRA 1M7GA 2WPDD 4PPNA 2ORIA 4NP6A 1XP8A 2FEMA 5HZKA 2O0KA 4GL2A 1CJTC 3EA5A 4UQOA 1CJKC 3DZDA 5K8TA 3QXXA 3H4MA 1EG7A 2PLFA 1TPZA 4M21A 2DFLA 3EZ7A 1COWA 3UPUA 2OFXA 3QPUA 4EFLA 5FUVA 3EZ9A 2MMCA 5LD2B 4PAMA 1N6PA 1KI8A 1QG2A 3B1WA 5F9HA 3QPWA 4Z51A 1RRFA 1NNEA 2ZE5A 3P20A 4DT1B 1DAIA 1CULC 3EZ2A 3WBKA 5DN6D 4S2EA 2KE5A 5EXPA 1HT2E 3CRRA 5DI9A 3WP0A 2IX3A 2O0JA 3DKPA 5B57C 2RGNC 4MITA 3T1OA 3T1VA 3SHFA 1T9HA 2WWHA 3Q72A 1R10A 4Q7LA 3AF0A 1OB2A 1E0JA 1WB9A 1XTKA 4JLJA 2CL7X 4LHYA 1P2TA 4WA7A 3R20A 5HR5A 3KQKA 4WAUA 3O8BA 2PL3A 3ZDQA 2BJWA 1QHHA 3I8XA 1GZSA 2BKEA 1SVMA 4IVRA 2O8CB 2GJSA 4JKIA 1Z6GA 5E95A 4DSNA 3W9YA 3HPRA 3TR5A 1HY3A 1IJFA 3C41J 3LW8A 4NCHA 2LWIA 4OHVA 1ZM4A 4ACAA 3KXKA 3BAFA 4RZ3A 1IQPA 2WOOA 4DB2A 3K0CC 4XOIA 1PLJA 4Z1MD 2IEZA 4QC2A 3QPVA 1EX7A 2OBNA 5CLLA 1G7RA 3RRNA 2YVUA 1N0UA 4QBGB 4KV9A 3CPJB 1FTNA 3FMIA 3EPLA 3X1WA 4DCVA 1M7HA 3GLGE 3J81k 5CB8A 2J7PD 1G6HA 1ZUNB 2AR7A 2P6RA 4TQ9A 1KMQA 2J7KA 4MKIA 3F8TA 2OFWA 2F1RA 4U5XA 3GEHA 1FQKA 2OCYC 1M74A 1OPXA 3AUYA 3CH5A 3DPUA 4PXAA 3AV0B 2CK3D 5IK2D 1IXZA 5EZ6B 3CF2A 1Q3TA 3EZFA 4HLCA 1TU3A 2WZQA 2B21A 4LBVA 5CITA 2B7BA 1EFRD 4OQLA 1OKKD 1XBTA 4Z8XA 1GRNA 2XTMA 2WSMA 3CLVA 3FHCB 2C04A 1XU4A 1NJFA 1RPZA 2ZROA 4CT5A 4KFSA 5JI3E 3H0KA 3F0TA 1AIPA 2QM8A 3QSYA 3K09C 3U61B 2X2FA 1IONA 1VG1A 4HLUA 4EUNA 1ZINA 1E2PA 3OFND 1VHLA 2F1JA 4LDJA 4D25A 4G3XA 5FOWA 5DE3A 2REBA 4MGIR 3THYB 1E1QA 2F3RA 4NE2A 3WNDA 4BRUA 4GDFA 1SZPA 4PSVA 3RC8A 1W0JD 2AFIE 4FIDA 4EPYA 3UWOA 1CRPA 1Z0JA 2YC2C 3EXAA 3GEEA 4KVGA 4OQFA 2F1HA 3F5FA 2ANBA 3KB1A 1E9DA 4C7OA 1ZD1A 3SN6A 2QY9A 3GCGA 3U6KA 1T5IA 1U8AA 3K0CA 3LQRA 5TB5A 5G40A 1F3OA 2BIFA 2NGRA 3GJ5A 1VDZA 4LJ4A 1XDBA 4ZV4A 2JGNA 3OE7D 4C4PA 1D2EA 3ZD6A 2IS1A 1S9DA 5EXXA 4MRPA 4A8JB 4AKHA 1IOZA 1F6BA 5CDFA 2CVFA 4V02A 3LDAA 1I2MA 3KKMA 3HDTA 3QG5A 4LI0A 2J3EA 3EIEA 1L4YA 1ANKA 2I4IA 1W48A 3NHBA 4Q4LA 4NYMR 2QENA 3I62A 2ZSDA 2ZEJA 3M1IA 1YHNA 2ZR7A 4E07A 6Q21A 1GM5A 4LC1A 421PA 3FKSD 4JMPA 2WBLC 1LNZA 3IIJA 2FEOA 2B92A 1NVUQ 2ZI3A 2RGBA 5C18A 4OQXA 5FR2A 1RE0A 1D9XA 4HUTA 2DCUA 1GIAA 4RD6A 3AH8A 5FTMA 1VCNA 4B33A 2W58A 2F43B 2JLVA 2GCOA 2XZPA 1FQJA 1NRJB 1CIPA 3HYTA 3NBFA 3K09A 4RZUA 1D5CA 5E7JA 5BXQC 1XMJA 1W2HA 1HTWA 3VR6A 2QG6A 2Z83A 5EUQB 1J2JA 5JSZA 4DZZA 3AP1A 4LJ7A 4EPRA 4AKGA 4GSYA 3DMNA 1IHUA 3AF1A 4O2RA 5G3ZA 3SI7A 1U0HC 4IRUB 4US0R 2EFHB 3LRPA 1W44A 2FZ4A 3IO3A 1GSIA 5J4VA 1TAGA 1R0YA 4QNRA 2WJHA 4XWOA 1VG9B 1GNRA 2REOA 1V5WA 1KO1A 3R9WA 1XFAA 4HAXA 2UVQA 4TLBA 3BB4A 3IIKA 3OZXA 5M04A 3EPKA 3WYAA 2IYLD 3FYHA 4OK3A 4Q03A 4QBFA 3K0SA 2ZUDA 4TMZA 2O52A 3UATA 1M1YE 2BOVA 1M6NA 1KSJA 1QRAA 4EQ6A 4GZMA 4DLSA 4FCTA 1F60A 121PA 2W6JD 2ZIAA 1I2DA 1RJ9A 2FSFA 3VR2A 4F38A 1DEKA 3QXHA 4KSBA 4DDWA 4URVR 3DZ8A 5JWRA 3CWQA 3S1AB 4Q4JA 2V4ZA 3TUJC 3ZQ6A 2UKDA 1PUIA 3Q7QA 2C99A 3CZQA 1KY2A 1D9ZA 1Q22A 2YINC 2BMJA 5J47A 3NKVA 2LCFA 5TDHA 3HR7A 4BE7B 2P2LA 1UKYA 2HDNB 2IYVA 1VIAA 1XEFA 3ZVMA 2OG2A 3QF4A 2H18A 5AJZA 4HAUA 3BH6A 5D3QA 2CJWA 2WIAA 4KYUA 4ZKEA 1SXJC 2YOFA 2WICA 2ZI4A 2ZRJA 1OF1A 3BERA 4DDVA 1WBDA 4JLOA 4BFSA 2GESA 4LBZA 2KWIA 1BOFA 2B8WA 4A9AA 3QBTA 2GZAA 3A36A 4B6EA 4KITB 4TT3D 5SZHB 2C03A 2YV5A 1MO5A 1JR3A 1TF2A 4Q1DA 4TTRA 1G41A 1GKYA 1Q44A 3O8RA 1UFQA 1GWNA 1CBUA 1PLKA 2R6FA 5JRJA 3VR3A 2XOKA 4FMCB 4E03A 2XB4A 4JYCA 3QKRA 4FMDF 1AZTA 1BMFA 4HYYA 4OQMA 3PEWA 3V00A 4C2TA 1GL7A 221PA 3K0FB 3HYRA 2QGZA 3T34A 1Z0DA 2PZFA 3WP1B 1NN0A 4PC6A 2GJAA 3U7GA 4LPKA 5JRZA 1OFTA 2EYUA 3MMPA 3P4YA 4Q1AA 3ZIAD 1XJ0A 3VR1A 4D0NA 4DLWA 1YR7A 1KO4A 3PFIA 4A2PA 1KKLA 1Q3HA 1AA9A 5IHPA 2PH1A 3ADDA 1NJGA 4QOSA 4PHGA 2FMXA 1XPRA 1MKYA 2VH5R 4PC2A 4JJKA 1I4DD 1D8TA 2ZANA 1NIPA 4X8HA 1XWIA 1ZU4A 3JVVA 4EFMA 3RS4A 4PPQA 4QNMA 3VNVA 4HDQB 5CIWA 1KDOA 1P62B 3BJIC 4KJZA 2FG5A 3TKLA 1C9KA 1OSNA 3CR7A 1ZD9A 4C0LA 1GRRA 3FMPB 1SXJA 2WOJA 2ZE6A 4HAWA 4BLPA 1LW7A 3VKWA 2QROA 1W36C 1N6IA 3SQXA 4D4KA 2OEPA 1ELOA 1KYIA 2JIZA 4UXJA 3CX7A 3QVUA 1E6CA 2XNSA 3LO5A 2WWWA 5E4FA 2WVJA 2VRWA 5JCPA 3W6NA 1SHZA 1E32A 1BYUA 3KQHA 3EIQA 3QNUA 4JBXA 3FB4A 1PZNA 4S35A 4HB2A 1XCGB 3GJ7A 1R5OA 4BGDA 4PZZA 4CGZA 3HP1A 2PMDA 4HAZA 5F3WB 2V6IA 1GNPA 2JASA 5D3MA 2XJ9A 2W6IA 1KI7A 2QNRA 4HZUB 2ZJZA 4UNPA 4B2LA 2HJGA 1OJLA 4JSYA 1KJZA 2VBCA 1RYHA 3SJBA 3SFZA 4B3CA 4EIWA 1AGPA 3FHOA 1KK2A 3PVSA 1E0SA 2VTKA 1XTJA 1KI6A 4LYHA 3DDCA 5FUWA 1TX4B 4KI0A 5EP1A 1E9BA 1N5KA 2OZEA 1ONBA 1CLUA 1I4LD 3W5JA 2ORWA 1E2NA 4V0ME 4ZI3A 4Q4AB 2CVHA 3GLFA 2LKCA 5J5CA 2IYYA 1UEIA 3RANA 4YXWA 5DGXA 4XWKA 4B47A 2AN9A 1X86B 2QTVB
chains in the Genus database with same CATH superfamily
1UKAA 2WPDA 4ZAZA 4ZHQB 3PJRA 2R4TA 2R68A 1Y37A 1Q92A 4Q4ZF 5CH8A 1LD3A 3ELYA 4B5LA 3U37A 1EUZA 5EGSA 2OAEA 1EDEA 1IJBA 3ECAA 1ATZA 3CWCA 2Q0HA 4UEJA 4C89A 2XLBA 3DQPA 1KJ9A 4DBZA 2J3KA 3EW9A 4U2DA 2SHKA 3T5GA 3DM9B 3KD2A 4MJ7A 1SOVA 1GHTA 2HD4A 5KTMA 3QEBZ 1JV2B 3QV2A 1F51E 3I0MA 4FEAA 1NFQA 1VSBA 4Q05A 3DV0B 5KO2A 3W9UA 4YASA 4NKRA 3BQNB 4BNUA 1E2MA 3S5UA 2G04A 2FN4A 3OQOA 5C7YA 2YNMC 4M63A 5FWDA 1BMFD 3R7AA 4AQ7A 1RLMA 3QLVA 2R5NA 5F2NA 1SG9A 1G8PA 3GLHB 4BUZA 1N0WA 1W0JA 1YO6A 3E2PA 4A26A 2O8DA 2XCLA 1NQUA 5GJVC 4RDCA 3RJZA 1CE8B 3T5DA 1KI9A 3VC1A 1JT9A 5LIRA 5AYVA 2BE7A 4LNUB 4JL6A 4C3EA 1WP4A 2BZGA 4YUXA 2JI6A 2WFMA 4RK1A 1R8SA 3MSXA 2RHTA 4G5FA 4GZ5A 1G17A 4V0KA 4YRIA 3SYKA 3O84A 3E2MA 1YA8A 3LLMA 4GC5A 1U0JA 3F49S 4TL8A 1UBOS 1KMIY 2G4VA 2BF7A 4BNLA 1JJFA 4N40A 1FFHA 2IY7A 2B9EA 1KH3A 1Q7TA 2HL6A 1DKQA 2RG1A 3MG9A 4ARAA 2IHTA 4IMJB 3GDWA 4OL9A 3IBGA 2DWPA 2P67A 3IMFA 2Q7OE 4QO7A 4YPFA 4YDHB 3TBHA 4DEYA 4EVQA 4O4IF 2HA0A 1KSGA 3RSFA 2VZ8A 1WHTA 3Q5GA 1AG9A 3L7NA 1Z15A 2XZDA 1KOLA 3WGNA 1GDHA 1YQEA 4KK3A 4CG2A 1D2GA 4C0KA 2XLMA 2AFHE 3Q7LA 3HGTA 4DC9A 3VISA 3I2GA 3DCIA 1EHYA 1WS6A 4H3HB 4CEJA 2CLOB 2HLDD 3GLIB 5BSRA 3WLRA 2CYDA 3AP2A 3FDZA 3C1AA 2XGJA 4YMIA 3IJRA 3TIFA 5A5FA 4WKGA 4EPXA 2L6FA 1JQLB 5EEGA 5AW7A 4C0HA 1QRUA 3V1UA 2D5AA 2C57A 4A0GA 2R62A 3DGEC 3MQ4A 3ZWDA 3L82B 3C3BA 3SZOA 4WKCA 3QTHA 2A8YA 4US1R 3TINA 1MX3A 1A27A 3FSEA 4NCQA 3FYTA 1PR2A 4PGAA 4OCZA 3GFOA 2JJ1D 4C3BA 4QARA 4N3GA 3FPFA 1TB4A 3M4XA 4EHKA 5BV2P 4M0UA 2IZZA 4XWGA 2XB9A 3MRVA 1EXVA 1R5ID 1V74B 1Z47A 4Q47A 1ECCA 3DKAA 1JWAB 2JFVA 3NDPA 3MA0A 1XRJA 3DPIA 3JD3A 3DL0A 1UCFA 7ABPA 5IVIA 2XQFA 3HSYA 3ZDRA 4QQ8A 3VPXA 4A23A 1Z4OA 1Y7HA 2R1TB 1NWHA 2VIIA 4W7SA 1WCXA 3RWOA 5FI0B 5FQOA 1DC8A 2ATEA 3DTVD 4CG0A 2HTEA 3L0ZA 1NF9A 4E22A 1Y1PA 2VP3A 4RYDA 6REQA 1RKEA 4FZRA 3AB3A 2M98A 5CA1A 2C5EA 1QHHB 2VPIA 1XQYA 1VIMA 7GPBA 3A58B 1UR5A 2DPXA 4D26A 3B8EA 2YL1A 3H17A 3FZYA 3WNVA 1ULTA 2B25A 2HCRA 4JEIA 4CN9A 4TT8A 4TZ6A 4P7JA 5B1SA 2HCFA 3ETGA 1XXLA 2DQ4A 4DR3B 2NZUG 3IUYA 3OLWA 2KNHA 4KNVA 3W8NA 1C14A 4NX2A 2IYFA 2JARA 5DDIP 2EFDB 3LYLA 5GZ3A 4N03A 2H9AA 3B6KA 4A6DA 2M9MA 3HXMA 2CC2A 4IDHA 1K7YA 2ZRGA 5JO9A 3A26A 5FWXA 3U60B 2E7ZA 3ABSB 4W5HA 2OM2A 2PX6A 1BW9A 4KO1S 4CMIB 4NYIR 1CG6A 1P81A 4ZOAA 3LWNA 2B1QA 5LBIA 3UCFA 1M8KA 4U7FA 5I9NA 2FG6C 1DOZA 2AOTB 1W0KA 3LOPA 3G85A 4LF5B 2Q41A 2ET6A 1JSXA 4Z7QB 4NXMB 4QYWA 2Q7DA 4Q9DA 3P9NA 2ZB2A 5FULA 1K5PA 4ZCQA 1JQDA 1CRQA 2Q2OA 2XNDD 4E5DA 3JZMA 4JS0A 2ZXOA 3LUDA 3DS8A 4IWBA 3LTEA 1DE0A 4EY8A 2V7XA 3DP7A 2NP6A 2FQYA 4UAVA 1U28A 3WHIA 2HGZA 3IA7A 5LP6A 5EP4A 3DBHA 2HGSA 3HO6A 4H7PA 2I6XA 1RHJA 3O90A 3DVAA 1QHSA 1P72A 1JR3E 4ND4A 4AW9A 5JJCA 1VYVA 3U39A 2WR8A 5LZ7A 2XL4A 2VQSA 4YA6A 1CEXA 4TRRA 3MBGA 3FN4A 1W59A 5ALIA 3OHMA 4XLTA 2G1AA 1DBQA 4DDMA 4MKRA 5G3YA 4DHWA 3K5IA 4AO8A 3WNQA 2HWUA 3OZTA 5NULA 3RSQA 3KR2A 3V3KA 5L0GA 3OZEA 3L43A 1JIUA 4IJVA 1W5SA 2GJKA 3ZD9A 1W4ZA 2C7RA 3JZ0A 2OT3B 2BUCA 3AEXA 1DQSA 3AYXB 2N1BA 2VS1A 2JFQA 2BMFA 3HNLA 2FRXA 1V8BA 4K6MA 1KVQA 3JARA 2JJ1A 3GJ3A 1KAQA 1FK8A 1HNZB 5A6VA 4REMA 1S3GA 4ZVKA 2ZYDA 4IDNA 4O6MA 1Z28A 5FBHA 1I9GA 2J48A 2A88A 3OUUA 4WXEA 1L4EA 4DF3A 1QZZA 1M34B 5TMDA 3TTYA 1FL9A 3WLMA 3DE0X 2EG5A 4GPIB 4I1PA 1UKEA 1X8JA 3HI4A 1WZ2A 2XHZA 1JEYB 5KU7A 5KHLB 4AMUA 4MRVA 5CLJA 4QATA 2C58A 4J94A 3H2ZA 3DTVA 4B35A 5G0TA 4KWTA 4DREA 3PSHA 2OK8A 4NBLA 2LGJA 4NPHA 3L5OA 2F43A 4ZQGA 5DEIA 3SX4A 4V0OA 1EFHA 4KXXA 1H42A 3FVVA 1NBAA 4NZNA 3MYFA 4D8UA 5AHRA 4XAQA 1M66A 3AEUA 2H7VA 2VASA 1DSSG 4DIOA 4WE3A 2WRZA 3T7EA 3GLUA 5A1TA 4AJIA 1PR6A 3LFUA 3I92A 1LEHA 2YZ2A 2IITA 4CDGA 1DOVA 4PV7A 3EZLA 2OGZA 4ZV7A 1P2UA 1U1DA 4Y2TA 1OQAA 1XDWA 2IUEA 2J0VA 4X60A 4PLFA 3ZKWB 3VNQA 3KQTA 4M9SA 3QF7A 4YR7A 2EGUA 4C4RA 4I1OB 1LKZA 3NV9A 3ZQUA 1PSZA 2EDCA 4H17A 3CSUA 1U6JA 2G67A 2J9UA 3B6JA 1NULA 2LZ0A 3LHIA 4RM2A 3H84A 3ROQA 1OI2A 1PG2A 5D51S 4KLNA 3OAAD 4CU2A 3V8MA 4Z4IA 5B4TA 3IAS1 5DYGA 5LLSA 1Y34E 2QHXA 1X9IA 4K7BA 5T57A 5IMSA 4W5QA 3ENZA 3UB3A 2H3EA 2WC1A 3CSKA 1Z2CA 1CUBA 5KWSA 1QV9A 4EA6A 3EY4A 4U9DA 1M6EX 1Q0PA 2HMAA 5BW5A 1LW6E 2P9ZA 3IP3A 3IR7A 2Z5FA 4E3ZA 1IY1A 4NE9A 2PX0A 1V8OA 1U6KA 1LDYA 5EWMB 1XQXA 2NZVG 2PU5A 2EINC 2X8AA 2CD9A 1CUSA 2OB1A 2ODEA 2WIKA 3BZBA 3BWMA 4XD7A 1KFJB 4ZMBA 1RWXA 3FOAA 3ZNOA 4LXIA 1RQ7A 5HRCA 1WUKS 1PSDA 2XZOA 4H1WA 1LS4A 2WD7B 2MYSA 4RPGA 4MQ6A 2RAUA 1XT6A 2OD7A 2I9PA 1ISGA 2REQA 3RABA 1SZDA 4UTNA 1PIWA 1K9VF 1V4BA 5DTIA 2Z6UA 1WXXA 4YUYA 4BZQA 2PGDA 1EUDB 3BAZA 3S5JA 5CCBA 1W9MA 1YA6A 2XDQA 2CKDA 3O8QA 1U81A 2DY0A 1XZNA 2H2FA 1QNFA 3H1BA 4GBED 1R6XA 2O7QA 4AKTA 1OWMA 3I4CA 1J8YF 1PZMA 1Q3KA 1NY6A 3BE6A 4KOAA 5LCXA 5BYBA 3AR3A 3DFKA 3WOHA 3E22B 3HFSA 4QWWA 3NBUA 4BQIA 3VYRB 2R02A 4GX5A 2HA2A 2VDLB 1E5VA 1Y1QA 3FYSA 3BEDA 4QAJA 1EX6A 3BKWA 4TS1A 3VJRA 4XRGA 3EOBI 4ZKDA 2JI9A 4H3VA 4V2UA 1GGJA 5HW0A 1RWVA 3UR3C 3E9VA 2ZRLA 3HCFA 1PJ3A 4DM3A 5BSTA 3ZHOA 3M4JA 3VDRA 1KTMA 4IWNA 1U0OC 2H7XA 2IP2A 2JH9A 3T41A 1WDKA 1D0ZA 5AVQA 3SFTA 5J23A 1R8QA 5HZHA 1JQAA 2ZJ5A 3DEKA 3EFEA 1P1BA 2Y0EA 1JFLA 2XLVA 2O2YA 3ZS8A 1KQPA 1PNRA 3H0CA 1A9SA 3QU4A 3AKYA 5GP1A 2Q9CA 3U44A 1ENOA 4RE5A 3THWA 4A1FA 4H1UA 3RIPA 2ODTX 1C7FA 5LQDA 2DF8A 4HNUA 2P3LA 1TQHA 4CHGA 1SBHA 4WZAE 8ADHA 3JALB 5CXQA 4D5EA 1TECE 1MJNA 4KPUA 1WSDA 2NU6B 5HQ3A 2GXQA 1CR0A 3U4DA 2HSZA 5SYNA 2VNHA 3R9KA 4KE9A 3DNMA 4C05A 4EVRA 1YKFA 1OLOA 3BGSA 1Y4CA 1T0UA 3O21A 3IP6A 4CCSA 1KEZA 1X1SA 4DTCA 4IQFA 3ORQA 4LJYA 3R2JA 4PSAA 2IWRA 2H4XA 5F77A 3IV6A 2R2AA 5IMBA 5GZ6A 4COOA 1F0YA 3AB7A 3LBIA 2X1MA 3L34A 4WH0A 3JCUQ 5JQWA 4GP7A 2ZJ0A 4GDMA 1O95A 2ATVA 2HMWA 4DCUA 3K8OE 3QVMA 4JH0A 4R16A 4M55A 2Y93A 1K6EA 4UUQA 1QQ3A 1E7SA 5F5XA 3U3XA 4EY6A 2PBFA 1ZMXA 2JFXA 4HAIA 2FEAA 4B3GA 4YL1A 3OAAA 1I5EA 1O54A 3GGDA 3QYPA 2CJYA 5FOUA 2NMVA 1KH1A 4GF5A 2YZ7A 4N4AA 2FJUA 1EZZA 2XE6A 1YKSA 2IXOA 2H07A 3TLBA 3BXHA 2D5CA 1Y9EA 3L7KA 2E4YA 2CXHA 5JJBA 4QDLA 4UDYX 5J63A 5HE9A 4XVCA 5EJEA 1MIOB 4DR7B 1D6NA 2HPAA 3AVXA 4YH1A 1RJGA 3I4UA 2GAIA 2JLXA 4XWYA 2DFPA 1SC4A 2AFIA 5IBQA 2Y6UA 1C0EA 5CYFA 1WE2A 1R6AA 2AU5A 5KVCA 1MUUA 1WSWA 5DBOA 4ZI2A 1EGMB 4F4CA 2UZ0A 3REGA 1GNTA 4M9XA 3C5HA 1GPBA 3UG7A 5H9VA 3PFHA 3B60A 4JSTA 2W00A 3WMFA 4HAVA 1ORJA 3LE8A 2Q1SA 5KINB 1SCJA 3CVOA 1YC2A 1WBBA 3C6BA 5H5JA 3MFQA 1JAYA 1OWNA 4M21A 5E3CA 3V1LA 4Z7OB 1EMDA 3MK31 4AUKA 3OA2A 1DAIA 4ZK2A 3FTDA 3GJSA 2HOQA 4Q34A 3TNLA 4DCMA 3T7DA 4AZSA 4LHYA 2YY6A 3WSWA 1U0NA 3X44A 2QLAA 4MPRA 3CX3A 4EZEA 3X43A 4DSNA 3EBPA 1L5WA 2AI3A 1FS6A 1TO6A 5FCDA 2AC4A 4EITA 2IEZA 4FFOA 5AI8A 2HEGA 3X1WA 4C3OB 1ZHHA 5J2UB 2BR4A 1NOKA 1ZUNB 3ESZA 4JXZA 3D5QA 4NSNA 4FFVA 5HFNA 4AX2A 5CITA 3N7AA 1VJCA 3FLAA 4X0RA 4HT3B 5JDCC 5F4BA 2HB6A 3P94A 4GYKA 5JAMA 5AVKA 4KSYA 3H0KA 4EKWA 1DUSA 1VG1A 1H2RS 2A68F 5DQZA 1VHLA 2QX7A 1FRQA 1UZAA 4NQRA 2HC9A 5JNWA 1SXGA 2HRRA 4JEHA 1YCDA 4YUAA 1ILEA 5TB5A 4O79A 1GXSA 2NGRA 4EA8A 3GJ5A 3VTFA 1U04A 4ZV4A 4XEKA 2JGNA 1Y7PA 1Y48E 1SUWA 1VXOA 1NQOA 4HTFB 3EIEA 1ANKA 5C5EA 3ZIDA 4DQKA 4X41A 2PRKA 3DBIA 1GIAA 4QXPA 4OV6B 1A4XA 5FTMA 1GD1O 2Q5HA 1SUDA 3LHFA 3NBFA 3VO2A 1XMJA 2WTBA 3K32A 2C4WA 4GSYA 2BY4A 3I1YA 4O2RA 3DXZA 4E5VA 4TKMA 2YV1A 4XWJA 4K6OA 1R0YA 4YAFA 3ER6A 1V5WA 1J9ZA 4V24A 3TRIA 3WYAA 3CFYA 4TMZA 1M6NA 1KSJA 2HQRA 2YQ4A 3C7AA 4DZTA 3Q8KA 2O4CA 2HF7A 2ZIAA 3SDBA 4POOA 1T1SA 2C99A 1M5UA 2AB0A 2FZWA 3R0JA 2CGEA 4UOEA 2NUAA 4KYUA 5BRJA 3AJAA 3BTVA 1OF1A 1QIFA 4JLOA 1ETHA 4KITB 2JI7A 3T94A 1QVXA 3BF8A 2PD6A 3ZDYB 3IXLA 5J1SB 4NAUA 3TD2A 2PD3A 1JDUA 4JP8A 2O1EA 1XRPA 3NNNA 1PJ2A 1SQ6A 2BSAA 4HRVA 1E2XA 2EYUA 4Q37A 3WOVA 4WCFB 4A2PA 1MTOA 1ML4A 3ADDA 1NJGA 5BQGA 1MKYA 4AM8A 1F2DA 2AVDA 4F97A 4U2GA 3NZEA 4BMPB 1SVUA 3WQHA 2A92A 1UT5A 1NBWB 1PX2A 3TZCA 3QVUA 1RTKA 5JAPA 1S2DA 4XE5A 2Z9CA 4FBGA 2X8BA 2SNIE 3V8EA 1M1NA 4HB2A 1N3YA 3VPFA 3WL3A 1R5OA 3DZGA 3FVYA 4PHCA 3G49A 3USCS 1MX1A 3HP1A 3Q7IA 3EGXA 3C3DA 4C29A 2QNRA 2UUBB 3OWOA 4B3CA 1RYHA 4EIWA 2FR8C 3DDCA 2MDTA 3VOSA 4MEBA 4Y9SA 5HQTA 3ZOKA 2O9JA 2IYYA 1L9KA 3K96A 4NZMA 3KT3A 1E62A 2GHTA 3RSHA 3NWEA 4WZBA 1C3OB 1Z35A 4NAHA 1OU0A 3S28A 1NXOA 3EDCA 1QX4A 3K5WA 4PVCA 1DIHA 4J8PA 3BGWA 4DMKA 3TZKA 5LQCA 3VVLA 1NC3A 4G81A 1BC5A 2RCNA 1VHTA 1SK8A 2BBSA 1CR6A 1P1CA 1YFKA 5TQ0A 1CP3A 4PIVA 4FEYA 1ORTA 4FN4A 4RA9A 3U4QB 3K66A 4BWYA 3WL6A 1QGED 4DR2B 3VR2D 3LH5A 4D8VA 1YVPA 3MLEA 3MYYA 4CS9C 3CPSA 4Y2VA 3IJEB 3FX2A 4IG9A 1G21B 2FPIB 2PIDA 3KQSA 4RHUA 4C9BA 1BS1A 4M0LA 5IBCA 3K1ZA 3OOEA 2QUPA 5JVDA 4E70A 5DFAA 2XMPA 4KAFA 4BNNA 3DO5A 1D2HA 1H05A 4LEIA 1DKPA 2C84A 3RVZA 2JKYA 2GD1O 5HE8A 3PUXA 3KYIB 4C7BA 4BUCA 3KKNA 5IG2A 1L7EA 3G8BA 4A8JC 5KSZA 4M37A 3TL3A 5BWOA 3N86A 3IUQA 1U9ZA 4MGKR 2GPJA 3NHKA 2GWHA 1KR2A 1GO2A 4CKZA 5A6JA 5CHYA 1G7SA 1CZRA 4Z6KA 3PFNA 4LOJA 4WZZA 2VTBA 1ZOSA 3GRUA 4R05A 1C2YA 3EGCA 16PKA 1Y1RA 4LCBA 4HGZA 1QHXA 1L7AA 3V9AA 1O5HA 1TMGE 4MR9B 1N2CB 1UMBB 4EG0A 4RY8A 2FKAA 4H7IA 5U9CA 1E8DA 5BSMA 1DUIA 3BFKA 1SHUX 1I01A 3PSAA 1HC7A 3E9MA 1B3BA 3K73O 1EAMA 1TM1E 5UKDA 4GS5A 2IPXA 2H4YA 4EGCB 3DEZA 3HWX1 2LNDA 2W42A 4NR0A 5K0IA 2ACEA 1A72A 1ODKA 3I04M 5DCYA 3T3EA 2I4NA 4X90A 2FY8A 5DVWA 1CFZA 3O39A 3NWPA 4OLJA 4AL4A 1W5EA 4LN1A 2MCFA 4NHEA 2G1UA 1QH9A 2CLEB 4LVOA 1FNDA 1FJHA 1XZKA 4D9EA 5JEEA 3RRXA 1X3SA 2IP4A 5CCEA 3RC3A 4C0AC 1ECPA 2C4HA 1TUIA 2QTZA 3HNOA 4Y6LA 3OTQA 3PCTA 3TD7A 1XF9A 3FM9A 1M67A 3H04A 4QGGA 1G20E 5G1NA 2X6QA 1LBQA 5GOZA 5IJZA 2JB9A 5DHQA 2Z04A 4RHTA 3OCVA 1T0JB 3NJRA 1VMIA 4RZXA 3RSOA 2DB3A 4RKEA 2HIGA 1F8FA 1EDDA 4QICA 2NIPA 4OX9B 5CVEA 2WJYA 1G3QA 4RFSA 3BFXA 2ERCA 4KE8A 2R4QA 4C0XA 4MGZR 4EBJA 4G5RA 4D81A 2C00A 3PQ2A 5KOJB 4UE6A 1JU3A 1UKVY 4IIHA 4EGQA 2RI0A 4BGIA 1QHEA 4UXHA 4WNYA 4ZCSA 5ALVA 3ZVKA 2I15A 2K7ZA 2HPZA 4W5OA 4NBSA 3AOEA 4G56A 1L1RA 3KG2A 1TO1E 1CW2B 1TK3A 4A5SA 1NN5A 1G8GA 3HABA 5FLEX 3OOWA 3F9RA 4WOCA 4BFZA 1YMVA 1WW3A 4ECEA 1NFNA 2RARA 1JFSA 4ZJUA 4BTEA 4E51A 5L8VA 1E3JA 3DG9A 2TMDA 3PHCA 2Q45A 4CM9D 3QWHA 4TTSA 3H1EA 2NZJA 1I5OA 5C8ZA 4BBPA 1Q7BA 4MWCA 1XSEA 3ZJVA 1C7RA 3ZLUA 5HDBB 4P4SA 1QZXA 4ZVMA 1B00A 2F3PA 3S2GA 3M4NA 5T67A 2EFJA 2NAFA 3C43A 1HBJA 5LA6F 1IEQA 3L7YA 5KOIA 4RBNA 1BVHA 3HFGA 3PTZA 3MVEA 3HXQA 2VH3A 4EPVA 1B0PA 2XE4A 4BJ5A 5A3SA 2I1VB 4TVOA 4BMXA 3G0CA 4DCJA 2PL1A 3SP1A 3FUVA 3BSSA 4YCNA 3KEOA 4NONA 1X7WA 2WQZA 3P9SA 3KSBC 5B12A 2QG4A 2XWQA 4CIVA 1NVMB 4R1MA 4DVGA 1EHCA 1HDEA 3BSWA 4FEEA 4Y1GA 1JJ7A 1QTIA 4KNYA 3K1AA 2VN8A 2VJOA 1RXSA 4F96A 2C5LA 3BXPA 3PV0A 2D5BA 2MWMA 3G9TA 3FRHA 1L7QA 3HUEA 2PYIA 1F1BA 1FIUA 1WPXA 3LK6A 1P7ZA 4CMBA 3C8DA 3JAWA 2HZBA 1HW1A 4BVLA 1BJKA 2QP9X 1KNQA 3FR7A 3SX0A 1MO3A 3W5IA 4BOYA 3B5EA 6ADHA 4MROA 4DFDA 3BDAA 5BQFA 3U9SA 5FOQA 1V6CA 2KLHA 2HX1A 4Q1VA 1ZW6A 3AILA 4B6QA 2GPSA 1PJRA 1WMDA 4RY2A 3TLYA 2GNPA 4IPTA 1JE0A 4PWZA 3V4RA 4BKUA 4CM4A 5GJCA 4QJ3A 3CBQA 3SVTA 10MHA 5ADUS 4G1UC 1NQAO 1ZD3A 2AV6A 2YYAA 2UUHA 2DGJA 2EF0A 3SJ7A 2HCJB 2WZDA 4YQEA 3I5UA 5ED4A 4AQYB 1NBHA 4F9EA 5GVRA 3A28A 3KIPA 3VZPA 3PQ8A 3WS7A 2O50A 5KVVA 2GETA 2HYIC 5IWCA 1QH1A 4P34A 1YE8A 4EJ0A 1YARO 3GPLA 2DYKA 4MTGA 4NMMA 2ILVA 4R3NA 3PL1A 4Z54A 2PMWB 2NP7A 1TLLA 2VZEA 5FKJA 5JAHA 3IV7A 3U7JA 1QE5A 2AG1A 5TE9A 3FW1A 1Y1TA 5KC9A 4M22A 1CF9A 3NH9A 1ZUWA 3LUKA 5CVCA 2XRYA 1X1DA 5ADHA 2V7EA 4ULVA 1PKEA 2VSQA 1Y6QA 2R87A 3VA7A 3NHFA 2QVGA 1Q77A 3LPLA 3O3OB 4B82A 2D7JA 3UOGA 1ZCAA 2XCSB 4WEOA 1E0DA 2XUDA 4FBLA 3TW6A 4JURI 2VF7A 4EM6A 2WJ6A 1KI6B 4MJ3A 4ZO6A 4XFDA 2QTRA 3ZNPA 4O4IB 4B9AA 4BX9A 5JAQA 3VR4D 4FLFA 4DKXA 5HKAA 4MVJM 1THZA 1KHHA 5JJLA 1M1XB 2DY1A 4FYXA 5E7IA 3GEIA 3Q85A 2G06A 5KVAA 5LOVF 4IIEA 3L0IB 2HREA 3LA6A 1Z4IA 3RG2A 3KQWA 1Y4SA 4OB7A 3P4UA 3BRWD 3N7UA 1PQYA 4A91A 1W8IA 1DAPA 3SC4A 2J45A 1Z2OX 4YRMA 5F23A 2VDQB 4QDTA 3ND6A 2RH5A 1MD9A 4BO0A 2R8PA 4U8GA 5CCXA 2OCPA 4MULA 1ZMRA 2IUSA 1OHHD 3CUTA 4L2IB 1MO4A 4UQPA 3CX4A 4MV5A 1W5AA 4HLDA 3KXLA 4FINA 2HK9A 2CV0A 1A69A 1BCSA 2JIDA 1G291 4XKJA 5BWLA 4RSMA 2V9ZA 1RLIA 1VECA 3AGPA 5L51A 1DGQA 4US2R 1SVOA 2NO7A 4FKMA 3NKFA 2VJAA 4R32A 3KFVA 4OBWA 3KKBA 4M0DA 3UKJA 5ALXA 4IQ8A 4PAOA 4XRRA 1NR5A 4MWSA 4OK5A 2R48A 4DA6A 3G59A 3DFIA 1Z0KA 1CERA 1XALA 1FRNA 3CW2A 2R2GA 3ETDA 1R18A 3B1XA 4FFMA 1IG3A 1REQB 4G5XA 5EXEA 2I1WA 4MVJA 5IDYA 1MOQA 3MWYW 2N0SA 2JZCA 1BFUA 1XX6A 2O07A 5FBKA 3W6PA 2W2NA 4K0RA 2W5UA 4PN7A 3QP9A 3L9WA 3JYHA 4MR8A 3SEZA 2MWQA 2P0AA 2CUZA 3UV3A 3P0EA 1NLFA 5DX0A 5CYOA 4MVJP 4LY6A 5AXCA 1JKXA 5JS8A 1P4GA 4MW8A 5CM2Z 2VTVA 2ZBEA 1ZBQA 2IOFK 1KZ7B 2W0MA 3ZTTA 4QLBA 1UWVA 1T9GS 1MMDA 3PGLA 1OC4A 3TQRA 5ITZB 2FHPA 3ZHTA 3ILXA 5F7XA 1IN4A 3CE9A 3QU2A 5B2FA 2XDAA 1OXUA 1RAIA 4OUDB 1JG1A 2G0NA 5LZ5A 1HUQA 5FA8A 1TM7E 5KPJA 1HW2A 2R79A 4YO7A 4WBNA 2BGIA 1MH1A 2AC7A 4OP1A 4M4SA 2YXBA 4LBWA 1ORVA 2YYZA 1ONSA 1YQQA 4XJSA 5BSGA 5KYTA 4KMSA 4ND5A 1Z17A 1O0CA 5D1NA 5KWJA 2H5JA 3HNJA 4CM7A 1ABEA 4LXTA 1LDGA 1LRJA 2QI9C 2ZXEA 4LUCA 1QFZA 2GTIA 2ZXFA 5FEMA 1PWYE 1Z8NA 5FPYA 3J80A 3OT1B 4QBIA 4IRXA 4N5DA 3OQIB 3EZ6A 1W2WA 2WYVA 2IS4A 1ZIOA 5CA0A 3L6BA 2KJQA 3AVOA 2ZETA 1R74A 1MJ5A 5T4BA 5DVZA 1NY5A 4LPSA 1ZH2A 1E2EA 1VBNA 1O89A 3NIGB 1RADA 1B41A 1O97D 3U31A 2IYQA 4REQA 2XT6A 1J42A 3JW8A 3G2HA 4LWOA 1MW8X 2BFMA 3C7TA 5KCMA 1R8XA 2XLDA 1K05A 1H2YA 1L1EA 2Z8YA 2CVPA 1M72A 3CONA 1LI7A 4EJMA 3R2PA 1RQGA 4HFKB 4KYVA 1V3UA 5EWJA 4L3WA 1HE8B 5FPKA 4ABYA 1C02A 3KR0A 3O0TA 5CIQA 2EKLA 1WATA 3NHSA 1GNSA 1UBJS 3DMHA 3C14C 4Y18A 4PFOA 1P1RA 2O54A 3N28A 3GBVA 4TTIA 3ND9A 3STHA 4LNHA 2JIRA 3LYAA 2ASVA 1OHHA 2Y4NA 2EHDA 2NUPB 4UUOA 4ZD6A 2R44A 1HMPA 1AKEA 2PGJA 2JJYA 1N2GA 2JAPA 1C9EA 1S9HA 1W4BA 4MUNA 3AF4A 3FPGA 3CVYA 4LYJA 3IXQA 4KFTA 1QLHA 1MJGA 2Q4RA 4HBGA 4O02B 1NMZA 2ZVPX 4L9WA 1MXFA 2IYTA 1MEOA 4MSUA 3UHPA 2CL5A 3PR1A 3B6MA 3CZ4A 1CLEA 3BD7A 1BU5A 1I3CA 2CN1A 3OOSA 5LKAA 1KOFA 1A7DA 2PLWA 3AIIA 3GR6A 1P2GA 2FGYA 4XSVA 3MJEA 4LYFA 2H52A 4M9UA 2C5HA 1XZBA 1B3RA 3EQLF 4XVUA 1VM6A 5EZSA 4RFVA 3HGQA 1UJ2A 5C2JB 1U90A 3RF3A 3GIWA 3JPYA 2XDWA 4BKQA 1IUKA 4Q48A 2QAGC 2PKRA 5CDYA 4H4EA 5IDWA 3GFGA 3JQRA 3I05A 1WULS 4D1YA 1SCBA 2Z2YA 4A6EA 3OX3A 4OQDA 1J0BA 3NOOA 2Y1WA 2Y3BA 3ME5A 3DL2A 4ZOBA 4L08A 4CEHA 4E6PA 1K6JA 2VBFA 3DMRA 1I2CA 4ZAWA 2BFBA 4OP2A 2WVNA 3EC1A 1JIQA 2WUVA 3FUXA 2XEXA 3A4LA 4AJEA 3CRMA 1NQTA 2ZITA 3CR3C 1E1CA 1EU1A 4F84A 1AZSC 2P6NA 3CH4B 2RB4A 2XL6A 3FWNA 2QVCA 3D4NA 2NQ2C 1R6BX 1C3VA 2AKEA 2WZCA 4ZLCA 3ENQA 2NU9A 5EL0A 5JQGB 2VNIA 4QPCA 1NN1A 4CKCA 1MX9A 2FEMA 5EZQA 5K8TA 2QD5A 2PLFA 5FUVA 3OWHA 3HQ4O 4EHIA 4G24A 2GBCA 1A76A 4FFRA 4K3UA 2JGJA 1VMKA 3DJUB 2GN8A 5DN6D 5AVWA 1HT2E 3CRRA 3ESBA 1SKUA 2QF7A 3TIXB 3GHHA 2C2KA 2YWAA 5HILA 1V9LA 1NE2A 1Y9ZA 3SQLA 4BAGA 4Y1RA 3R20A 4JLUA 4P08A 1Z6GA 3RFUA 1N2OA 5TMEA 3QEAZ 2LWIA 2XKAA 3L93A 3ASOC 4PSCA 4E0HA 1TJPB 3S29A 2HO4A 4ETMA 3MJ4A 3EPLA 1XZHA 4RQTA 2I4MA 1ZXBA 4MKIA 4QDZA 1P17A 4EEZA 2B7BA 2GI4A 4ALJA 5BURA 2Y66A 2X3FA 2XTMA 2X3YA 1NJFA 3IE1A 1YTUA 7REQA 5HZGA 1Q6YA 5IAKA 3H87A 2AE1A 3KC2A 2HDWA 3ZTMA 3DUFB 3BHMA 3OEOA 1SFRA 1QYXA 4Y1FA 4WPGA 3AHFA 2EJCA 3B6IA 2ANBA 3HO8A 1Y80A 3MEQA 3U6KA 3SSMA 3BGVA 4R1UA 3NHRA 1VDZA 1IC6A 5KWIA 2Q2NA 4BNIA 3OZGA 4GR5A 5EXXA 2MU1A 2BFOA 1OWLA 1VE3A 1XN4A 4LC1A 1PJZA 2YICA 2WBLC 2B92A 4MUMA 3IAAA 5EY5B 5K3SA 1DZ3A 2Q27A 4HQRA 1AB6A 3E9DA 1ZESA 3O93A 3IBTA 1Z4LA 2PAFA 2IJGX 1J2JA 3EZGA 3IBFA 4DEVA 5E4YA 3D1LA 4GM0A 1W44A 2DGDA 3JD4A 2H9YA 5AVRA 2NSFA 4JBHA 3LHSA 5I3CA 3LKBA 1C29B 3GUCA 3FYHA 2QQ5A 3GEBA 2J9WA 4KIUA 1M1YE 3IDOA 3ZNQA 1V4NA 1F60A 3LS2A 5EGNA 4URVR 1WY5A 4DTIA 4DWOA 3GJTA 1EDZA 3AQCA 3FOOA 1V0JA 3NM5A 1OZGA 3RFXA 4BTVA 5ADWA 3FZGA 4DA7A 4N6OA 2NU7B 2ZJ4A 2F4NA 3MGBA 4BFSA 3KLOA 4LBZA 3P0HA 4B6EA 3JQCA 2VR1A 4MUEA 3T7JA 2H5IA 3O8RA 2SKCA 4CPDA 1YQGA 1JF8A 5KNDD 1EP3B 1BMFA 3RPEA 5HK8A 1EBUA 1M33A 3MMPA 1H2AS 1CQIA 2H0QA 3INNA 3COVA 1WHSB 3V4ZA 1KPHA 1T25A 4MINA 4XM0A 4PC2A 1Y6ZA 1I4DD 1KDOA 3U4IA 1AF4A 1CZKA 4MR7A 3NONA 4J7XA 3WLSA 2UYOA 2IBTA 4WGYA 2VYVD 5KNBD 2WWWA 5E4FA 2YCBA 4ZO9A 3QV1A 3IKVA 3CT4A 2IM8A 5IANA 2A6PA 1PZNA 4IV8A 4BEWA 2H1HA 3QJGA 3W04A 1GNPA 4U5GA 3JTEA 1GEGA 1KI7A 1S8OA 3ODPA 3FHOA 3PVSA 4EH1A 1UJCA 3W1VA 1VHQA 5KYVA 5E6SB 2LKCA 3UMHA 1UPUA 3CW9A 5BOSB 4YK5A 1RZUA 5DSXA 5DBGA 4M86A 4M8LA 2XUFA 1THMA 1NI4A 5ETJA 5F3RA 1YVDA 4QDUA 3HCPA 1GT6A 2RC5A 3GCDA 4H7DA 2IXBA 2WG0A 1MAAA 2HV9A 4QT4A 2EL9A 4L7QA 2HMQA 5DN6A 2VHEA 3EF0A 4L9AA 5TLSA 4H7FA 2NT4A 2QYTA 2QL7A 2YDYA 3T95A 2R6ZA 3C24A 3IPAA 5TEWA 4Q9IA 2YN2A 3EF3A 1KRWA 2WF9A 3AQIA 1VBKA 4E5UA 5EMLA 4JLKA 5HF5A 4PO3X 3EXHA 2NTVA 3A1SA 1H1LB 1UAYA 3I6ZA 1ZHXA 2OGWA 5E3HA 5M34A 1L7VC 1L5YA 3HCAA 5KYWA 2HLDA 1XLVA 2J3QA 2I7TA 1IN1A 1TOAA 3QMVA 3LO8A 5BRAA 3E9YA 2JCXA 3EGDA 1OYOA 1LSOA 4UHKA 5CDTA 1HQKA 5AKEA 3PU6A 1QPZA 2BCGY 3WDLA 1SXJE 1PS9A 5AKGA 4DLYA 5ADVA 5T3WA 1MB9A 3MINB 2DLNA 3ZBUA 1HMYA 4C20A 3PGXA 4EHFA 5LDDC 3TZEA 4HNVA 1PAUA 4GKVA 3G8YA 4ZGWA 2XNJA 4U2KA 3WK6A 2YR0A 1DC4A 3TULA 2DBRA 1KZGB 2EARA 3R6LA 1VA4A 3HCCA 3PNYA 1Z0IA 1G8KA 1PG5A 3SVLA 2VPPA 1XB2A 2K2WA 3GO4A 1BE8A 4D4JA 4ODIA 3QMMA 1SCQA 4HYQA 4BUJA 2WA1A 2X15A 1X7XA 2Q07A 4CMEC 4WRRA 1YRYE 3D1VA 3CSSA 5A0TA 5I7AA 1X13A 1HSOA 1CS0A 4Y8VA 2GDCA 1U98A 1VIDA 1CY8A 2RGAA 1DQZA 4MHSA 1EX1A 3HWSA 1RAGA 1ZVJA 4E12A 2K7FA 1OX4B 1KC3A 3GFFA 3A6PC 4DRYA 3RS3A 1QZUA 4K0DA 3REQB 2I3AA 1Z8DA 4QQKA 2AOWA 3DNFA 1TAUA 3HUFA 2DFDA 5L3SB 5CTJA 4H35A 5KNDA 1RP1A 2HSJA 2Z30A 2CXNA 5AI9A 5JQGF 4NV0A 5ER6A 5E6UB 2M64A 3NIWA 1ND6A 3RRFA 1PTJC 1C81A 3GNLA 4I8IA 4OMFG 4MVQA 1RKCA 1OXKA 1MN6A 1SZIA 4P3PA 3Q11A 1QH0A 1X8LA 3PQ7A 2B94A 1G55A 4RV9A 2GVNA 2GASA 1LPAB 3ZBTA 5KNBA 1LM3B 3UUFA 5D00A 1MA3A 3BL6A 4H7EA 2O23A 3GW8A 2IW1A 2YH2A 4Q02A 1T8TA 3EARA 4GI5A 5BQ3A 4D82A 2Q1UA 3TK0A 2JGIA 1CPRA 2YVKA 2D1TA 4D4LA 3SCZA 1TRHA 2XNDA 1R0KA 1DBRA