3E70C

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
318
structure length
307
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVILTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the signal recognition particle receptor from the archaeon Pyrococcus furiosus: implications for the targeting step at the membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
total genus 105
structure length 307
sequence length 318
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00448 SRP54 SRP54-type protein, GTPase domain
C PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e70C01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3e70C02
2VSXA 2ATXA 2W0SA 3R8FA 1M8PA 3KXKA 1XEWY 1OT3A 3RYTC 3RRMA 3OAAD 4LUCA 4IKEA 1AKYA 1ZC4A 3AKEA 3SBDA 3SBEA 3NIBA 5BW8A 5DN6D 2QRZA 4LYJA 1NLYA 3R9IA 4I1VA 4Q21A 5FPHA 3KJEA 2QA5A 3WBJA 5JECA 1N6HA 3QXSA 3W90A 1IAQA 3QKRA 2JLYA 2BEKA 4JMPA 1LFDB 1OH8A 3PCRB 2QT0A 1XPOA 4C0BA 3AVQA 4HSEA 1DAFA 2AD5A 3NDPA 1ZU4A 2R8RA 2VP5A 2X77A 4TQ9A 3UIEA 5GADl 1NNEA 4XWOA 3I73A 3QKUA 2BBSA 3CPJB 4MDEA 3RAPR 3SFZA 2QORA 4DEXA 5LB2A 3TR0A 1G41A 2YHSA 2NO1A 1GOTA 3CBQA 3OAAA 1Z8FA 4IDNA 4B2LA 2GAOA 3OE7A 4OBEA 1UKYA 1Z0KA 4DLRA 2ZJ2A 4AKGA 2RGEA 4D4MA 4BRWA 2IXEA 3K0CA 4TLBA 1KOFA 1OFTA 2J0UA 3BGWA 3W3ZB 2C98A 2FX3A 4D4JA 1KI8A 2H1LA 1KAGA 2D7DA 3QF4B 1SVSA 4Q7KA 1O87A 3L8YA 1TL7C 3F0TA 4L8GA 4OJKA 4DRZA 4B3FX 4W5HA 4MUBA 5KO2A 1N6PA 2X1VA 1DG1G 3GLHE 2HLDD 2BC9A 5J4VA 4CYMA 2NO7A 4ZO4A 1E2DA 1W44A 4RY2A 4ZI2A 1E79A 4R7ZA 4JLJA 2F43A 3PIRA 3T1OA 4C0JA 2CCJA 2QMEA 3CH5A 5HPYB 4MYHA 5JCZA 3TKLA 4NP6A 4BFYA 2V54A 2FFAA 4RD2A 3DKVA 5JWHA 5BXQC 3CIOA 1Y3AA 4KFRA 3EIHA 2B21A 3KQNA 1BMFD 2WAXA 3TK1A 2O8BA 1IN6A 4NPHA 4UJ5A 3MLEA 1N0UA 1VDZA 2QNRA 4A82A 5F2EA 3R9XA 5EZ6B 4LBVA 1OXTA 3ICEA 1NL3A 2V7QD 5FPTA 4RD1A 5C4MA 4IXNA 4F93B 1NF3A 2ZJBA 3BAFA 3K9HA 1Z6YA 1KJYA 1E2PA 1XEWX 4PSKA 4EPYA 1OYYA 4JLMA 1TU3A 3B1VA 4LY6A 3WMGA 3KFVA 5KOYA 2DR3A 3BFVA 4XTCS 4BFSA 4E5UA 1RJ9A 3EW9A 3K8YA 2ZJOA 2A5YB 1OLOA 1XD2B 2JDID 3EZ9A 2QBYA 3B1YA 1ZVQA 1KK2A 2J87A 2DB3A 2V1XA 3TAUA 4JLDA 4R2HA 1FQJA 5F3WB 1VTKA 1Z6GA 5DN6A 3ETLA 1F2TA 3I8XA 3IIMA 4KCGA 1P2VA 2DWQA 1P61B 4M1OA 4IW3B 1OXVA 4M1WA 1HY3A 3TUZC 1FUUA 1Q1BA 1UM8A 1R4AA 2UZIR 1P9NA 4C7OA 1PLKA 3ZVNA 2F7SA 2G9NA 1RJ9B 3BE4A 5BWMA 2CNWA 1DAIA 3I4LA 4DCSA 5DLQC 2R6CA 4RJLA 3CZQA 1QHNA 221PA 4WBSA 3NEYA 2ATVA 2B7BA 5EQTA 2ZYVX 3GJ7A 1T8TA 4GP6A 4TYQA 4P0TA 4XSGA 1E2MA 2BJVA 1KMQA 2C99A 2ZRMA 1IHUA 2JAQA 2VHCA 3OESA 4MRNA 1Z0AA 3LDAA 2WJVA 4Q7MB 3HYRA 4DB4A 1QVAA 5F9FA 3IGFA 1UADA 2K5UA 3LAWA 3WP1B 3KKNA 1ZM4A 1OFUX 4YQFA 3TUJC 2C9OA 1DAMA 4RD4A 4TT3D 5FOTA 2GESA 3RDPA 2KBFA 3IIJA 3RS0A 1E0SA 4MRVA 4EQ6A 2EQBA 3LA6A 3SC3A 1GL7A 1M7BA 2FFHA 4W5WA 3WP0A 2ZSEA 4IFEA 5G40A 4KFSA 4OQFA 3QXHA 1FQKA 4NZYA 3VR4A 2WSSD 4OI1A 5DYIA 1BOFA 4AKHA 5FOVA 3SJCA 3VR5A 4DCNA 1J8MF 1FNMA 2HF8A 4JLOA 1FMJA 4M9QA 1YZTA 5FPSA 2IA5A 4URWR 5CIWA 1GL6A 1TQ2A 4MQBA 5HR5A 5KNCA 2HT6A 3CX6A 3TUIC 3K70B 1XXHA 2IWHA 1U2RA 5FPKA 5C4GB 1CJMA 4D81A 4G3XA 3ZGXA 3U7GA 1XMSA 4XTRA 2QTFA 5BN3A 1XCPA 1SVWA 2H18A 3GJ6A 1S9DA 1G8HA 2HUPA 2WVJA 3QKSB 2ODWA 1QF9A 3SS8A 4MDFA 1N5JA 4G5OA 2PEZA 3EZ2A 1TU4A 3GQBA 2VHQA 1E2JA 1DVRA 1Q3TA 3RHFA 3U3OA 4LRWA 2QMHA 1A1VA 3U7HB 3NC0C 3EC2A 4KSBA 3QIAA 1CP2A 1P4SA 2YWEA 1VYUA 2QBYB 1LB1B 5P21A 1NIJA 1R8SA 2WSMA 3TNFA 4MA4A 5IK2D 3HP1A 1E2GA 4I1UA 3RS4A 2O8FB 3W6OA 1XTJA 3RC8A 3RABA 4FWIB 2O8CA 1AIPA 2CDNA 5TVKA 2BMDA 2PL3A 1GG2A 1LVGA 2AWOA 3BOSA 4HAVA 3THWB 2G83A 2YKGA 1TMKA 3LLMA 3W5JA 2KE5A 1EWRA 1KZGB 2JLRA 3WYFA 2IYSA 1RRGA 1S3SA 2C04A 2JLWA 1MH1A 5SZHB 2QN6A 1KSHA 2V9PA 3AF3A 1DOAA 1OXXK 2VP9A 3K9NA 2O8BB 5DH9A 3B9PA 4OQLA 4YMVA 4AK9A 4RD3A 2DFKB 3LV8A 1ELOA 4BLPA 1KO8A 4Z8XA 1AGPA 3T5DA 5JFGA 1JR3D 3A58B 4B47A 2ZI6A 1TUIA 3AV0B 4ZKDA 5KSYA 5TB5A 4V0OA 4LJ4A 2AWNA 5AUNB 1LTQA 1SULA 4BFUA 1G3IA 4ZCIA 5TY0A 2VH5R 1NMXA 4IXMA 2W2TA 4IEIA 1EX6A 1MO5A 4TSFD 3NBYC 4PSVA 3PEYA 1M1YE 4URXR 1KDOA 2QEQA 5HE8A 2FN4A 4CEJA 1J8YF 4B6EA 4Q47A 4IOKA 4BFXA 4PPQA 2JJ2A 2CVFA 1CU1A 4QHTA 2QM7A 3T61A 3T34A 2GJAA 4KO8A 2ZYWX 1X8JA 2GDJA 4GFDA 5DI3A 1U8AA 2VA8A 3HJNA 3I62A 2IYVA 4BZQA 2IHBA 4YMWA 1I2MA 1YRAA 4AYTA 3AUYA 2J5XA 5EE0A 1FOEB 1SVLA 4B75A 2O8CB 3QQ5A 4ZIRB 3GMTA 3X1ZA 1HUQA 4Q9LA 3IBYA 1MV5A 4LI0A 1PLLA 2OEPA 1J70A 1JI0A 3RANA 2ODBA 1NKSA 1PJRA 2OBNA 1ZM3A 4Q4HA 1KI6B 3SZRA 3ZD6A 1GRNA 4LV8B 2EFHB 3BJIC 2FZLA 2GNOA 5EXTA 3QY0A 3K1JA 2P2LA 4KBFA 3B1WA 3UG7A 2IBMA 4FI3C 4POAA 1XTQA 1FP7A 2KJQA 3RC3A 5C18A 2P5SA 1M2OB 4JKIA 1RYHA 1RKBA 2ZVQX 1DAEA 5AJVB 3TW4A 1KZ7B 1N6LA 1W2GA 4QOSA 4B3XA 2GETA 3TRFA 2ZRCA 1JEEA 2MMGA 3AP3A 2VTKA 1T4GA 3BK7A 2WV9A 2VL7A 1XX6A 1ZUHA 2XTZA 3GJ5A 5TDHA 4TTPA 2YV5A 1TF5A 4TLCA 4X8MA 1IXSB 5FUXA 4CF7A 3U3KA 5FR1A 2OAP1 1KKMA 1Z29A 1FZQA 3FPAA 4KFTA 3VTKA 5GJBA 2QAGA 4YXWD 2JATA 3VR3A 4GPTA 4MRRA 3KKOA 3W8RA 3IKJA 5JI3E 1P5ZB 3FDIA 3AGQA 3B1XA 5H70A 1E98A 4NHOA 1W48A 1FPMA 2D7CA 4Z8YA 3A4MA 2ZRPA 4PC6A 1TADA 1KMHB 4M4SA 5G3YA 4Q4JA 1G3QA 2V8OA 3AP1A 1G1MA 5J5CA 1HQYE 1CJKC 5JRZA 2ORVA 1GILA 3K9GA 1E4YA 1T3LA 1CR2A 2C78A 4KAXA 1K5DA 4P4SA 3GLFE 4FN5A 3K0FB 2OV2A 2YJTD 4Q4LA 3NHBA 1CLUA 2DFLA 4OQXA 3V9PA 5IF9A 1IXZA 1F48A 2XZLA 1DADA 5GJVC 1OFHA 2J7KA 2FEMA 4TT3A 4DLTA 1GKYA 1KTVA 2Q9AA 1HURA 2C8VA 2ZAMA 5E4FA 3CB4A 5LD2B 4P4SB 3M4YA 1JPJA 3VMFA 1I4DD 4D0LB 3E70C 3TR5A 1D2MA 2CVHA 1XXHE 4MKHA 4UNRA 1WBDA 1IY1A 4Q1DA 1EK0A 2VEDA 3FHCB 4RVCA 4F38A 2ORWA 4WOPA 4MKFA 3QKRB 121PA 3FKQA 3AM1A 3GEEA 2AKAB 4HDCA 2Q9CA 3AVYA 5CJPA 4V0NA 1DG3A 3IDQA 3PENA 5ELXA 4LJAA 3ZZTA 2AHOA 2ODNA 1GUAA 2RH5A 5EUMA 2JIZD 3EIQA 1LS6A 4Q03A 2AL7A 4UNQA 3T15A 4JYCA 2I1VB 2ZSAA 1J2JA 1G8PA 4DLYA 2IS2A 1AQYA 2R6FA 4I99A 1S9HA 4L15A 5DE3A 5A4JA 1Z22A 3OHMA 1P72A 1CULC 4N3NA 4JLBA 4FWTA 3SYLA 1UF9A 1X1RA 3GJXC 4S35A 4A92A 1MR3F 3NTUA 4Q4AA 4QBFA 1N0WA 3EARA 4PZLA 4AC9A 4JVLA 4II7A 1OXSC 4M2LA 2Z4SA 1X8KA 4B71A 1SHKA 4Q9HA 1OXUA 1S2MA 2AD1A 2CK3A 3WRYC 5FR2A 5JSZA 3QI2A 3Q3JB 2JJ1A 2DWOA 3TLXA 3QBVA 3H0KA 1YQTA 1CRPA 3L0OA 5EXSA 5H68A 4D4LA 2DFNA 2F43B 3NG1A 5GJWC 4TMTA 2ZRIA 5KNDA 2ZI9A 2C03A 1R0WA 2OCYC 3EWAA 5JEEA 4PHGA 4DB2A 2C95A 5GVRA 2O52A 3GLIE 4M9XA 2G77B 3THXA 1OH5A 1CJUC 4JJZA 5ANRB 2FPKA 1KO5A 5C1BA 2YWGA 1VHLA 3RWOA 1TTTA 5E7MA 2F1RA 5FUWA 1VIAA 3B5JA 4C0KA 4FMBB 2NTYC 1LF0A 3GD7A 4O2LA 2CMKA 2FWRA 3HU1A 1YRBA 4ESHA 2RAPA 4CEJB 2IWRA 3AVVA 1CJVC 2QG6A 4M1KA 3LBNA 2BMJA 3QVUA 4DDUA 1IN7A 2ZM5A 1P75A 2YWFA 1VECA 3PQCA 3LFUA 1ZUIA 4LYHA 1EGAA 2WKRA 3P1JA 3OIUA 2ORIA 3B2EA 5HKKA 1FTNA 3LY5A 3PEVA 3VHXA 3KQKA 1AJEA 1E3MA 1XTKA 3NC1C 4KHZA 2WPDD 3HYTA 5CK4A 1G7CA 1VYTA 1W49A 5FBVB 3AH8A 4XVQA 3UK6A 3REFA 3T06B 2F3TA 5M04A 3AF1A 1IY0A 1XP8A 2BWJA 4Q1FA 2ZANA 4RCZA 1B23P 1KMHA 1VIYA 3NDBB 1MRNA 2ONKA 2QZ4A 2CXXA 1MO6A 2ZUDA 1ZM7A 1E9BA 2QPTA 3ASZA 1ZIOA 1W0JD 2ZE6A 4WW0A 3WBKA 3MG9A 5LBIA 2ZRBA 3GLHB 2CHGA 2RCNA 3FKSA 3MCAA 3WYGA 5FH9A 3WY9A 1G8FA 4P3YA 4QBGB 5FTLA 3O8RA 1WA5A 4TYNA 4DC9A 4PC7A 1NLZA 2D06A 4NDZA 2PMKA 4FINA 1H8HA 1D2EA 1E9DA 2OFWA 1QHSA 3VKWA 1E4VA 2KB0A 2H7VA 1BO6A 1S1CA 1ZINA 3CRVA 1KI7A 4HLUA 2B92A 2O8FA 1NVVR 4AG5A 1P6XA 2REBA 3SDZA 1RRCA 2GXUA 2QL6A 4ZV4A 2QT1A 1W36D 1YKSA 4LHZA 4O2RA 2OCPA 3TAHA 2D2FA 1UAAA 4P32A 1DARA 4Y0VA 4B32A 4C9BA 5B64A 2H5EA 2PT7A 2AFIE 2ZR9A 5EP3A 1NJGA 3JVVA 4PAOA 2GF0A 3U7FB 1UDWA 2WJJA 3A1TA 4TYYA 4C7OB 1ZNXA 4CZ2A 1ETUA 1Q12A 3UWKA 1QZXA 2FA9A 4LJ5A 1NIPA 3RS3A 1XXHB 3MWYW 1WQ1R 1E2QA 3KQHA 1ESMA 4MGKR 1F2TB 2P5TB 1CJTC 2IYLD 721PA 1T5LA 4PPFA 1GNRA 1W0KA 4NYIQ 4NKRA 4BFVA 3GLGA 1ZU5A 3A36A 3KZ1E 2BBOA 2H16A 4DUGA 1X8LA 4DCVA 4WZ6A 1U94A 2FU5C 1MABA 2HXYA 3KKMA 3GP8A 4D6PA 1W4AA 5B2ZA 4YMSA 4QJ3A 1OIWA 3U7EB 1Q1QA 2O0KA 4DHEA 5J4KA 5A0FA 1Z83A 1CTQA 1V43A 3B6EA 4JVMA 2JJ8A 4GBMA 3RWMB 3FWYA 3GPLA 4B48A 1AZSC 3L0SA 3HPRA 4JVNA 3F5FA 2QP9X 3EZFA 5DHAA 5JHHB 1W5TA 1Z08A 1E2KA 2WTUA 4HYYA 3E1SA 3KL4A 4CIDA 1NBMA 4R9UC 2ONJA 3KKQA 4AD8A 3DL0A 1TEXA 5GJCA 2VLIA 2N1BA 3QVVA 4JSYA 4YMTA 1TPZA 1VYVA 4XIGS 2J0VA 4RCYA 3W34A 2Z5FA 4DDWA 5SZJA 2GXSA 4QL3A 3R8CA 5KNBA 4TZ0A 1HYQA 3O47A 3C7KA 5FBQB 1IN8A 4CDGA 3D31A 2MMCA 3H1TA 2IUUA 1NBME 4C0SA 1KI2A 3MAAC 2WICA 3PFIA 1T8UA 1U90A 2AKYA 3L2OB 1S3GA 4CRWB 1OJLA 1OH7A 1KAOA 2CEAA 5B30A 3FB4A 3P4YA 1NMZA 5KTYA 4L9WA 4OK3A 3K0SA 4GOJA 4FMDB 3EAQA 1DS6A 2PLRA 3MGCA 4OK5A 4FMDF 1II8B 2AXPA 1XBTA 2GA8A 2QPOA 4NCIA 2ZS7A 2IS4A 1ZCBA 2O0HA 5K8UA 2JASA 1DTSA 2CE7A 2FZ4A 4DXAA 3AKCA 1XEFA 4XVRA 1E32A 1SXJD 2ZPTX 4MYUA 3TW8B 1PZNA 1W46A 3TQCA 4YONB 3QKSA 3SQXA 1UKVY 1ONBA 2P6NA 2GVDC 1X1SA 2Q0HA 2QE7D 5CM8B 4Z1MD 2Z6VA 1ZP6A 2C9YA 1I4TD 2ZREA 4A4DA 2R9VA 3QEOA 1KY3A 3MJRA 1ZYUA 2XTMA 2RB4A 4ACAA 1CR4A 5B57C 4TYWA 3GJ3A 3J81k 3VFDA 1WMSA 1HEIA 1N3BA 1KDTA 2A7QA 3PG5A 3QE0A 4PZZA 4NYJR 2IW3A 5DGXA 4PAQA 4BEBA 3IPXA 1GIAA 1KK1A 2A5FA 3OZXA 4EPWA 1TQ4A 4LJ9A 1HT1E 1S96A 2E9SA 3VU9A 6Q21A 1FW6A 3PV0A 1P73A 2WWIA 5KDDA 2OXCA 4ZKEA 4DLSA 5K8IA 3IQXA 1VG8A 3LRPA 3Q5EA 4QJ5A 1E2EA 1G7RA 1IBRA 4A1FA 1WDTA 4E09A 3NXSA 3CNOA 3A4NA 4TZ6A 4OK6A 5E3HA 1IJFA 4C3ZA 1D6JA 1SVOA 3FMIA 3QF4A 3LWNA 2BHRA 3PEUA 3R7WA 1CR0A 3IBGA 4PHTA 2ZVPX 3ZZUA 1WF3A 1W0JA 1OKKA 1G8GA 2TMKA 4DDVA 4JBWA 4ZDJA 1NP6A 2EFEB 2RGBA 1YZGA 2PX0A 4OHWA 5G3ZA 4WVFA 3EPHA 3WNDA 1NVWQ 4EFNA 2Z43A 4IEEA 3C5CA 2ERXA 4LYAA 1DPFA 4AURA 1BYIA 4HDOB 1KO7A 1EFHA 2V7QA 1OHHD 2H57A 4BECA 2V1UA 1KI6A 2IYXA 4WZBE 2Q6TA 2HYDA 2XSZA 5EXPA 4Q9IA 3CONA 2OFOA 5AUQA 5SZIA 3T1VA 5CIQA 4QBHA 2HLDA 2QY9A 2GZDA 2ZR7A 3AF0A 1K8RA 1P9WA 4Q7LA 1NKTA 1XB2A 2ODEA 4IDHA 1GRQA 2DY1A 3B78A 5EUQB 1OH6A 3TVDA 1AK2A 1N0VC 2CLSA 2CJWA 5C2JB 3BORA 4NONA 2PT5A 1MO4A 4L9SA 3GFTA 2XB2A 5TARA 4EDHA 4OQMA 2XZOA 1QHHB 3PUXA 4ESVA 3GEHA 4A8JA 1VCNA 2G88A 3UPUA 2WWXA 3IHLA 4YC7A 4OJQA 3ECCA 2R6AA 3DZDA 3FHTA 4Q02A 1YR8A 5G41A 2QMUA 4TMXA 2ZRLA 3THYA 4PO1A 2WOJA 4URYR 3BB4A 3ZS9A 2DYKA 3VNUA 4ACBA 2C9CA 2OM2A 1XDBA 2D74A 3NEJA 1SHZA 1PVOA 5BQ5A 2QQ0A 5CDFA 3IO3A 2VYFA 4FCWA 2EFCB 4QNMA 3VR2A 1E2LA 4FD2A 4Q7JB 4A36A 1CR1A 2JLSA 3FE2A 5BYJA 3LD9A 4ON9A 4HAYA 4Q48A 2Z83A 3N2IA 3WHLA 1CIPA 1MT0A 3EC1A 1HTWA 2IF0A 4KYIB 3IQWA 5FI1B 1UDXA 2YWHA 2R44A 1BIFA 4GNKA 4HLDA 3THWA 1AQUA 1XMVA 4KYUA 3I32A 1KDPA 1R0ZA 4H1VA 4HUQA 4LV5B 3NBZC 3PXGA 3EASA 2FFQA 3QPVA 2BCGY 1E69A 2BBWA 2AN9A 4E07A 1XU4A 3KUDA 4K46A 4IOMA 1XCGB 2QTVB 3OEED 1XFAA 2B7CA 2OE2A 3W6NA 3GFOA 2O8DA 3QG1A 4J0QA 2XX3A 2FF7A 2GJ8A 3ZVMA 3X2SA 1MKYA 1FX0B 3VKGA 3DMDA 4AI6A 4TL9A 2ZJYA 1JALA 4U5XA 1Y63A 1ZRHA 2EWVA 2FPMA 2VSFA 3C15C 4AYXA 4JJKA 2Q9BA 4ZDIA 4O3MA 2NIPA 3L43A 4MGZR 2YZ2A 2PJZA 3NH6A 3BBPA 3W6PA 1AS2A 3UKDA 3SJAA 2FV8A 1WXQA 1NN0A 2J7PD 4XWKA 3B13B 3GLHA 2XSZD 2XXAA 2QE7A 1T3HA 1US8A 2O0JA 3BH6A 3VR1A 3U4QB 5L3SB 1ZJ6A 2ZROA 4B33A 2AXNA 1ZMXA 5L3QB 2Y8EA 4LCBA 4NBSA 4PC3A 3OFNA 5EP1A 3T35A 2F9MA 4C0AC 4NTZA 3EPLA 1G7SA 3EIEA 1FP6A 4TL8A 2J0SA 3CNNA 1W2HA 1BS1A 1JECA 2J9RA 1UEJA 2IT1A 3UMRA 5IRCD 1N5KA 1JR3E 3BS4A 1QDEA 4XJXA 4C2UA 2ZYUX 1A2KC 1OYWA 2WJHA 3Q8XB 5CK5A 2D2EA 3RS2A 1ODFA 1SVIA 5C46F 4E03A 4K81B 4Q1EA 3UG6A 1XMIA 2V6JA 2GXAA 3QPUA 3BB1A 1QBKC 2EYQA 5KDOA 2RMKA 2EW1A 4XVUA 3GLFA 3SHWA 2BIFA 2NZJA 2V4ZA 3HU2A 2NPFA 2WM9B 2RGGA 3EA5A 3LLUA 5BYKA 2J0QA 2F1HA 3O8BA 1OKKD 3ZYCA 5EE3A 2RGCA 1NI3A 3VX4A 2PCJA 4LPKA 4R2IA 1NY5A 1U81A 3ZVRA 1LF5A 3REGA 1IJEA 4F7WA 1W1WA 3JZAA 1TNDA 3G5UA 2DHRA 2JGNA 2OILA 3IHWA 3GLIA 3IEVA 4B2IA 2DFTA 4JLNA 5CYOA 4JZKA 421PA 4LHWA 2FH5B 4GOXA 4JVSB 2F55A 5JLJA 2NPIA 1PUJA 1SZPA 3A8TA 1H8EA 2IK8A 4C2TA 4FW9A 2I4IA 4PQRA 4F4JA 1G6OA 4MYCA 2VP4A 2D3WA 3DDCA 3FTQA 1E1QA 2C96A 4LBZA 2G6BA 2NZ8A 3PVSA 2GK6A 4LC1A 1KSGA 4US0R 3U3MA 3GLIB 1GWNA 3C4JA 1B0UA 2HF9A 3GJ8A 4BZPA 3KTAB 3S1AA 2R2AA 1KIMA 4ITRC 4EFLA 3SQWA 1XPRA 4V0ME 4LBWA 1OSNA 1NG9A 3Q9LA 2WJIA 3IO5A 3IPYA 4Q1CA 4IOLA 621PA 4B6FA 1HH4A 4DKXA 4LHXA 2WWFA 3QBTA 4ASUD 4BRUA 4NH0A 5LD2C 4JKYA 4QHSA 4I81A 4QKQA 1OPXA 2IYRA 2ZSBA 1CKEA 1XCMA 1SXJA 1IN5A 5CLQA 4GT1A 3K53A 1ZUNB 4M9SA 3G82C 3DMNA 2CBZA 3K0AA 4NCNA 2QAJA 2D62A 1GVNB 4LDJA 1EFUA 3RNLA 3W3AA 4V02A 1II0A 3K0EA 1XD8A 1ANKA 2A78A 2ZE5A 5HCNA 3ZIAA 4K8OA 4G1UC 5KPJA 2N46A 3AF4A 1D8TA 1P9RA 3B7GA 1S0UA 4EPXA 1JQJC 2BMEA 3O8DA 3VNVA 2P6RA 1NSFA 1R0XA 4IDOA 2A5DA 1YVDA 1T0JB 4EJSA 4B73A 3A37A 1F2UB 1UBEA 4KSCA 4RD6A 3KFXA 1NBMD 4TSFA 5JHGB 2EFGA 4S2EA 3GCGA 4M1SA 3TVTA 4Z51A 4GZMA 1JEDA 3L82B 5GVSA 5CITA 2ZI3A 3KX2A 1AM4D 1US8B 4FXPA 2NO6A 1KDRA 3T12A 1E9EA 2XTNA 1H8ED 3SE0A 2FG5A 3MSXA 1VG0B 3ASYA 3MWJA 1G18A 4HEJA 1SKQA 4ARZB 1E9RA 3K0CC 1U9IA 4TLAA 4TQUS 1S8FA 4HAUA 5B58C 1T0HB 3ZH9B 4AG6A 3OF5A 3AGPA 4A2PA 4DUGD 3DZ8A 4QG7A 1E0AA 4QFMA 2PZGA 4MH0R 4I4LA 1EXMA 1L4UA 3GLFB 4WZAE 3K70D 4CEHA 1EFTA 2A2ZA 4MUAA 4Q4JB 1GL9B 2C77A 1W4CA 2ANCA 2WIAA 5FL7D 4BFTA 2PCLA 1S1MA 2HYIC 2WKQA 1Z0DA 1E1RA 1VCIA 3B9QA 3RRZA 2PBRA 3FMOB 3TMKA 3CRW1 1EX7A 2BEJA 4DIEA 1XRJA 1AZTA 3VU9B 1E2NA 4KXFB 1JB1A 4DIDA 2ZRFA 1WCV1 4IVQA 4E22A 3ADKA 5JBQA 4V0LA 3TGPA 1U0LA 3LBHA 4N0EA 4DCUA 1Q1EA 1X6VA 4O0MA 2ZRDA 5L3VA 4HAXA 4BFZA 2UZ3A 3H2YA 2XXAB 3CWZA 3ZS8A 3RRNA 4CGZA 3KQLA 1ZC3A 2RGXA 4F4IA 5JWRA 1XPUA 3CX8A 1IONA 4JLPA 2QENA 5AJXA 1IXRC 2RGNA 3BIFA 1AS0A 1UPTA 1U98A 2NMVA 2GVZC 1S4QA 3I1FA 3SJZA 1P2TA 4LZZA 4MKIA 4XH9B 1KY2A 4TTQA 1XTIA 5JJIA 4Q4HB 1NLFA 3W9YA 4HB0A 3F8TA 2JJ1D 2XJ4A 4DCTA 3L0PA 3IILA 5AJWA 3TJZA 3U61B 2MSCB 1YZLA 4M1TA 4ZCMA 1NJFA 2BM0A 2YOGA 4A15A 3AVWA 2XAUA 4GOKA 1R7RA 4RSGA 2BDTA 2WZQA 1NRJB 1UBCA 3VHLB 2IYYA 1W4BA 3BWDD 1SKYB 3K09C 3NH9A 5DI3B 2OXRA 5KDLA 3GEIA 4KFUA 1RIFA 4FIDA 4LJ8A 2ZXUA 1G19A 2W2XA 3CW2A 1XMJA 3NHAA 5F98A 2VQSA 2VHTA 2C2HA 3KDSE 1OIVA 3OFND 5G53C 2HCJB 2R6GA 5JSZB 1C1YA 3SFVA 4PQFA 1ZNYA 3AB3A 4YMUA 1XF9A 1NN1A 2NO9A 3C5HA 3UATA 1NN5A 1OIXA 4NYMQ 3HPQA 2FOLA 4IJMA 2J45A 2G3YA 3OIVA 4BEJA 3GJ0A 1KJWA 1N6OA 5J4HA 2A30A 4D2IA 2J7PA 1SGWA 4A6XA 4A0FA 2GEUA 3RSLA 2ANBA 1E6CA 3TBKA 1RFLA 3EG5A 2GZAA 3D7MA 4Z54A 4TMWA 3WYAA 5FFMA 2QGNA 4B43A 1E2HA 2IF2A 2QTHA 2WKPA 4N0DA 3T5GA 2YYZA 1ZAKA 3B60A 3VR6A 4EKDA 4DT1B 4LGMA 2IXGA 3CLVA 3GLGE 1UKZA 2YC2C 1BH2A 3EZ7A 1H65A 3KB2A 3GLGB 2QP3A 1N25A 1KK3A 2L0XA 2WWHA 1JAHA 1SXJB 4HLQB 5J47A 2HT1A 1ZD8A 2CLDX 2ZETA 4BGDA 5IHPA 4U02A 3SYNA 1H8HD 2QMOA 3JVUA 1N2CE 4MRPA 3QUSA 5CB6A 1LNZA 1O3YA 2YC4C 2ZS9A 4UNNA 2C5LA 3UMFA 1LW7A 1F6BA 1IQPA 1W47A 1UFQA 2EVWX 3CH4B 2JEOA 5JEDA 4CEIB 1LY1A 5D3MB 4L5BA 3BFXA 3U44B 3KTAA 4GMDA 4IVRA 4EPVA 4URUR 4G5RA 1J7KA 3Q5DA 3A1SA 3TIFA 3DM5A 1TF2A 2J46A 1MOZA 1QRAA 1RW4A 1YE8A 2P0EA 2XJ9A 4RFSB 4XOIA 1SVKA 1U99A 3GFPA 2ZRHA 5FBRB 2X2FA 2UKDA 4HI0E 2NGRA 3FFBA 3WRXC 1P2SA 1GFIA 3DPUA 4B35A 5JMTA 3ZD7A 1GDDA 1OE0A 2WPDA 1XZQA 4YXWA 5CM9C 1ZD9A 3BH0A 1F5NA 4PR0A 2GBLC 1TQDA 3U3JA 4US1R 3CX7A 1VG1A 1K5GA 2OBLA 4UJ3A 4PAMA 1XJCA 4U00A 2GXQA 4V0KA 2O8EA 3A1WA 3I72A 4Q1BA 3AVPA 2OBMA 1EFRD 3X1YA 3PR1A 2GF9A 3P20A 2DBYA 4OI0A 2W2VA 4URVR 1XTRA 1Z2CA 1II9A 5FUYA 5EP2A 3FFAA 3LW7A 1N6KA 2ZRNA 4A0RA 5DHFA 4US2R 1Z6TA 1HA3A 4M1MA 3H86A 4DBLC 1C4OA 2CLCX 4PHFA 3ZLJA 1SVMA 5FTKA 3R9WA 4KITB 2O5VA 4OHVA 1GKUB 1DEKA 1G3RA 1G6HA 4DSOA 1R10A 3CWQA 1VMAA 1SQ5A 2HCBA 1F3OA 2W83A 2VHUA 1Z0JA 1VCMA 1L7VC 3CR8A 4PANA 3BC1A 3SNHA 3Q7QA 3K0AB 2YOFA 3GJ4A 1RYFA 4LWZA 1Z2AA 3Q72A 4UQOA 2VF7A 2ZUCA 1NG1A 3NVAA 3UANA 1JXMA 4FCVA 1RRPA 4QRHA 1GAJA 5K8LA 2ZR0A 1Q44A 3C8UA 3CZPA 4WXPA 5EE9A 2ZJZA 4D82A 4UXJA 2WWGA 4NYJQ 4C0LA 1OF1A 1OV4A 3LO5A 5AUPB 3KQUA 1QG2A 4G5SA 1E9FA 5TMPA 1C9KA 4ZCLA 3LQQA 4B3CA 1Z07A 3HR8A 4GP7A 2FEOA 1U8ZA 2ZRJA 5HTKA 1R0YA 2IUSA 2GCOA 3PJRA 1FX0A 1U8YA 4DLZA 1N6IA 2B8TA 4P31A 5JWOA 3P26A 3CUEF 1XD2A 4KVGA 4L16A 4P4UA 4QGFA 2AK3A 2EU8A 5EXXA 2RHDA 4DSTA 2GEVA 3VQTA 4UXHA 4TL6A 3NWJA 5J4LA 2D4HA 3PUZA 3WNBA 2W6IA 2XB4A 4OHXA 1P3JA 4A6PA 3BXZA 4TN1A 1SXJC 2ZI5A 2G1KA 2ZUBA 5EZ5A 1RVDA 1KI3A 4QBIA 3QPWA 3MRSA 5H1YA 1R5BA 2PZFA 3ZQ6A 3U44A 3D6TB 2X19A 4JS0A 2FNAA 4NCKA 5KSPA 1KKLA 1OB5A 2VO1A 4Q4AB 4DZZA 1G4UR 2R6DA 1ZNZA 2FGJA 2XGJA 1Q3HA 5KU1A 4Z1MA 2GCOB 4ZI3A 5FTNA 2ZYTX 4B74A 1X3SA 1E9CA 1XZPA 4H1UA 4OHZA 5E95A 1A5TA 1NVVQ 3MJHA 3I61A 1KSFX 521PA 3RRYA 4KLNA 4P4TA 2WBLC 1T6NA 4C0HA 2QP4A 2FJUA 2G0NA 4TQAA 2A5GA 4TMKA 1PLJA 4IDQA 1ZM2A 1TF7A 1U0JA 3IUYA 5TV2A 3THYB 4M9ZA 4ILEA 1W0KD 2CCKA 2H8KA 2W58A 4JT2A 1QVRA 4JLAA 4TMVA 3MMPA 2CL6X 1ZD1A 2MSEB 3KJGA 4IRUB 1E99A 4GI7A 3K70C 5KUTA 5AJZA 1QHXA 3LNCA 2OLKA 4W9MC 3VKHA 4B3BA 1TQ6A 1COWA 2ZE7A 4LV6A 4JL8A 1JR6A 1Z3IX 4M21A 4IDPA 2DCUA 3AKDA 1JJVA 1GZSA 2ZE8A 2Q3MA 2ZU0C 3S1AB 2JJ2D 3X1WA 5FOXA 3U6KA 5LB4A 4EAQA 1GNQA 4NU0A 4UNPA 4IOJA 5DISB 2FSIA 2HEIA 3NBFA 5AK0A 3FOZA 1GP2A 4IFBA 1KO4A 2WMNB 2FSFA 2FGKA 5CB8A 3V4RA 3A4LA 4CT4B 3PUVA 5L3RA 1N5LA 1QHYA 4KU4A 4KV9A 4PZYA 1GM5A 3ADDA 4TYPA 2H92A 3QOFA 1OB2A 2OSBA 1E94E 1TAGA 2F1IA 2QPAA 3QKTA 3QXCA 3I3SR 4TWZA 3SJBA 2FDCA 3DEFA 1RE0A 4AY2A 2WIBA 2XITA 2WHXA 3WXMA 4A0GA 4WAUA 3UMSA 5JCPA 1Z28A 4V0MA 4ZIRA 2W0MA 1RC8A 4C0QC 1G7TA 4Q5IA 2GHIA 2ZEJA 1WGWA 3D8BA 2WAYA 3FMFA 2JCSA 3N70A 1R2QA 2V55B 4Q01A 2J3EA 2RGAA 2VP6A 1ZNWA 3ONWA 4D4KA 1W36B 3BH7A 2Z0MA 5AR1A 5HKKD 4NYMR 1G4AE 4RFSA 1NVXQ 3PUWA 4HB2A 2X8AA 4DSNA 2PX3A 2QSZA 4ZPXA 1FUKA 1G5PA 2REXB 3AP2A 4BLSA 3ND9A 4B2PA 4TLDA 4EQ6B 2OCBA 2QAGC 2QI9C 3P4XA 1W4RA 3DHWC 3IIKA 4FMCF 1W36C 2RHMA 2LKDA 2GTPA 1XEXA 2ZTSA 5D3MA 1EFRA 2VSOA 4GZLA 5FL3A 4R71A 1J90A 2IL1A 2LCFA 1FTSA 2ZSFA 2F9LA 4RKEA 4MGIR 4NE2A 1M74A 1VCOA 1CF4A 3V00A 5FOUA 4NCHA 2OG2A 5EP4A 2I3BA 2WWWA 3OEHD 5CYPA 5DYGA 4RZ2A 2OLJA 5JI2E 2QROA 4PC2A 4LJ6A 4C4PA 3ICQB 1QHIA 2QQEA 3FVQA 4F92B 3DM9B 4B3GA 1P7CA 2NQ2C 3U6BA 4XD7A 2OCAA 2XOKA 4QM7A 4HAZA 4DLXA 1YU9A 4C30A 1MABB 4DT1A 2QSYA 3CRRA 3B85A 4F4CA 3I5YA 1NMYA 1T91A 3I92A 5JS7A 4YDSA 2HJVA 1WE2A 3M0EA 1Q57A 4HB3A 1HE8B 1JR3A 4MITA 1DE0A 2OT3B 5FTMA 1JJ7A 1FFHA 3BFKA 1VKJA 5KYKA 3THXB 2VIIA 1U9IC 4D0GA 3SEAA 4Q18A 2KBEA 4QGAA 4CW7A 3L8ZA 4A9AA 2VRWA 4R98A 3AVXA 1KNXA 4D25A 5E7JA 4JIMA 1AA9A 1Q22A 3DKPA 4PXAA 3SHFA 1UBFA 4QHYA 3TH5A 1KSJA 4IHQA 3DOFA 4B44A 4W7SA 3G0HA 2PLFA 4LC0A 2RKOA 3W5IA 2EYUA 2VHJA 3LQRA 3NBXX 3BB3A 4Q19A 2RGDA 2XNDD 2N42A 3D3QA 4JT4A 1CBUA 4B34A 1Q20A 4DEYA 2CK3D 4D0NA 3C41J 1DBSA 2QGZA 4EFMA 4PSAA 4ASUA 5A5GA 4AKIA 3MWLA 4LOAA 4OKSA 3AVTA 3UWOA 2GBLA 1KI1A 1Z0FA 2JIZA 4P33A 4D80A 4DSUA 1HT2E 1ZW6A 2ZAOA 1I4LD 4JYBA 1W5SA 2R62A 3MD0A 3NKVA 5FTJA 1FL9A 4RZ3A 4TMZA 2BJWA 4B3DA 1F2UA 1EFCA 4RD0A 3LW8A 5KSZA 1XNJA 2OESA 3ZVLA 1GRRA 1I2DA 3FGNA 2JLZA 4GSYA 3HU3A 4RFVA 3LVQE 4PX9A 2ZJ5A 2PEYA 2ZITA 3Q7PA 5JZVA 3C14C 4MKGA 4KLZA 4LJ7A 1XJ0A 3OEEA 2ZQ5A 4RZUA 2VP2A 3U3RA 4F91B 1HV8A 1AGRA 4URZR 3OIYA 2IC5A 1L2TA 5AUOB 4G01B 2IS1A 4LHYA 3HWSA 1GNPA 1HQCA 1YHNA 2BVNA 4YDHB 1KYIA 2P67A 1ZM9A 2I1QA 2CL7X 2F1JA 3B8HA 3SOPA 1KGDA 3LXRA 2JLQA 1P62B 4A8JB 1YR7A 3EPKA 2CL0X 1D2NA 1UEIA 3WMEA 1ESNA 1NY6A 1G16A 1QHHA 2FE4A 4A2QA 4B76A 4M22A 1P60A 2R65A 2H17A 4KBGA 1AN0A 3EA0A 3CF6R 2IHYA 1X86B 5EE1A 5DSZA 3AQ4A 3TSWA 4AYWA 3DVLA 2GWHA 1U0HC 2KI5A 1R6BX 3M1IA 4KVAA 2P3SA 4L4UA 5SZKB 2IS6A 2REOA 3L0IB 2Q21A 3MWKA 4MYTA 1GTVA 3KUCA 3CRMA 4WA7A 5LPNA 3QSYA 3H84A 4G5GA 3TQFA 2GK7A 3MUFA 3AVUA 2GRJA 5EJEA 3K0FA 2OZEA 2P6UA 3QENA 4HB4A 4QGHA 4X8LA 1Q21A 4GDFA 4MRSA 1AKEA 1R5OA 4V03A 3BD9A 2O8EB 1BMFA 2GJSA 4I1SA 1XTSA 4YLGA 1EWQA 1W7AA 2YVUA 2GCNA 5JRJA 2KWIA 3K9LA 3C16C 4DLVA 1KI9A 3A6PC 4M53A 1VHTA 4HZIA 3LVRE 3RSOA 1E0KA 3JZMA 4BLOA 1UJ2A 2IEYA 2A9KA 2ZRGA 3OIWA 4X8HA 3SN6A 3QJYA 1YZUA 4EUNA 4G5QA 4KJZA 1SKYE 4OYHA 4HLCA 2QAGB 3T1QA 1E2IA 1CS4C 1DAGA 4HUTA 4PHHA 2GAAA 1F60A 4LSGA 2V3CC 2JA1A 4Q1AA 2CE2X 2NG1A 2IEZA 3KJIA 4QXAA 4CT5A 4ZDKA 4LYFA 5J40A 4LBYA 3ZJYA 1RRFA 1JQLB 1IM2A 2IYTA 3MFYA 3P32A 4CEIA 2GEDA 4X8OA 3LH5A 3A1UA 1G9XA 4FMCB 2NO0A 1YZKA 3PITA 2LWIA 3Q85A 5BN4A 4DLWA 1G64A 3EZ6A 2ZU6A 5L3QA 3ZQJA 2YOHA 3OE7D 2ZRKA 4D26A 2QUZA 5CLLA 5IT5A 2ASEA 2WMOB 2XNDA 3I5XA 1BYUA 3CPEA 5E7IA 1CRQA 1R5NA 1G291 3CF2A 1N5IA 4CVNA 3X1XA 2YINC 4OQNA 4ERNA 4LX0A 821PA 4MGYR 1G20E 3CO5A 4LHVA 3QXJA 2UVQA 4RKFA 3K09A 5DNYB 4KODA 1G3MA 3BERA 5J4YA 2ECKA 1SXJE 1Z6AA 2X2EA 2J41A 1E0JA 1KO1A 1RPZA 3CNLA 4GMXA 2NOAA 2RGNC 1WBBA 2KSQA 4Q9KA 2J0UB 4U7DA 2XNSA 4JLKA 4M8NE 4LK2A 4PO9A 5JJKA 3RLFA 4BUJA 4AIIA 3CM0A 1JBKA 4ARZA 2XZPA 4XD7D 4RZXA 1YZNA 3VAAA 2FSGA 1TX4B 3ADCA 3TSZA 2ZRAA 1DO0A 1EESA 2J59A 4PFSA 5L8VA 3OEHA 4KI0A 4JLVA 4PTLA 4A8JC 2IUTA 3ZIAD 4ABYA 1DAHA 4HAWA 3M6AA 3SYKA 2BKUA 4JBYA 4JSTA 4TLEA 2AR7A 1OHHA 1D9XA 4EJSB 3WNCA 4LPSA 3HDTA 1KHTA 4PC1A 1EG7A 1M7HA 2G0TA 5CDFE 3CPHA 3WMFA 2ERYA 3QG5A 4BLTA 2P65A 3VX3A 1JNYA 1IN4A 3W8NA 4BWYA 4M0LA 3QF7A 5HZKA 2J1LA 3AVOA 5KPDA 5CJ2A 4QGGA 5HCIA 5KSOA 1NSTA 3AF2A 4GL2A 4BLRA 1ZIPA 2DWPA 2ZI7A 4OI4A 3LX8A 3LX5A 3P27A 2IYQA 1XWIA 4HDQB 5FL7A 2OUKA 2JLVA 3H4MA 2B6HA 1JPNA 2FFBA 2HJGA 4UKDA 2F3RA 1WRBA 5FPYA 4BASA 4BPBA 2EWWA 3QNUA 2JLXA 4EJSC 5H8WA 4PPGA 1UKEA 3RS7A 4UNSA 1G5TA 4M1YA 1R8QA 2W6JD 1UBGA 5K8TA 4TL7A 3T1TA 1KK0A 2BOVA 1P2UA 1MO3A 2XOKD 1L4YA 1YZQA 2BKEA 3FYHA 3TSOA 4BQSA 5JJLA 4O25A 1M7GA 4NCJA 1OFIA 2BV3A 2WWYA 1IOZA 3B82A 2IXFA 4HLUC 1KJZA 4NMMA 2ZI4A 3PEWA 1A7JA 1XJQA 5EE5B 2AX4A 1G5RA 5UKDA 2A3RA 2GJ9A 3I8SA 4HZUB 1LV7A 2YNMA 3PUYA 4AKEA 3U5ZB 3SR0A 2WOOA 2WSSA 5TXGA 1TUEA 3KXIA 2W00A 2IX3A 3R20A 4NYIR 2G1JA 3EXAA 5HZHA 3ADBA 1COWD 3F3YA 2Q3HA 4W5JA 2OO7A 3CR7A 2BM1A 2ZJ8A 4BZXA 4CEHB 2GJKA 4DDTA 3TE6A 1ZCAA 1WB9A 2MSDB 4LJYA 1G17A 4IVPA 2HDNB 3RVBA 4TTRA 2FPLA 5FBLB 1PV4A 3FHOA 3KXLA 5HE9A 1II8A 1MRSA 3X1DA 4JBXA 4XSHA 1JAIA 5BN5A 2CHQA 4EPTA 4JL6A 4OHYA 1E1RD 2QM8A 3LBIA 2A5JA 1YR6A 3AUXA 3KB1A 2Q3FA 3O8CA 4QNRA 1CXZA 2IYUA 2F6RA 4HUQB 2LKCA 1Q0UA 5AJYA 2QU8A 4AWXA 1Z0IA 3FMPB 5LDDC 5JS8A 1K6MA 2HXSA 5AWFC 1KNQA 2CNWD 2VP0A 4ZDWA 2OFXA 5IK2A 1D5CA 2E1RA 4QC2A 1Z63A 1N6RA 1IY2A 1E2FA 1HE1C 1M6NA 1WP9A 1Z5ZA 4EPRA 5FI0B 2WJGA 2IYZA 4XWAA 3THOA 2QRNA 1FNNA 3AEZA 4WIAA 2PZEA 2ZSDA 3DOEA 1JXOA 2BMFA 1D9ZA 2DPXA 1E1QD 2EFDB 4BE7B 1VG9B 3HR7A 5L3SA 3EPJA 1A4RA 3U4QA 1Q1ZA 1XD9A 2IYWA 3E5HA 2PH1A 2OHFA 2GCPA 4G0NA 3U2QA 2AK2A 3BRWD 3SU8A 1DO2A 3DO6A 2JDIA 3KJHA 1FMLA 4DJTA 4NL4H 2FMXA 4QM6A 2W6JA 1G8YA 2FSHA 5DO9A 2WJYA 2E87A 3ZZ0A 1OW3B 3EWSA 1T3SA 3A1VA 4GRAA 5FOWA 2VPPA 1NVUQ 4UXIA 1YR9A 3CF0A 4PQYA 3QEJA 2AFHE 2HV8A 4EIWA 1YJ5A 3LXXA 4Q9JA 2V6IA 1Z06A 4H9GA 3FKSD 2GZHA 5DIFA 3CRQA 1VPLA 2ZJAA 1NN3A 1N6NA 4A0HA 2O8DB 8OHMA 4OI2A 2PJRA 4DVGA 1DELA 4I1OA 5D3QA 2CJWB 1ZBDA 3UXMA 2CHVA 2VBCA 1E96A 1A82A 1GITA 1J99A 4N1AA 1GSIA 1L8QA 4DWJA 2XEXA 3KKPA 4QJ4A 2B8WA 4WXRA 5FUVA 1AS3A 1M34E 3N5CA 3ZDQA 1PUIA 2ZIAA 4A2WA 1T5IA 1V5WA 2JLUA 1QHGA 2ZS8A 3SI7A 3WHKA 3U60B 1GKIA 3N2EA 4HATA 4JL5A 1DAKA 4Q00A 4OL0A 5F9HA 5FOSA 2GKSA 4Q66C 2OAQ1 2GILA 1E9SA 4HZUA 2BBTA 2W6ID 2BCJQ 1RZ3A 2VF8A 1G21E 5FBWB 1G3UA 3CKLA 4BFWA 2Z4RA 2PMDA 2SHKA 3B1ZA 3IEUA 3QXXA 4DLUA 5DI9A 1A2BA 4Y0AA 1KI4A 1QG4A 3V4FA 1E79D 4BLQA 1TEVA 5KHOC 1T9HA 2CCGA 3RS5A 4FCTA 4PO8A 1CEEA 1LS1A 1BKDR 1XEXB 1Z6XA 3AKYA 3E2IA 3R7WB 1E9AA 3EX7C 1Z47A 4PPNA 5IDVA 3ND8A
chains in the Genus database with same CATH superfamily
3T7IA 2XA9A 2VSXA 2W0SA 4EZEA 3R8FA 3ADOA 3KXKA 1P6UA 1XEWY 3D3NA 4A73A 1XDDA 1R12A 1YJQA 4HSGA 4YFVA 5LM3A 3RRMA 1C1XA 1ZC4A 1ZUWA 2P9BA 2HD4A 2QRZA 2HHAA 2FVYA 4MW2A 2PVPA 2G0AA 1C4XA 1F8GA 4PJJA 1NLYA 3R9IA 3ND5A 4I1VA 4Q21A 4BUCA 4OQEA 2UUOA 2ZJFA 1RKVA 4QDLA 1WASA 2X0FA 2A7XA 1RPAA 3VAZA 3SMVA 3QXSA 1P1HA 1QH1B 3HJBA 4QECA 3RYCB 3G50A 3VAYA 1LFDB 3U7QA 1E8DA 1WBJB 2XHZA 5FNVF 5KTKA 4LZJA 4M7OA 3R6WA 1XQ1A 4HSEA 3O90A 4ARUA 4HFFB 4FT2A 1AGXA 3SBXA 2XW6A 3ZK8A 4ZCSA 1ZU4A 1QGED 2R8RA 5AK5A 3UIEA 3WIUA 1EE9A 5E6RA 4O3FA 5CXSA 3CPJB 1L4GA 4Y6SA 3DTNA 1CUAA 2QORA 1JG1A 1G55A 2C7BA 4G9EA 5CDSA 4EVQA 4X45A 3K1IA 3O2JA 2YJGA 3EHMA 2NO1A 3CBQA 3T3OA 2AMJA 1EH5A 2PS3A 2G5PA 3WK8A 4ETMA 4RHYA 3KJZA 2BH2A 4LDQA 1UPXA 4HRAA 3UUEA 3MIZA 1CRZA 4DLXA 5L9AA 2AGVA 1J8QA 1T0BA 4DA9A 2ZCVA 5EIBD 5AVTA 3E0XA 3EUAA 1D1PA 4TLBA 5I7AA 2POQX 1YOBA 4RY0A 1L5LA 3BGWA 5D51S 1U8XX 4O1HA 2HTEA 4D4JA 3U9MA 1MQAA 3OT1B 1ECBA 2C7RA 4EKWA 1KAGA 2WB4A 2AVNA 2YIJA 3AESA 2WU4A 3KKKA 1Y9AA 4B46A 2WHPB 4OFWA 2I76A 1O87A 3G2OA 4FB5A 3ANYB 3UGOA 2XB6A 5TMDA 1ZQ9A 4LZAA 5LUAA 2VCHA 4RPCA 2NADA 3H5AA 1DXOA 1HEYA 3PCXA 4W5HA 2H1IA 5ALWA 4ZAFA 1ODTC 4K9NA 4W6ZA 1NUSA 2F3PA 5DM70 2X1VA 2OHVA 1WAMA 1U2GC 2QL9A 3WGYA 2HLDD 2B4AA 4O7GA 4O4LB 4HE8D 3EFBA 4QT0A 3ZCPA 4DYVA 5M2QA 2F3SA 4DCCA 2HSBA 1KDYA 4XWWA 1N5RA 1D5WA 3Q9UA 4MMXB 4DDKA 1TWHA 3MERA 3WLTA 1E79A 4R7ZA 4JLJA 3TOMA 3PIRA 1ZYRF 1R6VA 4P5EA 4C0JA 2CCJA 3TOZA 1I10A 3CH5A 5C9ZA 2NT3A 1FRVA 3TKLA 2HGSA 4NP6A 1OLUA 3INNA 2W37A 4GSKA 2V54A 4BFYA 3O4GA 5JWHA 3RFVA 3LNTA 3CIOA 1Y3AA 2A9JA 5T64A 3ZHTA 5BXQC 1K7FB 1UXHA 1Z4OA 2B3DA 4W6QA 3VUEA 3D2LA 1TD1A 3PVZA 4KSYA 3TVYA 4IDFA 1GZDA 2EBHX 1IN6A 5C5IA 3WHIA 3FUUA 1N0UA 2EJBA 4F3RA 1S8OA 4FB4A 1V96A 3H7IA 2IM8A 1M8JA 2WYOA 3O8NA 3RV4A 1JHQA 3GLIE 4GQBA 5EZ6B 1NVTA 1SBNE 1OXTA 2AN1A 2VDMB 2CFTA 3L7JA 5ALVA 4TTJA 5C4MA 1LSUA 3SG0A 4RD1A 3EGXB 4WINA 2TMYA 1D1BA 2IPNA 2VHWA 5F28E 3DAYA 4F93B 1W36D 4O4IB 4WNCA 1Z6YA 4MCIA 1JAFA 1E2PA 1U0FA 1XJWA 4OP1A 4A8TA 2G5TA 5BUOA 1OYYA 1I3CA 4KYVA 3OPYI 4YP6A 6PFKA 5J9FA 1UMDA 1U5BA 4LY6A 3IEKA 4TLMB 2LSEA 5K3AA 2DR3A 1QV9A 3D4BA 4PVCA 4XTCS 5L0DA 1UJNA 1QKRA 1Z82A 3DFIA 1XDGA 4BFSA 5CG2A 2IY8A 4GX0A 1P4RA 5LJIA 2CBXA 2I6SA 2JDID 1OLOA 4QI2A 2QZPA 1Q19A 2QBYA 3FI9A 1AE1A 3B1YA 1KEVA 3ODPA 2ZAYA 4JX8A 1SA0A 2V1XA 1E20A 5F78A 4CF4A 5DM60 2ZM6B 3L34A 2NQ8A 5IAAA 1FQJA 1FMFA 3RVSA 1Z6GA 2DR0A 5F3WB 3FUWA 5D84A 5DN6A 3W5AA 4D46A 3I8XA 1ULAA 3P9QA 3U3DA 4EA9A 3UNXA 4GLLA 4RAQA 2XVMA 2E4VA 5B3SC 3N8GA 4ZTUB 1H0HA 1UXOA 1QPGA 2G09A 2CNWA 2ZPUA 3LZDA 2ONZA 5E6RB 1PWYE 4IJQA 5FUQA 4WLOA 4D8TA 2R6CA 1DV2A 3CZQA 4S0ZA 4WBSA 1MUUA 3MB8A 3V8BA 4CMJA 3OT5A 5F33A 1AH2A 4QYWA 3DBOB 3GRKA 4TYQA 4HY3A 1ZICA 2PN1A 2EKBA 2JVIA 3DVRX 2HPZA 3FI0A 1KMQA 2C99A 1A7AA 3OESA 4MRNA 4ER3A 2ZZNA 1OT5A 1Z0AA 2XCQA 1CQWA 2WJVA 3NEPX 5IVHA 3OKPA 1QH8B 1QVAA 5ENVA 5F9FA 3D81A 2OJQA 4I3MA 3DNMA 5HV9A 3QX3A 3UK7A 3CGWA 3KKNA 1BEUB 1PUXA 2EIHA 3QU5A 1GUFA 3TUJC 5FOTA 3RDPA 4LKRA 2D1FA 1Y3BE 2R86A 3PZRA 3ZN2A 4LE1A 2FSPA 4ZO8A 3C5WP 3JQBC 3N75A 1OLUB 3H4IA 4QFCA 3TCKA 3SC3A 2ATIA 3AG1C 3M4XA 4YL3A 1HG0A 1GL7A 2V8BA 3CNBA 1BOOA 4IFEA 5G40A 1I3KA 4OQFA 3QXHA 3I9KA 2HBYA 1ABEA 3M8KA 4IH4A 1I14A 4NZYA 3OE4A 2EPKX 2FRXA 2BE5F 5B1BC 4IQGA 1YZTA 1ULTA 1KYYA 2IA5A 4PNZA 2H4YA 2H63A 2VYQA 1TQ2A 1Y3HA 4RTOA 4UTVA 5F2NA 1H2YA 2Z5GA 4L85A 4NMXB 1E83A 5JMOA 3P5SA 1M8KA 1QIFA 3DOHA 3KSMA 3Q7LA 3T7RA 3QLJA 4YRAA 5HRCA 2I2XB 2LK4A 1PL7A 5JNRA 4RIGA 4G3XA 4P2GA 1XMSA 1PW7A 4XTRA 1I33A 1LDMA 3X1KA 4MS4A 3ZI7A 5ISMA 1SVWA 2DBRA 4HX5A 3HUDA 5TF4A 4CQMB 5EJ9A 1G8HA 2B2NA 2I80A 3IB3A 4N5NA 1A8PA 4QYSA 2WVJA 3FPGA 1TQ8A 1UZNA 4MDFA 3VO8A 3ESXA 2PEZA 4BCCA 4QFDA 4DUYB 2BKAA 1Q3TA 3RHFA 2XQIA 3ETEA 2CFSA 2AUTA 3WLHA 4WJLA 3EC2A 1YDIA 4EBFA 4AZSA 4GLJA 4MJLA 4JXKA 1LB1B 3D6NB 3FBGA 5C8YA 1NIJA 4GM0A 4LCEA 4V1CI 3PC6A 1NTOA 4X6LA 3ZEIA 2X5JO 3NW9A 3HP1A 4I1UA 3AUSA 2O8FB 3ER8A 3VISA 6ABPA 2WWTA 3LZCA 1XTJA 1LM3B 2ZJ1A 4I8IA 3EDRA 3RABA 2UZ0A 2GM9A 3ZXYA 2HNAA 3GRVA 5KWJA 4HVTA 4UUBA 5TVKA 2BMDA 1K8QA 2GD0A 1QIKA 3H1BA 1AHIA 1GG2A 2VJDA 2QZ9A 4HAVA 4KE7A 4Q3LA 4E7PA 2F8SA 3K7DA 2HBQA 1BZYA 3KM0A 1KZGB 2JLRA 4EB6B 1RRGA 1S3SA 1JUDA 1LDEA 2GD2A 3HUFA 2UYHA 4FGKA 2JLWA 2QN6A 4IYJA 2HHCA 4CCYA 5ILOA 3P94A 4BNUA 5AI0A 4C43A 4JIOA 3GH1A 3K9NA 1D8AA 3LXUX 3HFSA 4FR5A 3INYA 4JGGA 4OQLA 1K0UA 3WYDA 3Q40A 2FPIB 3S70A 1ZH6A 1ELOA 4U2KA 4BLPA 4L07A 4PZPA 2VYVD 1GTMA 4K9MA 3RS9A 3ZE0B 5TNXA 5EJ5A 3T5DA 3K1AA 2H4FA 4Z7QB 3UAVA 3CLRD 3AV0B 2QV7A 3F7OA 4IGEA 3KWLA 4F1WA 4RWEA 1EDOA 2D5CA 2OCXA 2W9YA 2QLJA 1NZFA 1YVEI 3NHMA 5TB5A 3DDUA 2Q29A 3TNLA 3UJ6A 3LQFA 1DC4A 4GKAA 2VH5R 2Q1YA 3QRWA 4IEIA 3QLEA 5CM2Z 2ETSA 3ZU2A 2QVBA 3D6UA 5HDBB 4C76A 1SXGA 3NBYC 1ZWKA 2C20A 4DG8A 2R7NA 4URXR 1I0ZA 1KDOA 5D1NA 3X44A 1N2GA 5ED4A 3A2NA 1FCJA 2FN4A 4RVUA 4CEJA 1J8YF 4B6EA 4Q47A 2XT6A 1BVUA 3ENVA 3R0VA 4RJIA 5JZ9A 1OPRA 4EMUA 2JJ2A 2CVFA 1Y8RB 1LEHA 1MIHA 3T61A 5ESXA 1IEWA 4K3VA 1X8JA 4GFDA 4LZWA 3VNAA 3QXGA 3BXFA 4FYXA 1YRYE 1A9XB 1J39A 1MP0A 2UYQA 3HJNA 3L6BA 2X41A 3MTIA 2WW8A 2I66A 2IHBA 2F8TA 4GP9A 1HKHA 2QN8A 3RIPA 3K92A 3QX9A 2GBFA 2HDOA 4DTIA 4X65B 5EE0A 4B75A 4YNBA 1EP2B 2B4TO 4MUYA 4Z7OB 1PR0A 4Y1RA 4ZIRB 2D0PB 1N7GA 4MYDA 3VH2A 4CMBA 1MV5A 3UVEA 4YRCA 2H59A 1BGXT 5B1DA 2FETA 3H9CA 3JAKB 4OXYA 3SYRA 3UTDA 4A3SA 2Q8PA 4LI3X 3W2GA 1UBTS 3EOZA 3LLCA 3T4XA 2K87A 4IGGA 1PZEA 1KJ8A 1QH9A 1PV2A 2FZLA 2A67A 3BJIC 4KQ2A 4CNBA 4D57A 5D01A 3QY0A 1T2NA 1L7EA 3TXXA 2BSXA 1UK8A 1XTQA 3M89A 4YRNA 4KWIA 4D9CA 4DOZA 5KYWB 1JJBA 3RC3A 4FZJA 4XQ0A 4M0MA 3FPSA 4RNDB 2H0AA 3A4TA 1ODLA 4A27A 4RXTA 1X77A 4FFMA 1N6LA 4O33A 2Q41A 5K51A 4FX5A 1VXRA 2ZB7A 4J75A 4YMIA 2MMGA 5EQFA 4EITA 2EQ5A 2VTKA 2I5PO 4EGQA 3COVA 1L3CA 2WV9A 4BE4A 4JU8A 1AHPA 3FTFA 3ZG1A 1ZUHA 3LT5A 1RKUA 3B1FA 2Y93A 4TTPA 5CFNA 4TLCA 4X8MA 5FUXA 1ZITA 3QJ5A 5CVCA 4JB8A 4WASA 5K0SA 2R60A 1Z23A 3B3FA 3PFNA 5DCWA 5FR1A 1XEAA 3FXAA 5IP5A 2Z6QA 2OAP1 3MXTA 1OGJA 3OQ6A 1LV8A 4KOEC 3RBXA 3DBVO 4LVOA 2EKZA 2OECA 1JHUA 5SY6A 5GJBA 3VYTB 4NR0A 2JATA 5TQVA 4AIRA 3ZCUA 2WTEA 3U48A 3W8RA 4KR2A 4PN3A 2QB5A 5JI3E 1AK9A 1I2AA 3AGQA 3HVJA 3M81A 3RU2A 1UDRA 4C22A 5K05A 3KDAA 3QLVC 1E98A 3AR5A 4NHOA 4W99A 1YDEA 5H70A 1U11A 4TVOA 5ALZA 1KYXA 1EQ1A 2ZRPA 4K86A 4PC6A 4WBNF 1K3TA 1TADA 1KMHB 2XNKA 3SNKA 4L0CA 1NBAA 4M4SA 4E08A 3B3AA 5KB3A 3GGOA 5AI8A 1K05A 2IXBA 1I7LA 3AP1A 3E3MA 4G36A 5J5CA 4X0EA 3PEFA 4YRPA 3TTWA 4ECEA 5ITVA 1J0EA 1FQOA 3WGJA 4CDRA 5JRZA 4C4RA 2PMFA 1QB7A 2AOTA 2J09A 3IDZA 1T3LA 1K7XB 4ER5A 3HSYA 1ID8A 2F8LA 3VR4D 4ETNA 3AM3A 2FSVC 2D1RA 3K0FB 2Q5JA 2YJTD 3QX8A 3HCOA 2GX6A 4Q4LA 5ERXA 5IJWA 5I47A 1CLUA 3MCTA 1PTJC 4HBGA 3N7UA 3I6YA 5A62A 3WGKA 5D92A 1DADA 5GOZA 2XZLA 2VJAA 5HXAA 3WOVA 1EGHA 1K97A 2V3VA 4HFMA 5EIFA 3INGA 2PY6A 2YFYA 1WMAA 4XEKA 3VR4H 4CMKA 1FFDA 3O95A 1IQRA 2Q9AA 4FGWA 5LQNA 2ZAMA 4AAYA 2VJBA 5LD2B 1UBJS 4P4SB 1RXQA 1MC5A 4BKRA 1NW7A 3AERB 4R81A 4D0LB 4WBXC 1D2MA 1XGKA 2CVHA 5HP4A 1XXHE 1WBDA 1IY1A 2G7ZA 3B12A 1X1DA 5EQJB 2VEDA 3FHCB 1JR8A 2AQIA 3N8HA 2IH5A 2PLAA 4EA8A 3VV2A 4F3CA 1R9NA 4YK5A 4HRVA 4MKFA 4RL4A 5DKFA 5EJGA 2AKAB 3COSA 4HDCA 1RHRA 3DOJA 4V0NA 3MHTA 1A8IA 4ULVA 5ELXA 4LJAA 2OQRA 2ODNA 1EXWA 1RJWA 1WP4A 2BSAA 2M98A 1ECPA 4H31A 2L7AA 2JIZD 3TD7A 3GJRA 1LS6A 3FNHA 1E85A 1SB9A 3E9MA 1NONA 4Q37A 4ZYVA 4GD3Q 1U0RA 4Q3AA 4KR9A 2YTZA 1AGYA 2GERA 1VRVA 4I99A 5A4JA 1U3UA 1L7DA 2PGNA 1Z22A 3HLZA 3DE8A 5ADWA 5KJCA 3T5PA 4Y6OA 1VI2A 2OVBA 1WQ3A 2H7OA 4IDAA 4JLBA 4QXRA 1WXGA 1RXUA 2JNWA 4TXHA 5BMOA 5JNVA 4G0UA 3DBRA 1YRHA 3ENNA 1JJIA 2R5FA 4A92A 1EVEA 3NTUA 1PV1A 4F2HA 1HWYA 1N0WA 5IABA 4PZLA 4L7VA 3GDOA 4JVLA 4D3YA 5AW5A 3S0XA 4M2LA 2Z4SA 1X8KA 4B71A 3D2BA 1YB5A 3PFFA 1TKBA 1S2MA 1USKA 3BDVA 4Q9HA 2HHLA 1X42A 1PW5A 4I6GA 4DCMA 2FPPA 1ZS9A 2IZZA 5JSZA 3LG2A 1NXWA 2DWOA 3GPIA 4JEMA 4E0BA 4HG2A 1K3FA 1N4AA 5K03A 4CV0A 5H81A 1SEVA 4CCYB 3E6AA 1K2VN 3AHIA 3GA5A 1YL6A 2DFNA 3MTQA 4KGXA 4NJEB 4KX5A 1R8JA 3D6JA 1UG7A 4PEVA 1NP7A 1N2JA 5COAA 3RHZA 2V0GA 1MA3A 4E33A 4BDSA 2ZRIA 1O5OA 2BGWA 1DNPA 2RSLA 1DJMA 3FPBA 2OCYC 3EWAA 3RFFA 3S5UA 5IFLA 4H27A 4X44A 1UT6A 2C00A 1LKXA 3PZBA 3K4HA 2O52A 3OQBA 4M9XA 5GVRA 3TS1A 1VPDA 4AUNA 5M5BA 1TM7E 4E3WA 4JURI 4YL1A 2HJ3A 1UAYA 2B0JA 3VNSA 4ESOA 2ZBDA 1SG9A 2FQYA 1OWNA 3QLUA 4JJAA 5MDHA 3DW3X 1STOA 3KT6A 5FUWA 3B5JA 2XWPA 5L7YA 2VKQA 4C0KA 4D97A 5C8YF 1Z4LA 3GD7A 1BC5A 2J3MA 3GT4A 4ZT3A 4PW0A 4IMIB 4MCAA 3R7FA 2RARA 3DJFA 4K6GA 5EUBA 2WG1A 3VKUA 5C51B 4XLPF 4M63A 4JLUA 1M2GA 2RAPA 3ZK7A 4HNTA 2VDKB 4KQMA 3D2AA 3IRVA 2C94A 4PFQA 4IG4A 4M1KA 3L0BA 3IHUA 3P2KA 3P9ZA 1Z4MA 3MJDA 4RM2A 5KQRA 4E5NA 2QD1A 4JODA 4LXGA 4PCUA 3LUFA 1ZUIA 1DOVA 3A6DA 1XVVA 4JP1A 3OIUA 2ORIA 1BDJA 2VATA 3B2EA 4MQUA 4QATA 1FF9A 5A2QA 1N9KA 3LY5A 1YDWA 2PH5A 2YIDA 3PEVA 4AN1A 2NTJA 2ONYA 5CVVA 5EJ6A 1DKUA 1EZ1A 2EJVA 4G23A 4H17A 1VYTA 1W49A 4CG0A 5FBVB 4KOAA 3PSHA 2Q5CA 2XMDA 3PUHA 3A7EA 4YQZA 2F3TA 2HRCA 5BWCA 3EODA 1XP8A 3PL5A 4EL0A 4IPTA 2KW5A 1HRDA 5TMBA 1BWQA 1VIYA 2I4LA 2O7NA 2Q8NA 2QZ4A 3R3HA 4JVOA 1IZ8A 3LKDA 5CXUA 3KZKA 1MO6A 2ZUDA 3OP4A 3FOPA 3R3WA 4F7DA 1WZCA 1YS9A 3JWPA 3FVRA 3MINB 1NF8A 3CNQS 2HIAA 2X76A 2XDQB 1M1ZA 1OA1A 3EWIA 3MG9A 4K6OA 3AEKA 1V9LA 3MCAA 2C82A 1ORVA 1YZVA 5FH9A 2OO5A 1RLJA 1X7XB 4QZVA 4TYNA 2C2ZA 2HA2A 2PMKA 3ZW7A 3IUPA 3IXQA 4JHXA 4I5EA 1OR8A 1E4VA 5L3ZA 2HL6A 1OXKB 1BO6A 1S1CA 2H7VA 3JSEO 3PL1A 4HLUA 3M6UA 5JFOA 1NVVR 4HF7A 3ORYA 3IUEA 4E14A 6ADHA 4LEIA 4Z53A 1Z36A 2F1KA 3GO4A 3HDGA 4QJBA 3RKUA 1GN9A 1M2VA 2OOCA 5IT9A 1KJJA 1LPAB 2VVTA 4NU5A 2X8JA 3EUEA 5FWXA 4O2RA 1P2FA 2JJMA 4OF4A 1IPEA 4MA0A 2RI6A 5TLSA 1Y4DE 4D0RA 3IERA 3L6EA 2PYIA 1R9MA 1JFTA 1QGYA 3M4BA 4R1QA 4BMDA 1O5HA 3A1CA 3Q15C 4QYIA 2JGRA 5AM1A 1Y0BA 4F5ZA 4K7BA 5EP3A 2LIPA 5I7OA 1R4TA 5GPGB 1IQ0A 3U7FB 3EVTA 1J0AA 2GBPA 5LA6A 1KEZA 3ZWBA 1H7IA 1PDOA 3GUHA 1SKAA 3JQGA 1K27A 4JWKA 5CTJA 3ABRB 2C2OA 1CUBA 2XWQA 4RGYA 3C3AA 4OGLA 3UWKA 1QZXA 1B4DA 3RS3A 3GDHA 3CCFA 4OHFA 3N0TA 1LXCA 3MWYW 5ARCA 1WQ1R 3KQHA 3K6SB 1RQPA 2OL4A 1TJ3A 2DBQA 5D87A 4XWTA 5K6RA 4Y2JA 721PA 5GINE 1MJHA 4J0IA 3HWWA 4FFOA 5K6TA 1T1EA 5J58A 3MNFA 3H1AA 3PA8A 1ZU5A 1P0IA 2I8AA 2VJCA 4F1KA 3ZDEA 2VQDA 3CEHA 3H8VA 5EJMA 3UOWA 4CLOB 4DR4B 4YJFB 1KAHA 3HEMA 4DUGA 4F3YA 1IY9A 3KOYA 5DTEA 3HBMA 4F5YA 1JFLA 2G63A 1V7QA 1MABA 3QW2A 4KIGA 4LXIA 2CNDA 1PZHA 4F2PA 4D6PA 3GP8A 5B2ZA 1CZKA 5E3AA 4YMSA 2I2FA 7AT1A 1GNLA 3EVGA 3N6XA 4L8YA 5LIPA 3L4BA 4BS9A 5IX8A 4Q1VA 3CAXA 2D54A 1BDMA 1BJTA 3H9BA 2A1UA 3UR3C 2QX8A 2XA1A 1PEDA 3A6GA 3ABSB 3QW4B 4IV8A 4MR7B 1Z83A 4JU9A 3GDWA 5A0FA 5KC8A 1GEEA 2JJ8A 1J20A 4LERA 1VKZA 3FWYA 4B48A 4FQ7A 2N1MA 3VZQA 1NURA 3F5FA 3EZFA 2JIMA 3DE9A 1W5TA 1Z08A 3EYAA 1HW2A 2WTUA 1JH9A 1M54A 1OLXB 3CE6A 3KL4A 2DLNA 2L6FA 2TMDA 1NBMA 4N0PA 2ONJA 3I9JA 1VA4A 3KKQA 5I7EA 5F52A 4DW8A 2LUOA 3DL0A 1MOSA 2HKIA 3I0NA 5KWVA 1GN8A 4Z3KA 2XUQA 2APJA 3E9QA 4XIGS 2ZKIA 4LIPD 3ZCXA 3TOVA 3LYAA 4BN4A 3USCS 1YMUA 2GXSA 5KNBA 2PGXA 2CSUA 1Z39A 2OOSA 4CQJA 1Q7BA 4G56A 3AQIA 4U7HA 4UD6A 1PKEA 1XZAA 3C7KA 1EG2A 4YCBA 1IN8A 4BJTA 2ZIVB 4BP3A 3EBLA 4IB4A 1NBME 4O2AA 1YQXA 3L92A 2ACVA 3MAAC 3HJUA 1T8UA 1YQUA 5GV7A 3HKCB 5BSHA 4OOEA 4K9SA 2AKYA 1LI4A 1QS0A 1S3GA 3L2OB 3OFJA 1KEEB 3D8TA 4FOTA 4R9SA 5EY5B 4BQQA 4EYKA 4MV8A 3FB4A 1FXSA 1NMZA 3FPHA 4ISCA 2RBGA 4MAAA 3IP8A 4OK3A 4B7AA 4GOJA 1L7PA 4UEOA 1ES9A 4TLLB 5AI9A 4MPJA 1HSOA 2XUPA 3A06A 4QYTA 4DYHA 3S90A 3WNQA 2FUEA 2AXPA 1XBTA 2K7ZA 1JU3A 2VSQA 3L7CA 4KL8S 4R0NA 1ZCBA 3Q2IA 4D9EA 3AQBA 1DTSA 2FZ4A 4FHDA 1MDFA 4HYTA 1LTKA 2I2BA 4XVRA 1E32A 3IALA 5COBA 1DQSA 2UVPB 1EUZA 5DM4A 2O1SA 1CR6A 1JPVA 3T95A 4C08A 2AW5A 3AOGA 4YONB 4FK8A 3NI2A 3IE2A 3UCFA 5BUSA 4WEQA 2GVDC 5KQGA 4YUYA 4D9BA 4HD8A 3IXMA 3PC8C 3HBAA 1EXVA 4MLPA 1YONA 4OHCA 5CM8B 3OQHA 4AZTA 1AMUA 5KEIA 1ZP6A 3AM4A 2R9VA 1FNSA 2Q3TA 2XCRB 2CDAA 5GONF 4FNOA 4MTOA 2PWZA 5B57C 2INGX 4XDZA 2PS0A 3TQRA 3J81k 2H31A 1C8BA 1E1CA 3N0VA 2OEVA 2P7VA 1Q7GA 3PGMA 5L0JA 1KDTA 2A7QA 2WT8A 2HDWA 2GPNA 1BHQ1 2IW3A 3O83A 1QG0A 3ONFA 4I9NA 4PAQA 4BEBA 5IXYA 3IPXA 4ENSA 1I7DA 3IJ5A 1IOLA 3AHDA 2FPRA 1KK1A 2A5FA 4I3FA 3WTCA 1Q7EA 4G37A 2H54A 2E9SA 3HYLA 4HFRA 5ELLA 1DIHA 1G2QA 2VDVE 1V1RB 3PV0A 1ZKMA 4WKOA 5KDDA 4CG2A 3KLMX 1S89A 2YBEA 2WT4A 5K8IA 3K71B 2QRJA 3JWGA 1M67A 2Y39A 1ML3A 1E1KA 2CKDA 3KT8A 3Q5EA 3HZZA 4QJ5A 2LR0A 3WGZA 4HV4A 4XPIB 4OY3A 3IEMA 1WDTA 3QUTA 4E09A 3V1UA 2GM5A 3NXSA 3CNOA 3ILVA 5CB4F 1BU8A 4OK6A 6REQB 4TZ6A 1ONNA 2XE6A 4ID3A 4LCJA 4MWSA 4C3ZA 1D6JA 1GL3A 1SVOA 4MPRA 2Y1DA 4DLNA 5E4TA 4ED9A 4D02A 5CH5A 1A04A 1FNTc 1QCDA 1R74A 3PC8A 1FK8A 4PS0A 2X8WA 1H3NA 3OKFA 5B6IA 1WF3A 2XE8A 5JSUA 4LFBB 1QQ7A 2TMKA 2J9VA 3TPCA 1X94A 2RGBA 2PX0A 2VXCA 1ZL0A 4GMGA 3HY3A 4EFNA 4MVJI 5HOEA 3O31A 2WQ7A 3C5CA 3IR6A 3RT1A 3FCCA 3O84A 2H4ZA 4MTFA 3PFWO 4R6WA 3VGPA 1RLOA 4ULWA 3OSUA 2YZSA 3RAEC 1DPFA 1BYIA 1Q0QA 3ZWYA 2BFAA 2V7QA 3PHF2 4TV9F 4B3JA 5JAZA 2V1UA 4JELA 1YACA 4WZBE 2D13A 3VC3A 4AMUA 4DV0B 1PGOA 2X4DA 3D2CA 4NAUA 1DX9A 1DX4A 4DJEC 5AUQA 5JAIA 3T1VA 3WODF 4JV5B 2HRZA 1WCIA 3H5WA 5EOVA 3AF0A 2PTGA 1K8RA 2CLFB 1VTMP 5IUNC 1YB1A 4MEJA 3R75A 4Q7LA 4MR8A 4I2NA 1LCIA 1GRQA 2VRCD 1FDTA 1KA9H 5KYGA 5EUQB 1OH6A 4UTOA 1WD7A 2C1XA 4U5QA 1Z4JA 1N0VC 3IP6A 3EZIA 1LD3A 2O5EA 2HPAA 1B14A 3BORA 1C17M 2NZ2A 1T8RA 4EECA 2A84A 1T5SA 1ZK0A 2WTMA 2ZB3A 3IEEA 1D0SA 3GFTA 4G4JA 5K3BA 1HM5A 2EFYA 4OQMA 4IHJA 3UAZA 1BN6A 4AZ3B 5CCXA 1QHHB 4AMBA 3SZGA 1EA7A 2Y67A 1DKLA 2GI4A 1XNGA 3FPEA 4ESVA 3G0GA 3LFHA 3BWEA 5CPFA 2LP4A 1H66A 4X95A 3TW0A 1TRHA 5JO0A 1X3LA 4RTPA 3I2YX 4YC7A 4OJQA 3IE1A 2YN4A 3GNSA 1QZUA 2EP5A 5DNEA 4E7ZA 2R6AA 3DZDA 3FHTA 5G41A 1YR8A 3NM6B 4DRHB 2AH5A 1FYEA 2R5WA 3A2LA 5IVIA 4OM8A 4PO1A 3DTVD 5ALJA 3T9AA 1MB2A 1JL3A 1SNYA 4K1XA 3MBGA 2H00A 2FY8A 2GCIA 3B48A 5DYNA 5C46F 4GQIA 1GZVA 2YWCA 4PYIA 4XGNA 3REOA 3DC7A 4IS2A 1NVDA 1EVZA 1YB2A 2QQ0A 2VYFA 4FFDA 4LK3A 2QN9A 2YWDA 4NFYA 2XDYA 1MMDA 4QNMA 3O55A 2AXEA 2YXNA 3BIWA 3L7IA 2FGYA 4Q7JB 5GZ6A 2HU5A 4E46A 2XM0A 4YUXA 1M0WA 2QD3A 2BSQA 3GLQA 3OUTA 4ZYTA 4RHEA 5BYJA 4ZAZA 3AV3A 1Z4PX 3WSWA 1XMQB 1ODJA 3L07A 3F7TA 1CIPA 2B9EA 2YYYA 4DV7B 4CQLB 1IB6A 1FRQA 4D7AA 2IZ7A 2IF0A 2VC2B 3HKBA 4WNAA 5AXCA 3W4IA 3THWA 2BF7A 4R7GA 5DCYA 2XSEA 4Z9FA 1ZOPA 1XMVA 2R11A 4HGPA 3I32A 4KPUB 4KYUA 1JI3A 4CM4B 4PG4A 3AWDA 1A27A 2DX7A 3R5SA 2LD6A 3EASA 2FFQA 3W0LB 5BNZA 3GZTB 4UNIA 4Z9BA 2HV6A 3IOEA 2JH3A 3KUDA 4NX2A 2VDOB 1ZRMA 1JSLA 1XCGB 2CXNA 2QTVB 3HFGA 4HQFA 4IOMA 2O3RA 3IVRA 4MQEA 4MS1A 2IYAA 2VUHB 3GFSA 4WH0A 1NXPA 2PX2A 1OTHA 4R1PA 1DWPA 4UVGA 3F49S 3ABMC 1JV2B 2OORA 3BILA 1XRSB 5EMJA 5J2TF 1LU9A 5IKMA 1FX0B 1XQ9A 2VAWA 3DMDA 1YTUA 4YRMA 4UQPA 2A4KA 3EXG1 2GRUA 3UUGA 5HIKA 2CL5A 2ZAGA 1Y6FA 4KLCA 3UJ7A 2XKAA 4FFRA 4JJKA 2DETA 3Q1LA 4XVHA 3NFYA 2NO5A 1K4MA 4BY9E 2YV1A 3HB4X 4GW3A 3U4IA 3R7AA 1DMSA 2E4XA 5JLIA 1AS2A 3KOXA 1C03A 4MI1A 5T8KC 1W5FA 3I9OA 1NN0A 3K6BA 5EKTA 4CLRB 4EFKA 1B8NA 4GGPA 3OQPA 5DCUA 5TRTA 3CVYA 5CLFA 3AEKB 2XSZD 3R09A 4XIIA 1RAGA 1XVIA 2GRAA 3VR1A 3BH6A 3TD9A 4KP7A 2ZIUB 5CT9A 1JEQA 1DBWA 4BNTA 1H22A 3FOOA 3L7AA 2AXNA 4MQ9F 1GLNA 2OCKA 1MVNA 5G4KB 4F72A 1BE1A 1CYEA 3TD2A 3SXKA 1WW8A 2DBZA 2DLDA 1JQDA 1Z7Qc 1XAJA 4V3BA 2J0SA 1JXQA 4IJUA 1ST6A 2CWWA 3CNNA 3VYWA 2JLBA 1OZFA 4XQGA 5LMNB 1DBIA 3L7DA 3CKYA 2OR3A 4DLPA 3V7NA 2IT1A 5IRCD 4O8CA 4B87A 1N5KA 1JR3E 1H2AS 2SKCA 2JLAA 2X7JA 3WLMA 2PE5A 4C2UA 3R2JA 3U31A 4C89A 1BDJB 2RHTA 5CRIA 2QTLA 4DWOA 2ZYUX 1A2KC 3M6MD 2O20A 5I9NA 3G02A 4PGAA 1OYWA 3Q8XB 3ZDZB 4PLPA 1DQPA 1C29B 1ODFA 1LFAA 1VE5A 2QM3A 2OV6A 2W4IA 3K35A 3L79A 4K81B 1XZDA 2V6JA 1USVA 4ENQA 4PYJA 5JPIA 2JRLA 3CFYA 1NUHA 2A88A 3AR8A 1ZGCA 3PYMA 4XVUA 3R4VA 2V4ZA 5JS6A 1SD5A 5JSQA 1J4AA 1V11A 1FMCA 3KL2A 3D3EA 2B3TA 3OCYA 3O8BA 2EKDA 5KC9A 1UPUA 3CUWA 3ZYCA 4WY5A 1TXGA 1NI3A 2RGCA 4MOWA 5F21A 3RUDA 3VX4A 1G9TA 1UFRA 4FBLA 4TRJA 4E6PA 4WXHA 5AVZA 5AHOA 4EH1A 5JASA 1VQ1A 1UC4B 1EXNA 1RI4A 2LRHA 5GV8A 1IJEA 4NC3A 1W1WA 1LVUA 1FFTC 1SIOA 1TNDA 3G4ZA 1U6IA 2OILA 2SECE 2SKDA 3ESCA 3E23A 3HJCA 2PUWA 3IHWA 1V1MA 4JYPA 3WIEA 3WSVA 4MKXA 4B2IA 3U5TA 2P5YA 2LCIA 4ZZ3A 421PA 4LHWA 3R23A 4GOXA 2A5LA 1DAOA 3SGLA 3BJEA 4XOUA 1MIOB 1PUJA 3DB1A 1TVEA 3U0BA 3SZOA 5ABPA 2JD2A 3E9YA 2VT7A 3AETA 4DMCA 4FW9A 3T38A 1ZPDA 2CLOB 1M6EX 2ZIGA 4MYCA 4R2MA 4CNQA 3F2VA 4HEA1 3G4XA 2C96A 5IYZF 1NUTA 2G6BA 3LUBA 4MS2A 4OHKA 1MB4A 1ZXXA 2AW3A 4US0R 2Y71A 1KSGA 3U3MA 5I51A 2LZ0A 4HNQA 3BAZA 2HF9A 3KPUA 3CZ9A 1NZDA 3GB9A 1JYSA 1ORYA 1TFOB 1V45E 4NEQA 5IAEA 2XB9A 1J25A 3LUDA 1QR2A 1BVYF 3W2HA 3WHPA 3CURA 4ITRC 2OV4A 3S4YA 1BCSB 4IV5A 4V0ME 5AVVA 1PG5A 3EEYA 1DBVO 3GEDA 5BSMA 5B6PA 4F4HA 5JVDA 3Q9LA 4PG8A 1GU0A 4Q1CA 3FWKA 2YS6A 5LYJA 4B6FA 3O93A 5LD2C 4RNCA 1JA9A 4RMNA 3UYKA 5CURA 4QHSA 5A04A 4I81A 1LLFA 1WKVA 2IYRA 3MAJA 3S28A 2JARA 3QE4A 1RCFA 4RGBA 4AS3A 5CLQA 4DMLA 3V5ZA 3D1JA 1EDZA 3CS3A 4GT1A 1X15A 5AK6A 3ZCQA 4L4SA 4M9SA 4GR5A 2W2KA 3RVRA 2CBZA 1APBA 1H42A 4NCNA 1GVNB 2C2XA 1ZIXA 5I7RA 1YJBA 1YB4A 3ETCA 1DBQA 3L18A 3L46A 1II0A 3WAGA 1M2NA 1U0TA 4MVRA 3G6KA 4TS3A 4BLUA 1EB9A 1D8TA 1NV9A 3FCEA 4U7TB 1GD1O 1G8JA 1XZJA 4LOKA 4IDOA 2BTQA 2O14A 3HU5A 4RJTA 2LQGA 1B6GA 3DCNA 1QANA 1AKWA 4JJ4A 4AP6A 5JHGB 4S2EA 2NYVA 2VUTA 1SUCA 4GZMA 5DHRA 5ENDA 1BDHA 3OIGA 3DEJA 2EW8A 2PKWA 3L1UA 4FHZA 1HQKA 1XRRA 4GI2A 2B69A 4Z3OA 4TKLA 5FORA 3SE0A 3RQSA 3A2KA 1KEWA 1XA0A 4HEJA 3M1CB 2D5AA 1ST3A 1EUCA 1JYFA 1PO7A 3C85A 4CDNA 1P4GA 2E4UA 3NXKA 3ZLBA 5KYYA 4C29A 4B4OA 2R6HA 1VE1A 2M32A 1NUUA 3TNYA 3AJ9A 3K0CC 2HUJA 4FNGA 1O9BA 4QARA 2DJIA 1C3XA 4TLAA 4MSUA 2EG5A 1WXIA 4HAUA 4WKCA 2HU8A 3ZH9B 1WUHS 4BV2A 5B58C 3DLPX 3N07A 4N5IX 4QVGA 1WKCA 4AG6A 1TJ4A 2G80A 3LUHA 1YJXA 2O9JA 2FTKE 3HNKA 1M10