3E70C

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
318
structure length
307
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVILTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the signal recognition particle receptor from the archaeon Pyrococcus furiosus: implications for the targeting step at the membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
total genus 105
structure length 307
sequence length 318
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00448 SRP54 SRP54-type protein, GTPase domain
C PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e70C01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3e70C02
1IY0A 4A0GA 5JI2E 2ZRJA 2OCAA 3ZZ0A 2HT6A 4NP6A 2FEOA 1GL9B 1E2DA 1ZRHA 1LV7A 3PV0A 1N6HA 3PQCA 3GCGA 4DWJA 3PFIA 1CRPA 1H8ED 3QE0A 5KPJA 1ZD8A 3CB4A 1DOAA 3BB3A 4F91B 4S2EA 3CH5A 1OB5A 2VPPA 4B3BA 3ASYA 4N3NA 2IXGA 1DO0A 2XB2A 1G7CA 2WJIA 2R65A 2IC5A 1N6IA 1OIWA 1TPZA 3UATA 2QAGA 1FNMA 5TMPA 1OLOA 1KMHB 2BM0A 4OL0A 5DLQC 3TW8B 4GPTA 1XNJA 3R20A 3AKYA 5BYKA 2B92A 1ETUA 3RSOA 3ICEA 2I1QA 1UDWA 2JIZD 3GFPA 1R0ZA 5D3QA 2JJ2D 3CPHA 3EC1A 4X8MA 4DLSA 1ZC4A 2Z43A 1W4CA 2WWGA 3KQLA 3LV8A 1TL7C 3TSOA 3G0HA 1PUJA 2CVFA 1G64A 2JLWA 1K5DA 4IOLA 3QQ5A 2OESA 2WOJA 1IN5A 4C0KA 4L16A 4G01B 1XPUA 4M22A 2ONJA 1XPOA 1ESMA 2ZPTX 4H1UA 1G9XA 3QY0A 1Z63A 2PT7A 4OK6A 4QXAA 3KJIA 2I4IA 4QJ3A 2OLJA 3ZS8A 2Q6TA 4CIDA 1OSNA 5G40A 3T06B 4Z8YA 3ZQJA 4W5JA 3VHXA 1YVDA 1D2EA 2O8CA 4P4UA 1RIFA 3BE4A 2PH1A 3R9IA 1NN3A 4EPWA 1E2JA 1R5NA 2DY1A 2REBA 4POAA 3D8BA 4Q1DA 4V0ME 4M4SA 2QGNA 4TYWA 2GAOA 2FEMA 1E9DA 3W6PA 4ABYA 4JVNA 1XD9A 2HF8A 4L15A 3VNUA 3GLIE 121PA 4IFEA 4E22A 1NSTA 4GZLA 2G1KA 2PT5A 3ZVLA 4A2QA 2QORA 4JL8A 5DYGA 3E1SA 3VX4A 2HJGA 1X3SA 3SYLA 2KE5A 3BRWD 4KU4A 1TU3A 5AJZA 4OQXA 3C14C 1GWNA 2X19A 1GAJA 3BWDD 3HP1A 3GJ6A 3P1JA 5JS8A 1Q57A 3GLGE 1TEVA 1KZ7B 1Z5ZA 3OE7A 3PUXA 4TTQA 2XSZA 2ZRKA 3NEYA 5HR5A 1VIYA 5JSZB 5KSOA 1UFQA 4DLUA 1DAEA 4Y0AA 1OT3A 2NIPA 3T12A 1W46A 4NBSA 2FOLA 1GTVA 1VHLA 3VR6A 4ZDWA 2ZS9A 4DDUA 4D81A 1KO5A 1LS6A 5FI0B 4M1SA 2IYZA 2WPDD 3EWSA 3NBYC 2EW1A 4KHZA 4PSKA 2WICA 3QOFA 3UXMA 1OXVA 1ZM7A 4FXPA 4HYYA 4KBFA 4HB0A 3IHLA 2GCOB 1ESNA 5JCZA 4NCIA 1P2SA 5UKDA 4QRHA 1HEIA 3BB1A 4NH0A 3AM1A 2FSGA 1FL9A 1OYWA 4FWIB 1COWD 2GZHA 1OB2A 1HE1C 5CIQA 4WW0A 3AUYA 5JFGA 5HTKA 1ZW6A 1SXJD 1GKYA 1W0JA 4L8GA 4U00A 3RC3A 3OFND 3N2IA 4JL6A 4C2UA 1XCMA 2WSMA 4PO9A 1BS1A 4Q7MB 5CYPA 2JJ1D 4TLCA 5GJWC 3THWB 3NBFA 3VKHA 2JGNA 1CF4A 4JLJA 3FMFA 3KKMA 1KHTA 3PR1A 3H1TA 4A8JB 4MYHA 4PAOA 2MSDB 2ZYWX 5D3MB 2PL3A 4UNRA 1XX6A 3IKJA 2NPIA 5BN4A 1UAAA 3GFOA 4JBXA 5F9HA 2KI5A 2W0MA 3SEAA 1U0LA 2ZITA 1FP6A 3PUYA 5EE1A 5HE9A 2EFCB 5C1BA 2WWHA 2HEIA 2EFHB 2P67A 2YOGA 4MKFA 2XTZA 1TQDA 1RZ3A 3B5JA 3GLGA 4XWOA 3S1AB 1DAFA 4NYIQ 2N42A 4MGZR 2FN4A 2QN6A 4JLVA 1KSGA 1YR7A 1KZGB 5DGXA 3RSLA 2QA5A 2ZE5A 3PCRB 4NTZA 4HI0E 3A1TA 1T4GA 3RS7A 4KSCA 1BOFA 1RYFA 2LKDA 2A30A 2FGJA 4FCTA 2AR7A 5HE8A 3EZ6A 2BMDA 3BH6A 3I73A 4BZQA 2ZSFA 3C16C 2FU5C 4YXWD 2OXRA 2VSXA 4UQOA 1E79D 2W6ID 3TVDA 3VU9B 1ZD1A 4LJ9A 1RC8A 4FN5A 4HB4A 5FUWA 4M1KA 4NCNA 3H4MA 2BHRA 3BBPA 2J87A 3EA5A 3FVQA 1HT2E 1VG8A 2VQSA 1IOZA 4IEIA 1OXUA 4JZKA 4DCSA 1J8MF 3MGCA 4Q7JB 1DELA 1KOFA 1ELOA 1GNPA 2OFWA 4HAVA 2CCJA 4TQAA 2VSOA 4WOPA 5DO9A 4EPYA 3I4LA 3QVUA 4GRAA 3DM9B 1E6CA 3AF2A 1LW7A 1Q1EA 2NO0A 3LWNA 1P5ZB 3PEYA 2P5TB 4PO8A 1I2MA 1DEKA 3FPAA 4E03A 4I81A 1E9RA 2JCSA 1W4BA 4Y0VA 2RGGA 4RFSB 1S3GA 3RAPR 2OBNA 2OCPA 4WA7A 4Q02A 3M1IA 6Q21A 3FTQA 3F8TA 4H9GA 4BFXA 3KQKA 1E1RA 3W8RA 1GZSA 4FW9A 4Q4AA 4BEJA 4C0BA 3X1YA 4EUNA 2QTVB 4NCKA 1TQ2A 1IY2A 4YDSA 1HUQA 4KO8A 4U02A 3C4JA 3SDZA 5LB2A 3AP1A 3JVVA 4YC7A 2OV2A 2PLRA 1G5PA 2R6AA 2ZANA 4HDQB 1VYTA 4V0MA 2BBTA 3PG5A 4EFLA 4ZIRA 2Q9BA 1VG1A 3T34A 3W9YA 1OYYA 4JKIA 1F2UA 2XNDA 4PSAA 3GD7A 3B1XA 1G19A 4Q1EA 4QGHA 5HPYB 1P72A 3BGWA 1IJFA 2XITA 4RZ2A 1NBMA 2CK3A 3WYGA 1XJ0A 4PC6A 5FR2A 3BERA 3A1VA 4JLNA 4BASA 4L5BA 3K0EA 4C2TA 2G6BA 1HE8B 5FBRB 3W3ZB 4B2LA 2DFNA 1G1MA 4A8JC 2ZS7A 2F43B 3THXA 3P20A 4OHVA 2I1VB 3IO5A 1T3SA 2ZU6A 3LD9A 2IEZA 4C9BA 1X8LA 2C8VA 4NE2A 3TUIC 4JT2A 4LYJA 2ZI6A 3CRVA 1MH1A 1XTIA 1KO4A 3Q3JB 4IDOA 2BMJA 4A6PA 4R71A 1JALA 2QG6A 3GPLA 3T61A 4D4KA 2W2TA 4ESVA 3QENA 4P32A 2C98A 3ZD7A 2ZSAA 5LDDC 4U5XA 3U3JA 1SVSA 1E2GA 5FR1A 3VKGA 1U2RA 1UM8A 1EFTA 4L9SA 5CJPA 4A9AA 3SOPA 4MH0R 4ZKDA 5BW8A 5FH9A 2YKGA 3LLMA 2YHSA 1AQUA 2R6FA 5JMTA 2ZSDA 4DIDA 1XZPA 4FIDA 2F1JA 4RSGA 4AY2A 4LI0A 4BE7B 4GMDA 2OCBA 3FWYA 3G5UA 1JB1A 2J0QA 3VMFA 3U3MA 2O0JA 1AJEA 4US0R 3EWAA 4KBGA 4DB4A 2QY9A 5EXXA 5JSZA 2GKSA 1GNQA 2X1VA 2JDID 4MDFA 2D3WA 2NO6A 5K8IA 1KI8A 4PHFA 3R8CA 3WBKA 2ZI4A 2OCYC 4KAXA 2WJHA 2GNOA 4FMCF 4B3DA 4V0KA 4EJSC 3TRFA 1SZPA 3D6TB 3K70D 5FL3A 1N2CE 3H86A 3GLGB 1A2KC 3M0EA 1Z8FA 2ZEJA 5H1YA 4D0NA 4KYIB 1U8ZA 2OZEA 5H8WA 4M53A 1JECA 3IPYA 2EFGA 2F1RA 1NKTA 3IO3A 2BJWA 5AJWA 3EIQA 2YZ2A 1P2TA 1J2JA 3DZ8A 4B48A 1KAOA 1XTJA 2ZJ5A 4CT5A 3KXIA 1OIXA 4JLOA 4A8JA 2FDCA 3RVBA 4F93B 1XD2A 3T1VA 1QG4A 3U7FB 1JI0A 5FUYA 5ANRB 5BN5A 1GM5A 3R7WB 4KLZA 3THWA 3IQWA 3FOZA 3NVAA 3HYRA 3JZAA 721PA 4I1UA 4P4TA 3IPXA 2AD1A 2GJ9A 2V4ZA 4JLBA 4XVRA 4V0OA 3NXSA 4LYHA 4WXPA 3IIJA 1QVRA 3TSZA 1ZU4A 1M7GA 4B44A 3AP2A 5KTYA 2GCNA 4W5HA 1D2NA 1E96A 2RCNA 4A6XA 5A4JA 4BPBA 3I3SR 5E4FA 3TNFA 1UBEA 2IS2A 4KCGA 1KDOA 2F1IA 3CF2A 1SQ5A 2YJTD 3EARA 1OE0A 2AXNA 3OAAD 4BFZA 1SXJB 2IBMA 2YYZA 3Q7PA 2CNWD 4XOIA 2PMDA 3KXLA 3AP3A 1VYUA 2D2EA 2C04A 4HDOB 1P3JA 1G8GA 1VIAA 4UJ3A 5JJKA 4PPNA 2C2HA 2AN9A 3SNHA 5JLJA 1G16A 3ADKA 2QAGB 2ZJAA 2OSBA 1P62B 3L0PA 3MJHA 1G7SA 4IDQA 2QEQA 3O8RA 5FUXA 3BFKA 4TZ0A 4LDJA 3RWMB 4EAQA 3THYB 3ZLJA 4PHGA 3V4FA 1N25A 4G5RA 4YMWA 4P3YA 3VHLB 1KY3A 3TR0A 1S4QA 4BLTA 4TMVA 3KQHA 1IHUA 3WRXC 3K53A 1OXTA 1S9HA 1TF7A 2F6RA 5GJBA 4TL7A 3KKQA 3TBKA 2QL6A 1N5KA 3LBNA 4B47A 1KSJA 1IM2A 2FFAA 2GTPA 5HZHA 4F38A 1R5BA 2R62A 1K6MA 3PIRA 2H17A 3RHFA 2GZDA 5E7JA 2WKPA 3VR2A 4L9WA 2R6DA 4JKYA 4AYWA 4BFSA 2XOKA 4FINA 2V7QA 5HZKA 1CEEA 3RABA 2IUUA 1NMYA 2QENA 1E98A 2R44A 1VCOA 3G82C 2IS4A 4ACAA 1GRQA 1P60A 1Z6GA 4O2LA 2HF9A 4DSOA 4NCHA 1W47A 2GJ8A 1FUKA 5KYKA 2ODWA 3CWZA 1N5JA 3ICQB 4RD3A 1G3MA 1N6RA 1QHXA 2OILA 1KDPA 1RE0A 4J0QA 4LV6A 4B75A 1Q1BA 3VR4A 1JXOA 1JEEA 5F98A 1G18A 5B30A 1LY1A 1IY1A 4CEIB 4EFNA 2D7DA 2ORWA 3QBVA 2YVUA 3RRYA 3GFTA 1NVVR 3QXCA 4B2IA 2CHQA 1KI6A 4JL5A 2CLSA 5KDLA 1XP8A 2UVQA 1T0JB 3K0FA 4URXR 4LX0A 3TIFA 1L8QA 1H8EA 1KJZA 2NZJA 2ERYA 4DSTA 4LCBA 3W5JA 1E4YA 4BLSA 2QM7A 3LVQE 2QE7D 2BKEA 4GOKA 4BEBA 1N5LA 4NHOA 1FMJA 3LAWA 5JEEA 1BYUA 4BLQA 4B32A 2MMGA 2ZREA 3PEWA 4URYR 4B76A 4JLMA 4MUBA 4ZV4A 3CR7A 4LV5B 5G53C 4ESHA 3FGNA 2IEYA 2IS1A 4GSYA 4MGKR 1ZINA 1CP2A 1SXJE 4LHWA 5GVRA 1UEIA 2QPAA 3RYTC 1VYVA 4IOMA 4EPVA 1G5RA 3N5CA 3B8HA 3OZXA 3Q7QA 3RLFA 3L0OA 2AKAB 3K1JA 5KHOC 3I72A 3H84A 2IYVA 5B64A 1J8YF 4AKIA 2ZTSA 1Z29A 3DOFA 1YRAA 2CHGA 1U98A 4HAUA 1Z0KA 4KLNA 3I1FA 4BECA 3NBXX 5E95A 4NKRA 2OFXA 4XWKA 2BEJA 3X2SA 1WDTA 3NDBB 4MQBA 3AGPA 2NPFA 1ZAKA 1UKZA 2GHIA 4A82A 1GKUB 1GUAA 2D74A 2FSIA 4NYJR 4RD0A 2VL7A 1EESA 2AK2A 3V00A 3WHLA 1Z22A 3AF1A 3N70A 2WIAA 1I2DA 1GVNB 1BO6A 4AK9A 1KK3A 2D4HA 1F6BA 2QMUA 3CLVA 1NG9A 1JNYA 2RGXA 1KI6B 3QKSB 3ND9A 5GJCA 3U44B 2XZPA 3GLHA 3LQQA 3ZVRA 1W7AA 1T3HA 1FP7A 2ZJOA 3CRRA 4O25A 1E99A 4PC7A 5EXSA 1X1SA 2RGCA 3REGA 4Q03A 2JLQA 3VNVA 3U61B 1ZCBA 3SBDA 1VCMA 4B74A 5AUOB 1YJ5A 1G8HA 1S1CA 1ZBDA 2R9VA 2VF7A 3QVVA 4DLYA 1EWQA 4V0NA 2WJVA 4RVCA 3Q85A 3AVXA 4DEXA 1FTSA 1YKSA 2QSZA 4JVMA 1FQKA 1I4DD 3KKOA 1DAHA 2VH5R 1E2QA 4C0JA 3ADBA 2ZI9A 1TQ4A 2WPDA 4KV9A 1E0KA 1UPTA 2UZ3A 2Y8EA 1OJLA 4UXHA 2ORVA 2N1BA 3NKVA 3TJZA 2FGKA 3U4QB 1G8FA 1P4SA 4OHZA 4D4MA 4ERNA 4JMPA 4IVRA 1O3YA 1HA3A 1U81A 4IJMA 3B1YA 2CCGA 3EAQA 1U9IA 2CJWA 5E7MA 2MSEB 1CLUA 1I4LD 4HSEA 1ZNYA 2ATXA 3OESA 4FMBB 3UANA 1QHSA 4DSUA 1FOEB 3QPWA 2WKQA 1BIFA 5DE3A 1E32A 5FOUA 3GLIA 1G20E 2XXAA 2WWIA 5KNBA 1II0A 3W8NA 3SFZA 1OHHA 1R10A 2ZRLA 3KB1A 4IHQA 4Z1MA 4ZDJA 2CL7X 4QM7A 1T3LA 3V4RA 3RC8A 4Q1FA 2BCJQ 4RZ3A 4KJZA 1ZUHA 2BC9A 1W0KD 2VSFA 3QPUA 1JAHA 1Q44A 2A5JA 3PUZA 4M0LA 2C9CA 4K8OA 3B60A 5GJVC 2JEOA 4DJTA 1JR3D 4IVQA 4PSVA 2UZIR 1N0VC 1R4AA 4A2PA 4ARZA 1ZVQA 1W2HA 4KXFB 4WXRA 1P2VA 1SVWA 5F2EA 4C7OB 3IILA 3TQFA 4D80A 4DBLC 4R9UC 1NNEA 1U94A 1HQYE 1LFDB 2BBSA 4C4PA 1NL3A 1SHKA 2VP5A 4XD7D 4BZPA 3TQCA 2VP2A 1TF5A 5ELXA 1LF0A 4TN1A 4Q19A 2A5YB 5FL7A 1DADA 2ZM5A 2GJAA 1N0UA 2ZSEA 1Z2CA 2W58A 4CEJB 4ZI3A 5EE5B 1SVKA 1QVAA 1FQJA 2QROA 2A5GA 2JLUA 3DMDA 4OQFA 3FB4A 4QOSA 4LRWA 1CS4C 2CLDX 4CVNA 1R2QA 1WP9A 1KJWA 2NO9A 4DLTA 1H8HD 1KO1A 2WSSD 5FL7D 2HXYA 1D9ZA 1XTKA 1N6OA 5TB5A 2AXPA 2BV3A 1YQTA 1DBSA 2O8FA 2ZUDA 5KPDA 2HCBA 2WBLC 1KSFX 1FX0A 5C4GB 3M4YA 5DN6D 1DG1G 2GJSA 2FV8A 4DSNA 2VF8A 3LLUA 1DAMA 4TSFD 5EP3A 2JASA 1N6LA 4MKIA 1NLYA 4GFDA 1HQCA 2GXSA 4LJ4A 3W6NA 2YV5A 1RYHA 3EZFA 1YZKA 1NG1A 4NL4H 2ATVA 1F2TA 1S96A 1RFLA 3TE6A 1RRGA 4LHVA 1OH6A 1D8TA 5AWFC 1XXHA 3NBZC 2ZRPA 4I4LA 4XSHA 4GOXA 3ZVNA 2V9PA 1P61B 1G3QA 4HB3A 5J4VA 5CM8B 2Z4RA 3EASA 1QHIA 3F5FA 1DAIA 5EXPA 3T1QA 3WP0A 1CR4A 1M6NA 1FZQA 1XTRA 3D31A 3WP1B 3WMGA 3U6KA 2OXCA 2P6UA 2WWXA 2AWNA 1OFIA 3A6PC 5BQ5A 2C95A 3AF3A 1CULC 4PC2A 4QFMA 4IKEA 4TT3D 2RGEA 2ZRAA 2V6JA 3WYAA 4XJXA 2GXUA 2WWYA 3AF4A 2XZLA 1AZSC 2W0SA 3B2EA 4ASUD 1R7RA 2BEKA 1TX4B 2F3RA 4Q1AA 2ZUBA 2R2AA 1O87A 2ZSBA 1NVVQ 4QGAA 2QUZA 4IOKA 1E1RD 3B1VA 3W90A 4DCUA 1XU4A 4OQNA 5LD2C 1M2OB 3CR8A 1Z0IA 4P4SA 3ZZTA 4DUGD 4GT1A 3ZZUA 5LD2B 3L8YA 1G5TA 1M8PA 4N0DA 2GF0A 1J90A 4AG6A 2FMXA 2TMKA 2OAQ1 3THXB 1IN7A 4EPXA 4OHWA 1SKYE 3SBEA 4LJ6A 4OYHA 1ZM9A 2QM8A 3QG1A 4DIEA 5K8UA 3Q72A 3SR0A 2VYFA 1P73A 2NO7A 4RD1A 2FF7A 3SJAA 4M2LA 2C78A 3C41J 1XMVA 2DHRA 1F2UB 2D7CA 2KBFA 621PA 1Z0DA 3B13B 4G3XA 4ACBA 1OFUX 1N5IA 4UXIA 4B33A 2ZRDA 3X1WA 4ZIRB 3FMPB 2D2FA 2LKCA 5JBQA 4QBIA 1GOTA 1LS1A 1CJKC 1BYIA 3U5ZB 1Q21A 5L3VA 4AWXA 1R0WA 4A2WA 1TEXA 2XEXA 1E69A 2C96A 2GZAA 3OIUA 3QBTA 4N1AA 5K8LA 4Q4AB 4W5WA 3FFBA 2J0SA 2GEDA 5DH9A 4AYXA 4PHTA 3Q9LA 2GEUA 2Q9CA 3OEEA 3CO5A 3CNOA 3UKDA 4RFSA 2CL6X 1YHNA 3QF4A 5J40A 4V03A 1XB2A 2DYKA 5AR1A 1RVDA 1TTTA 3CWQA 2HCJB 1E2KA 4Z1MD 1OH5A 4PZZA 2GVZC 1WMSA 3IQXA 3SE0A 1NF3A 1NLZA 2VRWA 5FUVA 3AKEA 2CDNA 4QBFA 5FI1B 1Z0FA 4QJ5A 3TUZC 1IONA 4EJSA 3ZD6A 4TZ6A 3CF0A 3SJZA 1HTWA 2PMKA 2ZVQX 3SS8A 4DCNA 1W36B 3A58B 3KB2A 3ONWA 5H70A 3U7EB 4FWTA 1G3IA 1G291 5DHFA 1TF2A 3CKLA 3X1DA 1E2MA 1E1QA 4CDGA 3QF7A 4PX9A 1WB9A 2VP0A 3WNDA 4Q21A 1CJMA 1VG9B 4A0HA 2AK3A 4HB2A 1AA9A 5KSZA 3GLHB 1EK0A 3FKQA 5L3QB 4CRWB 1M7HA 4PQFA 3CZQA 3SYNA 1KI1A 2RKOA 4URUR 3OEHD 1F48A 2VBCA 3T5GA 1MT0A 2EYQA 3AH8A 2NMVA 4WZBE 2DFTA 4BGDA 4NZYA 4A92A 3U3KA 4C0SA 3TSWA 4C7OA 3TW4A 3K8YA 1YE8A 1G8PA 2XNSA 1CJVC 4UKDA 4CF7A 4HAXA 5FTMA 3GLFE 2DPXA 4GI7A 4NMMA 3FE2A 2CCKA 4A15A 3NH6A 3K0AB 4TQ9A 4LBVA 4GP6A 1W0JD 4Q9LA 2G3YA 5CK5A 3TGPA 5FPHA 3EPHA 1XCPA 2VHUA 4M1TA 2ZI3A 4CGZA 5TXGA 3TMKA 3BJIC 2W6JD 3UMSA 1C4OA 3LW7A 5L8VA 1W48A 3UPUA 2J1LA 2OBLA 2V1XA 1DS6A 2F9MA 2VEDA 3DDCA 2WMOB 2QTHA 3HJNA 1Y63A 1S3SA 4OI2A 3LY5A 1FNNA 1N6KA 1YZLA 1E2LA 2P3SA 4II7A 1YZGA 1X1RA 5LB4A 2CNWA 4GZMA 4TTRA 2QU8A 3W3AA 3SJCA 2ZJ2A 1NIPA 2EVWX 1JPJA 3MWJA 5EUQB 1OIVA 3FYHA 4QHTA 2GDJA 4DLZA 4EFMA 3U4QA 4LWZA 4M9ZA 4HUQB 1CTQA 4G0NA 1ONBA 2H57A 2OG2A 5JS7A 3BK7A 1GKIA 4IXMA 2P2LA 4BQSA 1DO2A 3VTKA 3B9QA 3H2YA 3BFXA 4CEIA 4RKEA 2C5LA 4DVGA 2EYUA 2WV9A 4LBZA 1BMFA 3WMFA 3KX2A 1TADA 1OKKD 1AZTA 3OIYA 2ZYTX 4X8HA 4YXWA 1GIAA 1Z06A 2VA8A 4BFYA 3QXHA 3RDPA 3WBJA 1E9AA 1DTSA 3UMFA 3A8TA 1GL6A 3LA6A 3U44A 1L2TA 5KO2A 5EE3A 3QKSA 3TR5A 2QRNA 4TMWA 3SU8A 1KK0A 4D6PA 2RGAA 2ANBA 4TMKA 3AVPA 1TU4A 3SI7A 4DXAA 1FUUA 5BYJA 2ZXUA 1BMFD 4LK2A 5CLQA 2ZJ8A 4URZR 4QBHA 2J5XA 1D9XA 2ORIA 3GJ5A 1KNXA 3KUDA 1A7JA 3I62A 2JA1A 1WBBA 3E70C 5JECA 2D06A 2XOKD 3BOSA 4RKFA 5DNYB 1VPLA 3EG5A 4S35A 5AUPB 1JQLB 4DEYA 4DLXA 4GL2A 1GL7A 4JJZA 421PA 4Q4HA 3TAUA 3AVWA 2O8BB 1COWA 2JDIA 2DWPA 2X8AA 1SVMA 4NYMR 4QGGA 3ZH9B 4ZPXA 1WE2A 3QPVA 1E2FA 1GDDA 1E1QD 4BFVA 3I8SA 2JLXA 1MRNA 4EKDA 1TNDA 1HT1E 2Z0MA 4Q4LA 4BLRA 5FTLA 3R8FA 4JS0A 1JQJC 1QHHA 2VP6A 3GLFA 4XWAA 3EZ2A 5CDFE 3VFDA 3BIFA 3EXAA 2IK8A 1UBFA 3FHOA 3B9PA 3OEHA 4IVPA 2J41A 4HEJA 2VTKA 2F3TA 2IWRA 4RCZA 1AS0A 4D4LA 3O8BA 2OE2A 3BH0A 2CLCX 1CJTC 2FSHA 3K0FB 1T8UA 5L3SA 3B82A 4PC1A 1P75A 3FHTA 3VAAA 3IUYA 1U99A 2P6NA 2ZJYA 3LQRA 3PEVA 4M9QA 1E4VA 2GF9A 1QZXA 3CUEF 1ZM4A 2J46A 1EFRA 1MO6A 1KI9A 1EFCA 2EFEB 4AC9A 1KMHA 1FTNA 1MKYA 4E09A 5KSYA 4NPHA 2FSFA 4RD2A 2JJ8A 2V6IA 3O47A 2AX4A 4DLRA 2IYTA 1XD2B 2HXSA 4MKGA 5CLLA 4AKEA 5TARA 2AL7A 2DWOA 2F1HA 5EP4A 3ZVMA 1F5NA 4BZXA 3I92A 3MD0A 3NDPA 2PLFA 4US2R 3IEVA 3HU1A 4YQFA 1A4RA 3ETLA 1KI7A 3RS0A 4AIIA 2IYUA 3SHFA 1UKVY 4EIWA 5IF9A 3NHAA 4KFRA 1SKYB 2DFLA 4CYMA 1Z28A 1CR2A 1MABB 2EWWA 4M1YA 3KQUA 2C9YA 1TMKA 5EZ5A 3CF6R 2W2VA 2WVJA 4GDFA 3CZPA 2J3EA 1JR3E 5HKKD 4A1FA 2O8CB 3D7MA 3W6OA 4Q01A 2J7PD 2IT1A 3IIMA 2ZYVX 1T8TA 1VMAA 3FKSD 1HY3A 1KI3A 1HV8A 4HZIA 3Q5EA 1E0AA 1QF9A 4DC9A 3C5CA 2H16A 4B6FA 4NCJA 1WA5A 3D3QA 1CR1A 4MRNA 4Q9IA 3MRSA 3A4LA 1KSHA 4F4IA 4RZXA 2ZIAA 5CDFA 5AUNB 2DWQA 2H18A 2QT1A 3R9XA 2BKUA 3FKSA 3WNBA 3TH5A 4M8NE 5FPKA 2FJUA 2AKYA 5B58C 5IK2D 4IDNA 1XPRA 4GP7A 4QKQA 1KO7A 4JBYA 3RANA 4W9MC 1IJEA 4BFTA 3B7GA 3WMEA 1HURA 4DHEA 4BUJA 2C77A 1B0UA 2C03A 1HYQA 4JT4A 1JPNA 2JLSA 3QUSA 2E9SA 2XZOA 3T15A 4D0LB 4RD4A 3EPLA 5CM9C 3KKNA 3ECCA 3TUJC 1Z3IX 1R5OA 3RRNA 4LOAA 2RGBA 2GK6A 4Q7LA 4C0HA 3DOEA 2P6RA 4PAMA 3C7KA 4R2IA 4MDEA 2O8BA 4Q4HB 2PJRA 4B34A 3DEFA 3QEOA 1F3OA 1Q12A 2OHFA 3P4YA 5EQTA 2NTYC 3HPQA 1U0HC 2B6HA 3AGQA 1NY5A 2PX0A 3BAFA 4B73A 4HAZA 1G8YA 1LB1B 1JJ7A 3GP8A 4TMZA 1PLLA 3LO5A 5M04A 4AKGA 1EXMA 1E9SA 2ZQ5A 3N2EA 221PA 3SQXA 1KTVA 1G6OA 1DARA 1KKMA 3DKPA 1SULA 3MWYW 2ZAOA 4JSTA 4QM6A 4Q4JA 4AKHA 2PEZA 1A1VA 1OFTA 2XAUA 2XTNA 3ND8A 4LZZA 4NONA 2O8EA 3X1XA 3VR3A 4Z51A 4BLOA 2BBWA 2FPMA 2FX3A 1EFHA 4D26A 5L3QA 4DDTA 3MJRA 2QGZA 1D6JA 2VHTA 1DG3A 1Z47A 1II9A 4LGMA 2YOFA 5JHGB 1A82A 4WIAA 2XGJA 1KJYA 3MFYA 5DI3B 1YRBA 2P65A 1QHGA 3LDAA 2IX3A 2ZRCA 2WM9B 2QPOA 4V02A 1EX6A 1PJRA 2ZETA 3MUFA 1WCV1 2F9LA 3NC0C 1Q0UA 4MUAA 2BBOA 2GRJA 1EFUA 1JAIA 2W6IA 4YONB 4URVR 1WXQA 4TSFA 5JJIA 1LTQA 2IW3A 3MG9A 2GESA 1ZC3A 3CONA 1KK2A 2A3RA 2NG1A 1RPZA 4QJ4A 1OV4A 3GJ7A 4G1UC 2FE4A 1M7BA 5TVKA 4AG5A 5G3YA 4OI1A 2QBYA 1W0KA 3U2QA 2Z5FA 2ZU0C 1T5IA 3ZGXA 3QF4B 4PPFA 2J9RA 1WGWA 2JLZA 3OEED 5FOXA 1Z6YA 2IYXA 4EDHA 3KFXA 2GILA 3HWSA 1M1YE 2QSYA 1G4UR 3M6AA 1T91A 4F92B 4NYMQ 4UNSA 5KNDA 4GNKA 1T6NA 1VHTA 1DAGA 2YINC 2WIBA 4JLKA 5JEDA 1XZQA 2QI9C 3NWJA 3QNUA 1WF3A 5EE0A 4MRSA 521PA 1T9HA 1G3RA 1Z6XA 3IBYA 4EPTA 1JBKA 4MRVA 3S1AA 4XVUA 1AK2A 5EP1A 3WNCA 3A36A 4PR0A 2FFHA 1IQPA 4TLAA 2ZRNA 4TL6A 1E2HA 2DCUA 3AV0B 2JLRA 4ZCMA 2B8WA 4ZKEA 4C3ZA 1VECA 1A5TA 1R8SA 1YR9A 5JZVA 5FPSA 3TLXA 5EUMA 1VKJA 3B85A 1U90A 4HUTA 1N6NA 8OHMA 5TV2A 3QKRB 1KGDA 3CNLA 4MA4A 2I3BA 2G0NA 1I4TD 2QMEA 2OFOA 3ZS9A 5EXTA 4HDCA 1YR8A 2ZE8A 4TL9A 1G41A 3U6BA 2WHXA 3RS5A 4QHSA 2QBYB 2YOHA 4DT1A 5CIWA 2N46A 1OHHD 3HR8A 1XMIA 4AURA 4CW7A 3CPJB 2RHDA 1ZNZA 1ZNXA 2IYYA 5G41A 2J59A 2HYDA 5IRCD 5GVSA 2YWEA 5KOYA 3NTUA 1P9RA 4UNQA 1QHYA 2MSCB 3LW8A 1G4AE 3KJHA 2O52A 1XEWX 2FG5A 2GCOA 3HU3A 3SHWA 4LC1A 3WXMA 5TY0A 2IS6A 3JVUA 4B35A 5DSZA 4A4DA 5EJEA 2PZEA 4OI0A 1XXHE 3CRQA 4PAQA 1FFHA 1YZTA 3W34A 1GITA 5JHHB 2W6JA 821PA 4JJKA 2O0HA 4TLDA 1KI4A 2WAXA 4DLWA 1AS3A 1OPXA 3KXKA 2DB3A 4UXJA 1Q20A 1UBCA 1VTKA 4P33A 1E9BA 4DB2A 3A37A 4DUGA 3A4MA 1D2MA 3VU9A 3NEJA 2DR3A 2OT3B 4KFSA 3K09C 2Q3MA 1AGPA 1R8QA 4YDHB 3DVLA 2GBLC 3SYKA 4M1WA 1C1YA 1Z0JA 1CKEA 1J99A 2IYQA 4ZCIA 4FMDB 4LHZA 4B3GA 2H7VA 4JYCA 1NMXA 1NVUQ 1U8AA 2A78A 4QC2A 4Q4JB 4US1R 4PQYA 2YWHA 2ZRBA 3L82B 2HJVA 4O0MA 1X86B 2OO7A 5FOVA 1GSIA 1OXXK 2V54A 4MGYR 4Q9HA 1C9KA 2QRZA 1GRRA 4BRUA 3QG5A 2BVNA 3L0SA 2MMCA 3EC2A 3NIBA 4P0TA 4C30A 1G21E 4GMXA 2REOA 3EPKA 2BCGY 5L3RA 4KVGA 1W4AA 2Q21A 1KKLA 1FX0B 4Q47A 4YMTA 5CB8A 4DLVA 3CX8A 2OUKA 4WZAE 2LCFA 1ODFA 3ZJYA 4DKXA 2RH5A 2ZI5A 1Q3TA 1XCGB 4FMDF 4LBWA 1VCNA 4JLPA 2KSQA 1OW3B 3LXXA 4TYPA 2EFDB 2J0VA 3K70C 2GVDC 4NDZA 4PPGA 2ZE7A 5KDOA 3AVVA 2CEAA 2CVHA 1E94E 5CITA 2CMKA 2FA9A 5AJYA 4PHHA 2YNMA 1NY6A 4Q5IA 1XJCA 5HCNA 1NI3A 5TDHA 1E9EA 1P7CA 4URWR 3I61A 5L3SB 3OHMA 1PZNA 4QHYA 3VKWA 1PLKA 4ZO4A 1E2IA 1ZUNB 2AWOA 4LC0A 4EQ6B 2ZRFA 3CBQA 3TAHA 1E0JA 1YZQA 4TWZA 4QNMA 4OJQA 4IDPA 3I32A 2ZE6A 5C18A 1J7KA 3K9NA 5SZIA 3HU2A 4O2RA 1W1WA 1WBDA 1MO3A 2YC2C 1P9WA 4P31A 2GXAA 4O3MA 2G1JA 4NYJQ 3ASZA 2QQ0A 1JJVA 3W5IA 2IHBA 1QHHB 1ZNWA 2IHYA 2PX3A 3K9LA 1Y3AA 3GLFB 4HZUA 4F7WA 1EWRA 2VHCA 3U3OA 2WJYA 3A1UA 3A4NA 1GILA 3HR7A 4IDHA 3EA0A 3TVTA 3UWKA 1LNZA 3P26A 4D82A 5FTNA 4BLPA 2C99A 2J0UA 4EPRA 5BXQC 4LPSA 1AIPA 1XDBA 4MRPA 4DZZA 1TAGA 3KZ1E 1NN0A 2YWGA 2NQ2C 2HUPA 2OM2A 1GRNA 2HV8A 2XXAB 1AGRA 1MOZA 1XXHB 1Z0AA 1E2PA 1Z6AA 2WAYA 2EWVA 2ZS8A 4QGFA 3TKLA 5FTKA 4LHXA 4KVAA 1T5LA 1ZMXA 5GADl 4U7DA 1E3MA 1KK1A 3EX7C 3OAAA 1ZIPA 2ZAMA 2VP4A 1TUEA 1S2MA 1MO4A 2QT0A 1R0YA 2AHOA 1K8RA 3L0IB 1ANKA 1W5SA 1XEXA 3BD9A 3HYTA 1DPFA 1VG0B 2E1RA 1A2BA 4M9XA 1QG2A 5FPTA 4XTCS 2HLDD 4LYFA 1RKBA 4ILEA 2JJ1A 2O8FB 3U7HB 2CE7A 3E5HA 4OBEA 4LJ8A 2OEPA 4TLBA 4XH9B 4PTLA 4LY6A 2BM1A 2FPKA 4LJYA 4KSBA 3ADCA 4W7SA 2R8RA 2H1LA 3Q5DA 5BN3A 1SGWA 2B7BA 5FFMA 4WAUA 4BRWA 1US8A 1SVOA 3P32A 2QPTA 3NH9A 1XF9A 3OIWA 3UIEA 3JZMA 5EP2A 2O5VA 4PANA 1RRPA 3BC1A 4TMXA 4RZUA 1AKEA 5JWRA 3UG7A 3BB4A 3K09A 2WOOA 1PUIA 3AVTA 5CK4A 1II8B 2FNAA 3UG6A 2GBLA 2IUTA 4HLUA 1KMQA 2IF2A 3IGFA 1YZUA 1IN6A 1QDEA 4HUQA 2FZLA 3E2IA 3GJXC 4LHYA 2R6CA 1IN8A 4TMTA 5FBLB 4QNRA 3I8XA 2BIFA 1Z07A 4TYYA 1NN1A 4FD2A 2ZR0A 4ARZB 2NZ8A 4FI3C 3SN6A 3T1TA 5E3HA 2XJ4A 3F3YA 1AN0A 2QAGC 3KJEA 2REXB 1NVWQ 3O8DA 3LXRA 2P5SA 1W5TA 3H0KA 2GAAA 1SHZA 4XTRA 3SFVA 4A0RA 2VLIA 5JWHA 1W49A 2Z4SA 4G5OA 5IT5A 1DAKA 4GOJA 1UJ2A 5CB6A 4OJKA 1PLJA 2BWJA 4YMUA 1KAGA 2WWFA 4FCWA 3PUVA 5F3WB 1UKYA 4M9SA 3B1ZA 3RS2A 2ONKA 4XD7A 1IXZA 4CZ2A 1XWIA 5JRJA 1CXZA 3B1WA 3QEJA 5IK2A 1E2NA 3WRYC 1ZD9A 5DI9A 1VDZA 5JRZA 1G17A 4KFUA 1S9DA 4G5GA 1MR3F 1ZCAA 3IHWA 4QBGB 5B57C 3I5YA 1L7VC 5A5GA 2PCJA 2W2XA 3L8ZA 1MRSA 3QXJA 3KTAB 3CIOA 4Q9KA 3MSXA 3CH4B 2GK7A 4A0FA 3BORA 4G5SA 1LVGA 5LBIA 1II8A 2ZYUX 3MMPA 4MKHA 3QXSA 1Z2AA 2ZR9A 2GEVA 4G5QA 3RS3A 2F55A 3GLHE 2WMNB 2FWRA 4MYUA 1ZU5A 4TYQA 2V1UA 3DO6A 3RWOA 2OLKA 2QMHA 5EZ6B 5F9FA 2J7PA 1ZM2A 4OKSA 3TK1A 4E5UA 4B71A 5IHPA 1SKQA 1Q1ZA 2BMFA 2C9OA 3CRW1 3IDQA 3LBHA 4CEHA 2O8DA 1SVIA 3MWKA 3FMIA 3OF5A 5E7IA 2WWWA 2WKRA 3MWLA 3T1OA 4LV8B 3A1SA 1XRJA 3AUXA 4QL3A 4F4JA 2WZQA 2B7CA 5FOWA 3LH5A 3IEUA 2JJ2A 3KDSE 5JI3E 2ZUCA 3I5XA 3O8CA 4EJSB 5DHAA 3MLEA 2ZRHA 4ITRC 2CBZA 4D0GA 4ZDKA 1XEWY 4XIGS 4I1OA 2ZVPX 1Q1QA 2IXEA 2SHKA 4DDVA 4K46A 4Z54A 2IYWA 2PZGA 3ZIAD 2J45A 2QP4A 1TUIA 4KFTA 2Q3FA 3PXGA 1NP6A 2GWHA 2E87A 1NBMD 3CPEA 1AM4D 4C0QC 3DPUA 3PJRA 2K5UA 2IYRA 2RGDA 2OBMA 1MO5A 3THYA 1K5GA 4IOJA 1BH2A 5J4HA 2J0UB 1B23P 2ZRGA 1NRJB 2AFIE 2QZ4A 3SC3A 3DKVA 1KYIA 3NC1C 2RGNC 2RHMA 2A9KA 4OK3A 5J47A 4OHXA 4C0AC 3K0AA 3EIEA 4YMSA 2UKDA 5IDVA 3RS4A 4D2IA 1AQYA 1S0UA 1NJGA 3AKDA 3OIVA 1HH4A 5G3ZA 3AB3A 1UADA 4OQLA 4I99A 2DFKB 4JLAA 2IYLD 4LBYA 4MYTA 1KO8A 2GJKA 3BXZA 1SXJA 2VP9A 1AS2A 3QKTA 2FFQA 4V0LA 2G88A 1WRBA 3CM0A 4TLEA 1NBME 2KBEA 3UWOA 4OHYA 2ZRIA 2IL1A 2WJGA 1CU1A 4MRRA 4M1OA 4B43A 2J7KA 2Z6VA 3QIAA 4PZYA 3DL0A 1OH7A 3QI2A 2JAQA 2FZ4A 3T35A 1Q22A 5DN6A 4Q9JA 1YR6A 3ZIAA 2ZRMA 2NO1A 5DISB 2HYIC 1U9IC 4P4SB 1JXMA 3NG1A 3R7WA 2W00A 2X2FA 4QG7A 4HAYA 2Q0HA 1GFIA 2A5DA 4GBMA 2AD5A 4LYAA 3B6EA 1XMJA 3KQNA 4HLQB 1W4RA 3K70B 3J81k 1ZP6A 2G0TA 1KDRA 1BKDR 1IBRA 2GXQA 3AVUA 4NU0A 1N6PA 2GA8A 3Q8XB 4CT4B 1ZIOA 2CL0X 4Q7KA 1J70A 4I1VA 2Q9AA 1RJ9A 1QBKC 4M21A 5B2ZA 1IAQA 3U3RA 4MGIR 2WSSA 3ADDA 4IXNA 2HLDA 4IRUB 3B78A 1EX7A 2ZJBA 3ZQ6A 4K81B 3UMRA 5JJLA 2PEYA 3AVQA 2CXXA 1IXSB 3LRPA 2BMEA 5BWMA 2RGNA 4RFVA 1H8HA 5JCPA 3CX7A 2QE7A 3KFVA 5C2JB 4H1VA 2HT1A 3C15C 1XFAA 1UKEA 2GCPA 4BWYA 5C46F 5LPNA 1QRAA 2A7QA 2VO1A 4R2HA 4E07A 1KI2A 4HLCA 5AK0A 4HZUB 4ON9A 3LNCA 2IUSA 1E9CA 2ASEA 3KKPA 1KNQA 1RJ9B 3KUCA 2JLVA 4X8OA 3GQBA 3LFUA 1RRFA 3FMOB 4Q48A 4IEEA 3LX8A 1YU9A 3ZYCA 3GJ3A 5FBVB 1IXRC 3OFNA 1P9NA 4EQ6A 2V3CC 3PITA 5EE9A 2EU8A 1QHNA 4B3FX 5C4MA 1W36C 4KI0A 4OQMA 2QTFA 1GG2A 2AFHE 4UNPA 4B2PA 3BS4A 4X8LA 1E0SA 2QP9X 4BFWA 1KIMA 4WZ6A 2ZJZA 1DE0A 2JATA 1Z6TA 3QJYA 4DRZA 2V8OA 1XBTA 3PVSA 1OFHA 2PZFA 3WHKA 1G3UA 2O0KA 3V9PA 2F43A 2LWIA 3AQ4A 4BFUA 5J5CA 2IYSA 2R6GA 2BOVA 2Q3HA 1KY2A 4M1MA 2QP3A 4RD6A 2CHVA 4R98A 1YZNA 4PXAA 4PPQA 2VIIA 2FPLA 2A2ZA 2Z83A 1NVXQ 2XNDD 1IN4A 5K8TA 3EZ9A 1JR3A 1N3BA 3QKUA 2ERXA 2WJJA 1U0JA 4WBSA 3PEUA 1XTSA 4JVSB 3HPRA 3MAAC 1H65A 3F0TA 1XTQA 2QNRA 4Q1BA 4TT3A 5AJXA 5A0FA 2H92A 3GEIA 1LF5A 2NOAA 4JLDA 1VCIA 3GJ0A 1ZJ6A 2B21A 1FPMA 5DYIA 4AYTA 3QSYA 3LBIA 4N0EA 5SZHB 4AD8A 4MYCA 3KL4A 1SXJC 4MITA 3SZRA 1TQ6A 2F7SA 2ZR7A 3P27A 1X6VA 2A5FA 3L43A 1NN5A 2IF0A 2ZROA 1OH8A 3K9HA 1F2TB 3RRMA 4TQUS 3NHBA 1E2EA 1FMLA 1L4YA 1WQ1R 3EZ7A 5HCIA 3ZDQA 1R0XA 2CJWB 4Q18A 5CJ2A 3CNNA 4TYNA 4PO1A 1Z08A 3C8UA 3GJ4A 2QMOA 3X1ZA 5J4LA 3U60B 1F60A 4FMCB 5J4KA 4HAWA 1S1MA 1E9FA 1N0WA 2IA5A 3DM5A 1XD8A 3BFVA 4PFSA 5CYOA 4JSYA 2GETA 3CW2A 1EG7A 4JBWA 1V5WA 1CR0A 3EW9A 2PCLA 1W44A 3K9GA 4KITB 2XTMA 4UJ5A 1AKYA 4WVFA 4JIMA 3CX6A 5FTJA 3WYFA 2QAJA 3K0CA 1ZM3A 1CBUA 1U8YA 4ZDIA 4DT1B 2O8DB 3REFA 5DI3A 2PBRA 5FOSA 1JR6A 3FDIA 2YC4C 3L2OB 5KSPA 1E79A 4I1SA 3EPJA 2G77B 1T0HB 4CEJA 4KODA 2X2EA 4R7ZA 4L4UA 4FCVA 3BH7A 3CRMA 4YMVA 3AKCA 2G9NA 3T5DA 3QKRA 2KB0A 4JVLA 3AVYA 4B3XA 5JWOA 3WY9A 1OXSC 3SJBA 1CRQA 1NSFA 3SQWA 2ECKA 4PC3A 3UK6A 3AEZA 2KJQA 1OF1A 3VX3A 2H8KA 3KTAA 4LUCA 4HATA 5FBWB 3AVOA 1ZUIA 2PJZA 4UNNA 4XSGA 4HLDA 2H5EA 4LPKA 3GEEA 3PUWA 1W36D 4LSGA 1Q3HA 1L4UA 1M74A 1R6BX 1EFRD 2BJVA 2V55B 4LJ5A 4PQRA 4D25A 3C5HA 4ZI2A 2VHJA 2X77A 2OAP1 1RW4A 2RB4A 3P4XA 4RCYA 2RAPA 2YWFA 2HDNB 2QQEA 3KJGA 2P0EA 4IFBA 2JIZA 4KYUA 5H68A 4DCVA 1GP2A 2CE2X 4PZLA 4YLGA 4Q66C 3GMTA 4OK5A 5D3MA 4LJAA 1NLFA 2ZI7A 1MV5A 3IBGA 4XVQA 5P21A 3FFAA 3GLIB 4LJ7A 3MCAA 1OKKA 1CIPA 5FBQB 4RJLA 4HLUC 2JLYA 3PENA 1D5CA 3U7GA 3VR5A 1G7TA 5FOTA 3R9WA 1XEFA 1X8KA 2ANCA 3DHWC 1S8FA 3A1WA 5SZKB 4IW3B 3LVRE 3VQTA 1UBGA 1DVRA 2XJ9A 2IXFA 1P2UA 4ZCLA 1P6XA 5AJVB 1NMZA 4F4CA 1XMSA 2G83A 1SVLA 4NYIR 3RNLA 1KDTA 2XB4A 4Q00A 3QXXA 3K0CC 3DZDA 2FH5B 3IIKA 5DIFA 4D4JA 1FW6A 1UDXA 4TTPA 2EQBA 2NGRA 5KUTA 5HKKA 2BDTA 3K0SA 5AUQA 2CK3D 4OI4A 4TL8A 1XJQA 2IWHA 1RRCA 2DBYA 3GEHA 4Z8XA 5FPYA 4B3CA 4A36A 4CEHB 1M34E 1NJFA 1X8JA 4DCTA 5KDDA 2D62A 1W2GA 1EGAA 1US8B 2ODEA 3LX5A 3THOA 4AI6A 1Z83A 1JEDA 1NKSA 2V7QD 3AF0A 3FHCB 4Q1CA 4ASUA 3RRZA 2ODBA 2B8TA 2VHQA 5J4YA 5KNCA 2RMKA 3EIHA 3OE7D 4DDWA 5KU1A 2XSZD 5SZJA 1G7RA 3GJ8A 3VR1A 1V43A 2XX3A 4C0LA 1ZYUA 2FFBA 4JYBA 2O8EB 1UEJA 3HDTA 4RY2A 2KWIA 1UF9A 2ODNA 3DMNA 1G6HA 4B6EA 1GNRA 1MABA 1PVOA 2L0XA 1NIJA 1CJUC 1XEXB 2WTUA 1PV4A 2W83A
chains in the Genus database with same CATH superfamily
2IDZA 3VOBA 4QYIB 5BNIA 4A0GA 4B4OA 3CISA 3GDGA 3RI3A 5SYAA 2HT6A 1K2VN 4QDKA 3ZZ0A 3ZOZA 3VU1A 1GL9B 1N6HA 1D1BA 2PMCA 1IEXA 2WG1A 4Q4ZF 3GCGA 4N5HX 4U4AA 4AP9A 5C1OA 1CRPA 5KPJA 4JGBA 4FP9A 5IBPA 1NW8A 2Q5HA 4EGSA 1MXFA 1FUEA 3K35A 1H4QA 2B2NA 3ASYA 4G23A 4J2OA 1XKXA 2CKDA 2AU5A 2XZTA 5AKKA 2C07A 2R65A 4BJ1A 1OILA 1N6IA 1OIWA 1TPZA 3ILXA 3L8CA 4HDKA 5FA6A 3ROMA 1GZDA 1ZVZA 2P9GA 5JOQA 1ZOIA 1QO7A 3U2MA 2Q29A 2FR8A 2HO4A 3NX4A 3EUFA 1OLOA 2BM0A 1IWOA 4TS3A 3TW8B 1XNJA 3R20A 3UJDA 1Z56C 4JR0A 2VAWA 1NM5A 5IDYA 3RSOA 3WSVA 2I1QA 4L0QA 1UDWA 4O3FA 2JIZD 3BX1A 4HX9A 1R0ZA 4ER5A 1SBQA 4GIBA 4Z2YA 2JJ2D 1J20A 1ZH8A 2VJYA 3EC1A 5FIUA 4WERA 3D6JA 2C4KA 5JG7A 3KQLA 2A5LA 3LV8A 4YJDA 3G0HA 3WNQA 4NJMA 1PUJA 4QDOA 1IY9A 2CHFA 3D5QA 3O4IA 2JLWA 3NI2A 4XDHA 2XRZA 1ZJYA 4ZU3A 5TR9A 2A57A 1C7EA 4XYMA 4KB5A 1CZOA 1DIGA 3O4GA 5D51S 1JG1A 3KEQA 1OGYA 3Q7RA 4YUAA 4RAQA 1X87A 3L6UA 4F4DA 2IIVA 2YMPA 4I08A 4MX8A 1ZHXA 3UPTA 4I9HA 2L6FA 3QUAA 3E81A 2V0NA 2JNWA 1T9KA 2OLJA 4WJZA 5HFNA 3ZS8A 2GASA 1OSNA 1QS0A 4CJGA 1TB4A 2QL7A 4CIDA 2PS0A 2QSUA 1JHZA 3CA8A 4Q37A 1KS2A 2BRUA 3KELA 4W5JA 3SDBA 5K8CA 3B6KA 2C4NA 4TTIA 4ZEVA 1VBFA 1Q92A 1Y7TA 2HPHA 5I9LA 4IYJA 2NT3A 2NZ2A 3KEFA 4P4UA 1RIFA 1QIKA 2V6FA 3BE4A 7ABPA 1NWCA 4LEIA 1E2JA 1C7IA 2REBA 2AW5A 3I6ZA 3OM9A 5B58T 3I9FA 4KI2A 4GX1A 4M4SA 3VPBA 1ADYA 4MW1A 2GAOA 4TYWA 1WS6A 2CLEB 5EKDA 5DHPA 2HF8A 2WKSA 3IKMB 1YSCA 4KH0A 4KLCA 3VNUA 1VDMA 2AXQA 1NV9A 4YT8A 1NSTA 4GM1A 1AE1A 4GZLA 3HG7A 4A2QA 4BN0A 1GCAA 3ZDLA 2BW0A 1RM5A 3L8GA 4PJNA 4JL8A 3SC2B 4O4JB 2CJPA 4D5EA 2EFYA 2WG2A 3L7LA 4L5JA 3SYLA 4HVTA 1TU3A 1DOVA 2B25A 3UQZA 1OI4A 4YPOA 4TRNA 4DV6B 1PJCA 1IE3A 4J7UA 4JCZA 2R25A 3PXDA 5GZ3A 1Z5ZA 2ZBPA 5AM0A 3DTVA 4TTQA 5HYVA 1ECJA 3NEYA 2AMYA 4GSLA 5THXA 2FW9A 1VIYA 2X4LA 4UAGA 4D9GA 5JCPA 1QIEA 4MZDA 4CIHA 1UFQA 2AE2A 1QYDA 2YXDA 4DLUA 5AW2A 5H4HA 2XDWA 1UXJA 1DJOA 4LISA 4KNVA 1HDRA 5TPZD 3FPJA 3T12A 2OHJA 1NRXA 2VNJA 3O4RA 3NANA 1VHLA 2CLHB 2ENWA 4ZDWA 5JO0A 1LK5A 2VASA 4C0XA 2YWDA 1AF4A 4LGVA 1QRUA 1E3SA 4M37A 3OQBA 3S29A 3EWSA 4D1YA 4AS1A 3UAZA 1YVRA 3JQ7A 3NBYC 2EW1A 1S5PA 2BC5A 4PSKA 5CH3A 3QOFA 5HV9A 5AOVA 5FWAA 4C20A 1OXVA 1H5UA 4CKEA 4TV8F 1CUZA 2GCOB 3BF7A 5JCZA 2XDQA 1GZ7A 5F5NA 1HDGO 5KSWB 1USIA 4HGOA 4IQ4A 4CMGA 3AM1A 2VWGA 1Y1PA 5K6TA 4WADA 5FFNA 1E1CB 1COWD 3HB0A 3TLKA 2FDRA 5JH7B 5DBEX 4UBIA 4X1KA 5K8JB 1ZW6A 3O4VA 4B8ZA 4MO2A 1W0JA 3AETB 4ZTZB 4TN5A 4YXFA 3KLPX 2W4BA 2WSMA 2VZEA 4PO9A 5CYPA 4RY8A 4PACA 3NHFA 2IHNA 3ZGYA 4YP9A 3KMIA 5GJWC 1MRZA 3KVVA 3NBFA 3WR5A 1CD5A 3ZK9A 4H6WA 4BMXA 2XT0A 4MUHA 1KYYA 1YBMA 5JC8A 5DX1A 1K86A 4IS2A 2W45A 3FTPA 1KHTA 2G5GX 5U4QA 3ESCA 3H1TA 2B37A 4KRXA 3SDSA 3ID6C 5L51A 3ONEA 2PL3A 4RHTA 3ZWKA 4LACB 4AJIA 2IBSA 2Y0EA 3A9WA 4P5EA 5BYAA 2I29A 2V58A 1FP6A 1TXGA 2XLCA 5EE1A 1CFJA 1KFJB 1P7VA 1MJGM 4HJXA 2WWHA 4I2NA 3ZQUA 2YOGA 4MKFA 1NBIA 5IJXA 5I47A 1TQDA 1RZ3A 3GLGA 1VKHA 2OVBA 4XWOA 3S1AB 4V1CA 1PG2A 2B2CA 1O6BA 3R0XA 4UFOA 1BW9B 3EFBA 2W70A 4MGZR 2CSXA 3IKTA 3PTLA 2XCTB 1KSGA 2HV9A 3MTAA 2QUAA 1YR7A 3ABIA 3N87A 3IR7A 2WF9A 5DGXA 1YK0A 2ZE5A 3OFSA 4F5DA 5MN6A 3LCCA 5GOZA 2VT2A 4KSCA 2KX7A 1YI0A 4LWOA 1YF3A 1YIOA 4J76A 1LJUA 2WDZA 3EZ6A 3FDFA 1RCFA 4PFOA 4BZQA 3R6TA 2DKFA 3A1NA 3NOQA 4YUWA 1H2BA 2F8SA 2FU5C 5HA5A 4MICA 5L4SA 4G25A 2VSXA 5CI8A 1H0SA 2W6ID 3C74A 3DHNA 3VU9B 3L4KA 4FGJA 2D2IA 1I01A 4HB4A 4NCNA 5FUWA 5P8WA 5EVJA 1YFLA 3BBPA 2J87A 3EA5A 1P7ZA 1HT2E 1KPGA 1VG8A 2VQSA 3GCZA 3PA8A 3HXKA 5DIZA 2WYOA 3W8EA 4DCSA 4XWWA 3KHUA 1Y3DE 1JKIA 3M5PA 5EWLA 4RHUA 3WKDA 5E6RA 1GQRA 3I1YA 4O4LA 4J7AA 1JILA 4RLQA 4Q39A 2BKXA 1RI3A 4BQNA 4EHLA 1UBNA 3M81A 2NVUA 4F2PA 1R88A 1A71A 4GRAA 3CZ6A 4O5AA 4YJ3F 1JFLA 1SPXA 3COZA 3NQ41 4WFKA 5JBNA 2PS1A 4GYYA 2XIQA 2ET6A 4F3YA 5AVJA 2YHUA 1UQTA 1ZCFA 2P5TB 3C3JA 3GNLA 4NC9A 4RJ2A 1N8KA 4D9JA 2Q8PA 3H5OA 4H6XA 3ZE2B 4QQ8A 1W4BA 1YNSA 4AECA 5AW1A 5J9FA 2GPNA 4H35A 4PCUA 1S3GA 1V7QA 1M6HA 4FYYA 3RAPR 1ULAA 3ZCUA 1YKGA 2J6HA 4RDXA 4NE9A 3MF4A 4G56A 5CVJA 3M1IA 3JTLO 1F06A 2QL5A 3HY3A 3FTQA 3G9QA 6Q21A 4RKQA 1ZD3A 1ORDA 3LL4A 5DVWA 2A4MA 1ICEA 2NN3C 2B20A 4GLLA 4FW9A 3CSDA 4Q4AA 4BQPA 4CM7A 3NYIA 4X0RA 1QJCA 1HUQA 5JS1A 4XPYA 3VJLA 4KO8A 4NVRA 4U02A 3ZW8A 5ALOA 1KTIA 3JCZA 1CZKA 2ZCVA 2OV2A 1U63A 2AEEA 1TA4A 3RHZA 5A6SA 1ZN2A 4K9LA 5BW4A 2VQEB 1T0UA 5KX5B 1N2EA 4HDQB 2HC9A 4PCAA 1IL0A 1EP1B 1U28C 5F5FA 1UJ5A 5EKXA 5J2TB 4S1PA 4N3AA 1EI9A 2F59A 2WD8A 2Q62A 1NPTO 1PT9A 1QYCA 3CE9A 2I15A 1D2HA 2Q9BA 2BKAA 3P9PA 3PUIA 3Q2KA 4BLUA 3W9YA 1NPYA 2FTKE 1C30B 3KLMX 5LXTF 5KWJA 3I9OA 5IULC 4D3XA 2BEUB 2BTQA 3FVWA 1OUMA 1U7TA 3UENA 2HMZA 1EDOA 3DXFA 3HB4X 3MLAA 2Q1SA 3TSCA 5HPYB 2JH3A 3L7BA 4W6ZA 2X0KA 2XITA 5DBHX 2CK3A 1Z6QA 3WYGA 4CG0A 4DNOA 4GPIB 4EO9A 5JC1A 1A9TA 3KOWA 4L5BA 2RAFA 5FBRB 3LUHA 2VCEA 5CX1B 5BT8A 3VTZA 5JJIA 1GV1A 3CLHA 2F43B 1PWXA 3PS9A 3DBOB 5K03A 3KB8A 5IYZA 1OBOA 4OEHA 4XCQA 4LF6B 1AEPA 2IEZA 3SIWA 1TGYA 4CKYA 3HWX1 4HN4B 2C8VA 3H5WA 1P5RA 4JT2A 3EG9A 1LPNA 2ZT5A 1KZ1A 2AEMA 2VLBA 2XDAA 2JARA 2E49A 3D2CA 2ZULA 3HHPA 3FX2A 3Q3JB 1C3VA 4OG2A 2BMJA 1ZH2A 2QG6A 2V7XA 2PGXA 5D86A 1LZKA 5E3AA 3GPLA 4HTAA 3T61A 1XF1A 5FV4A 5IX8A 1D7OA 4ESVA 3ZD7A 3ACDA 1Z37A 1P91A 5LDDC 1SF8A 2O4UX 3KQMA 1HM5A 3VKGA 1M33A 1U2RA 1K6EA 1UM8A 2HSEA 5CJPA 1E5VA 3ZX4A 4A9AA 5JT1A 5ICGA 2Q5EA 3KUXA 1QSPA 3RGGA 4I4TA 5DNUA 4JDUA 4FIDA 3UMMA 4YJ2B 3RD5A 4ZC1A 1QZUA 1L8LA 4HV4A 1JH8A 2OCBA 3Q1KA 3LT4A 3IUNA 5JUWA 5KYTA 1Y8QA 2D0OB 2DUNA 3R7AA 3RUPA 3FCXA 2I3AA 1XVLA 3EPRA 4US0R 5CVCA 3U3MA 4QODA 4KEAA 2QY9A 1X1CA 1T2UA 4OYYA 5JSZA 2NAFA 2YUIA 5LIRA 2X1VA 1GGMA 2DF8A 1Q77A 3HCEA 5K8IA 3C97A 2QWXA 4PHFA 5CXSA 2JVJA 1IZYA 5KTKA 2GPWA 2OTCA 3JQ9C 2RONA 1DAPA 1KMMA 2RDMA 3E6AA 4KAXA 1X7WA 3MMZA 1L8XA 1NX9A 2JD1A 2COEA 4UHCA 3FA2A 1E77A 3QYPA 1M2WA 4LVOA 3HXMA 4WFQA 5DM1A 1N2CE 3A06A 1A2KC 2EWMA 2B1IA 1MN6A 3CU5A 2J67A 1JLKA 1XN4A 4UCWA 4Q15A 4G0YA 4ZK2A 2V6MA 4M53A 1XVAA 2F1RA 1NKTA 1PZMA 3C6BA 5EIOA 4ND8A 5L7YA 4G89A 3FNFA 1P2TA 4Y1FA 1J2JA 3WLAA 4U5GA 1DXQA 2ZJ5A 1YZCA 1OIXA 2YMQA 4A8JA 3ZWCA 3TAXA 4C3EA 4C6TA 4CHTA 4F93B 5JXIA 5I9NA 1S7ZA 3I58A 3IPCA 4C7JA 1QM5A 1VLQA 3THWA 3IQWA 1JHPA 1SD1A 4UBJA 4ZYYA 2NP7A 3KVNA 2Z09A 4HYTA 4I1UA 3UXYA 4EAAA 3A1DA 4V0OA 1XCJA 3A04A 3HY4A 1QVRA 2O2CA 4QOJA 1ZU4A 1M7GA 4TTJA 3MUOA 4B44A 3VO9A 1TIKA 5KTYA 2W9YA 2HIAA 4OUKX 3ZU5A 4E51A 4WK0B 3TSAA 3GLVA 2GZ3A 4GVLA 5FF9A 4OATA 3I3SR 3KLBA 3OCWA 3PQ8A 1E6KA 4NU5A 1UBEA 1J06A 4K8RB 4QQNA 5E4FA 1RM3A 2WU8A 3ZE1B 2F1IA 2BPOA 3R5FA 1JKFA 3S2YA 3EARA 5EHIA 1OE0A 2BL4A 4TXJA 1EDDA 3RSGA 4JODA 4EZIA 1WZNA 2IXPA 1JG6A 1VC2A 5G0TA 4GZ5A 3BAZA 3CXRA 1BAPA 4Y9UA 3UHJA 4O33A 1R50A 1VHQA 1NFFA 1VYUA 2AG8A 2C04A 2C0PA 1OFVA 2VQDA 3P5BA 3P71T 3GJQA 1X7GA 2QXUA 4M3NA 2GX6A 4Q3AA 5JMPA 4MQFA 1J56A 5EZSA 2W2PA 2GPYA 1L8AA 3H2VA 4DA7A 2VJMB 4JB2A 5EN4A 2VUHB 3O9MA 4G0MA 3ZW9A 2Y3HA 1XJWA 2DUJA 3V4FA 5DNCA 1N25A 2VPIA 3DL4A 3OICA 1IG0A 3GG2A 3L8DA 4HGNA 4YMWA 1MX5A 1RHUA 1QMPA 1QO0D 2YJ4A 4M46A 3QFHA 5ALDA 3D3JA 3GJSA 3A9CA 3OMWA 3H99A 1PJZA 3UAVA 1Q0LA 1QTIA 1XVIA 1QYRA 1H3NA 2Y3IA 3K53A 3ZPXA 3NGLA 1JT9A 1S9HA 2D5BA 3M4NA 4KXQA 2O3SA 3I83A 1I24A 4BMSA 1P5HA 3HWWA 4QYSA 4EY4A 4QFBA 5F1OA 5GPGB 4DHWA 1R5BA 5J5VA 1BQEA 2R62A 2QUKA 4BTEA 2WKPA 4BFSA 3OZEA 1CEEA 1B41A 3LC0A 4IF6A 3OJFA 1KH1A 1FXSA 3WGYA 4AAYA 4WEOA 1MU0A 3RRXA 1UDCA 1VCOA 2OKCA 4BNMA 1ZIDA 5IJZA 3GWLA 3KYIA 1GRQA 1Z6GA 5CDUA 5IAAA 4O2LA 5ETJA 3TX2A 1BD4A 3S0XA 1KAEA 4MB0A 4DSOA 3K9BA 2I65A 5LWHA 1DRVA 3SXYA 4C3BA 2GJ8A 1FUKA 2ODWA 2R7AA 2VCHA 1PFWA 4ZVRA 4LE1A 4LV6A 1ORYA 1KDPA 1OBHA 2FLKA 2GJ4A 3VR4A 3C3WA 4KH1A 5GM1A 3ZE6A 3TL6A 2GKGA 1DX4A 4B6SA 4C03A 3ZC4A 5F98A 1EK1A 4MP8A 2L81A 1OWPA 3BVPA 1A1SA 3WGMA 2ORWA 3QBVA 3P19A 2WUWE 4U7FA 4A6DA 4YV7A 1ZOSA 3GFTA 1FSSA 2UZ4A 4E15A 5EG5A 2X8JB 2AFRA 4I4IA 4LF7B 1T0JB 1ZDMA 1TI7A 2GFIA 1S05A 4URXR 5DHRA 1HG1A 2QV7A 1VL1A 3NRHA 3UICA 1FK8A 1YQQA 4GX2A 4TUYB 4CTKA 2ERYA 4JYPA 5AVQA 3HV2A 3NP7A 4IDFA 4OAPA 4QJIA 2G9VA 3U49A 1ZY2A 2BKEA 3MC1A 2AUTA 4YN3A 2CMHA 3V46A 4UQLA 1XI2A 1DDIA 1QH8A 3LAWA 4BATA 4DZTA 1CYEA 1C02A 4AVYA 2NSGA 4MUBA 4ZV4A 4I4TF 4LV5B 4RU1A 4CODB 4CL2A 2C7OA 2V3VA 3FGNA 3HDVA 1FXUA 3P9NA 5B6IA 1SC1A 1YMQA 1RZUA 4KMOA 1ZINA 4MGKR 3CG4A 5KKAA 3TZQA 2ZSHA 3EDRA 5KEIA 4RWEA 4KIFA 3Q7QA 2EDCA 3PQDA 1WXIA 2QUIA 4WUTA 5KYYA 1I14A 2NXCA 2D0IA 5ES4B 3DTYA 5KHOC 1Z62A 3I72A 3S2GA 4AKIA 1J8YF 1IBKB 2CL5A 2ZTSA 2F3UA 2QD2A 2YL3A 3DOFA 3GLQA 4P1ZA 2ZUTA 4BECA 1JRLA 2NO5A 5LQKA 4JHXA 5E95A 2W2KA 1V55C 3IP5A 3ZKAA 1THMA 3W5UA 2A84A 2BEJA 3X2SA 4IY1A 4LMPA 2BRUC 2VR1A 1QTNA 2KHZA 1UKZA 4H17A 3MTJA 5T3UA 2CGEA 2D74A 4NYJR 3GEDA 2ZXWC 4DQXA 5BURA 1KVRA 4GKBA 4H1HA 4UDNA 2R5NA 3V00A 1Z22A 1AXRA 1FLDA 2FPGA 2Y9MB 4QTUB 3DWGA 4TKMA 4ITUA 1KK3A 1U6JA 3N3AC 3C7TA 2BI7A 3CLVA 1VPTA 3OKCA 4J90A 4KTTE 4RA6A 4EHBA 1KIAA 4WCFB 2DTEA 3QKSB 1J9GA 3LGXA 4ALIA 3QE9Y 2VEOA 4TOIA 3WVNA 2C7PA 4K9PA 1N9KA 5EXSA 2HRZA 3X1OA 2NTEA 3SBDA 1VCMA 2Y77A 3PDIB 4RIFA 2QLAA 1IHXA 4IFIA 3DBIA 1X7HA 1G8HA 2VF7A 4DLYA 3VR5D 1Y4AE 4RPHA 3V4LA 3JT1A 3Q85A 2UYGA 4J03A 5BN3B 3ENVA 3KOUA 3WJ7A 2Z1DA 4GNRA 3I6BA 3AVXA 5LOVA 4YUZA 3G8AA 1J0CA 4RSHA 1WV0A 1TQ4A 1Z7GA 1LNQA 2WUFA 4KV9A 1A3CA 2M98A 3IXLA 2UZ3A 4I44A 1R9NA 3GIWA 1JFFA 4DREA 1OJLA 2ORVA 1A9XB 4WV3A 3TJZA 1G8FA 2NVBA 3ASVA 4OHZA 4ERNA 2D1QA 1BMTA 3R6GA 4JMPA 1KH3A 2PQMA 2ID8A 4V24A 3PKJA 1YD7A 3B1YA 4XEHA 2HIMA 2EBFX 2CCGA 1U9IA 4FNOA 1RAHA 1WAMA 2CJWA 1QIGA 1UAGA 2BFDA 1I4LD 2ZBDA 1ZNYA 2ATXA 3RG8A 2BGWA 3OESA 1YBFA 1QV6A 2JAHA 4DSUA 4G4SO 1NJ5A 1TRKA 1FOEB 1YVUA 4REQA 2OZKA 1QAQA 1BIFA 2DC1A 1E32A 2JGDA 2WKQA 5DE3A 1GN8A 5FOUA 5CYFA 1OW8A 1ADBA 4BX3A 3ZG6A 5B3KA 3CW9A 2K7FA 3GLIA 2F1KA 1QE0A 3HCRA 5KNBA 1VTMP 2QZ9A 3W8NA 2KK1A 3S2EA 4CKBA 3KB1A 1C7QA 3FOOA 2MSWA 4QM7A 5K6RA 4LY9A 3RC8A 3WAKA 3VH1A 4YY3B 4RC9A 1POXA 1R0LA 4AJ4A 5AHOA 2A5JA 5FB3A 3B0VC 4F60A 3QPBA 5A6VA 3E9NA 4P7GA 3QVXA 3QUTA 1I10A 1PJ8A 4QXOA 4W7IA 3TW0A 3KOYA 1GDHA 1VHDA 1Y6QA 2EILC 1N0VC 2F67A 3NB0A 4PR3A 4PSVA 3ILSA 1N1EA 3IJ5A 4KXFB 4TSKA 4A16A 4ZI7A 1FMFA 4QYXA 4C7OB 2WHYA 2I55A 4ADSG 1U2GC 3IILA 1YJGA 1EFVA 1T29A 1T15A 3NHSA 5DV9A 3TQFA 4D80A 1NNEA 2I9KA 2IZ6A 4Z6KA 4ZGWA 6REQA 1RWBA 2O0LA 3EUAA 4XD7D 4OD4A 1TF5A 1SB8A 3MJSA 3DAYA 4G5XA 3OIGA 4KXNA 2YZSA 1AU9A 2XOXA 3VGJA 4AJ1A 2ZRQA 2A5YB 3LYHA 5C8VA 4G8JA 2I8LA 4PXSA 2ZM5A 2OP0A 2IQ5A 3AU9A 2DU8A 4LY0A 1UC5B 4MR9B 5HIMA 4DCCA 1LQ2A 1N0UA 4Z9XA 3S3TA 3FPEA 2IGBA 5EE5B 1SVKA 1VE5A 3AJ9A 1DRJA 4P7FA 3GHYA 2XLWA 2I5PO 4NFYA 4KQWA 1JFSA 3DMDA 4M54A 4OQFA 3N2KB 3FWPA 4LRWA 1RMYA 4O4IF 1EUCB 1CS4C 3RJ9A 4CVNA 1QO9A 1KJWA 1TQHA 1GU0A 3F3MA 5DYWA 4AE4A 2VCBA 2P9ZA 1KO1A 2WSBA 2WSSD 3FWNA 2HXYA 3C48A 3E1GA 2QX4A 5FL7D 2PK3A 4GE3A 1N6OA 3A3NA 4G9BA 2LCIA 4DPKA 2ZTVA 2AXPA 1E89A 2ZBGA 1LKXA 4ER7A 2BV3A 1YQTA 4AZ3B 1DBSA 1O8CA 5KPDA 5F64A 4E12A 2WBLC 1ZIYA 4CMJA 5C4GB 3M4YA 3DFMA 1DG1G 5DN6D 5KMGA 4HKTA 2FV8A 4QPJC 2VF8A 4TRMA 1ACMA 1SCBA 3NHJA 2LR0A 4BBAA 2EFJA 5EP3A 2JASA 4C76A 4MKIA 1MZVA 3KQYA 4F3RA 1C0IA 4O6YA 4IXWA 3HB9A 5LYJF 1EK6A 2FW7A 3RV4A 3QVLA 3W7AA 1ZSNA 2WK1A 3PQFA 1A5SB 2D4AA 4PYQA 5HM6A 2YV5A 3SSNA 3V8PA 1NG1A 2A88A 3DC7A 2EQ5A 3E9CA 4PYOA 1HZZA 1F2TA 2LRHA 2XBUA 4BP9A 5CLHA 4G7HF 1J8DA 1RRGA 2ON6A 3NJ4A 1D8TA 4JP2A 1EVJA 1XXHA 1Z5VA 3AT1A 1QGAA 1D6NA 2XRYA 3AHFA 3A1CA 1IOLA 2HJ3A 2V65A 3CLTC 3ORHA 1I5RA 1SG0A 1I3LA 2WF5A 5DKFA 4ENUA 4R3UC 2UYCA 3C7CB 5IKMA 4XSHA 2QRJA 1ABBA 1K3FA 4D3DA 3LESA 1G3QA 1P61B 1Z4MA 3JYLA 3Q9NA 4QECA 3HA7A 4JEIA 5CM8B 3WP0A 2I66A 1ATIA 2R60A 2QNIA 3MK31 1ZH4A 3WP1B 3O3OB 3SYRA 3ST7A 3WL8A 1U2GA 5DGIA 1BG6A 4EW1A 3BCUA 3RQGA 4ZLDA 2HKVA 5EIBC 4ECAA 3U6KA 2R84A 4G85A 2X6RA 2EHJA 2AWNA 3ZE7A 1OFIA 4NCBA 1J6UA 1LK0A 3PBKA 2X4IA 1AQJA 2C95A 2V6BA 3K2EA 2RHCA 1CULC 1PQ4A 4QFMA 3PQ2A 3TCNA 2WVQA 2RGEA 1VPDA 1LW6E 2V6JA 3R9KA 4XJXA 2QDKA 1IAVA 1QAOA 1JDZA 1SHJA 4HR7A 3TOXA 3UBMA 3WV4A 5BQ3A 3N6VA 3CVUA 1AZSC 2CUTA 5JMOA 4IQ8A 3VO1A 1KMIY 2R1VA 4XVUA 2D1SA 2PUVA 3DTNA 5EI5A 4UFPA 5CT8A 3KHTA 4RDAA 4FE3A 3AEUB 1NMSA 1U28A 2QUZA 4II2A 2WUVA 3NYLA 3O1IC 2AGVA 2Q6VA 3B1VA 3BN3A 4RDIA 4ZCSA 1Z17A 4DCUA 3TNJA 1XU4A 3BTUA 4JC8A 3ANXA 2RAVA 1M2OB 2ZSIA 4OQNA 5LD2C 5DQZA 3EBOA 4PX2A 4C4YA 1UJ4A 4GT1A 4MNDA 5LD2B 3DE8A 3RU7A 1LD3A 1M8PA 2GF0A 1I0LA 3H0CA 2TMKA 3HKDB 3TR6A 1IN7A 4ZVQA 1KQNA 1VJGA 3NAGA 1NVBA 3PHJA 2J4FA 3IAFA 4H7HA 1EB8A 1QWOA 3SBEA 3VH4A 4BKQA 1KU2A 2KLHA 3OTGA 2WI8A 3ZNQA 4Y6GB 4HVAA 5K3OA 3AEUA 1L6RA 1BRMA 1INLA 2FE1A 5LOVF 2JKYA 4WKGA 1RAFA 3ED1A 4NOLA 2P69A 4I1PA 3MYIA 5IUKC 1ZHOA 3ABOB 5DNVA 2X5XA 3I2YX 1WCWA 2FF7A 3A6ZA 4CLRA 3C41J 2ZBUA 1FSFA 5FFFA 5KNDH 3JQPA 1I9GA 4JROA 3OKFA 1EFVB 4MYDA 1F2UB 1CYDA 1BU5A 4QRDA 1QRTA 1YS1X 1Z5GA 3NNSA 2CUNA 1TEHA 2P6OA 3B3QA 3B13B 3IRUA 4G3XA 4ZI7B 5FWYB 1N5IA 4B33A 2SICE 2GWRA 4CETA 2ZRDA 1A5AB 5EMJA 5JV5A 3E8MA 1Z3CA 3P45A 1AV7A 1EQ2A 2JS7A 3JQCA 4U2BA 4OQQA 4P80A 4QBIA 1LS1A 1JHYA 3MUEA 3REOA 1ECCA 2Q27A 3RHTA 2HRRA 1P0FA 3FYDA 2VDUE 1R0WA 1VHJA 4DQUA 4YRMA 5JPDA 2GZAA 3QBTA 4L5CA 1XDDA 4UDXX 6AT1A 1PS9A 2ZIXA 1L7QA 3FFBA 4AYXA 1DDOA 1CLEA 1NHGA 4WBNA 2QIPA 2BE7A 2YIJA 3CO5A 3MYYA 3DJYA 5DS5A 3I2FA 3VR4D 2CL6X 1NVTA 1VHWA 3K4HA 3STTA 4F0JA 3WZ2A 1WM1A 2CJYA 1XB2A 3IUMA 3WNVA 1RVDA 3UAOA 3GFQA 1XLWA 1S4MA 2HCJB 1SY7A 4YK5A 1P29A 3ZG1A 1KE2A 2YFKA 3V5ZA 3JWJA 2E5LB 1SUAA 1V54C 3LRTA 1H9AA 3OO0A 4I8IA 1Y9EA 4JJAA 1XKLA 3SQDA 2WQ6A 3HTKC 1QQ6A 3IP9A 1ESDA 2C57A 1YKFA 3AHHA 3PFWO 4QJ5A 3TUZC 4P38A 3R6WA 1PL0A 2B5WA 2ZIFA 1UQRA 2PMKA 3SS8A 3DBRB 3EMVA 1E2UA 2ZWAA 3A58B 3IIIA 3ONWA 1QIFA 4KWIA 2WF8A 1G3IA 1UK8A 4L5IA 4Q34A 1AF7A 1G291 4CUZA 4XPXA 5DHFA 4ZDIA 3P9QA 1TF2A 4OLFA 1N2CB 2O8DB 1JHMA 1JEJA 1E2MA 2DEUA 1JTEA 3QF7A 4IQ0A 2C7BA 1Z2OX 3H2BA 5ECYA 1EE2A 1RVV1 4UTRA 2DHDA 3DH0A 2C9BA 1O5IA 4LXXA 4C4OA 3PDIA 4UU8A 1WB9A 4Q21A 3E3AA 2OEVA 1W0CA 1OXBA 2C0QA 3G2HA 3LY7A 4A0HA 2WTEA 1F9EA 1FJHA 1QGED 5HIIA 4AJ2A 4D0SA 4W7HA 1G8XA 4L22A 3EZHA 3BWVA 2WMYA 4RORA 4YV0A 4XLPF 3ZWIA 1QV9A 3FLAA 3B3GA 3GO4A 5LP6C 1R6UA 5FLYA 1F1JA 4RA6B 1H1TA 2VBCA 4HX2A 1MT0A 5BV1A 3JQGA 2XQIA 2Z2YA 3AH8A 3DEZA 3OT5A 3V5YA 5BUZA 2JG3A 5JFTA 3QW1A 4BDSA 1PG0A 2ECFA 4NZYA 3U3KA 4FGSA 4GGMX 1KJ8A 3OQ6A 3TSWA 4C7OA 3PC2A 4C0SA 3N1UA 2JIPA 1OLSA 1UBLS 1PFGA 2F48A 3P2JA 2NU9A 1E6WA 4FYMA 3DT9A 4QEZA 2YBDA 5LCXA 3UB3A 4CG3A 4CF7A 1SEVA 4NMMA 4Y6RA 5CXQA 5AVYA 4EY8A 1SBNE 4QD3A 4YJKA 4KNYA 4XJVA 4D57A 4Z3OA 1KPIA 2LGJA 2W2KB 4GP6A 1W0JD 2HK9A 1FDUA 4UPDA 4PLYA 5H02A 4XE5A 3I05A 3MILA 4BWVA 5G0VA 4Q9AA 4H7PA 2QJRA 5COMA 2ZI3A 3BG5A 3O8QA 5TXGA 1G2OA 4G24A 3OCVA 3B1FA 4J3FA 3LW7A 1K1EA 1HDIA 1R4NB 2EKBA 1ICIA 3IS3A 4CT0A 3PPIA 1VRWA 4HQFA 4AL1A 1Q7BA 3RTEA 2QTHA 3RUIA 3VZCA 2AJ8A 1LX6A 1Y63A 1S3SA 4EGFA 3OPYB 1RWOA 2YQZA 3BTOA 1CQIA 4FC6A 1YZLA 1YK1A 3T6GB 1XRQA 2QX9A 3JVIA 4II7A 2B9VA 4G8DA 3RBXA 3FR8A 3T5AA 1CZLA 4UMDA 3S2IA 4JTAB 3DNFA 3SJCA 1TT5B 1ZISA 1DRKA 1NIPA 3ROZA 4DLZA 5K9ZA 5ALIA 2M6SA 1AURA 4RTOA 4YL3A 2EJUA 3CV3A 5I9SA 5CCDA 1A9XA 2AQ8A 1CTQA 3F6CA 4HNSA 4FFVA 2WWTA 2PJDA 3H6GA 3N6XA 3W8HA 3BA1A 2H57A 2OG2A 1GKIA 5HS4A 2UXCB 4WD3A 3SGLA 3ECAA 4JOSA 4BQSA 4QI2A 1GADO 3IOYA 2EPOA 1Q0ZA 3AJ8A 1G98A 3GM1A 3BFXA 1OA1A 4NV0A 3LTNC 4RKEA 2XXJA 3NUQA 1RWKA 3WMFA 1FDVA 2KYHA 2LFDA 2AG1A 2X7JA 3S8YA 2TSYB 2Q8QA 4J9UE 1KQOA 1CPQA 1VE9A 3OIYA 4F7DA 2RGUA 4YXWA 1ABEA 1EVQA 1Y5MA 1TYEB 3MRTA 4PYNA 1GIAA 2VA8A 1M2KA 2FUNB 2WHEA 4PRKA 4YH1A 3WBJA 4MVJP 4JA2A 3HK2A 3A8TA 1FYFA 1EA5A 2E6KA 2Q3CA 4MQ9F 1XCLA 1GL6A 2HWUA 2AOXA 3L79A 3P0FA 3GGSA 4I9NA 2PMEA 5CDHA 5KVSA 5EE3A 2P41A 3DQZA 3E1KA 3QKSA 3S8MA 1KK0A 3BK1A 2RHGB 1OYOA 1CG6A 3AVPA 1FUUA 5L40A 3JS5A 4LK2A 4IDBA 4AP6A 5JDIC 4URZR 4RLHA 1J21A 1MD9A 3T0FA 4MIOA 2G82A 2WYWA 2FZVA 3L7NA 3QU7A 5JZOA 3DO8A 1LXCA 4JH0A 1HDOA 2ORIA 4C3OB 1Y5RA 4HFRA 1KNXA 3DC2A 3KUDA 5JAMA 3S2ZA 2QVLA 3IIEA 1SUFA 2VHEA 3JASA 2Z56A 4QYMA 5LWQA 1WBBA 4HEAJ 2XD9A 5JECA 1NLUA 1U2ZA 4N6GA 5B7QA 1Q11A 4GI2A 1F12A 1R64A 3BOSA 1ACLA 1K6XA 3SHTA 4ZTUB 3RSFA 1O6FA 1R0CA 3D6HA 4O02B 5M3BA 3VH3A 3BWMA 2O3UA 1IVYA 3MJFA 2Q7OE 2B5VA 2OOCA 4DBLE 4LCJA 4GL2A 3ZIBA 421PA 4Q4HA 3UN1A 3AVWA 3D43A 1COWA 5IZCA 4F6RB 2VJMA 4N5DA 4NYMR 3X2EA 3GM3A 4ZPXA 3QPVA 3SICE 2M32A 4YAKA 1GDDA 3VDRA 1E1QD 4GEGA 4UHDA 5FWDA 1MRNA 2CW0F 1BGVA 3OUUA 5JJCA 4E46A 4Q7CA 5DZSA 1JEAA 2Z0MA 4YP0A 4Q4LA 4Y2JA 3RYFA 3KJXA 1X70A 3DW1X 1JQJC 4Z53A 2I2WA 3NV7A 4JCCA 4XWAA 2P4UA 3F7MA 2VJBA 5CDFE 3PQ5A 1CIJA 4B5KA 3D4OA 2FR8C 2FLVA 4FBGA 2FUCA 5LA6B 3VVCA 2F90A 4I6EA 1JVSA 2MTBA 4KVFA 1EDEA 4PGMA 5TGTA 4IVPA 3VPCA 3W4IA 2J41A 4IYRA 4HEJA 3D3WA 2M4EA 2M9MA 3A05A 4TUYA 1QBGA 2F3TA 4EJ0A 1WO8A 3O8BA 3NETA 4E2XA 3KXPA 2FSHA 2XLHA 3NP9A 4S12A 2OGZA 4MYSA 4PC1A 5B2EA 2XYRA 2Y0BA 1S7GA 4BNJA 2XLMA 4PLCA 1HKUA 3ZQ4A 1PL8A 2EXXA 3NMIA 2ZJYA 3AEXA 1U0GA 4M9QA 1F8YA 5FO0A 5LA6A 5KOIA 3G2KA 4ZYWA 4YAGA 3CLUD 3KQVA 3H2IA 1OBVA 2EFEB 4H4CA 4MW9A 3DE9A 1HRKA 1T5HX 1KMHA 1FTNA 3TULA 2GN0A 3GFSA 2X1HA 4WNCA 1JSCA 4NPHA 5DF1A 4YCSA 5LQJA 3MXTA 1S01A 4DCJA 2C4WA 2YDYA 3AJEA 1Q5PA 1P2GA 3N8KA 4KOAA 1T1RA 3HDJA 4MQ6A 1E61A 5CLLA 2V98A 5C8DA 4IS3A 1H3EA 3PFCA 3PQ7A 3IOEA 2F1HA 4JELA 3ZVMA 2G5PA 3D8SA 5CFRA 1VBNA 2C8LA 4CQJA 3I92A 2WT9A 1M76A 3UK2A 1ENPA 3OOEA 4MW7A 2PLFA 4IUYA 2CXUA 4OUDA 4G0VA 2RGYA 4US2R 3I04A 1GPUA 4X64B 5DTEA 2DT5A 5ARCA 2X0RA 1MB2A 3MTGA 4OMFG 4AIIA 3EXEB 5JANA 1DO8A 4P92A 2BH2A 3DCYA 4EIWA 5GIPE 3U3ZA 3EVZA 4PGGA 4IV0A 2J5KA 1RM4A 1FRFS 1T24A 4LSZA 4BB0A 5D5PA 4L7VA 2O0MA 9LDTA 1V16B 1IOVA 3SPXA 1SKYB 2O2DA 1Q0DA 3AY0A 3JYNA 4M1YA 4D9BA 2WD7B 1AMOA 2C9YA 4BO7A 4J4BA 4YIHA 2IOHA 3DUFB 1KEEB 3I9JA 3LK7A 3RH0A 2CJFA 1UEXC 1V8PA 1OFGA 4G65A 1Z68A 2VNAA 4Q01A 3W6OA 2DR0A 3QVGB 2IT1A 5L9A