3E70C

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
318
structure length
307
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVILTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor
publication title Structures of the signal recognition particle receptor from the archaeon Pyrococcus furiosus: implications for the targeting step at the membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
total genus 105
structure length 307
sequence length 318
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00448 SRP54 SRP54-type protein, GTPase domain
C PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e70C01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3e70C02
2EFHB 2J0UA 2ANBA 1AJEA 1IN5A 2D7CA 4QOSA 4YMWA 3T1OA 3U6KA 1XFAA 5K8LA 3OIVA 4U5XA 5DYGA 5AUPB 4ITRC 1G3RA 2QT0A 3GFPA 4C2TA 4LBWA 2WJIA 1W49A 3GJ8A 3PXGA 4D0GA 4BFSA 2WM9B 5J4HA 3ZD7A 4OI2A 4JYBA 3CRMA 2PZEA 4WXRA 3T12A 2P6NA 2V1XA 4P4SB 1XMSA 2VF7A 2BEKA 3BERA 4NU0A 4YONB 4CW7A 5K8UA 1QVRA 5B30A 3MWJA 3THXA 5HTKA 1ANKA 3THYA 4ZDWA 5L3RA 1ESMA 4GNKA 5CITA 2ZSDA 5L3VA 4OJQA 2J9RA 4JLVA 1IXSB 4A4DA 2DFNA 3SC3A 4MKGA 3KUDA 3MWYW 3DDCA 1TTTA 3K9NA 2V3CC 2DYKA 4IDNA 2PZGA 2G1KA 1RJ9A 2WWFA 4TSFD 1U8AA 3KKOA 4FCTA 5SZJA 3OIWA 3VAAA 1Q3HA 3KTAA 4ZPXA 2BEJA 3IEUA 4EUNA 5KSZA 4X8MA 3H4MA 1LF5A 4Q00A 4UXHA 4O2RA 3HYRA 1KO4A 3ZZUA 2A5JA 2IK8A 1E1QA 2CJWB 4B34A 4S35A 2QP4A 3OIYA 3SDZA 4Z1MD 1R5NA 1M1YE 2CLDX 2WJJA 2ZE8A 2AHOA 3HDTA 3RANA 3WP1B 2ZSFA 1Q1EA 5LPNA 2FSHA 1DAIA 1F3OA 4YMSA 4H1UA 4PSAA 5TV2A 4POAA 1N6OA 2NZ8A 521PA 3SN6A 1ZUHA 3B9QA 2GEVA 2OO7A 4OI0A 2OAP1 5CJ2A 4KCGA 2MSEB 1G9XA 4EIWA 3DMNA 2O52A 1FMJA 1SVIA 1LY1A 2OXCA 3THWB 2PX3A 3FMIA 3LDAA 4JYCA 1CJUC 4OKSA 4BLTA 5JWOA 1E2PA 3X1DA 5KO2A 2HYIC 2QSZA 2YV5A 4OHXA 1FX0A 2QL6A 1ZIOA 4HB0A 1JEDA 1RKBA 3B7GA 3A1TA 1XD2A 3B1XA 1YZQA 2UKDA 1SKYE 3EARA 4NMMA 1ZMXA 3KKQA 4JMPA 1ZVQA 2XEXA 3VKHA 1XP8A 1G7SA 4JBXA 2GXAA 3QEJA 4E03A 3WNDA 1TPZA 4RFSA 1KI6A 5G41A 1TQ2A 3D8BA 2BMFA 2RCNA 3CPHA 1CIPA 3KXLA 1E4YA 1CULC 1UKZA 1F5NA 3PIRA 4NYIR 4M1OA 1AA9A 1KKMA 5GVRA 4PHTA 4M21A 4D0NA 2EQBA 1SULA 2WWYA 2FWRA 3WYFA 5JZVA 1PJRA 3M6AA 2R6CA 3EZ2A 2B7BA 2VP9A 4L9WA 1S2MA 2GEUA 4ZCLA 3UMFA 2REBA 1F6BA 1E9AA 1MO5A 3ND9A 1Q57A 1M7GA 3GJ3A 3IGFA 4IFEA 2QPTA 5EXTA 4HZUB 5F3WB 3CLVA 4HUQA 4NHOA 1A5TA 3GLGA 2O8EA 1E32A 2JJ8A 1NLFA 3K8YA 2HJVA 3IUYA 3L8ZA 4DDTA 1RPZA 3L0SA 3G5UA 4HYYA 5L8VA 3IKJA 2RGAA 1O87A 1E69A 3AUYA 3IIMA 2H92A 4BRUA 1MRNA 3LXRA 3NC0C 5DN6A 5KUTA 3QI2A 1WDTA 3BOSA 2C77A 1SKYB 4DSTA 3NXSA 2GXSA 1COWA 1OV4A 2AFHE 2FEOA 1MH1A 2FFBA 4GP6A 3FDIA 3K09A 2R6DA 4JLOA 2ECKA 3L0OA 3CW2A 3ZLJA 4DVGA 4WZ6A 2CNWD 2VSXA 4A0FA 1S3GA 2REXB 3WMFA 3B60A 3ZQJA 4V03A 1E2EA 1E2LA 4B3DA 1OFIA 3Q72A 1KK3A 4A2QA 1FMLA 5KPJA 5E7MA 4ACAA 1W36D 1HH4A 3AGPA 3LVRE 5LB4A 3BC1A 3KQNA 1U9IC 3QVUA 2UZ3A 2B6HA 3DEFA 1W7AA 4LJ5A 4LPSA 1IY2A 4IDHA 3IO3A 1AZSC 1IXZA 1JEEA 3TK1A 1JJVA 1NIJA 2JAQA 3VR3A 1P72A 2V7QA 1KSJA 2IS1A 2B21A 2F43A 3WBJA 3EZ9A 4NKRA 3EAQA 1U0HC 3SZRA 3T5DA 1VG0B 1G6HA 4FI3C 1GRRA 3SJAA 4ASUA 2QN6A 3NC1C 4LC0A 1U2RA 4UJ3A 4B47A 2G77B 1JI0A 3VKGA 2IS6A 4TMKA 4PSKA 2EFDB 1GFIA 5DLQC 2ERXA 3RRNA 4PZYA 1IN4A 4XOIA 2SHKA 1Z6AA 4P4SA 3AM1A 3LH5A 3SBDA 3PFIA 4ZDIA 4M9XA 4C7OB 1KI9A 3AVOA 2REOA 1GILA 4JLNA 1XMIA 3ZVRA 1O3YA 2WOJA 5GJCA 3MAAC 3VR5A 3DPUA 1DAFA 1T3HA 3K0FB 421PA 2O8FB 2ZVPX 1I4DD 4PZLA 1E1QD 3RC8A 4YMVA 4OJKA 2F9LA 3QPUA 2G9NA 3GFTA 2NMVA 3C16C 3EWSA 3IILA 4DLXA 1Z6TA 2XJ4A 4MGIR 2AN9A 2ZETA 4RFVA 4B2IA 1TX4B 5AWFC 2IYXA 4YXWA 4URZR 4NCNA 2CJWA 5JEDA 4QKQA 1E99A 2PLRA 1OHHA 1T4GA 2ORVA 3BFVA 3BJIC 4IW3B 4JBWA 1W36C 1MO6A 4OI1A 1P4SA 1W5TA 4K46A 3GPLA 2G83A 2NO6A 2A5DA 3FTQA 2QBYB 3I32A 1ESNA 1E9SA 1KI1A 4FIDA 3GLHE 3ZVMA 4DB2A 4CEJB 3G82C 3LNCA 2GJSA 4PO9A 1E9RA 4PXAA 2QAGC 3OEHA 2GJKA 3QKUA 5L3SB 5TVKA 2N42A 5SZHB 1GL7A 3Q5EA 4QC2A 1AK2A 2ORIA 4IOKA 4CGZA 4A8JB 4NZYA 3WBKA 1KI7A 1Q3TA 4BFZA 1ZNWA 3FWYA 4O0MA 2ZIAA 3C14C 3BD9A 4QJ4A 1JR3E 1MABB 3BH0A 3QPWA 5HE9A 4A82A 4BLPA 4D80A 1QVAA 1S4QA 1NBME 1Q1ZA 5HZHA 1FUKA 3FGNA 4W5JA 2WVJA 2HCBA 1KOFA 3PUVA 3AF3A 3CWQA 2GXUA 3B2EA 5B64A 3WXMA 3RS7A 5C2JB 1SXJC 2NPFA 1U98A 3AF1A 2LWIA 2JLWA 4B32A 2YYZA 3A1VA 2ZI5A 5J4LA 3LQRA 3KJHA 1AS2A 1QHHB 3KXIA 1D9XA 1Q0UA 3QKRB 4DLSA 2AL7A 1EG7A 5EP2A 4G5SA 4G01B 3QSYA 4B3BA 1N5LA 1X86B 2PCJA 2PJZA 1JB1A 2QPOA 1L2TA 4RVCA 1EGAA 1KJWA 3EPJA 4JLMA 3ONWA 4JVNA 4LRWA 4IEIA 1XB2A 1CLUA 3CH4B 3GLHB 4TMTA 1Z47A 1X6VA 3GMTA 1W0JA 4LCBA 2O0HA 5SZKB 2ZUCA 1EX7A 2W00A 2ZR0A 4W5HA 3ZYCA 1Z0DA 2P6UA 1ETUA 4Q01A 5AJYA 2XB2A 1E9EA 1Z0AA 3RS4A 2BJWA 2GAOA 1T91A 3RVBA 3OEEA 2OLJA 5DN6D 2ATXA 3LX5A 4HZUA 3OAAA 2I1QA 2RKOA 1COWD 1Z0FA 2C03A 2D62A 2ZRHA 1E2GA 1DE0A 1M6NA 3HPQA 4EQ6B 1KIMA 4JL6A 1G18A 1V5WA 1T5LA 4AKGA 4LJYA 1G5PA 4C0JA 5H8WA 5KSPA 5CB6A 2ZI3A 4UNSA 1W44A 2ZE6A 3WYGA 2Z4RA 1Z6GA 1CXZA 2VHUA 4C0QC 2GBLA 1YR8A 4UNQA 1WE2A 4UQOA 2V55B 1C9KA 2F1JA 3T34A 4ZI3A 5G3YA 5IT5A 4XWOA 1BYIA 2KBEA 1XF9A 1IM2A 3BAFA 1UKEA 2IYWA 3DOFA 2GA8A 2PBRA 2ZSEA 3QJYA 3NKVA 2V7QD 4XWAA 4FXPA 3BH7A 2IYSA 1VPLA 2ZAOA 5A4JA 4GFDA 3ZZ0A 1XEWX 5E3HA 5DNYB 2QPAA 2ZRLA 4ASUD 2Z4SA 2FPKA 4XTCS 3BRWD 4LWZA 5JHGB 3EWAA 1GRNA 3D6TB 2IXFA 2XB4A 2OBMA 1ONBA 1IN7A 3ADCA 1EFUA 1OFHA 1CJMA 2X77A 2J0SA 4LJ6A 1BOFA 4V0ME 4Q48A 3W3ZB 4E5UA 4DLYA 1D6JA 3ASYA 1LS6A 4TLDA 1G8YA 2O8DB 5EUMA 2A5YB 1E6CA 1J8YF 2WWHA 2ZRPA 1R4AA 3IIJA 4DRZA 1U94A 2ATVA 3IHLA 4DWJA 4D26A 1W4BA 1E0AA 1RRCA 4XJXA 3SHWA 4P32A 4BEJA 2HT1A 4HLCA 2GHIA 1J8MF 1P7CA 1T5IA 1TL7C 4HLUA 1WQ1R 4KSCA 4RY2A 2JIZD 1M7BA 4C7OA 2A7QA 2HDNB 3KL4A 4MGKR 5FFMA 4TMWA 4Q9LA 2EVWX 4FWTA 5KDLA 4JLAA 3DHWC 3K0FA 4PQFA 4F7WA 4YXWD 4G3XA 3GEIA 3NIBA 1TADA 2OT3B 1FQJA 2J3EA 5FTKA 3I62A 3H84A 4PHFA 5JEEA 721PA 1G5TA 2RHMA 1KK0A 1L8QA 2CE2X 2RGNA 3MMPA 2LCFA 4PFSA 3U60B 2QY9A 2GNOA 1U0JA 2C99A 3OEHD 1XZQA 2X1VA 3SYNA 3VR6A 3W5IA 1XPRA 4OHZA 2QI9C 5DH9A 4U00A 4Q9JA 3B1WA 5FPTA 4NP6A 2O0KA 4QM7A 3CNLA 2QBYA 1DAHA 4LI0A 4EAQA 3M0EA 1UJ2A 2QT1A 3IDQA 1FTNA 1GIAA 1VTKA 4CEJA 4BFYA 2WHXA 2GK6A 5L3SA 3Q85A 4FMDF 5FH9A 4IJMA 1G5RA 4B74A 4HDQB 2J45A 1Q22A 4A8JA 1OYWA 2IL1A 1JXOA 1I2MA 2ZREA 3I92A 4GOJA 1VYVA 4HZIA 3T35A 1KTVA 1BYUA 1TF5A 2IYZA 3BWDD 2YVUA 1MABA 4Q7KA 1W46A 1ZNZA 1W4CA 5DYIA 3CBQA 3MGCA 3CNOA 1Z29A 1SGWA 2R44A 2IS4A 1XEXB 1EWRA 3CF2A 2IS2A 1KGDA 2ASEA 3PENA 1UF9A 1ZC3A 4GL2A 3NEJA 3VTKA 4A0HA 1QHHA 4WA7A 2ERYA 3QKRA 3Q3JB 1R8SA 1PLJA 4JVSB 1NNEA 4TL8A 2F55A 1WA5A 1Y63A 1W0JD 2DFTA 3CF0A 4LBZA 4QBGB 1NG9A 1IN8A 1TF2A 4BLSA 3TRFA 3AF4A 1S8FA 4Z1MA 1WBDA 3OEED 1AIPA 1AS3A 3GLHA 5JI3E 1JPNA 2FN4A 2JATA 1VHLA 1KZ7B 3HPRA 1RW4A 1SQ5A 2VPPA 3CPEA 3K9HA 2VP4A 1E9CA 1I2DA 2FH5B 4AG6A 1LNZA 1S9HA 3BGWA 5KDOA 1JR3A 3W3AA 2YOFA 4G5QA 2GKSA 1NBMA 1XDBA 2WV9A 4RCYA 3WNCA 2ZPTX 4KVGA 1S9DA 2J87A 4ZV4A 4P4TA 5IF9A 1Z63A 1ZW6A 5TARA 5TMPA 4URUR 1IJFA 1GP2A 1IOZA 2Y8EA 4CRWB 2ZM5A 1DAGA 3Q8XB 1H8HA 3MSXA 1X1RA 2WAYA 3QOFA 2FSGA 4Q9IA 3WYAA 5C18A 4LZZA 1DO2A 4Q1AA 4EJSB 2WICA 1E0SA 2RGCA 4TQUS 1DAKA 3CH5A 5GJVC 4JSTA 4US2R 2AXPA 2GRJA 1K5GA 4EKDA 4B76A 1GVNB 5KNDA 1QHSA 3FMFA 4B71A 4BLQA 3R9IA 1J7KA 2BCJQ 4KVAA 3AKCA 3VHXA 3LLUA 1HQCA 1ZCBA 1S3SA 2X2FA 4LYFA 4QBIA 3W6NA 3EX7C 5FTJA 1NY6A 3KFVA 4UXIA 4M1MA 5B57C 1Z0IA 2VP0A 4WIAA 3MWKA 2YOHA 1UBEA 2ZI6A 4UJ5A 2QU8A 4GOKA 2Q21A 4DCUA 4LJ7A 1AGRA 2OCAA 1G3MA 4MDFA 2WIAA 4D25A 4Q02A 3UKDA 4MQBA 2OHFA 3L43A 3CF6R 1KSHA 4JVLA 1G20E 1E2MA 3K70B 1QDEA 1MRSA 3PEVA 1YZNA 1Z0KA 4N0DA 4C0KA 5BN4A 3UATA 2A30A 2N1BA 5EP1A 1X8KA 4N0EA 1AZTA 1W2GA 2BIFA 2O8DA 1OFUX 2DFKB 1AKYA 4Z8XA 3VMFA 4EFMA 1P62B 2R62A 4JLDA 1MV5A 4TLCA 4HB4A 3TW8B 4WXPA 3E5HA 4KO8A 1R6BX 1G291 3FFAA 2NTYC 4OQMA 2JLVA 1N6RA 4P33A 4FD2A 1DO0A 2GBLC 4IXNA 1JBKA 2PH1A 4YDSA 1GOTA 2FV8A 3O8RA 1ZM9A 2EFEB 2IW3A 2FZ4A 1L7VC 3A4LA 3RRYA 1JQLB 4TLAA 2JLZA 3PG5A 4UNNA 4S2EA 1A2BA 1LF0A 1CBUA 1VCMA 3QF4B 2J1LA 3EIQA 3QKTA 3U61B 4MUBA 1G7TA 4YMTA 3CRW1 2YNMA 1JR6A 3V00A 1NVWQ 1KMQA 4F93B 2XTZA 3MJHA 2YINC 3LBNA 2X19A 3U5ZB 4JT4A 1B0UA 3P32A 4LV8B 1KMHB 4V0MA 5BYKA 3FKSA 3QNUA 2E9SA 3B82A 5H68A 3RNLA 1GITA 1TU3A 4XVUA 2NO1A 3OF5A 4OHYA 2W2XA 2HF9A 1UBGA 3LW7A 1ZUIA 4FMDB 2O5VA 1ZD9A 3I1FA 2KB0A 3SQWA 3REGA 3PUZA 1BKDR 4C0LA 1RIFA 4OI4A 4HI0E 2L0XA 3A36A 2ZJAA 3NH9A 4PC7A 4YMUA 1OB2A 4OHWA 4OK6A 2P5SA 5KU1A 2D06A 1ZIPA 1A2KC 3T1QA 4BLRA 3M1IA 4F92B 4DT1B 4HDOB 3NVAA 4HLUC 4B3XA 1YZUA 2ZE5A 2ZU0C 4EPVA 5A5GA 2CL6X 3RRZA 3VNUA 1XEXA 3VX4A 4D4KA 1DOAA 2CDNA 4IKEA 5HR5A 5FOSA 1SVKA 2XXAB 3K0SA 1XMVA 1BIFA 4ZI2A 1BO6A 1LFDB 2WSMA 1UAAA 3BXZA 1Z2AA 1D2NA 3TR0A 2NQ2C 4X8LA 2C98A 2OXRA 1E2HA 3IIKA 4C2UA 2BBSA 5CIWA 3T61A 5C1BA 4Q1BA 1P2VA 4ZKDA 1NY5A 2RGNC 3D31A 3IEVA 1SZPA 2WKPA 4NYIQ 3U7GA 3GD7A 4V0LA 1FOEB 3R7WA 2CK3A 4LHXA 5AK0A 4GBMA 3QEOA 4M22A 4PPGA 2A2ZA 5A0FA 3AF2A 5JI2E 2DBYA 3AUXA 4NPHA 3PEWA 3O8DA 1D2MA 1JR3D 4ABYA 3QE0A 1G3UA 1NBMD 1HT2E 4JLPA 3VQTA 1SVLA 5FPKA 2C9CA 1QF9A 4M1WA 1CJTC 3LRPA 1VIYA 3TNFA 5CYOA 3LFUA 1II0A 1H8HD 1SVSA 3NH6A 3TLXA 1KZGB 1NVVQ 2RH5A 2ZI4A 3LAWA 3CPJB 3AVUA 4A8JC 5GJBA 1OH8A 2R6GA 1EFHA 1VHTA 2ZE7A 3VR2A 3MUFA 4TZ6A 1MKYA 4Q9HA 4B48A 2CE7A 3RRMA 5CM9C 4A15A 1ZM2A 2WKQA 1UPTA 2Q9AA 2BBWA 4BGDA 2ZU6A 2VTKA 3B5JA 5H70A 2CCJA 2QA5A 2ZRBA 1E2DA 2C95A 1NL3A 2G0TA 3IO5A 5EXSA 4EJSA 1DS6A 2AXNA 4ZO4A 3ETLA 5DGXA 1ZUNB 2QMUA 2ZRGA 1G41A 4AC9A 3QQ5A 1DTSA 3TMKA 2V8OA 2JLSA 3U4QB 2NO7A 3K1JA 4B44A 1T8TA 2P65A 4AIIA 3H1TA 2NPIA 2CMKA 3TSZA 2DWOA 2W0SA 3CWZA 5AJZA 4AKEA 4JLJA 5LD2B 5E7JA 1TEXA 4MYUA 3OESA 5EXPA 4WOPA 3T15A 2OCBA 3ADDA 3RC3A 4OK3A 5CLQA 1ZU4A 4LUCA 1JAIA 1YZKA 5HKKA 5G53C 121PA 3IBGA 3O47A 4DCVA 1RVDA 3SYLA 3QXSA 2W6JD 5FUYA 1XTSA 3EG5A 1XCPA 5HCNA 4LBVA 4AY2A 5FUXA 1WF3A 3LY5A 4M0LA 1KJZA 3B78A 2HT6A 2VP2A 4EPRA 2BC9A 1X8JA 1VKJA 3TKLA 1ZD1A 5C4GB 3FMPB 2J5XA 1ZD8A 1U0LA 2AR7A 4E22A 4G5GA 4EPYA 2HF8A 2BMJA 3TSWA 3KKMA 2B7CA 4D82A 2OUKA 5CK5A 1NMZA 5F98A 3KDSE 3QG5A 1WXQA 2VBCA 5FI0B 3O8BA 2W2VA 1JPJA 2ODNA 3SYKA 3R20A 1XXHE 1F2UB 5DISB 1XD9A 4A2PA 5DO9A 3IQXA 1E3MA 1YKSA 4L4UA 1GRQA 2VA8A 2GF9A 2YOGA 1N5JA 2NZJA 821PA 3V4FA 5ELXA 3CZPA 4PPFA 2IBMA 4R9UC 4PAQA 1LV7A 3ZH9B 3C15C 1Z06A 1T8UA 3RYTC 1UDWA 2CCGA 3UWKA 2D2EA 4EPWA 2WPDA 3VHLB 2HV8A 3QF4A 4BPBA 2ZJ5A 5EE5B 3FKSD 3GJ5A 2R6AA 3AH8A 2WJGA 3AVVA 3DVLA 1OKKA 4UXJA 2CBZA 3W8RA 2GEDA 3CZQA 3A58B 3TR5A 2VH5R 1W47A 5AJXA 4QNMA 3CONA 3CRRA 2UZIR 5L3QB 3P26A 2GWHA 1NN3A 2I3BA 1V43A 2YC4C 3REFA 2FPMA 4XVQA 1Z5ZA 1OXUA 3C5CA 1P9RA 2R6FA 4M1TA 5AJWA 3M4YA 5HZKA 4QHSA 1W48A 2ZRJA 3QBVA 5TXGA 1FZQA 1JECA 3ZQ6A 2IUUA 3QF7A 3F3YA 2B8TA 2DY1A 4OL0A 5JMTA 1MOZA 1XXHB 1CTQA 2H16A 3CRVA 3PEYA 1ELOA 3LW8A 3ZVNA 1YJ5A 1WBBA 1Q12A 4PPQA 5G40A 1G1MA 2HJGA 1LS1A 2D4HA 4YQFA 4CEHB 3ZIAA 4DT1A 4RD3A 3QUSA 3KFXA 2JIZA 2VL7A 4B6EA 2ZJOA 2GVDC 4OYHA 2RGEA 5J40A 2VLIA 1OXSC 4LYJA 2QROA 2XXAA 3W90A 1EFCA 4TYQA 5FOUA 5JFGA 2BV3A 3H86A 1F2TB 1XTKA 2CK3D 2QAJA 3MD0A 4IVPA 2W83A 3RWMB 1R0YA 1W4AA 4KBGA 1DADA 5JCPA 2QTVB 4D4LA 2KJQA 2NO0A 2GCPA 4LSGA 3QIAA 1XRJA 5EZ6B 1KI4A 2IYLD 4OQFA 1P75A 1UEJA 1XWIA 5CM8B 4RKFA 3SBEA 3BB4A 4HAWA 2HXSA 1Z3IX 2BMDA 4OQNA 4HAVA 4A92A 2QMHA 2GDJA 1E9BA 1ZBDA 2OE2A 5D3QA 3V9PA 3KXKA 1NG1A 3C4JA 1R10A 4P0TA 5AUOB 4NE2A 2JLYA 3UIEA 1GSIA 2OILA 1NN5A 4K8OA 2G3YA 1ZYUA 2E1RA 2ZRAA 5KSYA 3THWA 1M74A 2OAQ1 2JGNA 4EDHA 4FCWA 4D6PA 3U7EB 4JJKA 2AK3A 3VX3A 3VKWA 2ZJ2A 1KO7A 4AI6A 2WIBA 4PC3A 5FPSA 2C04A 4Q4JB 3B1ZA 1G4UR 4LHZA 5BWMA 1P9NA 2XGJA 2V6JA 4NYJR 2GF0A 2X2EA 1VDZA 4NTZA 5EQTA 1IY0A 1XJQA 5CYPA 3TVDA 3AVTA 4H9GA 5DI9A 5JRZA 2P67A 5BQ5A 1KDPA 4L15A 1XTIA 4DBLC 1SVMA 3PCRB 2VSFA 2FG5A 3CM0A 2J7PA 2C2HA 2D74A 4AG5A 4FWIB 3SI7A 2ZAMA 3ZVLA 1R8QA 2GVZC 4XIGS 3AQ4A 3TIFA 1RE0A 6Q21A 4KLNA 3BORA 3U4QA 4ZCMA 5HKKD 4PZZA 2O0JA 1D8TA 2XSZA 5JHHB 2V4ZA 1EESA 2G1JA 1NJFA 3TE6A 3I4LA 1HEIA 4PC6A 3KQLA 1E9DA 5C46F 1WP9A 1DELA 2KWIA 5M04A 1YR6A 2F1RA 3K70D 4JSYA 3KUCA 3EC1A 4LDJA 1GG2A 1UEIA 1KO1A 1R0XA 2H7VA 2W0MA 1FTSA 3WRYC 2FGKA 1P2TA 2IC5A 4BECA 3AKEA 2UVQA 5B58C 4LV6A 2ZI7A 4G5RA 4XTRA 5FPYA 3TGPA 3E70C 3TH5A 4BWYA 4CF7A 2J0VA 4DLVA 3WRXC 2XJ9A 2QMEA 3CX6A 3CNNA 2CL0X 5EE9A 2H18A 4Q1CA 3U44B 1G7CA 2OG2A 2XTMA 4ESVA 2BBOA 2OEPA 2G6BA 3QKSB 1IQPA 3B6EA 4DUGA 2CHGA 4NCKA 4EJSC 3ZZTA 1B23P 3GJ6A 3U3JA 3TBKA 2CVFA 3DKVA 4QXAA 1XD8A 2F1IA 4X8HA 4QGGA 1ZM4A 3W8NA 3KKPA 2CCKA 2WPDD 5BYJA 1W4RA 3AVXA 3I5YA 1VYTA 4RD0A 3SHFA 4Q4LA 3U3KA 2BCGY 4D4MA 1OKKD 2ZS8A 4DDVA 2GJAA 4LHWA 2CL7X 3AF0A 3H0KA 4LYHA 3ND8A 5FTLA 1QHYA 2HLDD 1A4RA 3GCGA 3MG9A 2QP3A 4MH0R 4CDGA 4X8OA 1U8YA 2QM8A 2YWHA 2J0QA 1XTJA 4A6XA 1MT0A 3N5CA 4HEJA 1T6NA 1OH5A 4CEIB 4Q4AB 5IRCD 2ZS7A 3FYHA 1RC8A 1FW6A 3WHLA 4LGMA 4MYTA 2ZRNA 4DHEA 3T1VA 3ICEA 1CR4A 4HSEA 4QG7A 5L3QA 4B2LA 4MYHA 3DM9B 4BZQA 2ZR7A 4ZKEA 3NG1A 4W9MC 2I4IA 3K53A 3SJCA 2JJ1A 2ZRFA 2H57A 5FTNA 3W6OA 3K70C 4JVMA 5LB2A 1OIVA 3DM5A 4OHVA 1KNQA 1FNNA 3J81k 3ZIAD 3BS4A 3DZ8A 3K09C 4GSYA 3EZ7A 2PX0A 2OESA 4GZMA 1CU1A 3LXXA 4M2LA 4KSBA 1UKVY 4DSUA 4O3MA 1XXHA 4Z51A 3RAPR 1QBKC 4B2PA 4US1R 3FMOB 3CKLA 1GUAA 2O8FA 2GK7A 4NCHA 5AUQA 4NH0A 4CEHA 2ZXUA 1NJGA 4B6FA 5EXXA 4ON9A 4A6PA 4BQSA 1EX6A 1UBFA 4LK2A 4GT1A 3AEZA 5FOTA 4DDUA 1SXJE 4KYIB 1ZRHA 3KJGA 5DSZA 3HP1A 3SJZA 1F2TA 2ZJYA 3RHFA 1CJKC 1XJCA 3C5HA 4I1SA 1OSNA 4JLKA 3PVSA 4RD1A 4RJLA 4RZ3A 4XD7A 2QORA 4ERNA 2AX4A 2KI5A 4JS0A 2FJUA 4RD4A 2BHRA 3EA0A 4G5OA 2XZOA 4LPKA 4MGYR 2OCPA 1P3JA 2RGXA 3EXAA 1EFRA 3PUXA 4KFSA 1HQYE 4NYMQ 4PO8A 4HAZA 1TU4A 2RGDA 4TYPA 5KHOC 1YVDA 3U6BA 1T9HA 1N6NA 2QAGB 1KK1A 4GZLA 4O25A 1Z2CA 4NL4H 5HCIA 2BKUA 1KYIA 4V0NA 4P31A 1E96A 5FL3A 4TL9A 3LO5A 3K0CA 1WRBA 4PQRA 4DJTA 3DKPA 1UFQA 2JA1A 3FFBA 3L8YA 2BJVA 3PUWA 4HDCA 1LVGA 1YZLA 1VYUA 2ZQ5A 3NDBB 1KO5A 1XZPA 2J7KA 3BH6A 4KJZA 3UMRA 1N6IA 3O8CA 2YHSA 3CO5A 4JL5A 4L8GA 3IBYA 2E87A 2J7PD 2GZDA 4Q4JA 2J41A 1N2CE 1M8PA 5DI3B 3PUYA 1KDRA 3A6PC 2ZTSA 1TNDA 4MKIA 1SXJB 2DFLA 4D0LB 1G16A 1JALA 1QHXA 1US8B 1KHTA 1XBTA 3N70A 4II7A 4NDZA 4C0SA 4BEBA 4ILEA 3QPVA 2IF0A 1ZU5A 2XSZD 1VIAA 2IEYA 3QXCA 1YU9A 4GP7A 4F91B 4AD8A 1OE0A 4JT2A 2Z0MA 2KSQA 1K6MA 2ZRKA 4CVNA 2G0NA 3UG6A 2GCNA 3KTAB 3W9YA 2AFIE 1SHZA 2QUZA 3GQBA 4Q7MB 3AGQA 3AP2A 2BOVA 3VR1A 3A1UA 3U3MA 4IEEA 4QRHA 4CYMA 3MCAA 5GVSA 2MSDB 221PA 4UKDA 1HT1E 1BMFA 2G88A 1P6XA 3AP1A 3W5JA 4MRVA 2DB3A 2EYQA 2IT1A 3WP0A 2YZ2A 2FSIA 4WZAE 3DZDA 3S1AB 1RYHA 1Z6YA 1ODFA 1P2SA 4HAUA 4XVRA 3TUIC 1MO3A 3GEEA 4LC1A 2I1VB 1KDTA 4BFWA 1HTWA 3B8HA 4HB3A 4TQ9A 4EQ6A 4MGZR 4URXR 4BRWA 3ZJYA 2O8BB 5EUQB 2A78A 1HE8B 1CR1A 4DUGD 4TMVA 5JCZA 1DG3A 3UG7A 2BM0A 4RZUA 2V54A 3ICQB 1CS4C 3U44A 4GMDA 4MRNA 3OIUA 2XITA 1NIPA 5DHAA 5JWHA 3SU8A 4EFLA 3TSOA 3F5FA 5LDDC 5KYKA 2QM7A 2RB4A 1TUIA 1NLZA 1XEWY 5FPHA 4BZPA 1TMKA 2DPXA 2OLKA 2PMKA 2OFXA 2ZSAA 2DR3A 3FKQA 1YRAA 3R9WA 1I4TD 3QXJA 1NKSA 1KY3A 2FX3A 3SE0A 1HYQA 2Q3MA 3EA5A 5FTMA 1II8B 3EC2A 1XPOA 2PZFA 3KB1A 2V1UA 1E2JA 5SZIA 5FBQB 1GZSA 4NCJA 5LD2C 3LV8A 3HU3A 1E0KA 2AWNA 4KU4A 4J0QA 2NG1A 4TYWA 1GDDA 2WWGA 2VP6A 2JJ1D 3ZS9A 4BLOA 4N1AA 1T0HB 5F2EA 4JZKA 3HWSA 4CEIA 2P3SA 1Z07A 1XJ0A 1N5IA 4Q4AA 1Z6XA 3UANA 2P5TB 4PHHA 5JRJA 4FINA 1ZNYA 4NCIA 2W6JA 2Q9BA 2IYRA 1XCGB 3VU9B 1C4OA 3AVQA 1CP2A 5FL7A 2O8EB 1NSFA 4JLBA 2H17A 3AVYA 4MYCA 4D4JA 1K8RA 3OE7A 1NF3A 4KFTA 3ZS8A 3B1VA 3AV0B 1E4VA 1E9FA 1G17A 1Q1BA 2XNSA 1QG4A 1OLOA 1E2QA 1OH6A 2WKRA 1DVRA 4D2IA 2IX3A 4P4UA 1OXVA 2HCJB 1AS0A 2WSSD 3RS2A 1G3IA 1M34E 4EPTA 2ZITA 4F4CA 4LOAA 2EFGA 3T06B 1WGWA 4HB2A 2KE5A 5DHFA 2Q9CA 3X1ZA 3BFXA 1OIWA 3EW9A 3IPYA 4XD7D 4PC2A 5K8TA 2F7SA 1CJVC 1OT3A 2QMOA 3QVVA 4IDPA 1R5BA 2WOOA 4Q9KA 5EE0A 2IF2A 3WMGA 2YKGA 4RD6A 5C4MA 1EFRD 4KBFA 3A4MA 4NBSA 2CLCX 4F4JA 3OZXA 4KAXA 1PUJA 5KDDA 2IWRA 4E07A 2QE7A 2LKDA 2FFHA 1KO8A 1EWQA 4HAXA 1KI8A 5FOWA 1FUUA 4ZDJA 1PZNA 2MMGA 2F43B 5KSOA 1WCV1 3I8XA 1KAOA 4IDQA 4Q03A 1G7RA 2JJ2A 1RRFA 2QAGA 2DWQA 3LA6A 4PTLA 3U7HB 4XSGA 2F3TA 4Q66C 5JS8A 1HY3A 3K9GA 1MO4A 4M53A 5EP4A 3AB3A 1WB9A 2W6IA 3ECCA 3I72A 2OFWA 1E2KA 3CX8A 3D3QA 2QP9X 1JJ7A 4M1KA 5JWRA 2IHYA 5DI3A 2ZSBA 4NONA 2ZYWX 1SXJA 4IDOA 4GMXA 1D2EA 3X1YA 1G8GA 1HA3A 1US8A 2OV2A 1P73A 5FR1A 4B33A 4TMZA 5FBRB 3WHKA 1NI3A 3SJBA 4DIDA 2AKAB 1XX6A 1OIXA 1SKQA 2GCOB 3LLMA 1XNJA 1BMFD 4V0KA 4L5BA 1LTQA 2ZROA 3AKDA 3U3OA 1H65A 4AYWA 4TT3A 2XTNA 1PLLA 2JEOA 4M8NE 2PT5A 3UWOA 4DLRA 1XPUA 1JAHA 3RSLA 1TQ6A 5FR2A 5BN3A 1S1MA 2HYDA 3X2SA 1ZM3A 2ORWA 2XX3A 2J46A 4G0NA 5K8IA 1VG8A 1GNRA 1Z22A 5BN5A 4A9AA 2XZLA 4BFUA 2B92A 2IEZA 4Y0AA 4U02A 3S1AA 3FHTA 2FU5C 1AQUA 4BFXA 3JVUA 4LHYA 2QTHA 2WWIA 5JSZB 2QEQA 1XTRA 2EWWA 3BB3A 3PEUA 3FB4A 4GI7A 2QGNA 1KDOA 2A5GA 1CR2A 1NN0A 3HR7A 3F0TA 3K0CC 4YDHB 5LBIA 3GJXC 4C0HA 2AWOA 1VG1A 3CRQA 3SS8A 1QHNA 2O8BA 1CRPA 5D3MB 3VFDA 1RRGA 2IUSA 1MR3F 2QQEA 2WBLC 1KNXA 4PR0A 2VRWA 2OM2A 5TDHA 3GLFE 5TY0A 1P61B 4IOJA 1W2HA 4DKXA 1FP7A 1SVWA 1G3QA 1OYYA 3FVQA 3GEHA 1UM8A 4QNRA 1IN6A 1NMYA 3CR7A 4HATA 3P4YA 2BVNA 2P2LA 1YZTA 1SHKA 2VSOA 4R2HA 1I4LD 4Y0VA 2P6RA 3WNBA 2IXEA 4TLEA 5DE3A 4JJZA 3DMDA 1CRQA 4AKIA 1N5KA 4Q7JB 2ZUBA 4AYXA 2MSCB 5JLJA 1II8A 1YQTA 4LJ8A 1ZCAA 3U3RA 1IAQA 2YWEA 3HU2A 3SNHA 1GTVA 1XTQA 2OBNA 4AWXA 5FL7D 1KSGA 3KJIA 4KV9A 5G3ZA 3LQQA 3FHCB 1A7JA 3NBXX 3OE7D 4CIDA 3HJNA 1F48A 5FBVB 3SEAA 3BIFA 2Z5FA 1SVOA 3IPXA 3LD9A 1K5DA 2A9KA 2RMKA 1KKLA 1NP6A 1NKTA 3W6PA 2QNRA 1ZINA 1DEKA 4FMBB 5IK2A 4TN1A 2IYUA 4KXFB 3VU9A 2ODEA 4GPTA 2B8WA 4HUTA 1RFLA 1T3SA 3IQWA 2F6RA 3QXXA 3GLFB 1DG1G 1F60A 4I99A 5CLLA 3GP8A 2WMOB 2PCLA 2XZPA 1DPFA 2XNDA 1R2QA 2D2FA 1NVVR 3CUEF 4Q1DA 2O8CB 1CEEA 4OK5A 3KJEA 2WJYA 5J4YA 1Q44A 1J70A 1G64A 1AKEA 4C30A 4TWZA 4FMCB 1JQJC 3P27A 1IHUA 1KI3A 1G19A 5E7IA 2IWHA 1QZXA 4AKHA 1FP6A 2EW1A 3V4RA 2EWVA 2FA9A 4QM6A 5JJKA 5JBQA 3F8TA 5JJIA 5FOVA 2QRNA 3GLIE 2NGRA 2QE7D 1X8LA 1ZC4A 2WZQA 3QBTA 5IDVA 2GETA 2C9OA 2OSBA 3RDPA 1DAEA 3LWNA 1G8PA 1S96A 3NWJA 1N25A 3EIEA 1GAJA 2HLDA 4TLBA 4DLUA 3I8SA 5CIQA 2DHRA 4ACBA 1N0UA 4DSOA 1S0UA 3A4NA 2WWWA 2JJ2D 1FQKA 3TAUA 1KMHA 4KODA 2HUPA 2VEDA 1YE8A 2YJTD 2AKYA 3MRSA 2W58A 4LHVA 1Z8FA 2JLQA 3EASA 5H1YA 3RABA 5KOYA 3UPUA 3MJRA 2F9MA 2W6ID 1E2IA 5B2ZA 4RZXA 4BFTA 3BB1A 4LX0A 4DB4A 3OHMA 3NBYC 4B3GA 1OJLA 1FNMA 2CHVA 4IXMA 5FUWA 3NBFA 4RZ2A 1L4UA 1VMAA 3NTUA 1UKYA 1SXJD 4M4SA 4OQLA 4NYJQ 4PAMA 4EPXA 1OB5A 1Q1QA 1QHGA 1HURA 3PR1A 3KQHA 4DXAA 4B73A 3LBIA 2MMCA 2FGJA 1NRJB 4GOXA 4PC1A 1E2FA 1IY1A 3X1WA 4B35A 2JDIA 3KKNA 3GLIB 3PV0A 3C8UA 5JS7A 1BS1A 4TT3D 4URWR 1C1YA 1G21E 2C96A 2NOAA 2P0EA 3A1WA 4QJ5A 4DCNA 3AVWA 3VNVA 5DIFA 4PQYA 2BMEA 3K0AB 1XCMA 2GCOA 2Q0HA 3MFYA 2JLUA 4OBEA 4Q1FA 2JLXA 1GKUB 2HXYA 3AKYA 3SFVA 2BKEA 4B3FX 2OFOA 1R0WA 1EK0A 1OFTA 4MRSA 4US0R 4DIEA 2J59A 2YWGA 1CF4A 3I73A 1IXRC 2LKCA 1FL9A 1VCIA 4TMXA 2ODWA 2VHCA 2JCSA 4B43A 1GKIA 5E95A 2ZRIA 1KAGA 2QZ4A 2RGGA 3BK7A 1GM5A 5JSZA 5JJLA 4KHZA 4MITA 3RS3A 3QENA 4JKIA 1U90A 4XSHA 2YWFA 1J99A 3JZMA 2PL3A 4B75A 4QJ3A 4FN5A 2QENA 3RS5A 4ARZB 4LV5B 2Q6TA 2FPLA 2GJ8A 4WZBE 4TYNA 5KNBA 3QY0A 5D3MA 3TUZC 1OPXA 4IOLA 2BBTA 2VQSA 5JECA 2QQ0A 4HLQB 4MRRA 1N3BA 4KYUA 2AK2A 1N6KA 3EPKA 1A1VA 2BM1A 2QG6A 4ZDKA 2WJVA 4URVR 2IYVA 2GJ9A 2ZRDA 1M2OB 3I5XA 4IVRA 1QRAA 2QTFA 3DO6A 5FUVA 1R7RA 4R7ZA 4YLGA 4JBYA 1H8EA 1U99A 2C78A 3K9LA 5AR1A 4AK9A 2XOKA 1VG9B 3B13B 4Q7LA 2R8RA 4KITB 4PAOA 2PEYA 1NSTA 1XU4A 4TTPA 3UXMA 4L16A 3TW4A 2IYTA 2FDCA 2AD1A 3SQXA 3NHAA 2RHDA 4XWKA 4TZ0A 3QG1A 2H5EA 3HU1A 1J90A 4A1FA 4CZ2A 4FW9A 4QHTA 1N6HA 5IK2D 1IONA 1OW3B 2GZAA 4I81A 5KNCA 5CK4A 1PUIA 2ZJ8A 3ASZA 3L0IB 1E98A 1X1SA 2ZEJA 1P5ZB 2C9YA 3TVTA 3DOEA 2HEIA 1VECA 4KFUA 2XNDD 2WJHA 5HPYB 4GRAA 4DC9A 1YR9A 2FMXA 4OQXA 3Q7QA 3CR8A 3P1JA 4IOMA 1E1RA 4M1SA 4E09A 2JASA 2Q3HA 2WWXA 2EFCB 1DBSA 1ZM7A 2GILA 2R9VA 3KB2A 4I4LA 4MRPA 4C0BA 3U2QA 1N6PA 2N46A 4JKYA 3GLFA 3GJ7A 4I1OA 2O8CA 5EE3A 1F2UA 3P4XA 4TL6A 4QGAA 2CVHA 4W7SA 3OFNA 5J47A 4BZXA 1Z28A 1W1WA 2CXXA 1OXXK 1D5CA 3R8FA 1IJEA 1P60A 4Q5IA 3CX7A 2FNAA 4DDWA 1DAMA 1IBRA 2QGZA 2CLSA 3FOZA 1NVUQ 2Z6VA 4W5WA 3AVPA 4QBHA 4Q4HB 2W2TA 4CT5A 1E79A 1GNPA 4WVFA 4PSVA 4WBSA 2NIPA 2ZYVX 3H2YA 1T3LA 5FI1B 3FPAA 3WMEA 2AD5A 1HUQA 1G8HA 3K0EA 5CDFE 2GZHA 4F4IA 4K81B 2V6IA 3Q9LA 3TAHA 2RAPA 4AURA 3RS0A 4MA4A 4IVQA 2ZI9A 4RD2A 1RZ3A 1OH7A 1R0ZA 4M1YA 1ZJ6A 3ADKA 2QRZA 1TEVA 4I1UA 1TQDA 2C5LA 4RSGA 2Z43A 5F9HA 4QHYA 5J5CA 2PT7A 4ZIRB 4WW0A 2DCUA 1AN0A 4R71A 3ZD6A 2H1LA 1G8FA 2JDID 1AGPA 3L0PA 1PLKA 1TF7A 2OZEA 4LJ9A 2ZRCA 5FBWB 1NLYA 2IYYA 4R98A 3A8TA 3VR4A 2OCYC 4BUJA 4KI0A 1Q21A 2EYUA 4U7DA 1YRBA 4R2IA 2NO9A 2ANCA 3X1XA 1OXTA 2WSSA 2WTUA 4L9SA 3HR8A 3GLIA 4F38A 3TQCA 1FFHA 3T5GA 4GDFA 4M9QA 3I61A 1NVXQ 1Z83A 3R8CA 2VIIA 4LJ4A 2R2AA 1JXMA 5AJVB 3K0AA 1AM4D 5AUNB 1OHHD 2J0UB 1T0JB 1NMXA 1W36B 1HE1C 2V9PA 5F9FA 3EZFA 3CIOA 4DCTA 3PITA 1W0KA 1XEFA 1R5OA 4D81A 5KPDA 2WAXA 3L82B 4PHGA 4ZCIA 2ZYTX 4MDEA 2IHBA 1GL9B 4RCZA 621PA 3RLFA 4C0AC 3EIHA 4EFNA 1GNQA 1KK2A 3W34A 3R9XA 1E94E 2IXGA 3U7FB 2FSFA 3I3SR 3P20A 4LBYA 5EP3A 1YHNA 2GXQA 2IYQA 3FHOA 4PANA 1KY2A 3TJZA 2TMKA 5KTYA 2VF8A 2JLRA 4M9ZA 3THXB 1M7HA 3N2IA 3THYB 4YC7A 4DEYA 2PLFA 3NEYA 3TQFA 3KQUA 2BWJA 4A36A 2DWPA 4Q18A 2D7DA 4ARZA 4AYTA 1NN1A 1U81A 3GJ4A 4DZZA 4Q47A 1LW7A 4URYR 5GADl 1ZAKA 4DLTA 1Z08A 4Z54A 4KLZA 1II9A 1TUEA 4TTRA 2F1HA 3DL0A 2FFQA 1RJ9B 2XAUA 2YC2C 1H8ED 5CJPA 3AP3A 4LJAA 3N2EA 2FFAA 5J4VA 4Q21A 2Q3FA 2XOKD 5P21A 1U8ZA 2GTPA 1J2JA 3JZAA 4TYYA 2X8AA 4DLZA 3B85A 3PJRA 1N0WA 3CB4A 2PJRA 1DARA 3EPLA 1UDXA 3JVVA 4TSFA 4DLWA 1UBCA 3SOPA 4FCVA 2FZLA 4Q1EA 2CEAA 1GL6A 1E0JA 4MUAA 5EE1A 1VCNA 3WY9A 3E2IA 3R7WB 5IHPA 1ZNXA 1G6OA 2H8KA 2OBLA 3UMSA 3NBZC 3LBHA 3A1SA 2VHQA 1UADA 4G1UC 2EU8A 1HV8A 2ONJA 4XH9B 3MLEA 4QL3A 1E1RD 3TUJC 1Q20A 3RSOA 3RWOA 5CB8A 3LVQE 3OAAD 2VHJA 3GJ0A 1KJYA 2A3RA 4O2LA 1RYFA 4HAYA 3Q5DA 4HLDA 4NYMR 4B3CA 3UK6A 2ZYUX 3GLGE 4KFRA 2ZVQX 3ZDQA 2ZJZA 4A0RA 4MKFA 2A5FA 3BBPA 5BXQC 4ESHA 4PO1A 3A37A 4QGFA 1Y3AA 3OFND 1FX0B 4BE7B 1D9ZA 2ODBA 1CR0A 2ZS9A 2VYFA 3QKSA 1N0VC 2ZRMA 1XD2B 3KX2A 3BFKA 5BW8A 1TAGA 4LYAA 2R65A 3HYTA 4UNPA 4IHQA 3BE4A 5J4KA 2WMNB 1TQ4A 5E4FA 2ZJBA 5GJWC 4BASA 1EXMA 1RRPA 3LX8A 5FBLB 1BH2A 4C9BA 4Z8YA 4RFSB 5EZ5A 1E79D 3C41J 1KI6B 3L2OB 2IA5A 2QSYA 2ONKA 3GFOA 3KZ1E 4P3YA 1P9WA 1S1CA 4N3NA 4MKHA 2PEZA 5FOXA 3G0HA 4CT4B 1KI2A 2C8VA 4I1VA 4UNRA 8OHMA 4IRUB 1U9IA 2BDTA 2VHTA 4QBFA 5EJEA 1E2NA 4Q4HA 3ZGXA 1YZGA 3EPHA 1X3SA 2CHQA 4M9SA 4PX9A 5TB5A 4BFVA 1XMJA 3NHBA 4RKEA 4WAUA 1GKYA 2D3WA 3PQCA 4HUQB 3GLGB 1N6LA 1A82A 1ZP6A 2RGBA 4V0OA 1VCOA 4QFMA 2PMDA 1PVOA 1FPMA 4JL8A 2K5UA 2KBFA 3B9PA 1L4YA 4DEXA 1EFTA 1WMSA 4JIMA 1LB1B 4TQAA 4C4PA 3KQKA 4TL7A 4A2WA 4DSNA 1QG2A 4FMCF 2VP5A 3THOA 3EZ6A 4ZIRA 3D7MA 2Z83A 4H1VA 2IUTA 2FEMA 2VO1A 3QXHA 1G4AE 1P2UA 1PV4A 1AQYA 2ZANA 3FE2A 3SFZA 3ADBA 1KSFX 4C3ZA 4A0GA 5HE8A 1W5SA 2ZR9A 3B1YA 5ANRB 1GWNA 3IHWA 3Q7PA 4LY6A 2F3RA 4PPNA 3C7KA 5UKDA 2GAAA 2FOLA 3T1TA 1JNYA 1Z0JA 3SR0A 2CNWA 1OF1A 4QGHA 2GESA 4Q19A 2FF7A 1W0KD 2ZUDA 1CKEA 3E1SA 4TTQA 4DCSA 1QHIA 1YR7A 2FE4A 4IFBA 5CDFA 4V02A 3NDPA 3MWLA
chains in the Genus database with same CATH superfamily
3DTTA 3U31A 5EIAA 5LLTA 1EDBA 4U5XA 3WWZA 2QT0A 3WB0A 3RVSA 3PXGA 4KXWA 1QMPA 1DXHA 4TPKA 1SOWA 3PI6A 4NU0A 2BEKA 2HQ1A 4GXNA 2VT7A 3FFTA 3KKZA 2AYXA 1IOVA 2BN4A 5FI3A 5I01A 1DRKA 2G1KA 2C5EA 4HXGA 4ZMBA 4O2RA 2IK8A 1Y1RA 3PYLA 4S35A 3A4YA 3QBDA 3PQFA 5FA5A 4BMOB 2WJJA 3LT2A 3ZWNA 4QQKA 4TN5A 5F7OA 4E12A 4PSAA 5LZ4A 4B0OA 4YY3B 3IDOA 1XYYA 1XK7A 1ZOSA 1UWKA 1SUPA 2JH9A 3X1DA 5KO2A 5BWBA 2I3ZA 2QL6A 5I4KA 2P1DA 1YZQA 3SQLA 3ZLVA 1B16A 2VBFA 4D5GA 4C88A 3Q3GE 1TOAA 4KWTA 1CIPA 4JHLA 1BVHA 4MTGA 1WXXA 3WYFA 1ND6A 3UGKA 3UMYA 2R6CA 1QH0A 1SD1A 1YD7A 4IFEA 2QPTA 1ZDMA 3G5UA 2IVZA 2AJTA 2CD9A 2EWMA 2Q3JA 5K3AA 3ZQ4A 2C9BA 2WEKA 2DKOA 4FNOA 1COWA 4UFPA 1YC5A 1EVEA 5ALVA 4WHMA 4WCVA 1LBEA 2XT0A 5HFNA 5CFRA 5KPJA 4RDXA 5BWLA 5LB4A 1JGTA 4GC9A 3VV3A 4OMDA 4IDHA 1V3QE 3CEJA 4BUCA 3ONVA 5AVZA 4O2AF 1U0HC 3JZIA 5BQFA 3SJAA 2XCRB 3VKGA 1A0OA 1J4AA 1GFIA 1TTHA 3F7TA 2ERXA 5FTWA 2HSJA 3V4LA 3KWJA 2SHKA 3RKUA 1Z6AA 3NV7A 4TTVA 3WK8A 1IZ9A 1V5FA 1H22A 1V7CA 4UZSA 2VH3A 1CETA 4HNVA 4C29A 1E1CA 2MSKA 2SBTA 2YLIA 4URFA 3VVMA 1TT5B 4N0QA 2G7ZA 2IP2A 1D0ZA 3ZWAA 1X7XB 4K46A 1GCIA 4Q3BA 3GLHE 4DPLA 4XX0B 2GJKA 1GJRA 3RVDA 4YMHA 1ZMBA 3PDJA 3BH0A 1Z33A 1DBPA 1QVAA 2DVMA 4W5JA 4QOEA 3GBSA 5EMKA 2R6HA 3HDVA 2C2BA 3CY6A 5C2JB 4LWOA 1Z7Qc 3FCAA 4WFKA 4RO0A 1VI2A 2JGMA 5ALSA 1M1YA 2TS1A 3CLSC 3W8EA 4DV3B 3JQAA 2EDAA 4E88A 1G42A 3E9DA 1UXIA 2ZR0A 4V24A 5DXJA 3ZV6A 4RWZA 2ZB4A 1RLMA 4QPNA 5KJCA 1YTLA 3GCXA 2GBIA 5FAKA 2XLVA 5EJ9A 3FJ1A 4NEHB 3N05A 5A4IS 1BS9A 1W6RA 1V5WA 1T5LA 5ARBA 5CB6A 3CVUA 1X7ZA 1CDDA 4X6XA 4LNUB 1EDOA 4GM0A 4W82A 3T34A 2NPOA 3IXMA 4TMYA 2PM8A 4WNIA 2ZSEA 3CGWA 4OBXA 4M87A 4WQMA 3TTWA 2ZAOA 3GVXA 5E3HA 3IP6A 1P5RA 2GM4A 5EHXA 4WK2B 2IXFA 1IN7A 5HOEA 4MK4A 2XIJA 1PWXA 1EB8A 4MRMA 2IU6A 2NU6B 5CA1A 4NNJA 5KAMA 1J8YF 5DCUA 4S1VA 3CTMA 2HT1A 3SHWA 4P32A 2AI1A 2O2GA 3CN9A 1DX9A 3GEIA 3SXPA 3KDPA 4FFVA 3DLAA 3QUBA 3RYIA 2VI5A 1NC1A 3ZLBA 3HKEA 1D4ZA 4IV8A 3W5IA 4I8DA 5L7WA 5AM4A 1H0SA 2JBAA 1QGZA 5FFFA 1QGOA 1UJ2A 4LJLA 3H4IA 5EJMA 3RK4A 1LVKA 2ETVA 4PBSA 4HDQB 5JLJA 2ZREA 3DQZA 4AVYA 3D3JA 1YVUA 1Y1LA 3ZE6A 3PTZA 1R66A 3AONB 2A8YA 4RDCA 1DJPA 3QPAA 3NEJA 4MUEA 1ZJWA 4MV0A 4Y18A 1UBHS 2GF2A 4U2BA 5DK6A 5JCOA 4QTXA 3EDQA 2UVDA 3E9NA 3HCBA 1NHWA 3LP8A 2I7CA 4IJ5A 2BGGA 2JATA 3A3NA 2VPPA 5COGA 2OXTA 2UXCB 4EZIA 2GZ1A 1MJHA 3PFCA 4O4IA 2GKSA 3B0UX 2KPOA 2WV9A 4RCYA 4KVGA 2P5UA 4LECA 3UH1A 4PF1A 2WICA 1DAKA 1GUDA 3GVCA 1KMCA 2W8ZA 4EVIA 3KAJA 1Q0ZA 2LPMA 3DHYA 3RF6A 4BLQA 3CEMA 2JD1A 4I2VA 3AKCA 1GRCA 2J5KA 3LLUA 5KTPA 5FTJA 3JZDA 2H1SA 2HA6A 4F04A 1P7WA 2DUJA 1XHEA 5BOSA 4WERA 3LT4A 2V59A 2A30A 2XYHA 1X8KA 2VQEB 4ZYTA 1GZDA 4EDFA 4FKBA 1R6BX 5BWNA 5JXGA 2YDYA 5B7GA 3GBPA 1MZPA 3M83A 3A4LA 4TLAA 4DCJA 3YASA 3GHYA 3AWIA 3DA8A 3ET5A 4CSAC 4MAAA 2C2MA 2H4YA 3U8VA 2O0LA 2ZPAA 4RE5A 3V00A 4DMFA 2FMTA 3TNDA 1HRKA 3CJRA 1KMHB 5BYKA 2DUMA 4UHDA 1WDWB 2HW8A 3N2KA 3A27A 1RIFA 4MPDA 2ZJAA 4NU8X 1EPUA 2GD2A 1LTKA 5A5GA 4HLUC 1T6UA 1V5EA 4QATA 4IKEA 5HR5A 3IOYA 1TFOB 3ZDAA 2II6A 3CEPB 4UUNA 4N9WA 4X8LA 2C2KA 5CH8A 4H08A 3AJRA 1NY5A 1T4BA 3NJRA 1QZUA 4V0LA 5JS1A 1U04A 1CUVA 3PFWO 4I9HA 1A5BB 1HT2E 2JIOA 5CGZA 3EBOA 3BZWA 2OBXA 1KZGB 2G1AA 3DVAA 4YN0B 3LAWA 3U5TA 1VHTA 1J2YA 3MIZA 4ZEXA 2BL4A 3G2NA 4DG5A 3ZK7A 1SWVA 3ETLA 1T9CA 3TJMA 1T4CB 5KTRA 2YFKA 1ZVVA 4AIIA 3S28A 3RHZA 1HSZA 4DIKA 4G56A 3R5HA 2GS9A 5EXPA 3CEHA 3U3DA 4LVNA 4OK3A 1RBYA 4ZZIA 5G53C 4L8LA 2QX6A 3QXSA 3D1JA 3C18A 1T43A 5FUYA 2IGBA 4R2KA 4RHXA 1LUAA 1PFWA 1E89A 3BSFA 2XUIA 1T3GA 2X5JO 2FPPB 1EA5A 1BWSA 5F3RA 3E0XA 4RQUA 5D7NA 3LZCA 4ZGGA 2LCQA 2BR5A 3DZAA 3LP5A 5IJ9A 1LV7A 2X7HA 5DJ5A 2MWQA 5IARA 2SNIE 1J21A 1RJEA 4BMVA 1QFSA 3TR5A 2QE9A 2ZXPA 4YPFA 1Y7TA 1CJCA 4AF6A 1SUSA 2GFQA 4RLHA 2PT6A 4OA5A 5IP5A 5AJWA 4PRYA 4QHSA 1Q0PA 4CI9A 1Z12A 4BNTA 4UHKA 2X5OA 1JR4A 1GZ4A 3C85A 1TFRA 1OX5A 2GQ0A 2V0NA 3QELA 4DT1A 5D1NA 4ARCA 3JQGB 4DANA 5A69A 4WADA 2VJBA 3T3PB 1T6IA 3E1KA 4KX3A 4QULA 3G5AA 1OMOA 4F3NA 4ZOLA 1HZZA 3HO6A 2JGNA 2QTWB 5LXTA 2ZJ2A 1YO6A 2HBYA 1GPH1 1DU4A 1JG4A 3D6AA 3KVVA 5GONA 5BQ5A 3HKCB 4L15A 4KGDA 3EVBA 2Q29A 3A70A 1ZUNA 3WIDA 4CCYA 1KMIY 2PKEA 4LJKA 4D9CA 3TE6A 2SECE 4GPAA 4II3A 1E9DA 3PDIB 2JCVA 3DL7A 1TQHA 3FCEA 1SR8A 4MKZA 3QZUA 3AGUA 5FRDA 3I6ZA 4H6VA 4EKGA 2BBOA 2BZ1A 3JQRA 2H7OA 1OC2A 3HQ4O 2R86A 4H4EA 2AYYA 1ZGJA 4JELA 5LP6F 1QHYA 4XLTA 2QP3A 4EZBA 4HQLA 4X8OA 1MX1A 2QLLA 1E4OA 1XVTA 2ID4A 4CXMA 3ROPA 1V55C 4MYTA 4EGJA 2BDUA 2QT9A 3BXEA 4W9MC 2C2ZA 4W5QA 3W6OA 3SK0A 3DH0A 3NETA 3BWMA 3DM5A 4R05A 1ISIA 2C7PA 5AM0A 4DSUA 3QMWA 3PEFA 4B2PA 2O8FA 1FUYB 5KYWB 1VKZA 1UBLS 5HKBA 4WK4B 5FOTA 4AX4A 4EFDA 3ZDZB 4LJRA 5CTAA 3SJZA 1F2TA 4XDZA 4J07A 1KVSA 2E37A 5CDHA 1ZIDA 2CMFA 4BVAA 2QORA 4OQDA 2FJUA 2AMFA 2ZJ4A 4Q12A 4OG2A 1JHPA 2C3MA 4ZYWA 2QAGB 2YL0A 3HCFA 3EF1A 2VCHA 5B53A 1LVGA 1XZPA 1KO5A 2HMUA 2EIXA 4EI2A 3NKLA 4D0LB 3RRBA 5JJCA 4C0SA 4HJRA 1BCRB 2I7DA 3KTAB 3MS2A 1Z2PX 4DV4B 1J9ZA 2D13A 3HMQA 2IKSA 4YJHB 4CYMA 5KTKA 3FPBA 3WK4A 1BR2A 1J1IA 1VRVA 1XTVA 2YZ2A 2VVTA 2FSIA 3DV0B 1FJ2A 3L6RA 5HRUA 1DQYA 3TUIC 1MO3A 1H9TA 1N4AA 4ZK2A 1C8VB 3UUEA 3LXMA 4URXR 4TMVA 3ORSA 1JFVA 3DMPA 1I7DA 1H9AA 3IAS6 5DHAA 2GEKA 1PR5A 3S4YA 1ZK3A 1XEWY 3SX2A 1MHPA 1JKJB 3F96A 4MTFA 1YRAA 4TRNA 3SE0A 3HCOA 4KXYA 2C0PA 2QS9A 1JSXA 5EINA 1GDDA 1AB5A 5KB3A 1U0FA 4FC7A 3N8NA 4FINA 1ZNYA 4NCIA 3QP9A 4RAOA 1T36A 1NSFA 1MXFA 3F4LA 1T2DA 4U9UA 3AV0B 4KI7A 2NV0A 3P9XA 1I3OA 1PUXA 4AUNA 4KNWA 2HCJB 3PFHA 2H2GA 5B3SC 4LOAA 2BE9A 2FZVA 5JP7A 1KOGA 4XD7D 1J20A 2KW3C 5DM70 1FPQA 2ZR8A 5EE0A 3PYMA 2CLCX 1C4KA 3S70A 2QIOA 4NFLA 3IPCA 3V1MA 3SLRA 1JH8A 1KO8A 3DFMA 4D9HA 4KO1S 1JR2A 5BT9A 3K94A 4RTKA 3MB5A 1NQXA 3JQ8B 3PHLA 2QYOA 3CUUA 3ABZA 2W6IA 2BP7B 4L75A 4CM7A 3IPAA 1E2KA 3A9VA 5LP1A 3BDIA 4NONA 1EJ2A 4BO5A 1LTQA 4BUZA 5KX5A 4M8NE 2C8LA 4EEKA 3DMHA 3LPNA 4MULA 3HLZA 3JVUA 3S55A 3PEUA 3F74A 4GI7A 2QGNA 3TKAA 1NYTA 2Z08A 3PLNA 3VHRA 1CRPA 1RRGA 5BVGB 2VRWA 2OM2A 1R8JA 5TY0A 1LRKA 4GBED 3FPLA 1SC3A 4FFOA 4X90A 5HF6A 4UEQA 3RV3A 2VSOA 3AJEA 5DE3A 5K9ZA 4YBRA 4AKIA 3DWEX 3GPDG 4LRSB 1ULAA 1A4XA 1RKVA 2P9YA 2OBNA 5DTMA 2PLNA 1VTMP 1SU8A 4EH1A 2NTJA 2OQ2A 4WBNF 3ZXYA 3LX4A 5EQFA 4DPKA 3COSA 5BPFA 4REMA 5AVWA 4MR8A 2FWAA 1CEEA 3JQQA 3G0BA 1P2DA 1UXKA 4XCQA 1N7IA 3Q9NA 1XAJA 4HZGA 2QM3A 1ONSA 5JBQA 4X20A 3IEKA 5LN1A 4YLEA 1S96A 3MCTA 2FRXA 3U4HA 2PNFA 3EIEA 3LQ4A 1YS1X 2EX4A 1S0UA 1KC1A 2ACKA 2VRNA 3QHQA 3FNRA 4ZO7A 2PUHA 1MG5A 3T5AA 1X7WA 3GPIA 2M4EA 1JQEA 4DB4A 3HE3A 4M7RA 4UUOA 1N5RA 3NBFA 5H4HA 1DC4A 1RMVA 2R7LA 2GERA 4TS1A 3IVMA 2IDMA 4QXQA 2Y0DA 3CLSD 2XVZA 3RVNA 3EWIA 1PR9A 4HFMA 1ID1A 3KT8A 4UTVA 1MC8A 1MAAA 3LIIA 4XPIB 2PR2A 1W5FA 3IMFA 2O19A 3QYAA 4Z3OA 4S12A 1C3JA 1VCIA 2ODWA 4B43A 1XZGA 5J1SB 2QZ4A 3K7EA 2YWFA 2R6JA 4CR7A 4MUNA 4MS3B 1MENA 3G7NA 1IBMB 2JI4A 2A1IA 1UDCA 3RNOA 4UTRA 1HOTA 2WILA 3KC2A 4BMPB 3PQ3A 2BM1A 4EZEA 2AHRA 5IJAA 4CV2A 4Z9HA 5AR1A 4Q7LA 5C4IA 3P52A 7REQB 1ORHA 3SQXA 2QD1A 3F3MA 4H7IA 1J90A 4Z9BA 1N6HA 1HTTA 3BCUA 1P5ZB 1B7GO 4UARA 4JUFA 2RHLA 4DC9A 1XZAA 4NFYA 3HBLA 4C14A 5DEIA 2Z2YA 2YWXA 4N82A 2WD9A 3N0XA 3ND5A 3RREA 4BQFA 3M89A 3DUFA 3I83A 1F2UA 4ZI7F 4QGAA 2VNKA 2UZ4A 2AGVA 3DBOB 5AKXA 2ZTMA 4DYHA 1IBRA 2CLSA 4PZUA 4W5WA 2I22A 3MTJA 3NCHA 4Y1FA 1E20A 2A4KA 1AUVA 4INZA 4E21A 2LP4A 4H3SA 1Q0SA 4TGLA 3GG2A 3O4IA 5L0DA 3MZ0A 1QVVA 3PNBA 1JHYA 1OFUA 3MT0A 1N1DA 3ERCA 3CLUC 3WNVA 3DGEC 1O6GA 3I0NA 4M8LA 1FP1D 1U2DC 2REQB 4GL4A 4BJTA 1RDFA 1FSSA 3ZD6A 4WT7A 2IYYA 3VR4A 3GJTA 5CDTA 4U7DA 4L4XA 4R2IA 4P7BA 1IEWA 3Q7IA 3DDOA 3H1PA 4EKIA 2XTJA 3HVHA 1GNLA 1P5JA 1T0JB 3ZCSA 3CIOA 1I0LA 3W2HA 1QIEA 4PHGA 2LD4A 2BGRA 5KJ6A 4WY8A 2GXQA 2OD9A 2RHRA 1C9DB 3AFMA 4N6HA 2EHJA 1T2NA 5CBPB 2JGRA 4ARZA 4Q47A 3OM9A 5T3UA 3BDAA 3O9ZA 2XOKD 2X8AA 4Z2YA 3LJBA 2PJRA 1JMWA 4XGIA 2XY4A 4NBKA 1KPHA 2ZBRA 2PHZA 3R0ZA 4XE5A 1CF2O 2XDQB 2H8KA 1EZZA 2XDWA 3IEIA 4NEGA 2CUKA 2ZUUA 1KTIA 3OAAD 4QI0A 1SJ9A 4B3CA 5DNUA 2ZCVA 4ESHA 1EVIA 4ZO8A 1N2XA 3J7TA 4N40A 1LNQA 3IX7A 2HMZA 3LY7A 3AF5A 4EHDA 1KP3A 4IHQA 3BMXA 3BM5A 2ZB3A 4ZU1X 3KZ1E 5KAPA 4HDKB 4N3NA 2CY0A 5K4GA 4AWBA 5ALZA 2CHQA 2GNAA 4JNKA 2VUIB 2D3WA 5LQMA 1PWHA 1AG9A 2Q1TA 1D1BA 1O95D 4JIMA 4TQAA 3THOA 4H1VA 3UQZA 4JBGA 1PV4A 3VR0A 4C3VA 1CRLA 2Z5LA 2OP1A 1I1QB 2GSWA 4ARIA 5HE8A 4A2NB 1V8BA 4XASA 2GAAA 4QDJA 4RELA 3E1SA 1TO2E 1EHIA 3CRZA 1JKMA 3UKJA 2ZIEA 4L95C 2VSNA 3NDPA 2C5GA 4WY2A 2QD5A 1ADGA 1AJEA 2C7OA 5KIAA 1PNTA 4PXYA 1UC4B 3A6EA 2WKSA 4AJ1A 5BQIA 1B2RA 3CRMA 2VAXA 4WXRA 3ZHYA 2P61A 2J4DA 2RAUA 4C7MA 1ANKA 1T9AA 1FS5A 3HB7A 3SC3A 1IW7F 3R5FA 1TB4A 1AUPA 4ZPXA 4X8MA 1PKXA 4EYOA 1M6TA 3KO8A 4LN1A 4RY8A 5A4DA 3ZY2A 3TZ6A 4OB7A 4CKWA 2YMPA 4CLXA 4MQEB 5TPZD 2MR5A 1PKEA 5FYQA 3T7JA 4X1KB 3RWBA 3QVMA 1XCOA 2W6ZA 4JYCA 1WZCA 1E2PA 3MRVA 3NALA 1GU7A 3WLJA 2J9FA 3RK1A 1FX0A 3IRVA 1ZIOA 2QSJA 4HP8A 5CUQA 4I36A 3VKHA 3QEJA 2CLHB 3KV1A 3O7WA 3F2IA 5DHQA 5AKZA 5F4ZA 2EQBA 3ETHA 2B7BA 2QUJA 4HZUB 2G9VA 2LE0A 1RPZA 3L8ZA 2UZAA 1O87A 3AUYA 1UODA 5ALHA 5COMA 3KT6A 3ZVKA 2FEOA 5TJ9A 2ON6A 3I5QA 4WZ6A 4G4GA 5JSFA 4A0FA 1G5QA 2WZGA 1M83A 5FFNA 3NWBA 3ZYZA 4YP1A 1HH4A 3NHZA 3FGZA 1LFAA 1XYGA 4ME6A 4EHPA 2O2EA 2PSFA 3VAYA 3GDFA 1VLVA 2YFHA 1LPSA 1AZSC 1JEEA 3TK1A 2JAQA 1PQUA 3ASUA 5B3AA 2BSAA 1J2UA 1GAQA 4PACA 3I52A 3BRWA 2GA9A 4DLKA 5LJIA 5KZMB 2XUZA 5CH5A 2E4UA 3LTNC 2FI1A 1IB0A 4ENWA 3M6VA 1LTHR 4BBAA 2Y1EA 2EKDA 5C8YB 3U2LA 4GGOA 4BB9A 4D3YA 3WQRA 3IP8A 3AG5A 3EWSA 3HDHA 3NV9A 3RHTA 4ND7A 1NXVA 1OHHA 2HRCA 3U62A 1P4SA 4EW2A 2J3KA 3OPYA 1HDOA 4KAFA 3IMEA 2DT8A 2Z95A 3FOBA 4RLSA 4MWZA 1DAPA 3QM1A 1DUVG 4K9DA 3A26A 4QDOA 4JI3B 3O21A 4JKOA 2OQMA 3PU6A 3H9CA 4F85A 1JU3A 1CVIA 1KKUA 2NO4A 4EVSA 4JV5B 4DLAA 3GVPA 1TK3A 3A1VA 1QQ5A 4Z86A 1UINA 4EABA 4L6AA 3KG2A 1BE8A 3EPJA 2QZPA 4M7PA 4BVGA 3OLCX 5AK6A 3ZE1B 4IZIA 1EDZA 3L4BC 3GEMA 2JVIA 2BJWA 4IJVA 2O4UX 2EV9A 3NHUA 1N7HA 1YL5A 4J1TA 2D62A 5IFLA 3K6SA 3M2TA 3QE9Y 1GPKA 1G18A 4FESA 1A5SB 3VC2A 4LJYA 1GEEA 3SXJA 2GZ2A 3WYGA 2I7TA 2WD7A 1GA1A 3ATPA 3I0ZA 1SUDA 2F8SA 1U6IA 4XWOA 4ZEOA 2RAVA 4LTMA 1UKEA 4BJ6A 2O9JA 3EXEA 4AN1A 5DNYB 5JAOA 3EWAA 4G86A 3ADCA 3PQ8A 3SWWA 3Q2OA 2F22A 4MW6A 3SIPA 4ZICA 1LSSA 3PF8A 4X7RA 1GZ5A 4LGYA 5T67A 3AUKA 1J8MF 4NBRA 1G9SA 2EVWX 2HN9A 1LBHA 3VVBA 3NIBA 1FQJA 4B5KA 1HETA 2O2ZA 4YTEA 3H84A 4CKEA 4JOCA 4QYIA 3PJEA 5JNLA 4PFSA 4CMGA 1U2ZA 1XZQA 4RA9B 1D2GA 4IICA 4Y2SA 5IAEA 3A28A 2QBYA 1VTKA 1L5HA 3NOVA 3AF6A 1XF1A 5LU8A 1KBZA 1A9TA 2QRVB 2WTBA 3H8WA 3U4AA 1SGWA 2PNJA 2QJFA 5CB4F 2DBRA 1NW5A 3AU8A 1ZC3A 2OBFA 4TQGA 3R3UA 3FYUB 3R3WA 5J3JA 1VL1A 3R4VA 3UHAA 4V3CA 5REQA 3TVYA 4Z1MA 4FMPA 3TR6A 2VDOB 2VG8A 4QYXA 4QBTA 3O03A 4C2AA 3BTOA 3WL6A 4E46A 3K9WA 3HBNA 5DM0A 2G25A 2OR3A 2DTEA 2HNKA 1HW1A 1H8HA 3MSXA 1X1RA 4LZZA 4Q1AA 5AIBA 1XUOA 4XD2A 3NYLA 3P96A 1P0FA 3JTLO 3R9IA 1M1NA 3TGLA 4HQ6A 2QWXA 4DV2B 3BWEA 1GT6A 1HPLA 2Z04A 4X93A 3TXXA 3ZHCA 4MDFA 5EESA 4Q02A 2ZJ1A 3TK0A 3UPTA 5AI9A 2GPYA 2BKVA 4BO0A 2Y92A 1C3VA 3MW8A 4Z8XA 3FDQA 4TLCA 2Y1XA 1WV1A 2O8VA 3HKKA 3JY6A 4BKUA 2PT9A 2COKA 3O8RA 4K9KA 4UVGA 3IP1A 1CQPA 4X00A 4NATA 2DBVO 2H1FA 1GQAA 2HWWA 4G0PA 4LV8B 5LVAA 2XQGA 1A1SA 1PJQA 1FU7A 3SC2A 4BS9A 2IH5A 2YZGA 2PKCA 1GZHB 1FYFA 1RMYA 4MP6A 5H9WA 2D06A 2X9NA 3T1QA 4B09A 1BWRA 1FA9A 4ZVNA 3THRA 2OC4A 3F1LA 1O03A 4M6WB 3T6KA 3VX4A 5IKPA 1DOAA 4B6PA 1XMVA 4U0KA 2QQ5A 2WSMA 1Z2AA 2NQ2C 1CUCA 3U4IA 3FOFC 1KDYA 4U2KA 5C52B 1FOEB 4XIJA 3AM3A 2A2ZA 5E3CA 1R0KA 1JXQA 3QNMA 2FZ5A 3E03A 4O1HA 3W3AD 3M5WA 1JYEA 2YW2A 3N59A 1LC3A 2C9CA 4KBYA 2G06A 1SVSA 3TLXA 5BNWA 3AESB 1YDFA 3KJNA 5ALQA 3ZE7A 2UYCA 5I3CA 3B5JA 4Y7DA 3IO5A 2UYQA 2Q0SA 1PCXA 4AMYA 4E13A 3O1JC 1DJOA 3CWZA 2GAFA 5LD2B 4QQ8A 3ETJA 1M2VA 4M0DA 5CB0A 3RGWS 4RUKA 1CZUA 4DVZA 4YWQA 4WBXC 1XCPA 1LH0A 3UH0A 3RQGA 4MMZB 2GBPA 4NZ9A 4DRXA 4LOLA 5EWLB 3P2IA 5EUBA 2DX7A 1JPJA 5JNSA 4E2XA 4WA8A 1J0XO 4UPEA 2JGLA 4ESOA 4QJIA 2FRDC 1UMBB 2CFCA 2P1RA 4MP3A 3LQ2A 3QWAA 4G0MA 2O54A 1G20A 1MNQA 2I3BA 2IHTA 2BE5F 2R6FA 4MB6A 1TK9A 5AVSA 1KR2A 2NUAA 2DY1A 2H16A 1ELOA 4RTQA 5JOQA 1YUMA 4YQFA 1CUSA 4BKQA 2QVLA 1EUZA 1PQ4A 1X15A 4XGQA 4UVEA 4O5AA 2C3YA 1R0YA 4M1ZA 4KBGA 1YQUA 1OVGA 4GUDA 3E6AA 4RKFA 2OK8A 3BB4A 2HXSA 2ZYSA 1GARA 3N2YA 1L7MA 4QRIA 2E1PA 4DDMA 3WZ2A 4QXMA 2D7JA 2NXJA 4BTEA 4JI4B 2JLYA 2XLHA 4KR9A 1ZYUA 4PM4A 4QU5A 5KYUB 4L76A 3LZDA 1VLQA 3K8QA 5AHRA 1BROA 1GTG1 3HZZA 1JWLA 2C2HA 5KYYB 4O63O 4XFKA 3GQBB 3LS0A 2B61A 5A5EA 3FCYA 1AHPA 1AMNA 4J0GA 3PA6A 4X95A 2Q8PA 1GG2A 1M8KA 3JQ6A 3CLUD 4Y6PA 3ANMA 3OG9A 1TK2A 4YA6A 1XC7A 2Y0PA 5EKDA 2J33A 2DTDA 2Q27A 4F2HA 2XMGA 4ESVA 1MJNA 3QKSB 3A9CA 1IQPA 1ISMA 4ZJZA 5BQHA 4QXAA 5IDYA 2DTXA 2BCGY 3KQPA 4HV4A 4EL5A 2NACA 4D4IA 1T6NA 1OH5A 1IM5A 1Q77A 2WUVA 1YQEA 4FLEA 1CR4A 2I4IA 2SKEA 1V1MB 1N1MA 3WIVA 1WZUA 3ASNC 5IUJC 1AMOA 4G1EB 4JX9A 3V34A 4S0ZA 5DBFA 4O3MA 1X7YB 1X1EA 4GOMD 3DNFA 1WUKS 5IZCC 2QKYA 3RFVA 4NH0A 4XQ1A 4IIEA 1A9OA 3LE8A 1C9EA 1XJCA 2NVWA 4GI1A 1THMA 4BYGA 4JEUA 2Z6UA 4GGMX 1T1GA 3OZEA 1TU4A 3W8IA 1ZVKA 2V7EA 4ZOBA 3EZXA 4QU0A 4Z7OB 2J5BA 3T5PA 1RWWA 1QOPB 3R7SA 4PZDA 1FFCA 2E7ZA 3GRAA 1J33A 1ZR2A 3OJ0A 2Q5OA 3HNIA 1NUTA 3PXDA 1PZXA 4RH3A 1BWPA 3ZCUA 1OE0A 2ZKIA 3V80A 1K6MA 1SHUX 2ZRKA 2G0NA 3MUOA 3KSBC 1YYJA 2ZWIA 3KB6A 1ZXLA 5D5QA 2VT3A 4MPRA 3DZDA 1X2EA 2DQKA 4LX8A 3GEEA 3N39C 3EZHA 3SVLA 1MEJA 5B37A 3ST7A 4XQ0A 4F3KA 3DW3X 4XB1A 4JJEA 1HE8B 2QMZA 5LR6A 4DUGD 1M2HA 5A2GA 3BEDA 3I5MA 8MHTA 4MPPA 1DDGA 1G5HA 4ED9A 4K6KA 4IZOA 1W5AA 2DR3A 4MJLA 3R9WA 3TNYA 2A33A 3KB1A 4ZCQA 3ZDYB 1EVQA 4IGIA 1BFUA 3OCXA 1ZVZA 3KQTA 1EUCA 2XYGA 4CM3A 4RVHA 4R84A 4L22A 2FQQA 4YHBA 1BDBA 4WN9B 4G07A 2O8EB 1C4OA 2I8BA 3SXYA 2I3AA 3R0IA 1X1BA 1PTKA 1P0CA 4R0NA 1I7SB 4RGQA 4D2IA 4NVRA 2WSSD 2HV6A 1XVIA 2ZITA 4MRAA 2DKNA 4ZCRA 4EF5A 3RTCA 3WMGA 2IF2A 1DSSG 4YECA 5CPFA 1IBSA 1DKMA 3LUTB 3TCNA 3N1UA 3L4SO 4LEIA 3DE9A 1Y1KE 3E7DA 3NP7A 4C7XA 2EKQA 3ESCA 2XA9A 2ZXEA 4EB8A 2VWQA 1BHJA 4F84A 4TMZA 5JH7B 4V0KA 3AKDA 3LC2O 4R6WA 4CIHA 2B4KA 1JE1A 3KPYA 1XAHA 2J46A 2P2DA 1SD5A 4A9AA 2RBGA 3VH1A 2XZLA 2IEZA 4Y0AA 5A3VA 5DBOA 4J7AA 1OFVA 1LDNA 4R1NA 4F4HA 1QE3A 1A9RA 4RHCA 3VFDA 2AFRA 1I7LA 3UAWA 2YN0A 4BO2A 4Y30A 4MVSA 1MB4A 4DS3A 4QNRA 2C97A 3DBRA 2SKCA 4AP9A 3CT4A 4AU1A 1V2GA 3DZHA 1XRLA 1NF8A 3EYWA 4URHA 1NPDA 4WZAA 1HK7A 2OSVA 4LYGA 4RKWA 5BUZA 5G3ZA 4OTZA 4AMGA 5HV9A 1OQCA 2NUPA 5KOHB 1DEKA 3CUYA 2W6MA 1OR3A 1U7TA 3FSRA 2OGSA 4R32A 1UXJA 4MR7A 5K0EA 5MN6A 4KZKA 1JQJC 5E7IA 3V4RA 1K1EA 3OU6A 2QE7D 3KHSA 1PR0A 1MAWA 3LWNA 1G8PA 3MGAA 3KQSA 3KQQA 5E1OA 4CV1A 3UPUA 1A77A 3B12A 3FX2A 1SB8A 7ADHA 3NBYC 5HK9A 3ESZA 3NTUA 1AUQA 1NFQA 1UG7A 1M34A 1NNSA 4DXAA 4RQAA 3LJKA 1E8MA 1MAHA 4B35A 4TT3D 5ICCA 3AVWA 4EL0A 2IZ0A 2IH2A 4C78A 3V5NA 5IAAA 3JD1A 4TZTA 4V0SA 2VQDA 3P2MA 1GKUB 3RIYA 1UM9B 1XL1A 3TN7A 1QLHA 2W9XA 4D97A 4UULA 3KE9A 2JHCA 3RYHA 4AUMA 1GKIA 2WIJA 3I05A 1Y4UA 3PT9A 1HY5A 4HTFA 1XR3A 4MWEA 2UDPA 4HNAB 5KNBA 1E5TA 1YV9A 1L7EA 4CU2A 2G1UA 2QG6A 3SR3A 5FIUA 4PG8A 3VA7A 1N9KA 5FUVA 1QRAA 1U99A 4YJDA 1TCAA 4HVAA 2VJKA 3PQDA 3WNQA 4TTPA 5F5NA 2XB8A 3HI6A 2PL9A 2CVQA 5FQOA 2I5PO 4IHAA 4GRAA 5FBKA 1YR9A 5A0VA 3REOA 1U6JA 1FU8A 1KQ3A 2BEVA 3IMCA 1I36A 1Y9ZA 2MYSA 1W1WA 2IOQA 4PZ0A 1C1DB 2I67A 3VHXB 1E5QA 2DP4E 2Z6VA 1BXGB 4YRMA 2AZTA 2NIPA 2ZYVX 4BV2A 4YAJA 3ILSA 4K81B 3AMVA 1K89A 1JLSA 1VMIA 1QC5B 1E6KA 3GDOA 1ZJ6A 1Z73A 4Y2PA 5J5CA 3AR5A 3FB1A 3HA3A 2OZEA 4J0KA 1CUDA 2WJAA 4FKMA 5EWMA 3TQCA 1FFHA 3WA6A 5JYCA 3JR7A 4B7XA 4PYQA 3ONEA 3LCJA 3UT5A 1ZOLA 2AR0A 3R9XA 3DV9A 3P20A 4LBYA 5L40A 1GCUA 1I01A 3LBFA 1M7HA 3RJZA 1MF7A 3GMDA 4CLRA 1B43A 5HEKA 4BZWA 1X1DA 5K4AA 2YC2C 3UAYA 4NXMB 1P4RA 2XUKA 2Q3FA 5JMPA 1ZCJA 4E7PA 1DARA 5K2MA 2XA2A 4OHPA 3H5WA 1U1GA 2Q2OA 1P7YA 3JX9A 4UTZA 5CB8A 3KZOA 3L0IA 4KQMA 4WDQA 3I2HA 4ZYVA 4PO1A 2Y39A 2OP0A 2P8SA 3G5MA 1WETA 2J8WA 4PYIA 2MYUA 4JA2A 1NAIA 2ONKA 1EBUA 3A25A 2JKVA 1SIBE 4H0NA 3KTDA 3DWGA 2QR5A 1EP2B 1N2ZA 3GFFA 3R24A 3UMMA 4C05A 5B1SA 2I6FA 3Q15C 1PSZA 3KS9A 3DJNB 1T15A 3CV3A 3FVVA 5EYPA 3MTAA 3SJ7A 3KQKA 1RCFA 4M76B 5A9SA 2LTAA 1G4AE 1P2UA 3NRCA 5TPWB 3SFZA 3WIUA 3ISJA 4C3ZA 5GAJA 3FCSB 2G72A 2YZMA 1BXKA 1OF1A 4ANJA 2JFYA 2H1WA 1R1DA 5DYGA 3C3XA 2BH2A 5A4FS 1P19A 1W49A 5CA1F 3EEYA 5J4HA 4HAIA 4FNGA 1Q6YA 4M0PA 4LCJA 1O95C 2UVPB 1F9EA 4EKEA 4D4XA 4IDNA 1QVZA 5SZJA 4WESA 1LF5A 5L4NA 1NM5C 3FNHA 5ALPA 2XADA 4B3TB 4EMSA 4YMSA 5BV8A 3ZCQA 4ZRMA 1WD5A 4YAGA 1SVIA 1JJFA 4IQ4A 2ACEA 5BMVA 6ADHA 3KKQA 4JMPA 1G7SA 4JBXA 3CCFA 3PXBA 4RFSA 3UK1A 3PC8A 3CPHA 1NUSA 3VZQA 4X94A 2DULA 4QSHA 2WM2A 3A6DA 4Z3KA 3LA8A 4ZU6X 2RB5A 1Q57A 3OP1A 1CERA 3NKFA 5EXTA 4O4IF 3I1JA 4LF7B 2WWVD 4YIKA 3D6JA 2IXOA 2XZDA 1U4NA 3T1YB 4EEZA 4AJ2A 3GWNA 2G17A 1SB9A 3D4LA 5ER9A 4ENTA 3DOCA 2XCTB 4PAGA 3H9GA 2REXB 3MUEA 1H2HA 1KK3A 2WI8A 4ER0A 4AF8A 4QT0A 1BFKA 4UEKA 3FGPA 4BMYA 1JJVA 1OU0A 2MYNA 5K20A 1HXHA 1A76A 3IULA 5CX1A 3T5DA 5TGTA 5AXAA 2H7BA 2G77B 4TMKA 3L4EA 1T29A 4RTMA 4P4SA 5BVHB 4J7UA 4PSCA 5I3ZA 4G5XA 1EVJA 5IVKA 4IGFA 3MAAC 4YCDA 3OZTA 1I4DD 2OCIA 1E1QD 3RC8A 3AV3A 5DTEA 3R40A 3H42B 4NE9A 4URZR 4FX2A 1T4GA 1XWWA 4IW3B 3R75A 1DLIA 1PGQA 1S6YA 1Z6PA 3ZVMA 3QKUA 4QC2A 4CGZA 3OWOA 3FOOA 4N4WA 3BD9A 4KH1A 4BLPA 4A8PA 2QNLA 1J0AA 1XZFA 2Y9PB 2CN1A 2Y0CA 2KNHA 3KOUA 3EVDA 3KYDA 2CB0A 2UUCB 2YMLA 2YYZA 3VR4H 2F1OA 1M5TA 2AA3A 4MEJA 1NF9A 1XZHA 2UYYA 3A1NA 4DY4A 2ILVA 5JMWA 3DVQX 1KZ4A 2ZUCA 2XRHA 4UPDA 1IAVA 5AJYA 4WKCA 1XWJA 5J63A 1I32A 1RYNA 3IP7A 1TA9A 2WM3A 2XCLA 2ZRHA 3C3KA 3TLAA 2QSUA 3KTFA 2VC2B 1SBIA 1Z5VA 4RBNA 1EH5A 1RI5A 1STOA 5TLSA 4MVQA 3M81A 4ZI3A 5G3YA 4C22A 1I0IA 1ZK1A 3AW8A 1SXPA 3ZIUA 1LA2A 1IBCA 3N2LA 3P8ZA 3J7AC 1QGUA 2QGFA 4K7BA 3ECAA 5F76A 5ECWA 2DWCA 1USIA 1WVIA 4TLDA 1RCPA 2O8DB