The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
105
|
sequence length |
318
|
structure length |
307
|
Chain Sequence |
MFGKLREKLKSFVKRVEEEVEKEEEEVILTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Signal recognition particle receptor
|
| publication title |
Structures of the signal recognition particle receptor from the archaeon Pyrococcus furiosus: implications for the targeting step at the membrane.
pubmed doi rcsb |
| source organism |
Pyrococcus furiosus
|
| molecule tags |
Transport protein
|
| total genus |
105
|
| structure length |
307
|
| sequence length |
318
|
| ec nomenclature | |
| pdb deposition date | 2008-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF00448 | SRP54 | SRP54-type protein, GTPase domain |
| C | PF02881 | SRP54_N | SRP54-type protein, helical bundle domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Four Helix Bundle (Hemerythrin (Met), subunit A) | Four Helix Bundle (Hemerythrin (Met), subunit A) | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |
