3E70C

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
318
structure length
307
Chain Sequence
b'MFGKLREKLKSFVKRVEEEVEKEEEEVILTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor
publication title Structures of the signal recognition particle receptor from the archaeon Pyrococcus furiosus: implications for the targeting step at the membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
total genus 105
structure length 307
sequence length 318
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00448 SRP54 SRP54-type protein, GTPase domain
C PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e70C01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3e70C02
1HE8B 5L3SA 3CNNA 2ORWA 3SJCA 4F4CA 1VKJA 3U6KA 3V4RA 4CEHA 1OSNA 1SHZA 1ZCAA 1GUAA 3TKLA 4D82A 2VL7A 2Z6VA 3BH6A 1E98A 4PC7A 1KZ7B 1P75A 2KBEA 4HATA 2XTMA 4S35A 1OV4A 3AM1A 3QIAA 3DDCA 4ZDJA 2XSZA 1OHHA 1NVVR 2P3SA 1H8HA 2QM8A 4LV6A 4DZZA 2A2ZA 2A3RA 2YINC 1SZPA 3CBQA 2J0UA 3FMIA 3O47A 4RKFA 1OXTA 4KJZA 4NMMA 4TMWA 2ZSBA 4Y0VA 3WNBA 5DISB 2QM7A 1G5TA 2CL7X 3F8TA 5CB8A 2HDNB 4NE2A 3EASA 5FPTA 4JS0A 3F3YA 3K53A 2BBOA 3L0PA 2Q9BA 1FNMA 2ZAOA 4R98A 3LDAA 2RGGA 4FINA 1HEIA 3K70D 3T34A 3GJ7A 1DAHA 1F5NA 1R10A 2ZJ5A 5K8UA 3TE6A 3K0CC 1YZGA 3QUSA 4BLSA 2TMKA 1KY2A 4HLDA 2OFXA 1D2EA 2Y8EA 4ZDKA 2D3WA 1OB5A 5FPYA 1G17A 5FL7D 1YZNA 4RD1A 2YZ2A 4LV5B 3FKSD 2ATVA 4LBVA 1EFRA 4BRUA 2MMGA 4DCVA 4PPNA 3GMTA 3F0TA 2WJIA 4NU0A 2VSFA 4NZYA 4JMPA 3DM5A 1NY5A 3OIVA 4X8MA 3EZ6A 3EG5A 5BN4A 2DYKA 1X8LA 1NLYA 2GJSA 4IJMA 3WRXC 4ZKEA 4W5HA 4MRPA 3FFBA 4W7SA 2B7CA 4US0R 3OIWA 4M9QA 5JJIA 1E0AA 1K6MA 4TMXA 2V7QA 4ACAA 1G20E 1DOAA 1W48A 5FTLA 3BERA 3CRMA 3A1WA 3HR8A 4I4LA 1GNRA 4LJAA 3SN6A 2WOJA 3OEEA 4QJ4A 2ZI7A 4NCKA 3JVVA 2X2EA 2QTHA 5CDFA 3P4YA 1VHLA 2FEOA 2GEDA 3D31A 5TB5A 3AP1A 1W7AA 2ZJBA 3AUYA 3K09A 4JYBA 1SXJB 2ZI5A 4DLYA 5FL3A 2QBYB 3U60B 3A6PC 1ETUA 2ZPTX 2E9SA 2XJ4A 4AURA 1NF3A 3VU9B 3K1JA 2FFBA 2CLCX 4QNMA 4A0FA 4LPSA 3H86A 2JLXA 4A15A 1P61B 2ZJOA 4CGZA 3MSXA 2KE5A 3QG5A 4BFTA 2ZTSA 1ZBDA 1XRJA 3QE0A 2CVHA 3BGWA 4E07A 1Z0FA 2JJ1A 3HU2A 2VQSA 2H8KA 2ZSAA 4GRAA 3KXLA 3UMFA 3B8HA 1AGRA 4E22A 4F7WA 1II0A 1CXZA 3BB3A 3NBFA 4AK9A 5J4VA 3KQUA 3BBPA 4F93B 1WDTA 3SYKA 4DC9A 2H16A 5LD2B 1TPZA 4JLNA 3FKQA 2KI5A 3AVWA 2F1HA 4GOXA 4CIDA 3WP0A 3CZPA 4PPGA 4NCIA 2X1VA 3SQWA 1Q1QA 3QXCA 1M7HA 1Z8FA 1ZC4A 2F6RA 4UNNA 5DE3A 5J47A 1G7SA 2XNDA 2KJQA 4NYMR 5DI3B 3ZD7A 4IHQA 4MDEA 2ZXUA 1ZAKA 2IUTA 1RW4A 4RJLA 1GM5A 2XNSA 2IF0A 3EPKA 1W5SA 2FZ4A 2BKEA 1P2SA 3QKSA 2NGRA 1UDWA 2VBCA 5ELXA 2X19A 4NYIQ 4G0NA 3IBYA 4OHVA 4PAOA 3VKWA 1GRQA 2DWOA 3NHBA 1KTVA 1Y63A 3LXRA 2FWRA 4EFMA 2ASEA 5J4LA 2FDCA 4EJSB 1M74A 1KNXA 4XVUA 1E2GA 5SZJA 2HYIC 2VHCA 1XJCA 1TF5A 2K5UA 2VHTA 1EFUA 2QE7D 4D80A 4DT1B 4Q03A 1TQ6A 2ZVPX 4URVR 1UDXA 2G83A 2KSQA 221PA 4B71A 4V02A 2FSGA 5JHGB 1LB1B 1CJVC 1KAOA 4FN5A 4QRHA 4LI0A 2ZRKA 5HPYB 4QNRA 3CR8A 3AUXA 4N1AA 1EWRA 3SBDA 2JJ2A 2QP4A 3T1VA 5CIWA 3CRW1 2D74A 3RDPA 2VP2A 1Z6TA 1JQLB 1UBGA 1R0WA 2OCPA 4MKIA 1GKIA 5P21A 4BLRA 4LHVA 1Z06A 1W0KA 4Z1MD 2O0JA 2ZJ8A 3B9QA 4JBXA 3KQLA 1DE0A 1J70A 1US8B 3K9HA 2OESA 1OXSC 3VHXA 1IM2A 3VR6A 3ADDA 4BZXA 5FH9A 3C14C 4C3ZA 1QG4A 4NCJA 4R9UC 3NBXX 2J5XA 5FI0B 4D4KA 3NC0C 2ODNA 5H1YA 2OG2A 4GOKA 3QJYA 2FFAA 1UEIA 1WXQA 5JSZA 2JLVA 4PSVA 5C46F 1UFQA 5E3HA 3R8FA 4QL3A 1XJ0A 1C1YA 3C5HA 2P67A 2FJUA 2VTKA 1TQ2A 1P72A 4BZQA 3SQXA 2CK3A 5DGXA 1UKEA 1WQ1R 1UBCA 3GEHA 1NRJB 5CYOA 1DTSA 1FTNA 1NIPA 1E2JA 5FUXA 2H18A 4Q1CA 3F5FA 4WBSA 4XJXA 3TSWA 5JWOA 3B85A 4TLCA 1GL6A 3X1DA 3CX7A 4WZBE 3CZQA 1QHXA 2O8FB 3CNOA 3V9PA 2ONJA 4YMSA 2FFHA 1PV4A 1AQUA 4RD0A 1XD2B 3K0SA 1FX0B 1Z83A 1G8YA 2ANCA 4NP6A 1HYQA 4GFDA 5K8LA 2BIFA 4GPTA 2OUKA 2O8CA 1CP2A 4BRWA 3ETLA 3AB3A 4QOSA 5FR1A 3FHCB 3SBEA 5EQTA 4Q4AB 3D7MA 2EWVA 3DMDA 2CVFA 4NYIR 1XZPA 4Q66C 1OW3B 2ZUBA 4ABYA 5KO2A 2PEYA 2A5YB 4M0LA 2DFKB 2GESA 1ZNYA 2C8VA 1ZNXA 1P73A 1LNZA 2RHMA 3LY5A 1S96A 4MUBA 3SJZA 1Z47A 3P26A 3QEOA 4P0TA 3CM0A 3KJHA 2ATXA 4FW9A 1P9RA 1N2CE 3G5UA 2DFNA 2AHOA 4HEJA 3SYLA 3V00A 4BGDA 3T12A 1KDTA 3PUZA 1L7VC 3SEAA 2AFHE 2N46A 1A2KC 2J87A 4BFUA 4AKHA 1JNYA 4YXWD 1O3YA 3BIFA 4FIDA 1VYTA 3LO5A 4GP7A 2BCGY 2MMCA 2DCUA 1XXHE 3IUYA 4POAA 1Z0IA 4RVCA 3VHLB 4KITB 2FSHA 2QPAA 3EXAA 2I1QA 1JR6A 3HYTA 5B30A 2J0QA 2R6GA 1SXJA 1W47A 5HZHA 2B92A 2BC9A 2XZPA 3NH9A 5EUQB 5FTKA 2QBYA 1G7CA 1Z6XA 4M22A 4QGAA 1FUUA 3VU9A 4HAYA 5DI9A 4D4LA 1G8PA 1S1MA 1UEJA 1DARA 5JS7A 4NBSA 1SGWA 4URUR 2RCNA 3EWAA 2XTNA 3W6PA 4LX0A 4C4PA 2JLYA 2WSSD 2HXSA 3LW7A 1U2RA 3V4FA 4ASUA 1DAIA 3Q3JB 4HAZA 2GAAA 2CJWB 1X8KA 3N5CA 4W5WA 3RVBA 4AYTA 3TGPA 5BYJA 4Q19A 5LBIA 1G5PA 4AY2A 1G64A 1W0JA 5M04A 1YZQA 3QSYA 3MUFA 2ZITA 3THXA 2KBFA 4A2QA 2QSYA 4FWIB 3SJBA 2AN9A 4Q21A 3L8YA 2OLKA 3RYTC 1E1QA 2W58A 4Q02A 2XZOA 2GVZC 2G0NA 1B0UA 2ZI4A 2FA9A 3CO5A 4JJKA 3RS7A 1ZYUA 2EYUA 4GI7A 1XTJA 2AR7A 3SFVA 4GL2A 2QQ0A 1QHHA 1RJ9A 1SVLA 3CRVA 5SZKB 4DUGA 5DI3A 4QBIA 2IBMA 1H65A 3GFTA 3MJHA 1AKYA 5CJ2A 1T6NA 3U3KA 5CM9C 1P5ZB 1TUEA 5BYKA 4KI0A 1T3HA 1Z28A 2YV5A 4D4MA 4OI1A 1N5IA 3QPVA 4XWAA 5EE3A 3OAAD 1WBBA 2D7DA 3QKUA 1H8EA 1NVUQ 2IXGA 4ZCIA 3QENA 1OFUX 1T0HB 2WAXA 5SZIA 4BPBA 1G18A 3QI2A 1QHYA 4WZ6A 1ZM2A 1WB9A 1P6XA 1W4CA 2OHFA 3K0FB 4X8OA 4DT1A 5FOXA 2GK7A 3GJ0A 3TLXA 1F6BA 1G5RA 5HTKA 3ZVNA 5DO9A 2C04A 4P4SB 1N6LA 3RS4A 2ZREA 1EG7A 3MD0A 3SFZA 1XEFA 3Q8XB 5JBQA 2CCGA 3NTUA 4U7DA 2JLSA 4PAQA 4DSNA 1R2QA 1N25A 4URXR 2GBLA 1UKZA 1CJTC 1KI2A 4IVPA 3TMKA 2J7KA 4I99A 1AKEA 4DSUA 1XPRA 1JJ7A 5FOTA 1DAMA 4TYNA 1PVOA 2GCOA 3WMGA 1FMLA 4F38A 2RAPA 3GD7A 3A1TA 2R6DA 4LK2A 2DWPA 2WWXA 4MQBA 2ZE7A 3BB4A 2P6RA 4QHYA 3ZGXA 3EPLA 4LHXA 2FH5B 4K81B 1Z6YA 3SC3A 1PZNA 3TUJC 2ZRGA 2JLUA 1JR3A 2F43B 2VSOA 4B44A 1E9SA 4HLCA 3WYFA 4PQYA 2AX4A 5KOYA 2FFQA 4OI4A 4PHGA 5KYKA 1KI1A 4AYWA 1IY0A 3QPUA 2GJ8A 2ZS9A 1U81A 4E03A 2J46A 2J7PD 1Q1EA 1M8PA 1XEWY 3AF3A 3C7KA 4M1KA 3FB4A 2PCJA 5C4MA 2XGJA 1NN3A 5JWHA 3GP8A 4KLNA 3T1OA 1E2PA 1CU1A 3ZD6A 1A1VA 1EX6A 4RZ3A 1XU4A 4PO1A 1W36C 1YR7A 2V1UA 5FBLB 2FPLA 5FBWB 5HE9A 4MYHA 2W0SA 4BLQA 3Q7QA 2ZR0A 3KKQA 1Q12A 4GZMA 3UIEA 3QVUA 3U61B 4DDTA 1FX0A 1OYYA 3ZIAD 2NMVA 1OE0A 5K8TA 2AXPA 4F4IA 1IHUA 1X8JA 2HT6A 4RD3A 1FTSA 4A8JB 1NG1A 2DFTA 1WGWA 1COWD 4Q4AA 2QAGB 4RZ2A 3AEZA 1ZD8A 1J8MF 3FKSA 1ZM9A 4EQ6B 3N2EA 3P4XA 4KFSA 1U90A 3QBTA 5C18A 3I61A 2QMUA 4JKYA 4PX9A 4QGHA 2FE4A 4KVGA 4JL8A 2IS4A 3H0KA 3OHMA 4OK5A 4QBHA 1E2KA 2ZRMA 4URWR 3TSZA 4EPWA 1SVMA 1YKSA 1D2MA 1E32A 1KDPA 1VPLA 1HE1C 1XX6A 1IAQA 1K5DA 2E87A 1SVOA 2IYLD 2QRNA 4OK6A 1T3SA 4YC7A 5CLLA 4M21A 5EJEA 4MITA 3T61A 3WMEA 4C0SA 3PXGA 3EAQA 5FOUA 1ZJ6A 2AKYA 4QXAA 3L8ZA 3RWOA 1DAGA 1DAFA 3AV0B 5BQ5A 4PC2A 3QEJA 4RFSA 2G1KA 5FR2A 1Q20A 3B5JA 4L15A 1OXVA 1MR3F 2BM0A 1FMJA 2PEZA 4AG6A 2Q21A 3HPRA 4DLZA 4BLPA 5L3QB 1YQTA 2JIZD 2YVUA 1SVWA 1KMHB 2GBLC 1XTIA 2UVQA 4RZUA 1XXHB 2H1LA 4GP6A 2BDTA 1E2DA 1RRGA 3AVUA 1CRPA 3MWJA 3X1YA 2H7VA 4ERNA 1EK0A 2AD1A 3UXMA 2QROA 4D4JA 3B60A 3L0SA 2IHYA 5JRZA 3QQ5A 3NG1A 2ZRBA 2OILA 3PITA 2QGZA 4LWZA 1NVVQ 4BFSA 2QNRA 2WJGA 2CJWA 2UKDA 3K0AB 4LYHA 1AN0A 4M4SA 2ZJZA 3TVDA 2XOKD 3BWDD 4MGKR 2EQBA 3FHOA 2XJ9A 3QOFA 2GF0A 4TLDA 4PFSA 2G77B 3OEHA 1N0UA 2RGCA 1IJEA 5FUWA 2IK8A 3UMSA 4I81A 1Z6GA 2HF9A 3CIOA 3WYAA 1ZP6A 4V0ME 4KO8A 1WP9A 1IOZA 1HY3A 4UXJA 2NG1A 1Z2CA 3ASZA 2ZSFA 4UXIA 4DVGA 1SVKA 2ZUDA 3QKRB 1DBSA 2IXFA 4I1OA 3HWSA 2J59A 1MO3A 2V4ZA 1HUQA 4B48A 4L9WA 3U4QB 1KO5A 1MRSA 1TU4A 1HT2E 2GA8A 2YWHA 3PEVA 4Q47A 5FOSA 2JA1A 3JZAA 3IHWA 3QXJA 1G291 2WMNB 3DZ8A 2RGEA 4US2R 4ITRC 3K9NA 3WHLA 1CIPA 3KX2A 3DEFA 3ZLJA 2QE7A 3K9LA 1J2JA 2LCFA 1S3SA 4LY6A 4OQLA 1VCNA 3W90A 2GZAA 4Q00A 1NN1A 5A4JA 5F9FA 5FPSA 1YR8A 4KYIB 1LW7A 1HT1E 4NTZA 4LJ4A 2PJRA 1Z6AA 2Q6TA 2DY1A 4MRNA 4B34A 4P4SA 1ZD9A 1IN6A 3KB1A 4LJ7A 1OH8A 4QFMA 4IDQA 2C95A 1XB2A 4NKRA 3KUDA 3AKEA 2WV9A 2ZROA 3ZZ0A 4EFNA 3E5HA 4LYJA 4NPHA 1MO5A 2C96A 2B21A 1XWIA 2EW1A 5E7JA 3SI7A 5C4GB 4Z1MA 4UNPA 4JLBA 1FQKA 2ERXA 1GG2A 4JLDA 4Q4HA 4Q9HA 1D9XA 5EP3A 2BMDA 2AL7A 3FVQA 1TQDA 3TR5A 3IO3A 3I72A 4WXPA 1N6KA 4M1WA 4YONB 1DVRA 1E1RD 4A1FA 4PQRA 1SVSA 1G3MA 1XCMA 3VFDA 4BEBA 3KKMA 3UATA 2EYQA 2XITA 1S2MA 2F1JA 2QSZA 4DSOA 4A9AA 4RCYA 2BBSA 1RVDA 3Q5DA 1G19A 4XIGS 1GDDA 1E2FA 2F43A 2OLJA 2GZHA 3Q72A 5J40A 3AP2A 1JECA 1T5IA 4M1OA 4RD2A 1MT0A 2HT1A 4TN1A 2GCNA 4QHSA 5J5CA 2QMEA 3NC1C 1UKYA 4ZPXA 2O8BB 2VRWA 1NY6A 3VR4A 2YC2C 1R5NA 4Q7LA 2GAOA 4IEIA 4IOLA 4NYMQ 3TR0A 4FMBB 1XCGB 2IA5A 1NNEA 1RRPA 2BEJA 2IL1A 1IY2A 1RPZA 1IN5A 4QGGA 2PLRA 4IEEA 2CL6X 2J0SA 2IS6A 3R8CA 4FI3C 5DLQC 2Z83A 4D6PA 2LKCA 1Q0UA 4PPQA 1KK1A 4KFUA 2J41A 4OJKA 5FTNA 2VP4A 4A8JA 5K8IA 4Q01A 4C30A 1EFCA 2DHRA 4C2TA 4M1MA 2GEUA 1UADA 4KV9A 3EZ9A 1KJWA 2QAGA 5GVRA 4MYTA 1J8YF 1W4BA 4CT5A 1U8YA 4YDSA 4EQ6A 2WKQA 1QZXA 4B2IA 3I32A 1OFHA 1PUIA 3X1XA 4BQSA 3LRPA 1Z0AA 1JXOA 3TJZA 3X2SA 1RYHA 3EA0A 1G8HA 2CE7A 1QHSA 4Q7JB 3I5YA 3ZS8A 1RIFA 4LBYA 4IVQA 1CLUA 2W6ID 4OHWA 3MG9A 3GLFE 4JZKA 3AH8A 4BASA 2WTUA 3B82A 1XMSA 5B58C 1KK0A 1GFIA 1QVAA 3RLFA 2EWWA 4M1TA 4KFTA 5EE0A 5FPHA 3FTQA 2AK3A 2D06A 1T4GA 4L8GA 1N5JA 4FMCF 1E4YA 1E9CA 2NO1A 1X6VA 1N6HA 1DAKA 1AIPA 3LBNA 1SVIA 1CEEA 2RGDA 4HLUA 3HU3A 5L3QA 1NJGA 5TMPA 1KMHA 1W49A 1KJYA 1NJFA 3ADCA 4D2IA 1P2VA 3PUYA 3RNLA 4QM7A 1XMJA 1KKLA 1TNDA 1CTQA 2FU5C 4DSTA 1DADA 2HLDD 1R6BX 4DCNA 3DPUA 1L4UA 2WSSA 2MSEB 2P0EA 2WIAA 4O3MA 2ZSEA 1CJMA 1WE2A 5EP4A 2YKGA 2G3YA 3SHWA 4TL7A 3KDSE 2QMOA 1OB2A 4TT3D 4KODA 4AWXA 4ZCLA 3LAWA 1CR0A 2OFWA 2UZ3A 1IY1A 2Q3MA 3OE7A 4HZIA 1MV5A 3CF6R 3IQXA 2QEQA 1UBEA 5FUYA 121PA 4GMDA 4YMTA 2C03A 3AKDA 4LPKA 1XEWX 2O8EA 4B47A 4G01B 1KDRA 2GJAA 2H92A 5CLQA 1P7CA 2IT1A 2P6UA 5JI3E 1E94E 5JCZA 2D7CA 4PANA 1XFAA 1ESNA 3CLVA 5KDOA 5KSZA 1OJLA 3M0EA 3BFXA 2NQ2C 3DKVA 1LTQA 5EZ5A 3H1TA 5JZVA 1VYUA 4KVAA 3QKRA 5IK2A 2ZR9A 2XX3A 3ND9A 2C99A 4HSEA 3J81k 2V8OA 5KDDA 1TQ4A 1M7GA 3NIBA 3SE0A 3WY9A 5GJVC 4M8NE 3VAAA 1CR2A 4H1VA 3TUIC 1FUKA 4A8JC 2LWIA 1Z0KA 1OF1A 4HDCA 2ZJYA 4Q4JB 1E6CA 3EPJA 2HCJB 1OXUA 2GXAA 4DLWA 2QA5A 1E79D 1RFLA 2A30A 3NEYA 4JLAA 4XD7D 3B13B 3VQTA 4CYMA 5GJWC 3ICEA 4KBGA 2P5SA 3TIFA 1SQ5A 2ZS8A 3FFAA 4EPRA 4PC6A 2GXSA 4C9BA 1P2UA 2F9LA 4D25A 2BMJA 3RSOA 4RCZA 3UKDA 4MGYR 4D0GA 3GLGE 4IVRA 4AKGA 3M6AA 4AIIA 2PZEA 3DO6A 2JLWA 1E9BA 4U5XA 3O8CA 3CX6A 3GLIE 2ODWA 3E70C 1OKKD 1D9ZA 1W1WA 3X1WA 2OBLA 3CKLA 4HB4A 1JAIA 4PZZA 1EX7A 2KB0A 1E2LA 2ZE8A 1AM4D 4DIEA 1KY3A 3WNDA 2D4HA 2JDID 2KWIA 1FP7A 3IPYA 4DLUA 2Z4RA 4LDJA 4DKXA 5KTYA 3NDBB 4TTQA 4KLZA 3THOA 1G7RA 4A92A 2H5EA 3VNVA 1C9KA 1DEKA 5LDDC 2CCJA 5KNDA 1X1RA 1RYFA 4JL5A 1SHKA 2B6HA 4G5RA 1JEDA 3FMOB 1DPFA 2Z43A 3AF0A 4P31A 3REGA 4O25A 4A6XA 4LJ8A 4I1SA 5ANRB 4PO8A 5B2ZA 1K8RA 3WMFA 3L43A 3A4LA 2J7PA 5J4HA 3U3JA 4C0LA 2O8BA 3I92A 2X2FA 4FCTA 3TUZC 4UQOA 5KU1A 2XSZD 3AKYA 3K70B 2QPOA 3DZDA 4B2LA 1H8HD 1XTRA 1CF4A 3ZZTA 3D8BA 5FUVA 3ZVMA 4GDFA 4DB4A 2QI9C 5L3RA 3ZIAA 1U0JA 3QNUA 2R6FA 4P3YA 2EFCB 2GZDA 3IDQA 5DYIA 5BN3A 4JVNA 4S2EA 4DEYA 1E2NA 2ZS7A 1HA3A 3Q5EA 1COWA 1YZUA 4RKEA 5H68A 3PEWA 4QJ5A 1UPTA 2QAJA 4DJTA 3ZZUA 4ON9A 4HDOB 4II7A 1IXRC 1EFRD 1OIXA 3PUWA 4TL8A 4G5OA 2IYRA 1R5OA 3BXZA 3EA5A 5TVKA 4B73A 5JJLA 3OFNA 4PPFA 2GK6A 3LLMA 4G5SA 1E9FA 1VYVA 1GP2A 5IF9A 1VG8A 2VP5A 3LNCA 3PFIA 4DDUA 1GOTA 4MKFA 4FMDF 1OFTA 2OT3B 2P65A 1XTQA 4IW3B 2IYZA 3FMFA 2I4IA 4IDNA 3W8RA 1A7JA 1FFHA 2ZRJA 1BS1A 521PA 2IEZA 1S9HA 2V7QD 3EIEA 4K8OA 1KSHA 3W9YA 2VHJA 5DH9A 3GLFB 1L4YA 5L8VA 1E99A 1FW6A 4FWTA 1E2MA 3CUEF 2NPFA 3JZMA 1I2MA 4PHTA 1U94A 1E2EA 1P60A 2XEXA 3EARA 3AVOA 1EGAA 2QT1A 3PG5A 2JIZA 2WAYA 3B7GA 3L0IB 4M9XA 2RGXA 4MUAA 4QGFA 3U2QA 1ZRHA 2GILA 5E7IA 1RE0A 3A1SA 2ZU0C 3D3QA 1R0ZA 2WPDA 1KK3A 2CEAA 4GOJA 4M1YA 4QBFA 1LY1A 1GRRA 1ZM3A 3IPXA 4PZYA 4W5JA 5TY0A 4TLEA 2H57A 1T0JB 5DNYB 1KDOA 3IIMA 3NBZC 4UNSA 5SZHB 2ZR7A 4IOMA 4YQFA 4G3XA 2JJ1D 1Z2AA 4DLSA 1WMSA 3RC3A 4DDVA 3KTAB 2XOKA 1QG2A 1KGDA 2REOA 2Z0MA 1ELOA 4IXNA 1N0VC 3KL4A 1D6JA 4RSGA 4XOIA 3SNHA 4V0OA 5IT5A 1EESA 2C5LA 1YJ5A 1WCV1 1YRBA 3AVTA 4U02A 5HKKD 2OO7A 1CKEA 3RSLA 3KFXA 2XXAB 3RRNA 4BFWA 2WKRA 3THYB 2BV3A 1G9XA 3LXXA 3GQBA 3LBHA 5TDHA 3ICQB 5HCNA 5AJXA 3VKGA 2GDJA 3U6BA 2VIIA 5G40A 5AJZA 3OESA 2OZEA 2VEDA 4TZ0A 1LS6A 4V0MA 4BUJA 5CITA 4FMCB 2XNDD 1JXMA 5GVSA 3SHFA 2OCAA 1W4RA 3S1AB 4DBLC 4EJSA 2PBRA 1SKYE 2NO0A 1BYIA 1F3OA 2ZYVX 3Q7PA 3EIQA 4Q9IA 2BJWA 3HJNA 1HQCA 1J90A 5GADl 3RWMB 1N0WA 1KMQA 1Q1ZA 4LJ5A 1G8GA 2RKOA 4TMTA 4N0DA 4LYFA 4Q4JA 4OHYA 2ODBA 3HDTA 4HAVA 4EDHA 3T1QA 3A8TA 2WWWA 3X1ZA 2AFIE 4CDGA 3CPHA 4MKGA 2ZAMA 4Y0AA 5KSPA 4F4JA 5HR5A 5AUOB 1YZKA 1TUIA 1MABB 4YDHB 4NCNA 3IIJA 1KI6B 2BBTA 4IKEA 4Q9JA 2Q3HA 1R0XA 3NH6A 2ZJAA 4ILEA 2YWEA 3I5XA 2JJ2D 3MLEA 2IUSA 2PZFA 2WWIA 4BFYA 1N6OA 1US8A 2YOFA 2V9PA 1NMYA 1OH7A 1U8AA 4M2LA 2WZQA 3GLGB 3OIUA 2FPMA 1ZC3A 2RGNA 1SXJC 3IQWA 1ZCBA 2IF2A 4B2PA 5KSOA 3PCRB 4B3FX 2JCSA 4US1R 1TU3A 1QF9A 1KI7A 1P2TA 1QVRA 3BH7A 4E09A 5AUPB 3GLIB 2WIBA 5EZ6B 3MAAC 2ZRPA 3RAPR 1JQJC 2WHXA 3AKCA 2IS1A 1P9NA 4HB2A 4URYR 1XMVA 4KCGA 4TMZA 1OH6A 2JGNA 1F48A 1RZ3A 2WWYA 4ZDIA 3T1TA 1S4QA 2XAUA 4CEHB 1XTKA 4Q7KA 4EKDA 3KQKA 5JCPA 1VG1A 3TSOA 3EPHA 3DVLA 4TLBA 1Q3TA 1KO7A 4LGMA 4HB3A 5FTMA 2CK3D 2Q9CA 3CPJB 4PSKA 1BOFA 4LJYA 4ARZB 3PV0A 4LHWA 5LD2C 2O8FA 2J3EA 4DHEA 1S9DA 3EZ2A 3WYGA 1XD2A 3KB2A 4BFZA 3BD9A 1GZSA 4QG7A 3R7WB 2J0UB 1SULA 1GNPA 5EE5B 1VCIA 4QC2A 2FSFA 2J1LA 2G88A 4F92B 1Z0JA 3O8BA 3B78A 2DBYA 1TEXA 4Q1EA 1FOEB 5FL7A 2O8DB 1YZTA 2NZJA 1IN4A 3RHFA 1W4AA 2PJZA 5FFMA 5DN6D 3VMFA 3W6OA 5FBVB 1T8UA 4AG5A 2HCBA 2V55B 2AK2A 5DSZA 4CW7A 3E2IA 1CJUC 3W5IA 4Z8XA 3VR1A 2H17A 4Q5IA 4JBYA 3U3OA 1AS3A 2E1RA 2FV8A 4P4TA 4EJSC 3T06B 2V54A 5E95A 5KNCA 4LBZA 5CK4A 1ZUNB 4TQAA 3ZVLA 2ZUCA 3U7HB 2GNOA 4BZPA 4JBWA 4IDOA 1KAGA 2DB3A 1U9IA 1YU9A 3A1UA 3FMPB 3A37A 3RS2A 5F3WB 1ZUHA 1VIAA 2PMDA 3NHAA 4LHYA 4AC9A 1VTKA 3SZRA 2W6IA 3LH5A 1WRBA 1ZIPA 5H8WA 3AVYA 1WF3A 3U7EB 2V3CC 1IBRA 4TTPA 2ZYTX 4PC1A 3CONA 1KO4A 3D6TB 3ZS9A 1N6IA 3MWLA 5AUQA 2LKDA 5F9HA 5F98A 1BYUA 1VHTA 4R7ZA 3UK6A 5HCIA 3HPQA 3GLFA 2MSDB 5E4FA 4C0KA 1F2TB 3GFPA 5AUNB 5A0FA 2XB2A 3DOEA 1E96A 2QL6A 4D0NA 3W8NA 2NTYC 2B7BA 3GEIA 3G0HA 1XMIA 3LQQA 4KHZA 3B1WA 621PA 4PTLA 3N2IA 4G5QA 4ESVA 2CE2X 1RRCA 2ANBA 1OFIA 2RGNC 2C9YA 5G53C 1Z22A 1XEXB 2F7SA 3QVVA 1G1MA 2JJ8A 1ZW6A 4Q18A 2WJYA 3UG6A 3DM9B 3IEUA 4IDHA 3QXXA 3VR2A 2CHGA 3C8UA 4TYYA 4MGIR 5AJYA 5BWMA 2FMXA 1AA9A 1IONA 2J45A 4LCBA 2XTZA 2ZU6A 4ASUD 4Q9KA 1G3UA 3L2OB 2YOGA 1JI0A 1NMXA 2WICA 4IOKA 3KTAA 3LVRE 4TQUS 2BBWA 1W0JD 3C15C 4TQ9A 3FE2A 1NBME 5EP2A 4ZDWA 2OV2A 3ADKA 4I1UA 4DLXA 1JB1A 1IXSB 1W36D 1QRAA 3PIRA 4C7OB 3BK7A 1IN7A 3GFOA 4FMDB 4Z54A 1E1QD 4EFLA 3GJ6A 2XXAA 1O87A 1E9AA 1G4AE 1NBMD 1TF7A 2VP6A 4AKIA 3UMRA 1UJ2A 2C77A 3WRYC 4W9MC 4HUQB 2GRJA 3I8XA 1AS0A 4G1UC 2MSCB 5TV2A 1Q44A 1GL9B 1TF2A 3K0CA 4UJ5A 4A82A 4BWYA 4D26A 1OXXK 2C9OA 4DUGD 2YHSA 3DL0A 3GEEA 4OK3A 4RFVA 3S1AA 2RMKA 1JJVA 1CULC 2IUUA 1VECA 4YMWA 3H84A 2PH1A 1U99A 4WAUA 1GL7A 2GHIA 2QRZA 1KKMA 3C5CA 1SKYB 2O0HA 2ERYA 2F55A 4HZUB 1CJKC 3K0FA 5FOVA 2QTVB 2R65A 1F60A 4TYPA 5JFGA 4B3CA 1E79A 4OQMA 3B2EA 2VF7A 1AZSC 1A4RA 1U9IC 2R62A 3MMPA 1G21E 5B64A 421PA 5AR1A 5CB6A 3PEYA 4DLRA 2YJTD 1IQPA 1MABA 3E1SA 4OBEA 3WBKA 4A4DA 1AJEA 2IYYA 3PEUA 2BOVA 2N42A 3B9PA 1JEEA 4EIWA 2R6CA 2FX3A 4PXAA 2WWHA 3TQFA 4JL6A 4A0HA 4HYYA 2OSBA 4CRWB 4Z8YA 1G6HA 4QBGB 3GLHE 1WBDA 1XD9A 3GLGA 3IILA 4C0HA 1N6PA 1F2UB 1R8SA 1UKVY 2ZRCA 3U7FB 4NONA 2IYWA 1JPNA 3GLIA 2F1RA 3BB1A 4HUTA 2BHRA 1E69A 1GNQA 2NO6A 1JR3E 3ZQJA 1U8ZA 1HH4A 4WVFA 1XPUA 1E9EA 3IBGA 1ESMA 5DIFA 3CF2A 1DG1G 1HV8A 2JAQA 2PLFA 1JR3D 3CWZA 3G82C 4IXMA 3LLUA 3VX3A 1BMFD 1II8B 1I4DD 2QY9A 1OPXA 4FD2A 4M1SA 3MGCA 2QGNA 2FGJA 2PL3A 2WM9B 1N6RA 2DWQA 4LZZA 2RHDA 2ZE6A 4FXPA 3P32A 2ZRLA 1KO8A 4ARZA 3TW4A 1AQYA 3AF2A 1PLJA 4JLOA 3VX4A 4TYWA 2ZANA 1CS4C 4PZLA 3BH0A 4X8HA 4A36A 3N70A 4BECA 3FYHA 2C9CA 3R7WA 4OI2A 1NVXQ 2Q0HA 4ZCMA 1NLZA 2VYFA 4NL4H 2HJGA 4AD8A 4NCHA 2IYVA 1DO0A 1Z0DA 3AF4A 4A2PA 3QG1A 2O8DA 2O8CB 3UWKA 3A1VA 1HTWA 2NOAA 4OQXA 4CF7A 2GTPA 4B6FA 4MRSA 2P2LA 2OXCA 3BJIC 3NVAA 2W6JD 4QM6A 5GJBA 3L0OA 4TLAA 4N0EA 4TSFD 3TNFA 1XD8A 1EXMA 4WOPA 5D3QA 4C0BA 2VP0A 3TQCA 4HB0A 2HF8A 1J7KA 4ESHA 1E0KA 2IC5A 5EE1A 3RABA 2QZ4A 1G4UR 1N3BA 2OBNA 2WJVA 3QXHA 4PQFA 4Q1AA 1IXZA 1TADA 1KHTA 3BOSA 5CJPA 2ZM5A 4Z51A 4BLTA 1U98A 4TWZA 4MRVA 4YXWA 1E0JA 2A9KA 2CNWD 4JLJA 2G1JA 4UJ3A 5L3VA 1K5GA 3ONWA 5EXXA 3RRZA 5J4KA 3IHLA 2O52A 4C0JA 5CK5A 1XDBA 4JYCA 1YR6A 2ORVA 3NBYC 1XTSA 4GNKA 1UF9A 1KSFX 3W3ZB 2ZVQX 2WKPA 1S3GA 1VCOA 1KNQA 4XWOA 2AWOA 4H1UA 2OBMA 1F2TA 4G5GA 2HV8A 4DLTA 1T3LA 1XXHA 1Q57A 2PX3A 2WSMA 3AVQA 1U0LA 3UANA 1VG0B 2CL0X 1JALA 3PENA 2IYQA 2C98A 3A36A 2VO1A 2ZEJA 1YE8A 2A5JA 2YOHA 1ZM4A 3NEJA 3AF1A 2BKUA 1XEXA 3C16C 1HQYE 1V5WA 4ZKDA 4MRRA 3NXSA 4HI0E 3K0AA 3KKOA 1ZD1A 2GWHA 2P5TB 2VSXA 1KO1A 1T8TA 2A5GA 4R71A 4EPVA 1KK2A 2REXB 1E3MA 1JBKA 4TZ6A 4JKIA 5AK0A 2OCBA 5JEEA 3WNCA 3W3AA 4CEJB 2VHUA 1TL7C 2ZETA 3H4MA 1QDEA 4HLQB 2JLZA 4WXRA 1ZNZA 3THXB 2R8RA 4BFXA 1W36B 1NP6A 1XPOA 1QBKC 5EXPA 4IDPA 2IW3A 3I73A 5TXGA 3OEHD 3K0EA 3WHKA 4XWKA 5HKKA 721PA 3MCAA 2ECKA 4C7OA 2DR3A 2OE2A 2WOOA 2AKAB 4LJ9A 4OJQA 5G3ZA 1NVWQ 1T9HA 1G16A 2R44A 2D62A 2IX3A 1LS1A 3U4QA 5G3YA 3LQRA 3KQHA 4HUQA 4GT1A 1QHHB 1RJ9B 1L8QA 4GBMA 2GEVA 3C4JA 2I3BA 1G3RA 3A4MA 1VDZA 2JASA 3MWYW 3GCGA 3NDPA 4GMXA 3OAAA 4B43A 2QENA 2QAGC 2P6NA 4HAWA 3W6NA 4KXFB 1NIJA 2A5FA 2OCYC 4OYHA 4DLVA 1PJRA 4LUCA 2N1BA 4AI6A 4JLKA 3U7GA 3U44B 3I1FA 4LV8B 1DS6A 3K9GA 4HZUA 2ZRHA 4Q48A 1DAEA 5JWRA 3CB4A 3R20A 3GJ5A 4MKHA 1G7TA 5GJCA 2WWFA 2ZI9A 1V43A 2JEOA 8OHMA 2ZRFA 1LFDB 3ASYA 3O8DA 3QPWA 1BIFA 4MH0R 4O2RA 1GITA 4D0LB 4L4UA 3FDIA 2CMKA 5J4YA 1NMZA 3LX8A 1TEVA 3RRYA 4DCTA 5EP1A 5FOWA 2FGKA 3NKVA 5FI1B 4C0AC 1DG3A 1M7BA 1B23P 2CHQA 4CVNA 3QF4B 2O0KA 3OZXA 5JJKA 2Z4SA 2W2XA 3REFA 1C4OA 3LX5A 5H70A 5IRCD 4HLUC 3LWNA 3B1VA 3WBJA 3EC1A 1MO4A 4IFBA 3PUXA 4EAQA 3WP1B 1F2UA 1ONBA 1N5KA 2GJKA 2ZE5A 2GCOB 2ZJ2A 1NL3A 3CPEA 3HP1A 3GLHB 3QKTA 4PHFA 1R5BA 3SOPA 4TL9A 3TAUA 4UXHA 2NO7A 4Q4LA 3ADBA 3BRWD 1FPMA 3B1ZA 1CR1A 5BW8A 1L2TA 4Q1FA 2RB4A 1R7RA 1D5CA 1KIMA 1QHNA 2ZRDA 3O8RA 1OH5A 4IOJA 3AVXA 2ZQ5A 1AK2A 1HURA 4CEIB 3P1JA 2YNMA 3BORA 1M2OB 2BMFA 3CF0A 3FPAA 4K46A 1G3IA 1II8A 1OHHD 1RKBA 4P4UA 4DEXA 3OIYA 2L0XA 2Q9AA 1KI3A 2ZYWX 3W5JA 2FZLA 4B6EA 1YHNA 1NN5A 1GIAA 2D2FA 4Q7MB 5DHAA 2OAQ1 2A7QA 4C0QC 1S1CA 2NZ8A 1E0SA 2XB4A 1W2HA 3QF7A 5D3MB 2CDNA 2ZI6A 4AKEA 3LBIA 1NG9A 3MRSA 2I1VB 1E2QA 4C2UA 3T35A 4LSGA 2ZRNA 2ZIAA 3DHWC 4KU4A 4KSBA 4LC0A 4UKDA 4B3GA 4WW0A 5DN6A 5KPJA 1I4TD 3CH5A 3B6EA 3I4LA 3RRMA 1ZM7A 4LBWA 4Q1BA 3AVVA 1LF0A 2ODEA 2FEMA 5TARA 1ZIOA 4PO9A 1ZNWA 4I1VA 2GCPA 4DB2A 2BEKA 4JIMA 4TMKA 4N3NA 2F3TA 2WWGA 3QY0A 4UNQA 4EPXA 3GJ3A 3L82B 1IJFA 1P9WA 3PR1A 1KOFA 2JATA 1G6OA 1X3SA 4HAXA 4OQFA 3GJXC 3SYNA 1T5LA 4OHXA 5HZKA 1M6NA 3VTKA 3LV8A 1ZUIA 1MOZA 3CR7A 3MFYA 4B76A 5CDFE 1KI9A 1OT3A 1XZQA 1QHGA 3KFVA 3OEED 3THWB 2F1IA 1R8QA 1MRNA 5FTJA 2VPPA 1P3JA 4KBFA 2X8AA 2IWHA 3T15A 4O0MA 3VR3A 3P20A 2ZI3A 2DPXA 4URZR 2WVJA 1KI8A 4RFSB 2GKSA 1DO2A 4B33A 1LVGA 5KHOC 2R2AA 4B32A 4HDQB 3BE4A 4MA4A 5JHHB 2B8WA 2ZRAA 5G41A 3KXKA 3TVTA 5KSYA 2AXNA 5EE9A 3WXMA 2PZGA 3DMNA 3KXIA 3Q85A 3BAFA 3MJRA 4JSYA 2OM2A 3RS5A 5DYGA 1XP8A 2HUPA 5CM8B 3K8YA 1OYWA 3T5GA 4JT4A 3K09C 1BO6A 4CZ2A 1GKUB 2REBA 4L16A 3LVQE 2J9RA 2G9NA 5AJVB 1DELA 1A5TA 3DOFA 2DFLA 2R6AA 1X1SA 3AVPA 4RZXA 3RS3A 2WJJA 2C78A 2FPKA 5KPDA 4AYXA 1Q3HA 2VP9A 2IEYA 1W44A 3CRRA 3CX8A 4KSCA 2A5DA 1TMKA 4CEJA 1M1YE 4P33A 4OL0A 3OE7D 4NH0A 4PHHA 4BFVA 5A5GA 5HE8A 2PT7A 4DCSA 2IWRA 3TW8B 1PLLA 2QP3A 1FNNA 1NBMA 4M9ZA 2GXQA 3ZQ6A 5IDVA 1VMAA 2V6IA 2BVNA 4LRWA 4OI0A 3KJGA 4KAXA 1KI4A 1ZVQA 2IYTA 3ZDQA 5C2JB 1CRQA 2HYDA 1Z63A 4IRUB 3IEVA 5KDLA 3IKJA 1NI3A 1UBFA 3DKPA 4YLGA 2EVWX 1ANKA 4M9SA 1N6NA 2VA8A 5IK2D 4PAMA 1NN0A 1E9RA 2WMOB 2YYZA 3PUVA 2A78A 2AD5A 4LOAA 4M53A 2QN6A 2QUZA 4A6PA 3CH4B 1E2HA 1NLFA 3U3MA 1KSJA 4B35A 3U5ZB 1AGPA 2FOLA 3AP3A 3U44A 5KNBA 6Q21A 2CLDX 1G8FA 4ZIRB 4MYUA 3IO5A 2BWJA 2ORIA 3PQCA 4XH9B 1CBUA 5E7MA 1E9DA 3FGNA 3ECCA 4ACBA 3TBKA 1JPJA 2UZIR 5FBRB 1MO6A 2OEPA 4TTRA 1FL9A 2ZRIA 3AGPA 1Q22A 2QORA 4JLMA 3EX7C 1WA5A 1I4LD 1FP6A 2IYUA 1ZU4A 2QPTA 2QTFA 3KJIA 3PVSA 3B1XA 1YVDA 2VLIA 3W34A 1E4VA 2VHQA 3QBVA 3TH5A 1TTTA 4QKQA 4YMVA 1YR9A 2JLQA 2GXUA 1MH1A 3SS8A 2EFHB 1XNJA 5LPNA 4P32A 1W0KD 2NIPA 3QF4A 4BE7B 4V03A 3H2YA 1OIVA 4B3BA 1N5LA 1XBTA 5EXSA 4MGZR 4XVRA 1S8FA 2YWFA 3EIHA 1SKQA 4E5UA 3R9XA 1E1RA 5LB2A 2PX0A 5CIQA 5B57C 1W2GA 2QT0A 4JLVA 4Q4HB 2IXEA 2J0VA 3KJEA 3NWJA 3EC2A 3LA6A 1TX4B 2GJ9A 2X77A 3LD9A 1GRNA 2B8TA 2BCJQ 3GLHA 1ZMXA 1KYIA 4A2WA 5L3SB 1Z29A 3VR5A 1R0YA 5JEDA 4BLOA 2ZYUX 1VIYA 3BC1A 4R2IA 4JLPA 2IHBA 1PLKA 4LHZA 4B3XA 2QMHA 1YZLA 4J0QA 5JI2E 1I2DA 2W83A 4X8LA 4QJ3A 1II9A 1BMFA 1S0UA 4CEIA 4U00A 2SHKA 4XSGA 3SDZA 1Q21A 2W2VA 1P62B 3SU8A 2FF7A 4A0RA 1NKSA 3HR7A 4GSYA 4EPYA 2IS2A 2NO9A 1Z08A 4DDWA 3AGQA 1ODFA 5D3MA 2D2EA 4O2LA 1BH2A 2OFOA 3R9WA 1QHIA 2QU8A 3TK1A 3ZYCA 2WJHA 4JJZA 4RY2A 2GVDC 1GVNB 4DIDA 2W00A 4PR0A 1JAHA 4F91B 3AQ4A 1NSTA 3ND8A 2FG5A 3I3SR 2QP9X 4JVSB 4XTCS 4JT2A 4LC1A 2XZLA 3VNUA 4NYJQ 4WIAA 3QXSA 1Z3IX 4JSTA 2W6JA 1KJZA 2FNAA 4WA7A 1NSFA 3EW9A 3HYRA 4DWJA 1GILA 4LJ6A 4TSFA 3FWYA 3M4YA 4D81A 1FZQA 4CT4B 2EFGA 4WZAE 1EFTA 2GF9A 2Q3FA 1IN8A 1OLOA 4OQNA 4H9GA 2PMKA 2FSIA 1TAGA 2QQEA 3OFND 1T91A 2NPIA 4ZO4A 4YMUA 3ZH9B 1EWQA 2BM1A 3FHTA 4RD6A 5DHFA 2V6JA 2CNWA 1X86B 5JMTA 3CWQA 4EUNA 3KQNA 1AS2A 3THWA 1SXJE 1E2IA 1PUJA 1LV7A 3UPUA 2G0TA 1Y3AA 3SJAA 4B75A 1GSIA 2OXRA 3KZ1E 3RS0A 4DXAA 3IIKA 1D8TA 4JVLA 3PJRA 3OF5A 1UAAA 4LYAA 1FQJA 1SXJD 2IYSA 3JVUA 2W2TA 3U3RA 4XTRA 2HLDA 3SR0A 2OAP1 1J99A 2Z5FA 3B1YA 3CNLA 4EPTA 4V0KA 3GJ8A 3I62A 4KFRA 3FOZA 3KKPA 2F9MA 4ZI2A 3EWSA 4OKSA 2EFEB 5LB4A 2WPDD 1P4SA 4OHZA 4TT3A 4Q9LA 4TMVA 2YWGA 3ZJYA 4PSAA 4NDZA 4PC3A 2QG6A 1U0HC 4TL6A 2GETA 2ZSDA 2RGAA 3TRFA 4FCVA 4R2HA 5BXQC 2JLRA 1M34E 2HEIA 1BKDR 1ZINA 3THYA 2FN4A 4A0GA 1ZU5A 2BMEA 3K70C 3BFKA 3Q9LA 5EUMA 2YC4C 1Z07A 1D2NA 1XF9A 5CYPA 3CRQA 4FCWA 3TAHA 2O8EB 5AJWA 1XCPA 3I8SA 5UKDA 5IHPA 2CBZA 1W46A 2PT5A 5C1BA 1OIWA 2R9VA 5BN5A 1NKTA 5KUTA 5F2EA 4ZV4A 1GAJA 4JVMA 4XVQA 1KZGB 1W5TA 3QKSB 2G6BA 4B3DA 3BFVA 4V0LA 1MKYA 3C41J 1AZTA 2VF8A 1A82A 4IFEA 4HAUA 3EZFA 5JRJA 3GJ4A 4NYJR 2CCKA 4V0NA 2PCLA 1VCMA 2CXXA 1Q1BA 1H8ED 2BJVA 4XD7A 821PA 4TYQA 3M1IA 4QHTA 1Z5ZA 3A4NA 3LFUA 3UWOA 4UNRA 2EU8A 3HU1A 1LF5A 3P27A 4ZIRA 4GZLA 4KYUA 4Q1DA 5JLJA 1GKYA 2V1XA 4NHOA 5FBQB 3VKHA 2HXYA 2WBLC 3EZ7A 1KI6A 1RC8A 5JS8A 1GWNA 3ZVRA 3A58B 3MWKA 4MYCA 5AWFC 2CLSA 2O5VA 2CHVA 1XJQA 3KKNA 4L5BA 3RANA 4DRZA 5FPKA 2HJVA 1OKKA 2F3RA 1EFHA 3GPLA 3R9IA 4L9SA 4DCUA 4BEJA 3BS4A 4MDFA 3CW2A 4RD4A 5JECA 1GTVA 1UM8A 3KUCA 1G41A 2JDIA 1RRFA 2C2HA 3RC8A 1CR4A 1VG9B 3T5DA 3UG7A 4B74A 1KSGA 2RH5A 2IYXA 4XSHA 2ONKA 1G3QA 2VH5R 2RGBA 2EFDB 2W0MA 1A2BA 3LW8A 5JSZB 3IGFA 1YRAA 2AWNA 4ZI3A 5EXTA 1R4AA
chains in the Genus database with same CATH superfamily
5A05A 3CNNA 1GKLA 4FGKA 5GP1A 3C3AA 5D8DA 1NVVR 2XXBA 5EKSA 5H0IA 3A3OA 3PE3A 4TMWA 2JKVA 3WV4A 4FOLA 2BBOA 1CY0A 3VC7A 1CV2A 1PV1A 3K0CC 3HO1A 4ZVUA 3BGIA 4P0PB 1TTQB 4LJRA 4LV5B 1PFWA 4LBVA 2YUTA 1LI4A 3QE4A 4JMPA 4KMSA 4HDKB 3HDJA 2I9KA 1U65A 1N8NA 3UH0A 1K6MA 2VDNB 1PR2A 4QJ4A 3JVVA 2RC6A 5IKMA 5EWJA 4UC0A 1UK9A 2XADA 2QJTA 3Q10A 4HNQA 4MVXA 1QNLA 3OZDA 3K1JA 3PLNA 4LPSA 1QANA 5BQHA 4EF4A 1SUCA 4J1QA 2ACEA 2QX9A 4FGLA 3SIPA 1P1FA 3MJ4A 2VDWA 5FUBA 2E3JA 1ZKMA 3BB3A 3NBFA 3VTZA 1CUGA 1D6NA 2H16A 3F9RA 3HJBA 2EKQA 3LC7O 1CR6A 4X71A 1LWOA 1ZC4A 2F6RA 2HR1A 3IEMA 5K8JB 4IHQA 4DLAA 2ZXUA 1U0RA 4UVIA 3C24A 2QJFA 1DAOA 3VKWA 1KTVA 1Y63A 2ASEA 5FF9A 4EHHA 3MGAA 5TPWB 2H29A 2X9NA 3NHUA 4NCBA 3PIDA 3S2IA 3BHMA 1HLGA 1Y3IA 1SOAA 5JHGB 2LGJA 1KAOA 5AOAA 2QP4A 3G9XA 1UMDA 3F7MA 1KPHA 1A9XA 1DXOA 3VNBA 2C0PA 3BQMB 4XA8A 4CR8A 4JT8A 2CJPA 4CG0A 1J4AA 2XBUA 3L1IA 4BKMA 4BPRA 2XF8A 4D9JA 3RBVA 1QE5A 2R02A 3TIIA 4KPUB 3RD5A 3E9NA 1WQ1R 4MQLA 2SKDA 3GEHA 1M0TA 5E1MA 3IB3A 3QVSA 2MR5A 3A31A 1NOJA 1FX0B 2HHHB 4EJ0A 4NP6A 3OPMA 4KB5A 5JH7F 1S2IA 4QOSA 2E4YA 1EZZA 2YN2A 5EWLB 5KO2A 2HV7A 4R8KA 2A5YB 4M0LA 3O3CA 2IZ0A 4C6SA 1UPXA 4J2TA 2P69A 3QEOA 2ZBUA 5JBNA 3A2LA 3KJHA 1CVIA 4DR6B 4EABA 1E6WA 4LF4B 5BVHA 1G20B 5B4UA 3F2IA 3BAZA 1XXHE 3F67A 1FF9A 4J0JA 3G7NA 1I36A 4E7ZA 2X5JO 5DI9A 3LL4A 1QP4A 1NBOA 2RHTA 1OCCC 1HE9A 5M04A 3A1DA 1S8AA 4FFBB 1AZWA 3QW0A 4JT9A 2OXIA 3PF9A 4PYJA 3ZHYA 1KTMA 4Q24A 1L7BA 2G0NA 2BELA 4XM1A 5IDWA 3PHIA 3C3KA 3CRVA 2BKLA 5CJ2A 3MJHA 5DHSA 1XG5A 3BMNB 1QHFA 5DYNA 4M86A 2AMFA 2XDYA 4FFOA 3W1EA 5H16A 2VTDA 4MQFB 3OKPA 1X2BA 2Q46A 2WAXA 5SZIA 1QQ6A 4H4CA 3STXA 2HOQA 1G5RA 2J4FA 2GCGA 4FEYA 2ZREA 3A6LA 2ZIGA 1RHKA 5JNTA 4HX5A 4IVPA 3ZLTA 1X8XA 2GCOA 2Q5CA 4OIQF 2RAPA 4H6PA 1I7PA 1D0XA 5TIIA 4ZCQA 1NOKA 1B00A 4FZ5A 3CCCA 1JR3A 4CTMA 3PT9A 2XF2A 2KLBA 5G1OA 1U81A 2LFFA 2J46A 2J7PD 2PFGA 4D8WA 1GAXA 4AG3A 5FBWB 1JKJB 2WZDA 3I9KA 4WY8A 1Q12A 3I01M 4ND5A 3B12A 2QR5A 5D85A 5FAXA 1SPXA 2PPLA 1B4DA 2VS1A 1ZD8A 3TJRA 2BDEA 2RHHA 1U90A 4M8IA 2JAOA 2P7VA 1SVMA 1VPLA 1HE1C 2ZIZA 4G0WA 1SVOA 3GRRA 4MULA 4YC7A 4E5NA 1TTPB 1UBUS 5ENDA 2NVWA 3EDQA 4L72A 1N2CB 2CT8A 2MYUA 4MYDA 3G9TA 2WZCA 4F72A 4KGZA 2HSWA 2C3YA 2OAGA 3EQ9A 4YRLA 4ZRDA 4J90A 2P7HA 2FZKA 2XM0A 1EUCA 5EHIA 2CXRA 1NM5C 1L5MA 2OCXA 3RW9A 5BSMA 3HLTA 1L8OA 2BRUA 2ZJZA 4XUGB 4XEHA 1W4LA 1EZ1A 4Z53A 5HM8A 4D57A 4Y2GA 3K6JA 1NE2A 3VO8A 1SC6A 4WGYA 3HCPA 2WQZA 4B48A 3LUAA 2EZ8A 2SBTA 2IM8A 2JA1A 4MVJP 5G0TA 1HFKA 4UM9D 1CIPA 2GEBA 3H6KA 2NZVG 1YB1A 1NX9A 1B76A 4BKRA 4LJ7A 4G81A 4R1SA 1C3OA 4HH1A 3V4LA 5EIEA 1FQKA 2XODA 1D9XA 1HTTA 5KVCA 4YCBA 2AV6A 3ZI0A 2VT6A 5LQKA 3T3EA 2Q3JA 4JTCB 4BEVA 1GTL1 1DXYA 1V9CA 4IEIA 2WF9A 1RRPA 2ZB2A 2QTZA 3D7LA 2PWZA 2CL6X 2QRVB 2IS6A 1J6UA 4D6PA 2FYTA 3CC8A 1KDZA 4C30A 2GPYA 3PR2B 3EBLA 4KO2S 2I71A 1U8YA 2DPLA 1QZXA 5HYVA 2OR3A 4CIHA 1PNQA 1NW5A 4LFBB 4RKQA 3CLTD 2EWWA 3FTQA 5GOTA 4WOBA 1EIZA 1XNGA 2R48A 4BCBA 5K0FA 1P2VA 3PUYA 2H1OA 3M5DA 4IDBA 3CZ4A 1RI1A 3O8QA 2UYYA 5EP4A 2WI8A 1RAIA 3KDSE 2Z2JA 3CX4A 4TT3D 4KWIA 1GNSA 4B0OA 5IFKA 5TGTA 3ZHOA 3QYFA 3RF6A 5KDOA 3I1JA 3BIXA 4BVHA 3ND9A 3O1JC 2V8OA 3FCSB 2OCGA 3RSCA 4H1VA 3TUIC 4P6IC 3PJDA 3FGOA 5E6SA 2HCJB 3JZFA 5EYPB 2M98A 3L1MA 4DLWA 2FCRA 1QGED 2J32A 1AO3A 1E3WB 4KBGA 3TIFA 3ONDA 3VYTB 1QFMA 4D0GA 1QCZA 3Q6NA 3CXRA 1JAIA 4MTGA 1J56A 5HG0A 2UVDA 5JDIA 4MKXA 3C85A 3LLIA 1GADO 3GBSA 2B6HA 4MPDA 5TS2A 3LYAA 2EKZA 3MHTA 3AB7A 2R6HA 4QBTA 4ULWA 1DFIA 3QFTA 4DB4A 1WUIS 1BX3A 5DKFA 3IDQA 3PC2A 1VKHA 4L6AA 2W7TA 2P4UA 2GS9A 7GPBA 1OIXA 2EL7A 2CVPA 3EA5A 1K6XA 4FU0A 1GP2A 5CYGA 1GOTA 4MKFA 4GYYA 2OT3B 4KKXB 2X58A 4KOEC 3DJNB 2VHJA 1L4YA 2WUWE 4OHKA 2CHUA 1GPMA 1E2EA 4Y2TA 4DAEA 3RB8A 3PG5A 4Y9RA 1AHIA 1RE0A 4JTAB 3PE4A 4AO6A 4BMCA 3NBZC 3Q8WA 2PA0A 4JI6B 2FN3A 4GQAA 3KTAB 3UGTA 4DDVA 1OFUA 4W5NA 3ICVA 1CVRA 1RPTA 1IIBA 2OO7A 3EIWA 3A28A 3LBHA 4IMJB 2PD4A 4TZ0A 5GY7A 1JXMA 5CB4F 1MX3A 3S0JA 2VYCA 1FJ2A 3KSAC 3MUEA 2XMCA 1T1EA 4HNRA 1RQLA 2FWPA 1MNAA 3HDTA 1CNMA 2WWWA 4XGIA 4MKGA 4H4DA 2X0DA 1YVEI 5EERA 1VBMA 5CLFA 2Q3HA 3OJ0A 2H48A 4P1ZA 4MR7A 3C3CA 1N6OA 4OO3A 3L1UA 4W82A 1DHTA 5IVPA 1MMDA 4BNMA 3AJDA 4LZLA 1G5ZA 1EFVA 1F48A 3T1TA 1C2TA 2HO5A 4C29A 4TLBA 5EMMA 3EGIA 4PFKA 3OJWA 1DINA 2JH3A 5AOCA 5E2IA 1FS4A 5KINB 1BA2A 1OWLA 2B5VA 1TPYA 1L5LA 3IQ6A 1DCKA 5D86A 1ECLA 5AKYA 2CMFA 1YONA 2ZGVA 4LN1A 1P1JA 3E2IA 3KTFA 4DTCA 1LSSA 5BR7A 2FV8A 3GC6A 3U7HB 1DJPA 4HDAA 2FZ5A 3C6ZA 1VTKA 1VL1A 5DPMA 4BX9A 4YQEA 5IN5A 3QVXA 3HNLA 1M2NA 4B4VA 4XLZA 2GK4A 1VHTA 1Z25A 2ID4A 4IDFA 2C9DA 2QX6A 2VT7A 1QLJA 3L0IA 4PEVA 4XYMA 4CLHA 4QDLA 3ZJTA 3H7AA 3GEGA 1IONA 1Z9BA 4JQYA 1FYDA 2YOGA 2IH2A 1FRFS 3G5MA 4IO0A 4J0IA 3FE2A 3KOZA 1AUOA 4UUAA 1VQ1A 1NBMD 1T9KA 2C77A 2HK7A 5ICEA 1BJKA 3BGSA 2WTMA 1TF2A 4O59O 1OXXK 3FZGA 3K72B 2PH1A 2EG9A 3VNSA 3FJYA 1PYGA 1T4DA 4RJJA 1AZSC 1XCOA 1A4RA 1C17M 3KLPX 4BCDA 4BVKA 5AR1A 3PEYA 4A4DA 3FPHA 1JEEA 2EWMA 2WV7A 4JL6A 5AW2A 1O08A 2KYHA 1XD9A 3NYQA 3IILA 1YAJA 4FSXA 1AKNA 5BWBA 3HXOA 4OF4A 4OA8A 2NO6A 3VNRA 1P4AA 1JR3E 1MTZA 1MB9A 3OPYA 3ONEA 2IYPA 1I4DD 2Q5FA 2PL3A 4AO8A 2ZE6A 4FXPA 5K2MA 4JI3B 3MOSA 1FFTC 3Q7LA 4NL4H 2HJGA 4FN4A 1DO0A 5IXSA 4J6EA 3BRJA 3A1VA 1NBBA 5BR1A 4IZHA 4AULA 4RVOA 4EGSA 4C0BA 4EELA 1Y9JA 3RYHA 3EGDB 1RVV1 3ADOA 1TZ2A 2H5JA 1ZUNA 1H5QA 1K75A 2VAVA 3LUPA 4C7KA 4MRVA 1I9CA 1BDMA 4UW9A 2O52A 1VPWA 2WD7A 3W3ZB 4U0JA 5IKOA 3WGTA 3C2QA 2C1EA 4HMPA 4GYJA 1U0LA 1B0AA 5DHTA 4L51A 3GH3A 3IALA 3MLBA 3O7MA 3NXSA 1HT0A 4HI0E 1T8TA 1KK2A 4YAWA 3KWFA 1YRHA 1QDEA 4KXVA 1A7KA 3L1JA 5ITSA 2GUGA 3U13A 4PICA 2ECKA 2DR3A 2OE2A 1MPTA 1I4ZA 1NKVA 3CIFA 3QFFA 2EJCA 3P9ZA 2H9YA 3UAOA 1NU7D 3L79A 2VDKB 4NCAA 4RH3A 3ISVA 4UM9B 3UK7A 2G5PA 2JFGA 2F3SA 2VP3A 4AQDA 4Q48A 3FWNA 4RV9A 8OHMA 1P1BA 4D0LB 3E27A 2X9VA 1P0MA 3ESDA 1ZOSA 1Q7BA 1H42A 4M88A 2BZ0A 3LWNA 3B1VA 4PFJA 4EAQA 3BCSA 2B83A 3CPEA 4U6QA 3SK0A 1QCDA 2VOEA 3B1ZA 1HFWA 1PK8A 1D5CA 3SXYA 3L0YA 3GIDA 1XCJA 4DEXA 3HL0A 3TTXA 1I0IA 2ZVDA 3AFGA 3AEKB 4Q7MB 2IP4A 3F1LA 3GH1A 3V33A 5MGNA 2NUTA 3FLMA 2NSLA 2ZRNA 4C6RA 1XSEA 5U1PA 2ZW9A 1I4TD 2NXEA 3RRMA 5KOHA 2C1XA 1ZZEA 4ARVA 3L82B 1S01A 1P9WA 3TEMA 2V45A 4ER0A 2DQ4A 4EX7A 2NSDA 1CUCA 4DKJA 2B36A 4KBFA 3VR3A 3GDGA 2WVJA 3BWXA 5KHOC 1ODJA 1K89A 2I7VA 3E23A 1O2DA 5BUQA 2I6TA 1IQ0A 2HUPA 1WPQA 3HXMA 5FV4A 1TM1E 2H65A 3N2YA 3TYXA 2WJJA 4YP1A 5CVVA 4LRSB 3H65A 3VUFA 2F67A 3ZWBA 2BUCA 1W87A 4JYMA 3EVGA 3IAS6 5CDGA 2EIJC 5D2CA 2NUPA 1E66A 1RI5A 2B8EA 3AFHA 1D1BA 2DY0A 4TKUB 1T5OA 2E89A 3AP3A 1U6HA 3VPFA 1YB5A 5KJFA 3RKOF 4WNCA 3RHTA 4DYVA 4RJTA 3EHDA 2CNOA 2HFJA 4LOKA 4GXQA 3B1XA 3FVVA 4L75A 3BF8A 3M5WA 4PG4A 3OCZA 1T1RA 3D6AA 3C8GA 3JWPA 1OIVA 1V8ZA 2CDBA 1SIWA 1V11A 4CLEA 5E4YA 3AJ8A 4MEBA 3D4NA 3AO0B 1E5DA 1NUUA 3BD6A 4MIEA 1QLWA 5M5BA 4YRPA 3Q7GA 3PYXA 1BXKA 2CB9A 2MSNA 3CZ6A 2GEFA 2WNHA 3IAUA 3TK1A 3ZYCA 4JJZA 1EUYA 2ES4A 1SU7A 1NQOA 2OCDA 4FHFA 3O2SB 4XTCS 4CDVA 1JIUA 2JC3A 4M87A 3QXSA 4JSTA 2HPZA 2CKDA 3KS9A 1A5AB 5JNWA 4UD6A 3D6UA 2RONA 5DHFA 5FHRA 2TMDA 3TF5A 1E2IA 1ZVZA 4A23A 3B6MA 4B79A 1TW2A 1CJCA 4PW0A 3F5SA 2XE6A 3E35A 2HPVA 3U3RA 4XTRA 1TR2A 1ZDMA 5LQCA 1MEJA 2P6OA 1Y4DE 1WCIB 2Z2XA 3ZJYA 3I2GA 4D3SA 1U0HC 3CLRD 5K4HA 1T3ZA 3M82A 3A6GA 1SKMA 3NUGA 3THYA 4J4HA 3TNLA 3GJZA 4CSAA 1MB2A 4V38A 1KVSA 4N39A 1XUOA 5KJ6A 5AMXA 1P1IA 2VF8A 3W0LB 5FLYA 3M6VA 2PCLA 1JFFB 3U9JA 1DQNA 3GDOA 2EJVA 5J2UA 4D9EA 5D1HA 3M1IA 2X22A 4R40A 4PVCA 2EU8A 3KPJA 4K03A 4P7BA 1QJ4A 1BFUA 3IV7A 3A58B 4YV7A 3SZ3A 3CNBA 4JWTA 3I6QA 1EFHA 4F5YA 4FONA 3KR9A 5EOVA 2I03A 1CRWG 4LS3A 3RC8A 1ZHXA 4QTTB 3TOLA 1T36A 4BMYA 3IGFA 1BGVA 2A58A 1CUAA 3I76A 5DK6A 4U2KA 3A9SA 1MVLA 4PZUA 1WU7A 4U5EE 5L40A 4CV3A 1GUAA 1P1KA 3HXKA 2Z6VA 3BH6A 3FYDA 1L7RA 2BGUA 3D6FA 4BKQA 4RKFA 2YWRA 3CEJA 1NXOA 3G8DA 4I3HA 4DMMA 1HEIA 3O1HB 2P1DA 4IDAA 2OO5A 2LZ0A 4TVBA 2GKOA 3MRTA 4M0CA 1YZNA 2CN1A 5LOVA 4BRUA 4JEBA 1NPDA 3H0EA 3FXAA 4J49A 3LPLA 3WRXC 4P93A 2B7CA 3ABQB 1ISPA 1MUUA 2A94A 2V7QA 5LQAA 2JBAB 2FOXA 4LHEA 2CD7A 3QPBA 3EUEA 2A9FA 2G76A 4IRXA 4ARAA 1BD4A 4GG1A 1WW8A 2FB9A 5FDFA 2FFBA 1Y3FE 4NXNB 4A15A 3NM5A 3S9OA 1P61B 1V8OA 4B31A 1YJCA 4OREX 1YS9A 2FZCA 4U0KA 4CF3A 2ZSAA 3E9RA 1A41A 1AGRA 3PTZA 2AMLA 1PWZA 3E9DA 1L5ZA 3D4BA 3D8TA 3AVWA 2XMGA 4PPGA 3Q4GA 3JD2A 4ROSA 3T1NA 2IF0A 1MQ9A 4W8PA 2BKEA 4L6IA 4NYIQ 4OHVA 2DPMA 1P80A 5JANA 1AQNA 5IUKC 4BO6A 3GYBA 1V2GA 4CCWA 1E2GA 5SZJA 3WGUA 4XRRA 1N32B 3LYHA 1ZW3A 1RPNA 3VAYA 2WTBA 3DAOA 5TEVA 1QFJA 1AXRA 4QRHA 4LI0A 3JRWA 3B9RA 3E2PA 4NTBA 2JJ2A 4FDAA 3L0CA 3WL4A 1J0BA 1GQAA 3RDPA 2G9QA 4KPEC 3U7QA 3M8KA 2BC5A 4D1YA 3D7RA 4QDUA 3NKEA 5BSGA 1UKCA 4LY9A 1TWHA 1FSPA 3CV3A 4CKCB 1TT5B 2GFQA 1SHJA 3KV3O 2H18A 2KLHA 1ETHA 4YWHA 1EQ2A 3T3OA 1XVLA 3X1DA 3NGLA 4J3FA 2X7HA 2HLHA 1Y7LA 1VLZA 1G8YA 2ANCA 4R84A 2BEWA 1CP2A 4PYOA 1XZFA 1F38A 1SELA 3VPCA 2HBRA 2EWVA 3ELDA 1ZD2P 3DZAA 3SX2A 3HXTA 2O7NA 1ZJJA 4UBOA 4GGOA 3R24A 1JSLA 3G5UA 4JB2A 2G5CA 2P1RA 4RPHA 3U31A 1U7WA 2VYND 2XYRA 3F7OA 4BLWA 3U5TA 3IP7A 3PCXA 2BCGY 1TM2A 1WDMA 4KITB 5COGA 4FJ2A 3EXAA 3MJTA 5I9NA 3UMYA 5EUQB 3NW9A 4NPCA 3JPWA 4QGAA 5K0SA 1FUUA 5JS7A 2XTNA 3GPBA 2OP0A 4XQCA 5M7EA 4X1KB 1G64A 1YO6A 3LLSA 1BVRA 1YRLA 4P58A 4FGZA 1KU6A 3R5KA 3D81A 1SUFA 2AR7A 4M36A 4HTAA 2NP6A 2HJHA 2GAQA 4HQOA 5DI3A 3GFTA 3JR3A 3RIPA 4KACA 1Z13A 4NG4A 4CM3A 3A1NA 2WM2A 2F17A 4O8ZA 3Q40A 3NOQA 5CA1F 2HQBA 3QUAA 2GFIA 1L3IA 4C08A 3KRTA 4HNUA 3ENVA 1UKZA 3FTDA 3JW8A 3OH8A 2YYAA 256BA 2J7KA 2BFMA 4DSUA 1JJ7A 4WJKB 3NIFB 2V03A 1PGJA 3AOEC 2OLEA 4FM9A 5C7YA 1XMOB 3DV0B 2IXTA 2IE8A 3BSFA 4UTPA 5KYKA 4PHGA 2CMGA 3C7KA 1VJ0A 5BT9A 3GBPA 3VAZA 5HE9A 2XVYA 3RF7A 4F3RA 3G5AA 4MDHA 4RD3A 5DWVA 2R5NA 1VJTA 2JGDA 3GGCA 1NW3A 4PYNA 1U2EA 2CYBA 1VYHA 5KHAA 4HHEA 3PHF2 3WADA 2QMUA 4JKYA 1E2KA 2ZRMA 3RM3A 1KDPA 1EPUA 1E89A 5D3KA 2R6ZA 1T3SA 4J43A 1Q7CA 3DD5A 1RWPA 1ZJ6A 4LJSA 3IA7A 1YASA 3GJRA 2G28A 2BY4A 3OZCA 1P4HA 1A4UA 5LZ7A 5L3QB 1QAMA 2H1LA 1YR1A 4XI9A 1Y8CA 2V5UA 3SOZA 2QROA 4L4SA 2IHVA 3OQ1A 1XHEA 2ZRBA 4Q3KA 3AX6A 1LPMA 4IUCS 4M4SA 3TVDA 1LW6E 4OQZA 3QOFA 1NA5A 3AG4C 1NVDA 3GORA 2GZMA 1N1CA 3TRIA 2ACKA 3O31A 2R7RA 5KC8A 1GPLA 4E15A 1RXQA 4AUKA 3G2IA 3HCEA 1N2GA 4OQLA 3W90A 1F12A 1NN1A 1ZIDA 5F9FA 2HV6A 4LJ4A 2UXCB 4IO1A 1V9LA 3HLKA 3KB1A 1ZQ1A 4C78A 2ZROA 4EFNA 2Z5LA 4Q9HA 3ORQA 3DDHA 2O7SA 2EERA 2NTVA 4YAOA 1XCBA 3I2FA 5EPUA 1XWFA 4YL1A 5LYJA 1UBOS 1KFBB 4Y1RB 4AX4A 3U09A 1ZK3A 5K45A 5CD1A 2J6CA 1GNTA 4OYLA 4MA0A 4GR5A 4XM2A 5FYQA 2HSGA 4HJXA 2YL1A 3UAGA 3P19A 1K3FA 1EGQA 3DI5A 3GRVA 4YDSA 1OX4B 3DFZA 3WL5A 4BQSA 3QITA 3LRPA 1Z0AA 5H7XA 3EA0A 3SX4A 4KMOA 2Q4BA 1WSAA 2R751 3P2JA 2Z9CA 4OHWA 3FPSA 4JC5A 5BWLA 4X64B 5FPHA 1U31A 4EKIA 1VLHA 3LHIA 3VKFA 1ZHTA 3KAKA 3RNLA 3NGMA 3X2EA 1JEOA 1U0EA 1XLVA 4C76A 4IUYA 2NPOA 2AT1A 1NP3A 4KR0A 1CR0A 4AUNA 2C2GA 4FFLA 1QC5A 4YIHA 2C03A 1UINA 1Y81A 2QJWA 4CM8B 3E9CA 5EHXA 3WB1A 2H0RA 5GIPE 5KSZA 5F78A 3A10A 5HXAA 1KDYA 4YP6A 1YOVA 2Y3GA 5F3RA 2IU4A 1N8KA 1WDKA 3HA2A 3TGLA 3VAAA 3MWGA 1OF1A 3GGJA 4HDCA 1Y4AE 3PRJA 4G4GA 1E79D 1RFLA 3B13B 4CYMA 1UOPA 7ADHA 2GXSA 1C1DA 3HVKA 1YZYA 3JRNA 4KG7A 1U7ZA 4EZEA 2BEUB 3E70C 4I8XA 2RC5A 2YL2A 2ZE8A 1AM4D 5L0HA 2JDID 2I6XA 3D8UA 4HDRA 4LKRA 5DEIA 4BZWA 2E5FA 1XZMA 1ZHZA 5AM3A 3B3QA 2FMKA 2KW5A 4N76A 1U28C 2AWYA 2FN8A 4KRGA 2KSFA 2R25B 3FZEA 3BT7A 1SFRA 1XTRA 4L57A 2AEFA 3WG7C 2EPKX 3RIMA 4NEGA 2CY0A 4JVNA 1COWA 3WRVA 1KS2A 5BN1A 4HKTA 5KNBH 2DUUA 3TQOA 3F3SA 1SD1A 2Z2KA 1ZI6A 3LNCA 4WN3A 3TZHA 1FJGB 1SA0B 2IEZA 4MV9A 3LOUA 2P61A 4EO7A 1KU2A 1O4WA 2PRIA 3DFMA 2XTAA 3DVSX 1H2YA 2QT1A 3AVOA 4ZOLA 4CHTA 2PUFA 1E1CA 4WNAB 3D6VA 4PZYA 3MPUA 2JCVA 1CERA 4LJLA 3AIMA 3EZXA 4V0OA 5LXTB 4CBEA 1WR8A 3AVTA 1CKEA 4JX9A 1G9XA 3GQBA 3WLQA 3TJ6A 4WOCA 4KR6A 4J0FA 4WCFC 4AMYA 4XDYA 4G0PA 1RZVA 3HJNA 2F4VB 1J90A 3QLUA 3JD0A 1EINA 1J0XO 3SZOA 4F3KA 2R7TA 1AB5A 1FMCA 1C1HA 2Y1GA 2JVJA 3O91A 4H4KC 4B9EA 3KU4A 2FPGB 1R0XA 2IUSA 1QNFA 4ZXFA 3BL6A 1YS4A 2R4TA 2YVAA 3EXHB 2YIDA 2VYVA 3ESCA 5EZ6B 4G78A 4MW3A 3AKCA 3QM1A 4MQ5A 4HFJA 1UJ5A 1V8BA 3E3AA 2G06A 2HWWA 1XMQB 5GV8A 5LD2C 5LU8A 4BFZA 1GZSA 4P7JA 2XUOA 5FI5A 2HJSA 1QS0B 1RXCA 1ZR4A 1YZTA 4HL6A 2BFBA 2DBQA 3QA3E 3FVWA 1ULUA 4R1TA 4DJJA 3WGGA 1TUBB 3SVTA 3SSAA 1VB5A 4H16A 3B48A 1G60A 1SG6A 1U8EA 2FRDA 2GQ0A 3PGKA 4UQLA 3ED1A 3Q7IA 5F76A 5DVZA 4PWYA 1GTSA 5AUQA 3VJLA 1EHIA 4L0MA 2X3UA 4YJHA 1KJNA 1M76A 4DA9A 3E58A 3UENA 2JF0A 4PJMA 3AEQB 3TZLA 2FSPA 4H15A 2WP0A 2CFSA 4ESEA 1QO9A 3BILA 4DLXA 3OQVA 3DNPA 5FNVA 5FPPA 4H7KA 4UVEA 3D4LA 1QYWA 4LLCA 1SXIA 4K7JA 4BKOA 4WKNA 1L4FA 3NOVA 1ZEJA 4ZAFA 2LCQA 3HKEB 4KQ2A 3GAZA 4D26A 2W9XA 3LCRA 1C7IA 3FJOA 4DQDA 2CZCA 4KNVA 4WAUA 2VUIB 5KCZA 3M83A 3A9WA 4DIOA 4LDRA 3COZA 2X3FA 1A7EA 3GB9A 3L7YA 1OCEA 5KSWB 3IQEA 2AFIB 2OV3A 1NNSA 1W34A 5IMSA 4G0UA 4Z8YA 2Q5LA 1F2UB 2V3VA 4XGKA 1XPUA 4W5RA 1DG1G 5JS6A 2C9BA 2JK1A 4H1WA 2NPUA 3F98A 1GGVA 1ODTC 1ZSNA 1DC8A 2WE8A 2ZYSA 1A8QA 1VI5A 4Y6SA 3WXBA 3MFNA 3FZNA 3AF4A 5CH5A 3CKYA 3F3KA 3T99A 2UUHA 3HYCA 5MN5A 3T6JA 1RC1A 4QZVA 4N0PA 2PSFA 5EEGA 4NHEA 2WJVA 1FC0A 3BOSA 5IVKA 2PQMA 4TWZA 3CVJA 4EF6A 5L3VA 2HA7A 4JYCA 2ORVA 3WQHA 4YAGA 1KSFX 3W4KA 2R4QA 1FK8A 4Z0PA 5B55A 3DTYA 4WLVA 1C30B 4MRRA 3KOWA 3Q0IA 1RZRA 4KQWA 1E3MA 5CTJA 1NF2A 2BTQB 4OIPF 4ND8A 1KJJA 4WXRA 3OZGA 1WDLA 1FVHA 5C8DA 5JROA 2RJNA 3ZWXA 1VKOA 3FPLA 1QIHA 4F0JA 5D7BA 3H17A 3U4QA 1RQPA 3OT1A 4OJNA 4F21A 2OA0A 1LXCA 3VTFA 3CSUA 2PM8A 2NP7A 2DBZA 3B38A 3A6EA 3R44A 5LP6F 2OCYC 3EF0A 2SCUA 1PJRA 3HZRA 5IXYA 3AR9A 3S40A 4HEA6 3AF5A 3CQZA 4I50B 4ZVTA 1X7XA 3TIVA 4MKHA 3ZE2B 3K7DA 1G7TA 2QRHA 2ZI9A 3WOVA 2ZRFA 4B8WA 3JQAD 1MC8A 2CMKA 1Z5NA 3RRYA 3DWFA 5FOWA 1PHRA 2PAFA 2XE4A 1R0SA 3DZFA 4DPLA 1MAWA 1VLTA 1ICEA 1N5KA 4LJKA 4TL9A 4YMIA 3ADBA 3LFTA 1FMTA 5B6IA 1OH5A 5T4HA 4NZMA 4CEIB 4G4SP 2LDXA 3ROEA 5F2NA 1YHNA 4TV9F 5DHAA 3FVTA 1I14A 3W1VA 5KYXB 5GGYA 3T9EA 2ILTA 3CW9A 3LPMA 4FQ7A 3GHYA 1YL7A 4MTLA 5BQFA 3K16A 2VT2A 2C3PA 1QYRA 4I1VA 1ORWA 3BGOS 1TAQA 4BXOA 3KE9A 4HAXA 2PNFA 1M6NA 2AZXA 4MR9A 2WA1A 2G25A 1OQAA 2XMRA 1GCIA 2IWHA 4WLEA 4RDXA 2VHWA 1EM8A 3BE4A 2HXGA 4AL0A 3IOEA 4V1CA 4HK4A 3D2CA 2HSEA 1QQ5A 5DBOA 1NDHA 2A6PA 4XR4A 3PPVA 3EGEA 4E18A 2HRQA 4U39A 1PX2A 9LDTA 4Y2PA 1DELA 3JQQA 4FYJA 1UBHS 2XQFA 3WDLA 2C78A 2POQX 2O1WA 3PU6A 3U62A 3P2OA 3BMXA 3NYJA 4PG6A 1UMBB 4M9ZA 3ZQ6A 3NS7A 3ZHRA 1CRQA 1H0KA 3VDQA 1A7AA 4PAMA 3TMYA 2AD5A 1HYGA 1M73E 1G4WR 3DB1A 3QELA 3PWTA 3LPAA 3QFCA 5PGMA 3HEMA 1X7ZB 1FL9A 3AGPA 3CNEA 1OC4A 5CFMA 4JUIA 2EIMC 4FLFA 1ZONA 3MJVA 4QPDA 4PTYA 3TH5A 4CDNA 3C43A 2VCEA 1XKXA 3C63A 1E1RA 2XQGA 5B57C 1V8DA 4YJ2B 1GFWA 3EZGA 2QLFA 1VHDA 2PNOA 1DXHA 1V71A 3H13A 3VVLA 1NF9A 4WFKA 2HGSA 2OGSA 1SXPA 3QVOA 2OHGA 4A0RA 1D5WA 2AIRA 3H1PA 3JD1A 4DDWA 1ATZA 1CQXA 3TQTA 3ZKWA 3DEHA 4PYQA 3KK0A 4F91B 3PQ5A 2P9GA 2CL5A 1I3NA 4WA7A 1KJZA 2VHXA 4ND2A 2HCFA 4D81A 4KE9A 4IQGA 2IHUA 4B5KA 3H9JA 1ORDA 3E8XA 3KG2A 5LIPA 4GMFA 2Q6LA 5H9WA 1ZHYA 1X86B 1XVVA 5ALJA 1JMKC 3RRXA 1GPH1 1SCNE 4QIHA 2QW8A 2W93A 2XPCA 3IIEA 1ZGGA 4M0KA 1DX6A 4RHCA 3I6IA 1MH9A 4XWGA 2OHXA 1N7HA 4FDUA 2HA4A 2PVCA 4QTYA 2OZPA 4PBTA 3KYBA 3HM9A 2ZWVA 4PSAA 3K9CA 4N6NA 3HN7A 4Z9BA 2ODTX 5FBKA 4LVUA 2VKTA 2JLRA 1AUQA 3SYTA 4CIYA 3J81A 4ENWA 3BFKA 3VPDA 4L95C 3PQ7A 2XQKA 5HIKA 3TAHA 4PCAA 1VP9A 1GQOA 3RS8A 5K8VA 3EZFA 3NFRA 3GEDA 4E1VA 4XD7A 1SCUA 1UC4B 4DMCA 4GZLA 3GVPA 5JLJA 1DIAA 5FBQB 2WBLC 5JS8A 4QPJC 1DU4A 4QPCA 3JQBC 2A0YA 3KKNA 4CJGA 3V8MA 1AHPA 1OTYA 2F3RA 3LNMB 1S8NA 4IJ6A 3AESB 5FA5A 3G0GA 1N9GB 3HLZA 3OJFA 2IYXA 1RWQA 2AWCA 5BSVA 4MINA 2JARA 1R4MB 1Z6ZA 4GWLA 4YMGA 1CZKA 3ZXXA 2Q4RA 3FKJA 3U6KA 4CEHA 3TKLA 3AR7A 4GOOD 1QG6A 4PC7A 4M9UA 3FD8A 1H9AA 2Y4NA 4BMXA 3O47A 1G5TA 3F8TA 1MQVA 5FPTA 3L0PA 5AW6A 4EATA 1G0NA 1B42A 4QYIA 5CA0B 4UUOA 1F5NA 5FPYA 5BXYA 4NI5A 5JRAA 3UUEA 4XWWA 2FGYA 4DCVA 5ITVA 2FQWA 2C9ZA 4AROA 2R7SA 4ZKEA 3FFBA 3MBIA 4M9QA 5T5QA 4WZAB 2NU6B 1DJMA 1Z15A 1R8XA 5FTLA 3CRMA 1IUPA 5A02A 1Y1LA 1KJ8A 4QI2A 1MC4A 1X15A 3HU5A 1HWYA 3AP1A 3Q9NA 2XB6A 3KIPA 1TIBA 2PH7A 5LLSA 3MSXA 1QGUA 1PR0A 5I9IA 2BKAA 2IODA 1II0A 5C80A 4K9SA 1RLTA 3S2YA 1BN6A 1TPZA 3FKQA 1QBGA 3A4VA 3DHEA 5CGZA 3US6A 4C20A 5DIZA 1GM5A 1W5SA 1ENOA 1P2SA 1NBAA 1UXIA 2Q7DA 4KJXA 1H4TA 1QVZA 3FAJA 2QIPA 2ON6A 3TLJA 3HFGA 2D5RB 1JQLB 1UBGA 1GKIA 1ULSA 4LHVA 1Z06A 3L4EA 4IIVA 1QHEA 2O0JA 3OFSA 1X14A 4ARCA 3ZNOA 2C0QA 3M9XA 4D9HA 2PX6A 3DAFA 3CE9A 5H1YA 1T4BA 3WL7A 3DBRA 4P54A 4FEAA 1WXQA 1ZXXA 4L85A 3RTCA 1EK2A 3HCAA 4X20B 2EQ5A 5FIUA 2O48X 5A03A 1SEVA 1EX9A 1Y8QB 3FNRA 1NXXA 2WJWA 4KFCA 3OC6A 1GL6A 5BSFA 4TWJA 2O8FB 3FPCA 5LP1A 4B6SA 4GPTA 1NFRA 1NMEA 3LBAA 5TGZA 13PKA 4ABYA 4PR3A 4BX0A 3ROFA 4ZN6A 4Y9TA 1ZNXA 4MRAA 4DQUA 4MUKA 2XV1A 3MSCA 4OUDA 5MFPA 3PUZA 4UBLA 4YHBA 1PT6A 1A2KC 4YTEA 1W75A 1RJWA 3IB6A 2J31A 1ZPDA 1WMBA 2A0KA 4POAA 2FSHA 4HNVA 2BP7B 1P77A 5FTKA 3JQ6A 1KBOA 2LIGA 1G8MA 3VU9A 4XGQA 4D8UA 5CVUA 1I1OA 3HXQA 4ZQIA 2EP8A 2V59A 1JIJA 4HMOA 1PL0A 2HBQA 3MF4A 4C05A 1U0SY 4Q39A 2A1UB 3HN2A 2O3RA 1E1QA 3GO4A 3JSZA 2FA9A 1ZYUA 2JI4A 4KRXA 1RJ9A 3AIOA 4B45A 3L01A 3ILSA 4ZLCA 4BO3A 2Y92A 3RFCA 3DTNA 3AZQA 3KVNA 2I2DA 2X6TA 2P2SA 5KNCH 4ZCIA 4XLTA 2MYPA 1TE2A 4H7PA 2BGJA 1SQ0A 1MNDA 4X8OA 4HGOA 3GJ0A 3DLHA 1HE3A 3IEPA 1JEYB 5L0CA 3BN3A 5JBQA 5IT0A 2NUAB 5EJIA 3WTBA 2YV1A 1DCFA 1V5EA 2QQFA 4ATNA 1N25A 3E05A 4URXR 4N47A 1KI2A 3FBGA 4N7RA 1S2GA 3T3IA 1BEEA 4JU8A 4R01A 3A1TA 5BWCA 1XRLA 2ID7A 4RC9A 2H6EA 4K81B 2ZRGA 3K92A 4YX9A 4O2BB 5IZCC 1PW7A 4OI4A 5C51B 1TMOA 1NGSA 4BMDA 1XELA 3NJ4A 5JS1A 4RIHA 4N5IX 4AN4A 2DT8A 2YDXA 1F1BA 2D2VA 4GZMA 4DRJB 1AO0A 4WZBB 4A8JB 2AOTB 2GPSA 4BLVA 3GV0A 3S1SA 1HF3A 4DNXA 4RZ2A 4DMKA 1G9TA 3N2EA 5EJ9A 3P4XA