3E70C

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
318
structure length
307
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVILTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the signal recognition particle receptor from the archaeon Pyrococcus furiosus: implications for the targeting step at the membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
total genus 105
structure length 307
sequence length 318
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00448 SRP54 SRP54-type protein, GTPase domain
C PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e70C01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3e70C02
4JVLA 2HJVA 4RD3A 3KJHA 1JEDA 4HB3A 5D3MA 4M2LA 2AL7A 1E94E 1AQUA 3C5HA 3EPKA 1RE0A 5IRCD 2PLFA 1Q22A 3KX2A 4LJ8A 2IF2A 3DEFA 1WCV1 2R9VA 3K70C 2ZJOA 4DEXA 1YZNA 3EPLA 4G01B 1FNMA 121PA 4PSAA 3U7HB 2JGNA 2WKPA 2J3EA 3PCRB 4B33A 4EPRA 1XEXA 4L16A 1B23P 3ZD7A 3AKDA 4LJAA 4Q4AA 2HDNB 2C9CA 4DVGA 3KUCA 4CEJB 1E9EA 2EWVA 2NIPA 4TYQA 1QG4A 3U4QB 1UKVY 2B92A 3GJ4A 4IEEA 4NCJA 2Q3HA 2REXB 5E4FA 1RW4A 3BB4A 5CDFA 3SDZA 3ZGXA 1XXHB 5TMPA 2PMKA 3BWDD 3AF0A 4URVR 1W2HA 3LBIA 2R6FA 3O8DA 2ZEJA 4MUAA 3VTKA 3K1JA 1QHNA 2DFKB 3TIFA 1WBDA 5JJLA 4Q4HA 4Q9KA 4L4UA 1E1RA 1Z6GA 4CYMA 2I1QA 1GDDA 5JHHB 3TSWA 5FBLB 4YQFA 5BYKA 4C2TA 1KZ7B 4OQXA 3X1XA 2P0EA 4JSTA 1G3QA 1ZJ6A 3MD0A 5A5GA 3R9IA 5LD2C 2IS1A 3KKNA 4P4UA 2DY1A 3AVQA 1XCPA 2F55A 1J8MF 4H1UA 1RJ9B 2PJZA 2QY9A 1WQ1R 3EARA 3OZXA 1N6LA 2FZ4A 2ZSDA 1X3SA 2NPIA 1N0UA 4ACBA 2A5GA 3L0OA 1YR8A 5L3QA 2QZ4A 2Z5FA 3PEUA 1DAHA 1UM8A 1E2GA 1W0KD 1OH8A 4ERNA 3IPXA 4RZ2A 4GRAA 4TTPA 1GSIA 1YHNA 3MSXA 4OI0A 2VRWA 2IX3A 4DLVA 2HT6A 1T5IA 3GLHA 4EPWA 1Y3AA 4GDFA 4GNKA 4GOXA 4Z51A 1N6RA 3I5YA 1W5SA 2G1JA 3QG5A 4Q5IA 3QKRA 3H0KA 4HAYA 2GKSA 4PC1A 3HDTA 1XTSA 4U02A 3I62A 3KUDA 1GITA 1SXJE 4H1VA 2QENA 3U6KA 2PEZA 2GEUA 4FCVA 2DR3A 2G88A 4OHWA 4NYMR 3RABA 3VR4A 4XJXA 4IFBA 2QP3A 2FSFA 1ZD8A 2HCJB 2Q6TA 2V7QA 2J0SA 2EFGA 4KU4A 4PXAA 1NP6A 2ZI6A 3T1OA 4YC7A 1Z29A 2WPDD 1GNQA 1ZVQA 1U81A 4KLZA 4CEHA 1ZIPA 4JBWA 5CM8B 4KODA 1P2VA 4A2WA 1VHTA 3N2IA 2XTMA 3Q85A 1SVWA 4LOAA 3K0CC 3CRW1 2WTUA 2DFNA 2D7DA 1AS3A 3BC1A 3DZ8A 4IDOA 3Q9LA 4P4SA 1TQDA 3QJYA 2BHRA 2NO6A 4W5HA 5FR2A 5H70A 421PA 1KHTA 4XVRA 3Q7PA 2OFXA 3X1YA 3N70A 2QP4A 4DLTA 1RC8A 2A5DA 1FTSA 1G3IA 2FFBA 3PUWA 4MRSA 5J4KA 3L0IB 1SKQA 1UADA 2O8CB 4BFZA 4HDQB 2WBLC 1TU4A 4B3DA 3IEVA 2P65A 4XTRA 2O8FA 2ZRKA 4EAQA 1GWNA 3GQBA 1VG0B 4KXFB 3IPYA 3CX8A 2QMHA 4IDHA 3PEWA 2HCBA 1PLLA 4GP7A 3EZ2A 2ZVQX 1FTNA 3P4YA 2GJAA 3C14C 1YZGA 3UXMA 1H8HD 4NCNA 1JEEA 1HQYE 1CJVC 1T4GA 1VCNA 4JLPA 3I5XA 4BLRA 3T1TA 1KO8A 2IYZA 1QHIA 3QPWA 5JRZA 3A58B 1MV5A 3O8CA 2CLSA 3ZS9A 2XNDA 1N5JA 3P26A 4FCWA 5B57C 4LBYA 1D2MA 2IF0A 3ZDQA 2BIFA 3A1WA 2DCUA 5FPTA 3THOA 2PCLA 1T9HA 3ZJYA 4D4KA 2J0VA 2ZJ8A 4R7ZA 2ZJAA 4YXWA 4ZI2A 2H57A 1COWD 1G7SA 3ZQ6A 4D25A 1CEEA 4RD0A 3KQNA 2JJ1D 3EA5A 1BYIA 2ORVA 1UKYA 1VTKA 3QXCA 2C03A 4V0NA 2GDJA 3SJAA 1FX0B 3DM5A 4A15A 4L9WA 3ZZUA 1AGRA 4MRVA 3DVLA 2OFWA 2P6UA 1SZPA 1T3SA 2C95A 4DUGD 1VCOA 4L9SA 4TMTA 2ZJBA 4HZIA 4NZYA 3ZIAA 2NO0A 4A2PA 1U8ZA 3ADDA 3CNOA 2QMUA 4YMVA 1G4UR 1F48A 1CF4A 2EW1A 1LY1A 1VG9B 5LBIA 2CJWB 2ZI9A 1ANKA 3IGFA 4NCHA 4MYHA 4MYTA 5EP3A 1B0UA 4FXPA 2W6ID 5EXPA 2NTYC 4ABYA 3PR1A 1TF5A 3UMFA 1G3MA 1IAQA 1Q1EA 1CR2A 1Q3HA 3L0SA 2NGRA 4DKXA 3IIMA 2EU8A 2GAOA 3REFA 3THXA 2ZRGA 2NO1A 4JL5A 2J87A 5IF9A 5LB4A 2D74A 3HPQA 1HTWA 6Q21A 3KQHA 4ESVA 2GJSA 3K53A 1FL9A 3F8TA 3NBXX 1GILA 3DMDA 3MFYA 1MABB 3A1VA 3TH5A 4Q00A 4DIDA 4HLUC 2O52A 1Z6TA 1IQPA 3VMFA 3V00A 1HQCA 4TT3A 1ZIOA 2VHCA 3HU1A 3KTAA 3MWYW 3TQFA 1H8EA 1L4UA 1U90A 2FN4A 4O0MA 4PHHA 5FI0B 2ZRBA 5F9FA 1CU1A 2Z43A 1NIPA 5KO2A 1M7BA 1ZNXA 2Y8EA 4TLEA 1CKEA 3EC2A 3SYKA 2QT1A 3HP1A 4BLPA 2O8DB 2GCNA 1P75A 4EJSA 4E5UA 1E0SA 1XEWY 2WWIA 4LCBA 3CX7A 2GZHA 2FPMA 3LFUA 2J41A 1QBKC 3CNLA 2IK8A 3LH5A 1KI8A 3WRYC 5DISB 3EZ9A 5D3QA 4NH0A 2OO7A 5FTJA 3VU9B 4HDCA 5CDFE 1NKSA 3SJBA 3PXGA 1DE0A 2ZUBA 5FOWA 5HPYB 4EKDA 4BASA 5J4YA 4Q4LA 1XD9A 1HY3A 5K8IA 4BEJA 2HXYA 1GL9B 2R6CA 2AHOA 3L8YA 3CRQA 3LA6A 1TU3A 3WNCA 1CR1A 3VX4A 1GL7A 1U8AA 4KSCA 3VKWA 2BV3A 1Q12A 2OV2A 3EZ7A 1FP6A 2ZR9A 1KSFX 2YWHA 3SJZA 1D5CA 4QGHA 1P60A 5TB5A 4V02A 2J45A 1UDWA 1SKYE 4E09A 4HAUA 3RS7A 3W5JA 4DUGA 4KFSA 1YRBA 5L3QB 3FHCB 5DHAA 3QXXA 4XWOA 4TMVA 4IXNA 4DCVA 5AUOB 2FWRA 1GKIA 3M0EA 2BM1A 4JLJA 5CB8A 1E2JA 1KTVA 1NSTA 1AKEA 1ZUNB 1QHHA 4PZLA 3K0AA 4LJ4A 3MWLA 1G18A 2PX0A 2OAP1 4LYFA 5CK4A 2VBCA 1K5DA 2QRZA 3U3OA 4MYCA 4ZCMA 1NG9A 3U2QA 4V0LA 1OH7A 4WZ6A 3LBHA 1P9NA 2EFHB 2ZSEA 5FOVA 4IOLA 1E2LA 2GILA 1W1WA 4Y0AA 1U2RA 1N0VC 3TQCA 1QG2A 3Q5EA 4IDPA 1EFTA 3TUJC 1R2QA 4LC1A 1YZTA 3QE0A 3ZIAD 4Z1MA 3CF0A 4JBYA 2XXAB 4NCKA 1Q3TA 5BN4A 3B2EA 1G6OA 1SXJB 1PLKA 2OM2A 4NE2A 4B34A 4U5XA 3A6PC 1T0JB 5JWOA 1VPLA 1P7CA 4B48A 3BH7A 3W8RA 3ADBA 1W4BA 3CR7A 4AURA 1E2QA 5H68A 4JKYA 5C4MA 3BB3A 3CZQA 5GJCA 2YKGA 4GFDA 1QZXA 4URZR 3EASA 5JCPA 5B2ZA 1KI6A 1KYIA 1R6BX 1N6OA 2GXUA 2QSZA 3GLIB 1G1MA 4DDUA 3QSYA 3DKVA 1XJ0A 1QF9A 1M1YE 1D2NA 4PPGA 1YZLA 3SOPA 1UF9A 1E96A 1IJFA 2A3RA 3RS2A 1US8B 4DCNA 4C0BA 5FOTA 3Q8XB 4M9SA 1E9FA 5JFGA 4U7DA 1Z8FA 1ZM2A 4KLNA 1V43A 5DSZA 4MRNA 3PUYA 5EE9A 4HB4A 5G53C 2ASEA 4PQRA 2GVZC 5G3ZA 1YZUA 2DBYA 4EJSB 2BBTA 4B3CA 1CRPA 2XX3A 2IYTA 3FMPB 2BBWA 1KAGA 1ONBA 3ETLA 3I1FA 3KXLA 3OIUA 3QPUA 3BAFA 1FPMA 1LVGA 4P33A 2GWHA 1N5IA 1Q1BA 2CEAA 4POAA 1FMJA 3WHKA 4JLAA 2IUSA 1GRRA 3O8RA 3C7KA 5LD2B 1MO6A 3P4XA 1OIWA 2F6RA 1LF0A 1R5NA 2QU8A 2ZSFA 5FL3A 3AF4A 2V3CC 2GXAA 4DCTA 2ORWA 2WOJA 2MSEB 2F43B 3OHMA 4FIDA 4TYPA 4CZ2A 4O3MA 1E6CA 3U6BA 2I3BA 4AG6A 2HJGA 4DCUA 1IN4A 1H8HA 1X8KA 1AZSC 1XP8A 2V1XA 3FVQA 4X8OA 1TADA 4D0LB 4UJ5A 1G3RA 1S0UA 3JVUA 3QPVA 4LBZA 2CNWA 3I4LA 3C4JA 2XOKD 2VHUA 4ZPXA 4W7SA 3QKRB 1F2UA 5CJ2A 5KPDA 1HE8B 1SGWA 1S2MA 2VH5R 4HLCA 5H1YA 2CJWA 2JASA 3T1VA 3SHFA 4DSOA 4BZQA 5DN6D 4KCGA 3K9GA 4TLDA 2VTKA 3GMTA 3KQUA 1ZUIA 2BMJA 3LAWA 2VSOA 2OAQ1 4DCSA 1AS2A 4Q4HB 4V0KA 2XJ4A 2DWOA 1W0JA 4ASUD 1QHXA 2N46A 5LB2A 3I8XA 5EJEA 2A7QA 1XJCA 4ILEA 2WAYA 2G77B 3D8BA 1DVRA 2H1LA 2RKOA 4HAVA 2CHGA 4PO8A 3KDSE 3BIFA 4DSTA 5FR1A 3T61A 4D6PA 4EPTA 1ZNYA 2MSDB 2X2EA 2VSXA 2ZYTX 2BKEA 2UVQA 3SQWA 3B1ZA 2QE7A 4ITRC 2QSYA 3NWJA 1W36B 3BXZA 4KYUA 4JS0A 3KKPA 1HURA 4OHVA 1J8YF 4C2UA 1NG1A 2MSCB 3D31A 4ZI3A 5JS7A 1L2TA 2HF8A 4BLOA 2F9MA 2QT0A 3QF4A 4HLQB 5EQTA 3RAPR 3PITA 2Z4SA 5E7MA 1IN6A 4B71A 1JR3D 1RFLA 1YU9A 4YMUA 2WWXA 3P1JA 1EX6A 2JLRA 1US8A 4D4MA 1ESMA 5JBQA 2UZIR 3P32A 4ZDWA 5JWHA 2IYXA 1JALA 4OK3A 2W6JA 3H4MA 1ZU4A 5FOUA 3VKHA 2UZ3A 4URUR 5KU1A 1RYHA 2Z0MA 4HI0E 4QJ3A 1G5PA 1KIMA 1Z6AA 1NMZA 4JT2A 5IHPA 1ZRHA 2V9PA 3OF5A 4JLDA 4HLDA 3AVXA 3PVSA 5L3SA 2AWNA 1JR3E 5DHFA 2IW3A 2CVHA 3JZMA 4CT5A 3IBGA 2ZR0A 1P6XA 4GP6A 4Q03A 4DC9A 2EFEB 3FKSA 4DZZA 2WJIA 1XF9A 1LFDB 4TMKA 5JRJA 2J7KA 1T0HB 3B9QA 4O25A 1Q21A 3DOEA 1R8QA 3N5CA 3B1YA 4XVUA 4Q21A 3AVPA 2NPFA 4EFLA 4PTLA 5H8WA 3RNLA 4KFUA 3NKVA 2IUTA 4XD7D 4JMPA 1OJLA 1BIFA 3TR5A 1DAGA 2ZRCA 2HF9A 3AF2A 4UJ3A 3ND9A 5FUYA 1NY6A 4Q7LA 1WRBA 1W4RA 4QJ5A 4X8LA 3NBYC 1JBKA 3ASYA 4PSKA 4A8JB 1Z0JA 5KSYA 3KJIA 5JHGB 5FL7A 4HATA 3UATA 4CEJA 4MGIR 2IS4A 4D2IA 4NDZA 3A8TA 2H7VA 4JVNA 3B5JA 4A92A 1E9SA 2D2FA 2D62A 4HSEA 1VYTA 4YDHB 2J0QA 2QUZA 3QEOA 3U7GA 4A8JA 1XU4A 1NN0A 3THWA 4UXIA 2GAAA 2KSQA 4Y0VA 5EZ5A 4M4SA 4QBIA 2GTPA 1KDOA 4FMDB 4NONA 3UK6A 3Q7QA 2ZM5A 1VYVA 1GP2A 4E07A 3IEUA 2P5TB 4LHZA 3VKGA 2AD5A 4LWZA 5J40A 4Q66C 4PZYA 2VP5A 4PPFA 4KSBA 1HE1C 3C5CA 3QVUA 4Q4JB 3VHXA 3EPJA 2WMNB 2QPTA 4ZDKA 1DO2A 2GK7A 3B78A 1MRNA 2HV8A 3HYRA 1KI7A 1VDZA 3OAAA 3RHFA 4F38A 1OKKA 4Q1AA 2CMKA 4Q4JA 3U7EB 2FSIA 3EXAA 1IY1A 4O2LA 3THYB 1CTQA 4EDHA 1G6HA 4JLOA 2PZEA 3QKSB 4RD2A 1MR3F 1A4RA 3CRRA 1W47A 2IYSA 621PA 2JLXA 4DLYA 1MRSA 1Q20A 3TUIC 3IBYA 4PAMA 4M21A 4HUTA 2ZROA 3U7FB 1KSHA 1KJZA 2FEMA 2ZSAA 3QKSA 4S2EA 3AKYA 1RPZA 2A2ZA 1HV8A 2YOHA 1KMHB 4KITB 1XEXB 3LX5A 2R6AA 3WMGA 4NU0A 2ZU0C 1G8FA 4AKEA 1KO1A 2EFDB 3F0TA 3V4FA 1P9WA 4MQBA 4QFMA 1OF1A 4UNPA 4Q1FA 3AP2A 4TWZA 2OESA 4AY2A 4M1TA 2IXFA 3Q3JB 3GJ0A 1ZP6A 2D06A 4RFSB 2AK3A 4UNSA 2PMDA 1BMFD 3BORA 1EWQA 3IHWA 2VP0A 1IM2A 3A4MA 1VKJA 2WKQA 2ZSBA 4S35A 2AXNA 5G3YA 2X2FA 3MJHA 3RRYA 5JMTA 4TTRA 4TL7A 3ICEA 1Z0IA 2WWYA 4I1SA 4IKEA 3X1WA 4AG5A 3HPRA 4TYYA 2C9YA 3RLFA 4LV5B 1AQYA 1C1YA 1UEIA 1XBTA 1S4QA 1KI1A 3FKQA 1ZBDA 5K8TA 4O2RA 4M9ZA 2V6IA 1D6JA 2E9SA 1OXSC 2IA5A 2OHFA 3AKCA 4RVCA 2DWPA 2GF0A 4HB0A 3AM1A 1VYUA 2BMEA 2C96A 1G64A 3I72A 2C8VA 4Q19A 4ACAA 3B85A 5DI3B 1ETUA 1ZNZA 4QGGA 1OXXK 1LF5A 1ZCAA 3SJCA 2WWGA 4TTQA 3CW2A 4OJKA 4RKFA 2XGJA 2AD1A 4UQOA 4F4JA 3EIEA 4DEYA 1IJEA 3LD9A 3NXSA 1HUQA 5FBRB 3FHOA 1FNNA 3AGQA 5FUWA 2RGXA 4C0HA 1TL7C 2IXGA 4XSHA 3RVBA 3IIKA 5KNCA 3RS0A 1GIAA 1ZCBA 1CS4C 3AVOA 3H84A 4RZUA 3AVYA 3L43A 2C77A 4NCIA 1O87A 3QOFA 1XTJA 4TN1A 3GLIE 4LY6A 4YONB 2QP9X 3U44B 2ZI7A 2UKDA 3GLGB 3DKPA 4C7OA 5JI2E 1G20E 1XZQA 2A9KA 2J59A 2XOKA 1XMJA 3GLHE 3TGPA 1KKMA 4Q1EA 1YVDA 2H17A 3UIEA 3AKEA 4OQMA 5EXXA 4P4SB 1YQTA 3KZ1E 1TTTA 1VG8A 5KNBA 2JLWA 2CDNA 5BN3A 1R5OA 3SBEA 2P67A 3K9NA 4I1UA 4Z1MD 5CLLA 1C9KA 3UMSA 4W9MC 3AVUA 1J99A 1Z28A 1GVNB 1G9XA 5F2EA 1HH4A 5TARA 5E3HA 4WW0A 2BM0A 2WMOB 1R0ZA 2Q0HA 4B6EA 4GZLA 2QL6A 4G5SA 1XWIA 1ZU5A 4JJZA 1W46A 4QHSA 3GJ6A 2QPAA 4Q1CA 3SE0A 1ZM9A 2AKAB 3OIYA 2PL3A 1KKLA 1LS6A 3K8YA 1AK2A 4JLMA 2BJWA 4R9UC 3W9YA 2XAUA 3HJNA 2IWRA 2X1VA 2ZYVX 1KY2A 1OSNA 3B1WA 4KJZA 4CT4B 2R62A 4PHTA 2GNOA 3TUZC 3SI7A 1OFUX 1SULA 2W0MA 5EE5B 3I3SR 1G19A 4X8HA 4IRUB 4BGDA 2REBA 1X1RA 1MO4A 5TY0A 3LY5A 3VR2A 3K09C 5J4HA 1GFIA 2ZIAA 3U61B 2J7PA 2EQBA 5SZIA 1SXJA 1L8QA 1ZC4A 4URXR 1KNQA 4PR0A 3KXKA 2JJ8A 3KQKA 1XMVA 1EXMA 2OCPA 2QM7A 5D3MB 5HCIA 2W0SA 2IHBA 2BBSA 2HXSA 3N2EA 4TLCA 4Q9LA 1JB1A 4EPYA 1JXOA 2R8RA 3QQ5A 3GJXC 4FWTA 2F3TA 3IO3A 2G3YA 4PANA 1E1QD 2RGBA 2FNAA 3QVVA 2YYZA 4JLBA 5AJWA 4PZZA 3UMRA 4H9GA 3FHTA 4B35A 1X6VA 4RD1A 3I92A 2XNSA 2CLCX 2JJ2A 1KK0A 3U60B 4OQNA 2O0KA 1GG2A 1E2NA 2OLJA 4DDTA 4TQUS 3GFPA 4Q7KA 1TMKA 4RCYA 2W83A 1U99A 1OIXA 3WYAA 3PEVA 2QTHA 5G41A 4BFXA 4RJLA 3FWYA 1F3OA 1DOAA 2JDIA 3VR1A 5J5CA 2WVJA 1NBME 5DO9A 3GEHA 4BPBA 2ZRNA 1XD8A 3EWSA 4LI0A 1EFRD 1S96A 2XSZD 5HE8A 3B13B 1E79D 3SEAA 3NDPA 2FDCA 1G4AE 2OCBA 1RKBA 2CHQA 3BOSA 5DYIA 3X1ZA 2KBEA 4OQFA 3CRMA 2GESA 1YE8A 3QKUA 2QNRA 1XPOA 3GJ5A 2CCKA 2Q21A 1P62B 1EFHA 4TZ6A 2ZRFA 4MGKR 1I4TD 221PA 2F7SA 4WXRA 1XD2A 2GJ9A 5IK2A 3SFVA 1MABA 4IVRA 4RCZA 1OXTA 1G3UA 1S9HA 4G5QA 1OB5A 4M1KA 3ADKA 2NO7A 2RMKA 3KTAB 3VAAA 3CF6R 5BN5A 3FOZA 3KKQA 1NBMD 1A2KC 2ZUCA 4MA4A 1XD2B 1KOFA 5A4JA 4NPHA 3ZVMA 1GKYA 1LTQA 4QM6A 1AJEA 1IHUA 2ODNA 4WXPA 1E2DA 4PAQA 2ODWA 2ERXA 2QAGA 1VECA 3K70B 5J4VA 3UWOA 2XZLA 2A5YB 4TSFD 4WZBE 3GLHB 4B47A 2C2HA 2O0HA 2IYWA 4Q47A 3BGWA 1G7CA 1CJUC 1EK0A 2ZR7A 4DLXA 4EPXA 5TVKA 4AD8A 2QAJA 2FFAA 4Z8XA 3RC3A 4IDQA 4BWYA 2A5JA 4C9BA 4DB2A 1JQLB 3I32A 3BFXA 3U3MA 1PUIA 5FTNA 2P2LA 4M9QA 1E9RA 4AWXA 4LYHA 4RD4A 3W8NA 1IXRC 4D81A 5M04A 1Z6YA 4NYJQ 3GLGA 1D8TA 2GJ8A 1KAOA 3DPUA 1NVWQ 1DG3A 1E32A 1QHYA 5HKKA 1MH1A 5C1BA 2DB3A 2GHIA 1G291 1N2CE 4DXAA 4WA7A 3IHLA 2VO1A 2XZPA 5FPYA 1A7JA 1JJVA 5C4GB 3BK7A 2O8EB 4B75A 3NHBA 4RD6A 3JVVA 1CP2A 3CM0A 4J0QA 4R2HA 4NKRA 1FMLA 2FV8A 4I99A 3H86A 2QAGC 3K09A 3LDAA 2ZQ5A 3MWJA 3NVAA 3I73A 4JKIA 1JI0A 3AUXA 5BYJA 2BOVA 4M9XA 1XCGB 5CB6A 1OH5A 4A36A 4P4TA 1Z0DA 1D9XA 1KZGB 2BMFA 1E98A 3W6OA 4KVGA 4OKSA 4DLWA 4DRZA 4Q48A 2OBMA 2ZTSA 2ZXUA 521PA 1HEIA 4DB4A 4MUBA 3B1VA 2F1JA 4XVQA 4A0FA 4MITA 3F5FA 1FQKA 3BH6A 3NH9A 1DG1G 4ZDIA 5BQ5A 3QI2A 4C0AC 2WJVA 2TMKA 3IIJA 5EUMA 3FYHA 3GCGA 2WIBA 1RRPA 1EX7A 1OPXA 1PUJA 4JYBA 4M22A 1CXZA 5KOYA 4BFSA 4YMWA 3VU9A 4UXHA 1ZUHA 4B74A 3ADCA 1M6NA 1WE2A 2FPKA 4TQAA 4B44A 2EVWX 1XFAA 4GPTA 1W44A 3TW8B 1OHHD 2VF7A 2ZS9A 3PIRA 3R9XA 3KL4A 3EA0A 4JL8A 1G21E 1T6NA 1XMSA 1DEKA 4PPNA 3OFNA 1JPJA 3AF3A 5EP1A 2JJ1A 4G5OA 1W36C 1S1MA 1ZD1A 4LHXA 4G5RA 2RHMA 1NIJA 2IYVA 4L5BA 4ZCLA 5DYGA 2QROA 3BJIC 1U94A 2FA9A 2VP4A 3LVQE 3GPLA 1M74A 4QBHA 4TL8A 2ZE8A 2O8BA 4Q9JA 2GETA 2ZAMA 1HA3A 4IDNA 5DI3A 2G6BA 4PQFA 5JZVA 5HR5A 1DAFA 4B2IA 1I4DD 1H65A 4US0R 2ZJ2A 1E0JA 2VF8A 1ZNWA 4HZUB 2W00A 3K9LA 1UPTA 4JZKA 4F7WA 1OFIA 1K8RA 3GP8A 2YVUA 2RGCA 2QM8A 1HT2E 3CPJB 3CPEA 1DARA 5AK0A 3WP1B 1RRCA 5E95A 3RDPA 1EGAA 3R8FA 1UDXA 1CIPA 1W0JD 3BB1A 5E7IA 5EXTA 5JECA 1Q0UA 1KSGA 4B2LA 4BFTA 3CB4A 2A30A 2H18A 3ZVLA 3ZS8A 3ZVNA 2D3WA 2XZOA 3FE2A 5JJKA 4XOIA 2OFOA 5SZHB 2Z83A 1OXVA 4QBFA 3WBKA 3V4RA 3OEHA 4DDWA 2ZYWX 3LBNA 1JNYA 1UKEA 1I2MA 2CNWD 1N6KA 1WXQA 3K0FB 4PHGA 4DSUA 1N3BA 2P6NA 2YZ2A 4B3XA 1QDEA 3MLEA 3W3AA 3RS5A 2ZI3A 3SN6A 4DWJA 1T5LA 3WY9A 4FMCB 4D80A 1OYYA 3F3YA 4PC2A 1WA5A 4R98A 5CYOA 1EESA 4PO9A 4V03A 1Q1QA 1MOZA 3WXMA 5J4LA 5AUQA 3M1IA 3GLIA 3JZAA 5JSZB 4C0KA 2AKYA 1IXZA 1A1VA 1E9CA 2FX3A 1JR6A 2ZRLA 2FU5C 4RSGA 5EP4A 4ZKDA 1L4YA 4B3BA 2QAGB 2I1VB 3H1TA 5AJVB 3SR0A 3FTQA 2PZFA 4AC9A 4B3FX 1NSFA 3K0EA 4II7A 2QG6A 3FFAA 3VX3A 2ZREA 5FTLA 1G7RA 2OCAA 4YMTA 1UBGA 4IEIA 1NVXQ 1OHHA 2NQ2C 1ODFA 2PT5A 1X8LA 3OESA 3WBJA 1U9IC 2AK2A 1QVRA 3QIAA 4OHZA 4K81B 1G7TA 3QF7A 2WICA 3QBTA 4P0TA 1KJWA 5FBQB 2BKUA 4F91B 4JLKA 1L7VC 1NY5A 2PH1A 3M6AA 3R20A 1F60A 2GEVA 1U0JA 2WSMA 3A4LA 4JSYA 1KGDA 2KWIA 1DBSA 1ESNA 4N0DA 1XTRA 4Q02A 4TSFA 5FOSA 5C46F 4V0ME 3AVTA 3MGCA 3CIOA 2DYKA 2C9OA 2O5VA 1Q57A 4IVQA 1OXUA 1VHLA 4AKIA 4MYUA 4ZV4A 5IDVA 2YC4C 1OV4A 2OG2A 4IHQA 3RANA 5LPNA 1PZNA 3FMIA 3D3QA 4KFRA 4IXMA 4MGYR 4N0EA 4NYJR 1A5TA 2JIZA 3EW9A 3C16C 4EUNA 2ZU6A 3E2IA 2D4HA 4QGFA 4C0SA 1NNEA 2OT3B 1VCMA 1Z0AA 4OBEA 2ZJ5A 2W2VA 1SVMA 4URWR 2VHTA 4GL2A 2VHQA 5JLJA 1IY2A 1N6NA 1IN5A 2QGZA 2PJRA 5K8LA 1G5TA 5HZHA 1F6BA 1FW6A 4A2QA 5AWFC 4X8MA 1KK2A 4Q4AB 2ZETA 1R4AA 5GADl 3RC8A 3AVVA 2JLVA 1EFRA 1E4VA 2ATXA 2ZRDA 3AEZA 5SZJA 3NTUA 3X2SA 4JBXA 4BUJA 2QA5A 1FP7A 1N6PA 1E0KA 1SHKA 2GA8A 4LHYA 5HCNA 2OZEA 4EQ6B 4LZZA 2NOAA 1KNXA 3UG7A 1TPZA 3M4YA 3O47A 3U44A 1N5LA 5F3WB 2C99A 1G17A 2F1IA 4JIMA 5DI9A 4IOJA 2VHJA 2XJ9A 4LK2A 1KSJA 3T15A 3LX8A 4D4JA 3MAAC 2QBYA 2ZS7A 3ASZA 3FMFA 4IVPA 1FUKA 4KYIB 3T12A 4N1AA 2VP9A 3NBFA 2W6JD 1UJ2A 1T91A 2IS2A 3QY0A 1NJGA 2Z6VA 1ZM7A 4OK6A 3TJZA 1SQ5A 3TBKA 2QBYB 1P5ZB 1XXHE 4CRWB 4NL4H 4V0MA 3T5GA 5KNDA 4RZ3A 2XTZA 2IC5A 3TE6A 3TMKA 3G0HA 4QGAA 1P9RA 3DOFA 3SBDA 1KMHA 1II8B 2JEOA 4NYMQ 4CEIA 1FOEB 1JAIA 1UBEA 2ZYUX 5EXSA 1LV7A 1ZMXA 2QMOA 3I8SA 4FWIB 4TL6A 1WF3A 3R7WA 1QHHB 2WAXA 2WSSD 2XITA 3CPHA 4IJMA 4UKDA 4BFUA 4BECA 5FBWB 4G3XA 4M1WA 2J5XA 2JA1A 4TYNA 3ECCA 3TAHA 1KJYA 2IEYA 3OIWA 4LBVA 2B7BA 4MDFA 1W5TA 3K0CA 1NLFA 4BQSA 2JIZD 5AR1A 2CE7A 4HB2A 1MT0A 1R8SA 4EIWA 1VIYA 3HR8A 3CONA 1E69A 4PAOA 4QKQA 4QC2A 4BRWA 1UBCA 4A1FA 2XSZA 2ZI5A 3LWNA 5CM9C 2KJQA 1II9A 2OILA 1Z2CA 1YKSA 3B8HA 3IUYA 3BBPA 3TSOA 1AGPA 1W36D 3EG5A 1Z5ZA 2CE2X 5FTMA 4DIEA 4QJ4A 5JCZA 1A2BA 3QXHA 2VP2A 2B8TA 3OEED 2GVDC 5DLQC 2B6HA 3KKOA 1A82A 1T3LA 1E3MA 4FN5A 2CHVA 2V55B 5IT5A 4NMMA 4D82A 3BD9A 5C18A 1K6MA 2VEDA 1E9AA 5EP2A 4Q1DA 5AJZA 1JR3A 1BS1A 2IYYA 2O0JA 1WBBA 4C0LA 3K70D 2Q9BA 3SNHA 3B60A 4WZAE 4XWKA 5KDDA 3AQ4A 5KDLA 3A4NA 3CWQA 5FPSA 2JLZA 1PVOA 5A0FA 3CZPA 2BEKA 3GFTA 1ZAKA 2QE7D 2WHXA 4FMCF 1ZYUA 3TSZA 4BE7B 3PUZA 2D2EA 1G16A 4LUCA 1UAAA 4AYTA 3THWB 1Z63A 4U00A 2ZI4A 2I4IA 1M8PA 1DAMA 4GMXA 1NJFA 4M1MA 3HU3A 4Q9HA 1N6IA 4DT1A 2HEIA 4C7OB 4KO8A 2O8EA 4PSVA 1E2HA 1Z2AA 4BZXA 4MKGA 4Q1BA 4A8JC 2PCJA 1J7KA 1W48A 3W6NA 5JEDA 3B6EA 1Q44A 2R2AA 4C30A 1KI2A 4ARZA 3QENA 2XB2A 1LB1B 5JS8A 1KDPA 2DWQA 3L8ZA 3LO5A 5CIWA 1GOTA 4HEJA 3TR0A 1DO0A 3GEEA 1U98A 4M1YA 3UG6A 3HWSA 2GZDA 2ERYA 4M53A 4DJTA 2V54A 4NP6A 1OB2A 3WYFA 1TUIA 3Q72A 1JECA 1XB2A 1XRJA 2V7QD 4W5JA 1KDRA 2WWWA 1CULC 3NIBA 4D0NA 2JAQA 1E2MA 3A37A 4TQ9A 4AI6A 2W2XA 2IYUA 1IBRA 2JATA 3B9PA 2D7CA 2ZRPA 2CL6X 5AJXA 3T35A 1I4LD 3KJEA 1E4YA 3GFOA 1TEVA 4TLAA 1XTKA 1LS1A 1N25A 4ESHA 4B3GA 1P3JA 2REOA 2BBOA 3IQWA 1NVVR 2FE4A 2RGGA 5L3SB 1NLZA 3R8CA 2YJTD 2O8FB 2ECKA 1D9ZA 1XMIA 3VQTA 2PLRA 2X8AA 4Q7MB 3EIQA 1W2GA 2CBZA 3RSOA 3LW8A 1PLJA 2AFHE 2FPLA 2QQEA 3OFND 1Z0KA 1PJRA 4QOSA 1MO3A 1FZQA 2L0XA 2GCOA 3S1AA 5TXGA 3T06B 3NH6A 5KSPA 4PC6A 3CO5A 1QVAA 2WSSA 4M8NE 4V0OA 2XXAA 1X8JA 4WAUA 2QEQA 4NYIR 3SU8A 3ND8A 4B2PA 2R6DA 3VHLB 1EG7A 4TYWA 2IHYA 2B21A 4Q18A 4WVFA 1EFCA 2RGNC 2QI9C 1T8UA 1II8A 3THYA 1E1RD 1X1SA 2OUKA 4A82A 3GLGE 2G0TA 2FSHA 3TNFA 3B82A 5J47A 2VL7A 4KFTA 1AZTA 4PHFA 3W3ZB 2O8BB 2PZGA 4JVSB 1YZKA 2ZRHA 3O8BA 4DBLC 1D2EA 3BS4A 1YZQA 2ODEA 2WWHA 3LLMA 2V4ZA 1KK1A 2OXRA 3LXRA 2QORA 1YJ5A 3RRNA 3KXIA 4HDOB 3SFZA 5JI3E 4DLSA 3MRSA 1F2TB 3LQQA 4XSGA 5FBVB 5E7JA 1OT3A 5FUVA 2QQ0A 2VA8A 5CLQA 1IN7A 2QTFA 1DAEA 5DE3A 4DSNA 4TZ0A 1SVOA 5F9HA 4NHOA 1NL3A 4AYWA 4QRHA 3KKMA 1YR7A 2J46A 4FINA 3CR8A 5HTKA 4CGZA 2J0UB 4MGZR 4WBSA 5GJBA 1QHSA 2RGAA 1E79A 3T34A 3MMPA 2BDTA 2GBLC 1OKKD 1LNZA 1FUUA 3RSLA 1OE0A 1GNPA 1XNJA 5KPJA 5FPKA 3L82B 4WIAA 1KO5A 4OYHA 3I61A 3AF1A 3UKDA 2JLQA 3QNUA 2IYLD 4I1VA 4MKHA 3WHLA 5JSZA 1ZM3A 3L2OB 2WM9B 2RGNA 1JJ7A 3FFBA 2OLKA 2OBNA 3R7WB 3SC3A 1DADA 1CRQA 1XCMA 3QKTA 1T8TA 2ZAOA 3WRXC 4OK5A 2QGNA 4EJSC 4A4DA 2ZS8A 3TVTA 4AYXA 1MO5A 3DHWC 4KBFA 3VNUA 3PUXA 4A6PA 4FMBB 3J81k 2WWFA 1BOFA 4MRPA 5DIFA 4D26A 4JYCA 2QPOA 2AWOA 5FPHA 2BVNA 3NEYA 4TLBA 4BLTA 5CK5A 4EPVA 3GJ3A 3TW4A 2E1RA 3FDIA 3CLVA 1IXSB 1P4SA 1QRAA 3P20A 1NBMA 2J7PD 3SS8A 5C2JB 1NMXA 1O3YA 1RIFA 5AUNB 4LJ7A 4HAZA 1S8FA 4HAXA 1Z0FA 2J9RA 2OXCA 1J90A 3E70C 2AFIE 1M2OB 1TUEA 1ZC3A 2C78A 1XPUA 2YINC 3CRVA 4CDGA 3QBVA 1GKUB 1TF2A 2FZLA 2WJGA 2RGEA 4QG7A 3NG1A 3K0SA 1OYWA 3OE7A 1U0LA 3VR6A 2R44A 4G1UC 3SZRA 4YXWD 2VYFA 3VNVA 1CBUA 2PX3A 4UNQA 5KUTA 1CJMA 2AXPA 3GJ7A 2ZJYA 1XDBA 2LWIA 1KI3A 2GEDA 1GM5A 4LX0A 1E9DA 1S3SA 3IKJA 5LDDC 3E5HA 3EX7C 4P3YA 3BFVA 3LRPA 3EIHA 4HYYA 2GJKA 3MG9A 2N42A 4XD7A 5EE3A 3ZH9B 1DPFA 5HE9A 2RHDA 3IILA 1M7GA 4BFYA 1HT1E 4E22A 5KTYA 3GJ8A 3LVRE 4LC0A 4GZMA 2VPPA 4EQ6A 1FX0A 1GRQA 2NMVA 4KHZA 1GNRA 3A1UA 2Q9CA 2FF7A 5DNYB 1R5BA 2XEXA 4LGMA 1VG1A 2RAPA 4LPKA 1BYUA 1AM4D 1BH2A 2GK6A 4I1OA 4JLNA 4QXAA 2W6IA 3V9PA 1UKZA 2X77A 4AIIA 3OIVA 5EZ6B 1F5NA 1NKTA 4US1R 4DHEA 2CK3A 2IXEA 4KAXA 1E9BA 1S9DA 5FFMA 3CKLA 3ONWA 3HR7A 3SYNA 2AX4A 2JLSA 2BEJA 3GEIA 1UFQA 3C41J 1CLUA 3W34A 1DAKA 3DM9B 1RYFA 1N6HA 3EZ6A 4YDSA 2CK3D 1SVSA 3A1TA 1BKDR 2ZRAA 3RRMA 4L15A 1PV4A 2YWEA 2FGJA 3W5IA 1RRGA 4YLGA 4B32A 4NTZA 5KYKA 4HUQA 3ZVRA 4XIGS 4A0GA 3C15C 2Q3FA 4GI7A 4C4PA 1T3HA 2DFLA 2YV5A 4E03A 3TRFA 5KSOA 4CW7A 4MDEA 4P31A 5FI1B 1Z47A 2BCGY 4BZPA 3NHAA 2HYDA 3LQRA 3IO5A 4ON9A 5JEEA 4AKHA 5EE1A 4A6XA 4MKFA 4QM7A 1NN3A 5KSZA 3QG1A 5GJWC 3FMOB 1NI3A 1CR4A 4TMWA 5CITA 1ZD9A 2ZVPX 1Z08A 4FCTA 3AV0B 4GSYA 4OI4A 5G40A 4XTCS 3GD7A 1WB9A 2MMCA 3OEEA 1NMYA 4D4LA 1BO6A 1R0XA 5UKDA 3DMNA 3A36A 2BMDA 2GCOB 4Z8YA 4GT1A 8OHMA 3NDBB 4RY2A 1M34E 2BWJA 2FSGA 4A0HA 5FH9A 1IOZA 2GCPA 5DH9A 5TV2A 2IL1A 821PA 4LBWA 4TL9A 5DN6A 2A78A 3W6PA 3WP0A 2R6GA 5FUXA 4PX9A 1GZSA 2CL7X 2ZE5A 4BLQA 4F4IA 4FI3C 2VP6A 1W0KA 1RJ9A 2AR7A 4D0GA 3U3JA 5GVRA 2OSBA 3W90A 1VCIA 2G0NA 2F43A 5TDHA 3PJRA 4PQYA 2HLDA 3U3KA 4ZO4A 1SXJC 1TQ6A 1Y63A 1G8YA 2H5EA 4BFWA 3AB3A 3NC0C 2F9LA 1U8YA 3TVDA 2DPXA 3TK1A 2EYQA 4JJKA 5JJIA 4BRUA 5CIQA 2AN9A 1TQ2A 2ONKA 2ZE6A 4URYR 2ONJA 5F98A 2J0UA 2P3SA 4LYJA 1E2IA 1DELA 4OQLA 4GMDA 3EC1A 2RGDA 1ZINA 3BERA 3QEJA 3RS4A 3AP1A 4CIDA 4KVAA 1W4AA 3TLXA 5EE0A 5B30A 1R0WA 1E99A 4ARZB 4CVNA 1WGWA 2YOFA 2IWHA 5IK2D 2G83A 3NBZC 1OFTA 3PENA 1E2PA 3CH4B 2BC9A 2G1KA 1N0WA 2HT1A 2BCJQ 4B43A 1XEWX 3A1SA 2KE5A 3KFXA 1XPRA 1WMSA 5CYPA 4QBGB 2N1BA 2PT7A 4G5GA 2GRJA 2ORIA 3UANA 3WNDA 1OLOA 5FL7D 3GLFB 2W2TA 2FMXA 3LLUA 4C0JA 4QL3A 1U9IA 5HKKD 1OFHA 1U0HC 2CCGA 3OE7D 1G8PA 1KI4A 1OIVA 1SHZA 2ZRIA 3BRWD 3AH8A 3PG5A 4AK9A 2ODBA 1FQJA 5GJVC 4R71A 3U5ZB 1HYQA 2CXXA 1G5RA 3T1QA 2F3RA 3EWAA 1X86B 1NRJB 3R9WA 1XXHA 2LKCA 4EFNA 3LW7A 1TEXA 4MKIA 2Q3MA 2FH5B 2FG5A 4CEIB 4QNRA 1P2SA 3KB1A 3AUYA 4KBGA 3AP3A 1OW3B 3IDQA 3ZQJA 5GVSA 4QHYA 2IUUA 4LRWA 2XTNA 4RKEA 5FTKA 1AS0A 3DL0A 4LPSA 4EFMA 1V5WA 2LCFA 3CX6A 2LKDA 1CJKC 4G0NA 3PEYA 2IT1A 1SVLA 1XTQA 3K0FA 2WOOA 1WDTA 1UEJA 2JDID 2ZJZA 3L0PA 4OHXA 4JLVA 3LNCA 1KO4A 1E2EA 4FMDF 2NG1A 3G5UA 1KI9A 2FJUA 2G9NA 2A5FA 4JT4A 3CWZA 3LV8A 2IYQA 3AVWA 3HU2A 4TT3D 4Q01A 2EFCB 2JJ2D 3RWMB 2YWGA 3ZYCA 4F93B 5B58C 3MWKA 2WZQA 3NEJA 1Z6XA 4I81A 4DDVA 1SVIA 3E1SA 1Z06A 3K9HA 1P61B 2J1LA 4CEHB 4M1OA 2GBLA 2PEYA 1E2KA 4PC3A 1UBFA 3FB4A 1SVKA 2QMEA 4OL0A 4ZCIA 5HZKA 1XEFA 3ZD6A 2O8DA 5K8UA 1F2TA 1GTVA 3BFKA 1GL6A 1IONA 4OI1A 5ANRB 4LDJA 3CH5A 2C98A 1DTSA 3IQXA 1VIAA 1NN1A 2K5UA 1Z22A 5AUPB 3B1XA 2GXQA 2JLYA 4BEBA 1TQ4A 4IOKA 3EAQA 1AKYA 3KFVA 3ZZTA 1E2FA 4GBMA 4QHTA 4DT1B 2H92A 1S3GA 2NZJA 2VSFA 1R7RA 4OHYA 1LW7A 721PA 3Q5DA 3SHWA 4JL6A 3WMEA 2E87A 3HYTA 4JVMA 3WMFA 4PO1A 4A0RA 2HLDD 1R10A 4GOKA 1RVDA 1C4OA 1JXMA 1XJQA 4RFSA 2ZITA 5L3VA 1E1QA 2X19A 4ASUA 1P2UA 4US2R 3UWKA 3DO6A 4UNRA 4YMSA 2CCJA 3CF2A 1YR6A 2ATVA 3FKSD 1TF7A 1YRAA 3GLFA 2XB4A 1JAHA 1KMQA 3BH0A 4LJ9A 1I2DA 2NZ8A 3QXSA 4LJ6A 3D7MA 4P32A 2ANCA 4NBSA 4RFVA 2RCNA 4PPQA 2Z4RA 4L8GA 2F1RA 2CVFA 1H8ED 4F92B 1SXJD 2XNDD 5CJPA 1M7HA 3FGNA 4HAWA 4LV6A 3X1DA 5KHOC 3NC1C 3QXJA 4Z54A 2KB0A 2Q9AA 4UXJA 1W4CA 2YNMA 2OEPA 5BXQC 2B8WA 4I4LA 1DS6A 2QRNA 1ZW6A 2EWWA 3QUSA 4QNMA 1TX4B 3T5DA 3ICQB 1TAGA 3DZDA 2B7CA 2FGKA 3RWOA 2R65A 4PC7A 4F4CA 1RRFA 3UPUA 4ZIRA 3CNNA 5BWMA 4IW3B 1Z3IX 2RH5A 2YOGA 2IYRA 4LSGA 4UNNA 1II0A 3PUVA 1COWA 2SHKA 1NVVQ 1IN8A 2F1HA 2DFTA 2P6RA 1ZM4A 2V1UA 5L8VA 3LXXA 3VFDA 2ZPTX 1AIPA 1P2TA 5B64A 2ZANA 2IEZA 2OE2A 1R0YA 4LHWA 4M0LA 2ZRMA 4BLSA 2IBMA 2QN6A 1Z83A 1W7AA 1AA9A 2JCSA 4ZDJA 4IFEA 1G8HA 2ANBA 3MUFA 1KK3A 3C8UA 1MKYA 4LHVA 1GAJA 3DDCA 3H2YA 1XZPA 4WOPA 4K46A 5KDOA 3G82C 1KI6B 3VR5A 3BE4A 1GUAA 4IOMA 1YR9A 1BMFA 1NN5A 3OEHD 4LJ5A 3REGA 3D6TB 3PFIA 5L3RA 3KQLA 4DLRA 3U4QA 1EFUA 4GOJA 4HUQB 4K8OA 2HUPA 2ZE7A 3VR3A 4B76A 1WP9A 2YC2C 4PFSA 4BFVA 2O8CA 3MCAA 4MRRA 2VLIA 3QF4B 5EUQB 3EZFA 2VQSA 4A9AA 4LJYA 2C04A 2DHRA 4ZIRB 2WJYA 4NYIQ 4DLZA 2FFHA 3RRZA 1F2UB 2KI5A 3PQCA 3TAUA 4Q9IA 2OBLA 4TMZA 2P5SA 1Q1ZA 2V6JA 2ZUDA 4AKGA 3KB2A 3KJGA 4R2IA 1G8GA 1J2JA 3U3RA 4FW9A 4FD2A 2GXSA 1Z07A 2QTVB 1IY0A 2WIAA 5SZKB 3GLFE 1RZ3A 2WJHA 2KBFA 2MMGA 1FFHA 2PBRA 1G41A 3OAAD 2ZRJA 4HLUA 3PV0A 5DGXA 3EPHA 2EYUA 2FFQA 4RZXA 5BW8A 1KDTA 3SQXA 3WNBA 1E0AA 2WV9A 3S1AB 4KI0A 2YWFA 2YHSA 2CLDX 4XH9B 2WKRA 1SKYB 3B7GA 5AJYA 2W58A 3FPAA 5ELXA 1CR0A 1NVUQ 1NLYA 1EWRA 4N3NA 3CUEF 2OCYC 5JWRA 4XWAA 1GRNA 1W49A 4C3ZA 4M1SA 1KY3A 2V8OA 2HYIC 4Q7JB 1AN0A 1N5KA 2FOLA 3P27A 2GZAA 4CF7A 1XX6A 3AGPA 4OI2A 1JQJC 1NF3A 1TNDA 1K5GA 4MH0R 5P21A 4HZUA 3TKLA 2H8KA 4ZKEA 3RS3A 2VIIA 1XTIA 2IS6A 4B6FA 1S1CA 1KO7A 2WPDA 2JLUA 4B73A 5FOXA 3ZLJA 1CJTC 2H16A 2FEOA 1VMAA 4OJQA 1P73A 2WJJA 2GF9A 2CL0X 1QHGA 2RB4A 2BJVA 2C5LA 1OH6A 3RYTC 4C0QC 3MJRA 3CBQA 3SYLA 1DAIA 3ZZ0A 3K0AB 1P72A 4TMXA 1J70A 3THXB 1ELOA 4DLUA 4KV9A 4LYAA 3WYGA 1JPNA 4LV8B 2NO9A 4W5WA
chains in the Genus database with same CATH superfamily
2BKVA 4JVLA 2WJAA 2HJVA 4YGYA 3DZIA 2JH3A 4G4SO 4HB3A 4ZO9A 5D3MA 3WAQA 2A9VA 1JTVA 4Z9IA 1R3DA 3V1TC 2P4EA 2SECE 3C5HA 4OJTA 4TV8A 1RE0A 4KI2A 3HGTA 3QW4B 4B09A 5IRCD 1JXAA 4B4VA 2PX6A 2XRZA 2YNMC 3G4XA 1W8DA 1DSSG 3KX2A 4LJ8A 3MTJA 1NW4A 1YJQA 3EPLA 3TNDA 3AO0B 2HK7A 4RLFA 4C07A 5C8DA 1T3ZA 4IDCA 2JGNA 2WKPA 3PCRB 4PZ0A 3S0JA 1UZLA 4KIFA 1QXSA 4L16A 4QYIB 1PS0A 4QU9A 2QUHA 2JVKA 3AKDA 4QUKA 2E2WA 4XWYA 4MJXA 2P9YA 4DVGA 1M3SA 2EWVA 2NIPA 1W8IA 1W85A 4MUIA 4WBNB 3U4QB 4IZOA 3II6X 2OAGA 1UKVY 4UHHA 3FUTA 2FSUA 4P84A 4IJVA 1F8FA 2Q4RA 2QMQA 4R6XA 3RRXA 3NM4A 4Y18A 3UN1A 4O6MA 4NCJA 4HYTA 1QX3A 2REXB 4XEVA 4IFTA 4QA9A 4AZWA 5A4MS 5BSWA 3C70A 5FB3A 3H0CA 4J32B 2JCVA 4CHTA 1DJPA 2R1VB 3BCSA 3SR4A 1C9MA 4PLPA 1DQYA 3Q88A 1Z25A 1GGJA 4BB5A 4RKQA 1X2BA 3O8DA 4QQFA 1IPEA 3M33A 4MUAA 3WMRA 2DFKB 3DNMA 3D6MA 1G4WR 4L1KA 4NG5A 4GLJA 4M8SA 1WBDA 3DO8A 3S84A 4OU4A 4G89A 1JQ5A 5TPWB 4G41A 2C7VA 3MRVA 4CYMA 5M29A 3RVQA 2PKYX 4EUKA 1Q7GA 1GDDA 1VFPA 1YIAA 2DSNA 5FBLB 3UUFA 5JHHB 2ZT6A 1I33A 1D1BA 2R00C 4JSTA 1G3QA 4OQXA 2WAAA 3RIYA 3WDKA 5A5GA 2IS1A 3OA0A 5EKDA 3DMTC 3VR2D 3GM3A 3DAGA 1E66A 1IK4A 2R6JA 3E27A 1RHMA 3AVQA 2JAOA 1VHDA 3D1JA 3EIFA 3GT7A 5DM60 1EP2B 4KAAA 1KZ6A 2PJZA 2QY9A 1WHTB 4KXQA 1WQ1R 4ZOBA 4ZALA 1W6RA 2FZ4A 2J8ZA 2NPIA 3B51X 3WYEA 1AKMA 2GAFA 1RPTA 5C34B 1ORRA 1XYYA 4HPWA 4D5EA 5JH7F 5L3QA 2QZ4A 3G17A 2IDZA 1UM8A 3DXXA 3W7AA 1OH8A 3KEOA 2JPDA 1ITZA 1Q92A 4TTPA 3MSXA 1OZGA 4Q4ZF 3N8HA 4QOGA 2IX3A 4OGFA 1NHWA 5HK8A 4G0WA 1V5FA 4QO7A 4XGQA 2RJOA 4L08A 4MVJD 1Y3AA 4RY9A 4EPWA 2DEUA 4MWSA 3FVYA 4RULA 3N05A 4NARA 3PR3A 1EE1A 2RB5A 4RH0A 5IAJA 2G9ZA 4YK7A 2WRZA 3WODF 5ALPA 3BXXA 4OQ4A 1ONNA 3DXZA 1NVFA 1YHYA 2I6GA 2EBFX 4Q5IA 1K7FB 4GVXA 3OLWA 1XTSA 1U5BB 4OINF 2E0IA 3L7NA 3L4BC 2OHHA 1JEJA 5D5PA 1ZGHA 2PXCA 1MQ8B 3AUKA 4OIPF 2ZB7A 3CZ4A 5HG0A 5AW8A 4JR2A 4FR2A 4NC9A 4G8CA 3W6ZA 1HBJA 4II2A 1IYZA 2ZQZA 4FYVA 2XI4A 5K3DA 1I3LA 1T2FA 4TV8F 3ND5A 2Q6TA 1V1RB 3DW1X 5CVDA 3M9LA 4PXAA 1TUBB 1EFAA 1OYVA 4XLTA 4RL4A 3KT3A 4GDMA 4Q9DA 2WIGA 1R88A 5FLYA 3T7IA 2LVBA 4MW9A 4KE7A 3RU2A 1GNQA 1ZVQA 1SURA 1JKIA 1U81A 2HAEA 2E49A 2ZYAA 1O3UA 1P4AA 4FGUA 3FDXA 3E3NA 2AQKA 4PBSA 4RF2A 4MPDA 5ILQA 1P2VA 3HB7A 3F6CA 1EJ6A 3EXFB 3D3WA 1H05A 5FWAA 1SVWA 2BISA 3UJDA 3P7MA 1FR0A 1IM8A 4BNFA 2OXIA 1UXJA 3TOVA 1AS3A 3DZ8A 2D7DA 3WJ2A 3ZN2A 1ULTA 1U0EA 4IDOA 4NNJA 1A7VA 3JT1A 1M0WA 1TQDA 4LZLA 4ADSG 4MQ6A 5DGIA 5CA0B 2ZBVA 3F6EX 1FTWA 2XUOA 5H70A 5HRCA 2W2QA 3Q7PA 4JR0A 2YL3A 4BO9A 1KIAA 1ZK4A 1HK7A 2QP4A 1Q95A 2BEVA 4QSMA 3IDSA 3TDNA 3V34A 2B2CA 3DAPA 3DWWA 4BMXA 1ISFA 1BDJA 3UB2A 1A5ZA 3IAUA 2MWMA 3X44A 1NXTA 2CFIA 4O1HA 3C8HA 4HDQB 4I2NA 3QLJA 3S90A 2J9FA 2QRPA 2AFRA 2ZRKA 2WU0A 4INPA 2GHRA 2O3RA 1GPJA 4X64B 1M8KA 2XQIA 2ATIA 4IDHA 3K2BA 1QO7A 2EERA 2HCBA 3ZX5A 3FFTA 2HF7A 5IKOA 5DP2A 3L77A 2R84A 3T3GA 4EF4A 3AJDA 2P3QA 5A4AA 2UYYA 2XWJI 4XA8A 3DLIA 2IZ6A 3P4YA 1QYIA 4LTNA 3WIUA 2I78A 2ZIXB 2GJAA 4DLAA 1FSPA 3P9KA 4UREA 1K7SN 1J4AA 1I30A 1MX1A 1QFYA 1YGYA 2FPIB 2ZJ3A 3MUEA 4OJNA 4PCAA 1JEEA 3AHIA 4BN4A 2IZ5A 1HQYE 2B0HA 1NQ5A 1H2WA 2ZBGA 2MCFA 3P96A 5DXJA 1B41A 4BLRA 2ID9A 3OQJA 3ROPA 3FTNA 5JRZA 2HDWA 4EUKB 3F6PA 4P86A 1MV5A 2HKIA 2CLSA 3ZS9A 1U2DC 5E4TA 3P26A 2C5SA 2R7KA 3BSYA 3BWXA 4GYYA 3DKIA 4UMFA 5GIOE 1H2RS 1U7UA 4LGYA 2QLJA 3DWIA 2M6LA 3RTBA 3ZDQA 3BQ9A 4PIPA 4QVKA 3THOA 3WMWA 5LMUB 2PCLA 2QIOA 4DV4B 1OXBA 2GDCA 1EUDA 2J0VA 1Y8CA 2MHCA 2ZJAA 4LNUB 4UM9B 1KGSA 4ZI2A 4MCAA 2H57A 3AESB 3HCNA 4TV9A 5JAHA 7MHTA 3AY7A 3LT0A 3KQNA 2QVYX 1E4OA 1DB3A 2JJ1D 9GPBA 1VFNA 3DE9A 2C03A 1CQPA 4EHNA 3ANLA 1NVAA 5A6KA 2YVKA 4PGAA 4J43A 1DTWA 1AGRA 5DM70 4CIPA 1IQ0A 1QQ7A 2ZXEA 1YBVA 3HDQA 4L9SA 4DJFC 4DUGD 4QXPA 1JDUA 4BRZA 1EWYA 2NO0A 2GZMA 4JDPA 1SKMA 3CNOA 2QMUA 1JH9A 2EW1A 3OIDA 3T9AA 3P9CA 3ENNA 4WN9B 2CJWB 4O2AA 2HRQA 3WLTA 2Y92A 2JGIA 3DTVD 4FVTA 4LAFA 2EGGA 3ROGA 4WL0A 4ZQFA 2QLTA 3QLEA 3PR1A 2XRYA 5CIYA 4AO8A 4HY3A 3L41A 1N78A 1HLPA 5C8YB 4WOCA 1Z9BA 2UV8A 4ID3A 1Q1EA 3OX4A 4BNKA 4NU8X 5JS1A 1YRYE 1MN6A 3FETA 3F6YA 4UHKA 3U3DA 2GAOA 4CLRB 4AX8A 3THXA 2IHUA 5IF9A 1U2PA 1R15A 4HNSA 1QIJA 3KQHA 2XQJA 3K53A 3CJTA 3VA7A 3DDOA 4GIBA 3GLKA 2ZTVA 1GILA 3ZI4A 1MABB 4B6IA 1G5QA 4Y9SA 5ISMA 4X24A 4N6GA 4B81A 3MS7A 2Y3DA 3VMFA 1SXQA 3LUCA 1ZIOA 2VHCA 3KTAA 3MWYW 4CI9A 2R8OA 4DJEC 4YUZA 4KR3A 1U90A 1C3VA 2GM4A 3PJFA 4FGSA 4HQLA 5HUJA 4IX1A 2FG7C 1CU1A 2PSFA 4V0RA 5TRTA 2Z43A 5I7HA 2QLAA 1IW7F 2FP4A 4FC7A 1CKEA 2B4RO 3EC2A 2JRLA 4V38A 3EBLA 3HP1A 5HJ7A 3ETNA 5HK9A 1HEYA 1B68A 2VDUE 2EL9A 1QE5A 3MMNA 1OD6A 3A25A 4GPD1 4A8HA 4OLAA 2A9QA 5JNUA 3V46A 1MX3A 2FDXA 2AFHB 3CX7A 2VBFA 3SZUA 4JP1A 4G25A 3DDUA 3OQ1A 2NUTB 2VJQA 3G5AA 4L0QA 4UVGA 4ES6A 2R7VA 3GOQA 4TKLA 3LH5A 4Y2GA 4F1KA 3AEKB 1GYRA 1Q5PA 3WRYC 4RIEA 5D3QA 5AM2A 3KTDA 1R4NB 2R00A 4IUDS 3I6YA 1OCZC 3DR3A 3MEQA 2H8AA 4UQLA 4FGJA 3ET4A 4GC9A 4DCMA 1L5OA 1C8BA 3EVFA 1U0GA 5EVJA 3I05A 1XD9A 5BNWA 2CVQA 4KO1S 1FS4A 4YN0B 2P4HX 3S29A 3BRSA 2CJXA 3CRQA 3L8YA 5JTUA 1QVWA 3NEPX 2P1DA 1MHTA 4JC0A 1CEXA 1GL7A 5KKNB 4D96A 5FZTA 1FRVA 3QY9A 4QU8A 4QRIA 1SQ0A 5BQIA 3DV2A 4V1CI 4ENSA 3WFZA 1D2AA 2RK6A 4BNYA 3GGSA 4QGHA 4HFRA 4LDQA 1BVRA 4FFDA 4YH1A 3UJ6A 5IKPA 4JUBA 3QWFA 4V02A 1UDWA 2FVYA 4C6RA 3B0UX 2ZUWA 1TJNA 3U4IA 3CZMA 3JSZA 4HAUA 3CWCA 4P38A 1T5DX 2VYVA 4KFSA 3BEDA 4MWCA 2FPUA 4TMVA 2Q4TA 2PBZA 2DULA 5TPZA 4PXYA 3RYCA 4U5BE 2Y1EA 2VWGA 3P9PA 4LSWA 3TI9A 1GKIA 3M0EA 4JLJA 3HA7A 5JYBA 1BXKA 1RXWA 2OZVA 2FXVA 3R3SA 1VK5A 2RCYA 2Z30A 2P9BA 2ACVA 1QHHA 2XA1A 4KO4S 1QCYA 3JQAB 3PNKA 3RCBA 4LYFA 5DGCA 1VPDA 2QRZA 3ZUPA 4RDAA 1YUNA 2PP4A 4MYCA 2O07A 3U2QA 1USUA 3GLVA 3OZEA 5E6SB 1OH7A 5J2UA 1K6EA 2ZSEA 5HIIA 3TSYA 3GJZA 2GILA 2Q45A 3UVEA 4ZZ3A 1U2RA 1O95D 2IYPA 4F5WA 5K4HA 1LTHR 3O1JC 3QE0A 5KHAA 1P1RA 1VYHA 5B1HA 4AXBA 3LEVA 2E4AA 1A0BA 4IGIA 3PNBA 5CT4A 2YZMA 4MRMB 4Q34A 4O4HB 4B6JA 3CF4G 5BN4A 1O9GA 3PU6A 1SXJB 3E9YA 4H27A 2NQTA 4M22A 4NE2A 4X93A 4QDTA 1ULSA 4U5XA 5FO0A 5JWOA 3DOCA 4B48A 3SEOA 1UJNA 1H2HA 3V6LA 3TRIA 4D0RA 1W4BA 4JLSA 1PVVA 3S7ZA 1SU7A 3MAJA 4DEVA 4C4AA 5HZMA 4DNXA 1C03A 5IJXA 5H68A 4JKYA 4O59O 5BP7A 2OUIA 1IB0A 1V39A 2QX4A 3BB3A 4OOEA 3U9LA 1RKCA 3U2MA 3DLTA 3LUBA 4C05A 2YKGA 4XFJA 4G5YA 2F67A 3DMTA 2J0WA 1FU7A 2G67A 1KI6A 3MW8A 4HVCA 1NRWA 4F4FA 3EVNA 1N6OA 2NO4A 2NXWA 1G1MA 3HCPA 3IB6A 3PE4A 4DDUA 3OLYA 4Z49A 5AXAA 1QF9A 4MVJG 3HSKA 1QK5A 1ZOOA 1KZ9A 1UF9A 1E96A 3D43A 4G8JA 4PFJA 4O4JF 3GRZA 4OHRA 3WL6A 3GLQA 4DCNA 4C0BA 5FOTA 4MQ4A 1DKRA 3QFSA 5C80A 1ZM2A 4KLNA 5C35A 3HS3A 5DSZA 2VDPB 3LYAA 1QBGA 4DRIB 3ED5A 1R8JA 4HB4A 5G53C 3AFNA 4OEHA 2YWDA 1TT5A 2HCTA 3AWDA 3IAHA 1Z12A 2DBYA 1A9TA 2OYSA 4XM2A 2H0QA 4B3CA 2C9DA 4D44A 2G07A 1CRPA 1ZLXA 4EX7A 1WM1A 1NPDA 1OTXA 2IYTA 1E61A 3W1EA 4HXEB 2BBWA 5IG2A 4LF8B 1IVYA 5KC8A 3QPUA 1ISIA 3U40A 4OL9A 3UK2A 1IQUA 1LVGA 1YJAA 2CEAA 1IUNA 1Q1BA 4FDLA 4POAA 1QP0A 3WHKA 2QW0X 3UCFA 2HWUA 2ZCUA 1ZSVA 3P4XA 4U6QA 2F6RA 3PPVA 5FFFA 1WOMA 2BFDB 1JU9A 2BSXA 2ZSFA 3DULA 3AF4A 2VNKA 1X1EA 3EXEA 5FL3A 3V4VB 2GXAA 2PZMA 3AR4A 3D8TA 2C2BA 2PUBA 5HXAA 3EGEA 1FDUA 3H2ZA 3ELYA 3RAEC 2Y3HA 2CYCA 3ITKA 4TYPA 1H7IA 3VR4D 3ZE9A 3ZIDA 5H3HA 3RFTA 2I3BA 3KBOA 1LLDA 2HJGA 2OXTA 2VJBA 1XUOA 4PIMA 4DCUA 1AZSC 2PKXA 1XP8A 3LUDA 3FVQA 4D0LB 1TADA 1KARA 4ZEOA 3T7SA 2R2GA 3JVUA 1MENA 2XLEA 4LNAA 4ENUA 1SK9A 2XOKD 2UZ0A 4I8DA 3QKRB 4W7SA 5CA0A 1NUQA 1JYFA 1Z68A 3MJDA 3VGPA 2FMTA 1ZN9A 3F6BX 4FYJA 5CJ2A 1BGWA 5G2OA 5TMBA 3VOSA 1LBSA 2VH5R 4KOEC 2Q29A 4HLCA 3BF7A 1ES9A 2PRYA 1LQUA 3IPLA 3T4RA 2V9CA 2IRWA 4YLEA 4ZVTA 3PB3A 2VZEA 1AS2A 3U4HA 4BXOA 2H3HA 2MSKA 2XJ4A 1YCGA 4H4DA 4JBNA 3ZKAA 2N46A 4R84A 4QECA 5A04A 5KNCD 4TOIA 4M0KA 4YWQA 3I8XA 3M4NA 4HFKB 3X0DA 5EJEA 1XJCA 3MELA 4ILEA 3UHOA 4NFHA 1DVRA 2H1LA 2RKOA 3BA6A 3FCXA 2H1RA 3WNVA 1G2IA 2IXOA 3AZPA 4DSTA 3T61A 2HBYA 5CJJA 2OO5A 2MSDB 5J2UB 1MAAA 2V0NA 4PLCA 1DEXA 5CCXA 1HETA 1ZSNA 2IZZA 3WA7A 5LNK6 1MPXA 1YZHA 1Q2UA 4DQXA 2HDHA 3B1ZA 4OXXA 1KP2A 4GE0A 4KVZA 4YJ2B 5KINB 3WQRA 2HSEA 4OFWA 2JIBA 3BXZA 3R3HA 5JCOA 3B1KA 1DZ3A 1UBOS 3RFCA 1NV9A 5AICA 2ZSUA 3EDMA 2A7XA 4PSCA 1NG1A 1Q7EA 3NNSA 1Z74A 5CCDA 2HF8A 4ZI7B 4BLOA 3RI3A 5HOQA 4C5CA 4CJOA 1RAEA 2Z4SA 4MSUA 1AMOA 3CBGA 4WEOA 2R7WA 1RFLA 1YU9A 1YXMA 4XB2A 1PHRA 2Y05A 4U3JA 2O0LA 3P1JA 3S68A 5BOSB 4AJHA 2I67A 2HIHA 1Z4OA 2C4MA 2DQYA 1T36B 3L6CA 2VAWA 5C8VA 3TD7A 3B1JA 4FPXA 2IYXA 1JALA 4J0KA 4RHUA 5J9FA 1JHYA 1Z6QA 5FOUA 1TRHA 4ZCSA 5I7EA 3VKHA 3QVTA 2VDKB 4PIVA 4URUR 2Z0MA 3VSEA 4DMKA 2QNBA 3GDFA 4V3CA 5K0CA 2V9PA 1DDOA 3KKEA 4JLDA 7ADHA 1QK4A 1QO0D 3FLEA 3GEPA 4WZAA 5JD5A 1C41A 2PZLA 3VV2A 2BF7A 1I80A 1XRRA 3QNWA 5ITZB 5F1OA 3COPA 2OV8A 5ALOA 2RHBA 4UOQA 2GCEA 3NHUA 4CLHA 1G5ZA 1EVIA 1V25A 3I0ZA 4GP6A 4Y6LA 1Z16A 2YXPX 4ZQHA 1C9YA 1C29B 2W4IA 3AIOA 4YUVA 4AT1A 3STXA 4L8YA 2WT8A 2QNIA 5AC4A 1OTHA 5GMOA 1TQ8A 5IJZA 4D9FA 3A3YA 1K0UA 4UHCA 1Y6QA 4Q7EA 3WOVA 1ENPA 4L5CA 4EGJA 3N5CA 3SP1A 2YRXA 5LIRA 3OX2A 1ZZEA 1Z62A 4XVUA 2QI9F 4MVRA 2IU6A 4PTYA 4FNOA 2WUDA 4MV6A 3AVPA 3EIOA 1B7GO 1PQUA 1YJBA 1P7ZA 3C6YA 3S3TA 3RNLA 1CZLA 2JGRA 1WZUA 5AH0A 4AY5A 4EKEA 4XD7D 3I4FA 4JMPA 4L50A 1EP9A 1QGYA 1OJLA 3EOAI 4Y2QA 3EWNA 4QTZA 2I8LA 2AOWA 3PD7A 2MT9A 4IINA 4U6SA 3T9CA 4F46A 2CNOA 3KS9A 5HRAA 3KQTA 1HE5A 2QV7A 3ND9A 5DTJA 5FUYA 1V6CA 4B7AA 3DE4X 2HHHB 1W4RA 1G6KA 2HIGA 4EGCB 5FX2A 3PEFA 3GHHA 3FPGA 3VH4A 3R0QA 4QLBA 1F12A 2Q4FA 4DBRA 3CZAA 1JB9A 5CX1B 2HA4A 1OGYA 1Z0JA 3G23A 3UATA 2IXBA 3A6FA 4RNDB 1RSZA 1P6UA 3UUGA 3B5JA 3RODA 2LFDA 1E9SA 1YIDA 4HSEA 4EYQA 1ZI9A 2PUGA 3RC1A 4A03A 4DPLA 2XUIA 3U7GA 1I7PA 1XU4A 4B6SA 3BJZA 3SZOA 2J09A 2GAAA 3LUAA 4J30B 1E1CB 5EZ5A 1QWOA 3HUTA 1MLDA 4M4SA 4N5MA 4WASA 1F38A 2GTPA 3NHRA 3FWZA 4FMDB 4NONA 2ZM5A 1EGMB 4E07A 1DEHA 4E6EA 4F06A 3VKGA 1NSGB 1BKYA 4J8PA 5J40A 2OCKA 2WHPA 2B78A 3FJYA 4NBNA 3L8GA 1M10A 1X8XA 3U2LA 1E6WA 4DN6A 2NYRA 4D3ZA 3EPJA 4K9LA 2C4WA 2C84A 1DWOA 1E5VA 2H29A 1MV8A 5F35A 1QUEA 2C31A 3B78A 3MTBA 4NQFA 2YRWA 2Q46A 3P9IA 3HYRA 2EIKC 1OWNA 1KI7A 1OKKA 2AJLI 3CLSD 5GOTA 4YR7A 4Q4JA 4Z6KA 4KOAA 4IXWA 1FJGB 3EXAA 2FWPA 4O2LA 2C1EA 1AT1A 4LSZA 5JJBA 5J5VA 1G6HA 2J5KA 2PZEA 3PQ8A 3QKSB 1YB4A 3O21A 3ZE2B 1MR3F 1YNOA 1A4RA 2P27A 1WSAA 4MO9A 2IYSA 4C3OB 621PA 3UJ9A 4Y7DA 4RY8A 1VMEA 1ZZPA 3IBYA 5J43A 1WMBA 1Z23A 1KJZA 1VXRA 2CJYA 4UEJA 3U4CA 2H1HA 1BU5A 1BVUA 2A2ZA 2V3VA 5GZ3A 4CM8A 4Z7JA 2EFDB 3A6ZA 4QFMA 1U8CB 4RPJA 3TLMA 4CL2A 2OJED 2QLLA 4UNPA 2O2DA 3O03A 2O6HA 1U4SA 2ZW9A 4P7FA 5LDHA 4AY2A 1I0LA 3RK0A 2B5OA 1AUQA 4COOA 2DAPA 3OOJA 3THWA 1VIVA 5FAXA 3TE7A 4XPYA 5K0IA 1ECPA 3DBVO 1ZP6A 4L9AA 4WUVA 3K73O 3VPGA 1RXSA 4O2BF 2AK3A 4UNSA 1WUTA 3CT4A 3TDKA 4QU5A 4L6AA 3ITFA 2HA0A 5DCWA 3IHWA 3CUTA 1SWVA 3QX3A 1P18A 3ZWBA 4BLUA 1TLLA 1L4EA 2WJ3A 4E18A 4S35A 4BNUA 4EA8A 1JKJB 2WU3A 1IY9A 2X2FA 3MJHA 4G4GA 5JMTA 3GPBA 5IXYA 1I0IA 3JTMA 5ADVA 5DLPA 3AR8A 4MVCA 1RI5A 1P3Y1 3ICEA 4XFKA 4IKEA 1E3WB 3X1WA 3C1AA 3PDIA 4AG5A 1ZVVA 5COFA 2GUGA 1UL1X 4RA9A 4YYZA 1S4QA 2E85A 1Q0LA 1ECCA 1F4LA 2VDWA 3LPLA 4NZOA 2CYDA 1X0VA 4FBLA 4FDUA 2IQ5A 1QPZA 2IYOA 2IA5A 5I51A 2P61A 4E0IA 4AMYA 2DWPA 1V1JA 1AO3A 3WGYA 3ZHRA 1QV7A 1KYQA 2YASA 3I72A 1G64A 1F7UA 4BV2A 4NG4A 2C8VA 1U6KA 2RI0A 2ZLBA 2D4UA 1Q0HA 4HH4A 1PI3A 1DTWB 2RHGB 2PVCA 4L6CA 4OD0A 5PNTA 6ADHA 4ZTZB 1Q2XA 4QGGA 1NQXA 2HJ9A 3RVLA 4DOMA 1MGPA 2WFAA 1ZCAA 2HMAA 3WZMA 4ZAFA 3GLGE 4LQLA 1CUCA 5B6PA 5IW8A 1REQB 2XDWA 1HUQA 1KORA 5FBRB 1FNNA 5FUWA 4ZVPA 2RGXA 5JXIA 1TL7C 4MO2A 4P0PB 2IXGA 4XJSA 2LCQA 3P0EA 3PI7A 1DEAA 3RVBA 3IMEA 1FRNA 3HBFA 4MZXA 1PS9A 2QTCA 1FDIA 5FYDA 2WDZA 1QMPA 4WZZA 4XGRA 3ZDCA 3VGJA 1E6UA 5JU6A 5HM6A 2Y93A 5ALXA 3LXMA 4GWLA 3GVIA 2C77A 2O5CA 2VXYA 1O87A 2BGWA 3LFHA 4LY6A 5K8CA 2QX9A 3WG7C 3LECA 4YONB 5FHQA 4D6YA 3U44B 3L0ZA 4MV0A 3GLGB 2CV0A 2FMIA 5T41A 5ALEA 3DBHB 5I7VA 1C0KA 1UZUA 1H9CA 4KO3S 2A9KA 4FFVA 3ZK9A 1IC6A 3VISA 1SQ6A 2J3MA 1WHTA 2HZ7A 1KKMA 4S1PA 3QELB 4Q1EA 2H65A 3UIEA 3I9FA 3AKEA 3QLVA 3M6UA 4DYDA 3IAEA 3OTOB 2Q1XA 1L5SA 3E9MA 1YQTA 3NHFA 3ZE7A 1Q6YA 1G38A 5HJ2A 4Z86A 1VG8A 2QTZA 2R96A 4NQZA 2JLWA 1T9AA 1R5OA 1D4AA 4W9NA 5BN3A 5LQJA 1S89A 1HE2A 1XDWA 1YQWA 2P67A 4I1UA 4Z1MD 2C58A 3EHNA 1R0LA 2Q6LA 1OAKA 5CXXA 1Z28A 2BGNA 2O2EA 1GVNB 1G9XA 1BE0A 1JG7A 1FQWA 1LW6E 2ZK7A 1SUDA 3VZCA 3GNSA 3EQ2A 4LRXA 3C4VA 1IUPA 1XDGA 4EJ6A 1CZNA 3HB5X 2QL6A 4J4BA 3TMAA 2VTDA 3DB1A 3IKVA 5HKOA 3GJ6A 2WFLA 4AMVA 1ZM9A 1PTJC 1YARO 13PKA 1LS6A 2NZ2A 1AK2A 2PL3A 2BJWA 2CXHA 3I01M 2VJMB 3IDZA 4MNTA 3OP4A 4OYLA 3V2HA 5LMNB 3HU5A 1R9NA 2IWRA 3LGAA 2ZYVX 4ZVKA 1NP3A 1TTQB 4BB0A 3O9VA 2A0WA 3DEKA 3QVKA 4CT4B 1WPXA 2GNOA 4BMCA 1SULA 3K32A 3QPAA 3JVEA 4BQOA 2Y0CA 3LOUA 5DGDA 4BGDA 1FVFA 2E55A 1LI5A 3DLAA 1DJQA 3ESCA 2HZBA 5WRFA 2WINI 4BY9E 1DKMA 3K09C 3H9UA 1MB2A 2ZIAA 3JZDA 3VUEA 2PAFA 1HYBA 1SXJA 1Y89A 4D0SA 4PR0A 2YR0A 1OGIA 1U3CA 2Y0PA 3KXKA 2JJ8A 1ZL0A 3WHNA 3KYDA 5L40A 3KQKA 5IVHA 2AMLA 1NW6A 2RH8A 3JQ7B 5KX5F 4GC5A 3QPBA 3UHAA 1GGFA 2QM7A 1FFXA 5D3MB 2JKZA 5B1BC 1QOQB 2BBSA 2VG8A 4IIJB 1YJGA 5AVUA 2P9JA 2H2GA 3LQ2A 4TLCA 4YO7A 3V1UA 5IJ9A 4XQ0A 3GJXC 3RTAA 1FU8A 1ORHA 2BGJA 1CUUA 5LQNA 1E1QD 5EJ8A 5IM4A 4CBVA 5EFZA 2KQ9A 4UUPA 1SKUA 4HQRA 2FNAA 4JLBA 5F4ZA 1ZYRF 5B7GA 4KWCA 3T4PA 1PQWA 2IGBA 5ULLA 1BCRB 4NJEA 3E9DA 1NZDA 5E0OA 3EIXA 3R6LA 4P9FA 1HYGA 2JJ2A 1KK0A 2UUBB 2G09A 3IB3A 2AFIA 5KTKA 2EKQA 4G09A 1J20A 1PJ8A 1QH8A 3MB8A 4Q7KA 1TMKA 2IIBA 4P7GA 4QXRA 2W83A 4H59A 1Z2EA 4P8RA 3WYAA 1W88A 3RU7A 1D6MA 5CX4A 5EJMA 4RJLA 4MQFA 5CI9A 1XDDA 3VR1A 3UMJA 1X38A 1WY7A 3AHFA 3UH1A 2ZRNA 1XD8A 3EWSA 2FX2A 3UMYA 3ZOZA 6ABPA 5HF8A 3UAZA 1VC2A 3NDPA 1G4AE 1RKBA 1P4JA 2CHQA 3BOSA 3MZ0A 5DYIA 2KBEA 4BP8A 1H5UA 1H3NA 1X3LA 5JBNA 2YIVX 3HR4A 3QKUA 2VASA 3R41A 2QNRA 4QULA 3GJ5A 3ZEIA 5T4EA 2ENWA 1X1DA 2Q21A 3G89A 4J75A 4AZSA 3V48A 4B9AA 1A2OA 2D2IA 4EB6A 1X7YA 1BQ4A 1NC1A 5EJIA 4L4XA 5KYGA 4IGEA 221PA 3ROZA 1PYDA 3ZCPA 1XD2A 1P1JA 3SFVA 1MABA 1F9AA 3H4IA 2KC3A 1G3UA 1OXTA 3DEYX 3H87A 4M1KA 4N3AA 4FI3F 2B4YA 5HCIA 2ZWMA 3FD8A 3KTAB 2YZKA 2A33A 2JGAA 3GVHA 4ZC8A 2PS1A 2PMWB 4HX9A 2XUZA 2YXBA 1A2KC 1FTGA 2EC5A 4C89A 1XD2B 3CNHA 5A4JA 1RPNA 3N8NA 4DR5B 4NZMA 2ODNA 2JX0A 2RHRA 4IAQA 1PJTA 3NKFA 4LKOA 2VSNA 3H1PA 2PM8A 3HA2A 3N8IA 4PAQA 1HY5A 1NFRA 1XO1A 2J85A 1QLJA 2WAMA 5EA2A 2P75A 4DUYB 3UWOA 1VZ2A 2X6QA 2A5YB 4ZT3A 4TSFD 1ATIA 3WE7A 4CKBA 3GLHB 4LOJA 1XG5A 1M2HA 4WOJA 4Z1OA 1G7CA 1WMEA 1EK0A 1LLUA 1MC1A 1QZTA 2VUSA 3JZIA 1WU8A 3MCTA 3R3WA 4I4IA 4LXHA 4ZAZA 5GINE 1QGUA 2GD1O 4NS4A 4I1MA 2E18A 4H3HB 3OJXA 3QFTA 4IDQA 4BWYA 5LA6B 4O2AB 1JQLB 1RWOA 1OMOA 3L1KA 3K6BA 1PUIA 4JEMA 3OCUA 4IKOA 1UC8A 3DFMA 3BICA 5FTNA 1X92A 3CVUA 2I65A 2PU7A 1E86A 2FEAA 3CPSA 1IXRC 3GR6A 3I01A 1XHEA 4M0CA 4D81A 1Z6YA 3OF3A 4K9SA 3MWFA 4X7RA 2H7YA 3BDVA 4O4HF 1Z0ZA 3FW1A 4ARBA 4QOEA 1SCNE 4LVNA 1UQRA 1X13A 5B3LA 1J1ZA 5K0GA 2YIDA 3ZK7A 2VO1A 3M1CB 3Q9UA 5C4GB 2Q5OA 4H1TA 4YCCA 2HPHA 2IPMA 2O8EB 1TECE 4GRIA 4O7GA 4EW2A 4AJOA 1FBNA 3JQBA 3IE0A 3PHIA 2ES4A 2QAGC 3WK5A 2PMEA 1HXHA 1I7NA 1J6UA 2OKUA 1Z7Qc 1MUUA 1XA0A 1QE0A 1ZCFA 4CPDA 1TD9A 2Q0QA 2QR2A 4IHJF 5I9NA 4A36A 4P4TA 4L3VA 4MR9B 1GRVA 3SBXA 4B7UA 3VF0A 4FLEA 1U6IA 3W6OA 1T36A 3W9UA 1C30A 4XPIB 4GPZA 2G1PA 5E1OA 1L3IA 3OUZA 4R9UC 2JNWA 4GP9A 4YAGA 1D0IA 3QBEA 1EK6A 5BQXA 2PKWA 1Q84A 4MVJE 4YCLA 3ZIUA 1GL3A 2F1JA 1Z5GA 3PC3A 3F5FA 3ZIBA 4MITA 1FQKA 5AOAA 3BH6A 3NH9A 4WX2B 3F78A 4C4XA 5FWXB 1CDDA 4TKMA 5HP4A 3DMRA 1N2GA 3JAKB 4I9GA 3MJTA 2OD7A 4BKRA 4CGYA 4C7XA 3PPIA 3QI2A 4C0AC 3KJQA 1F06A 5KTMA 2VT7A 2QN1A 5I7RA 4MVJP 3ED1A 3RQSA 4LDPA 3OZBA 3B89A 2I3AA 3ILHA 1QJCA 3BGVA 1PQ4A 4BFSA 4TXLA 1NPTO 2NT3A 3NKLA 4PZPA 4ENQA 2B2NA 1W88B 3OMXA 3PHGA 3PQ7A 2WTXA 4X1YA 4B44A 4TRNA 4PO3X 1I4OA 3ZNQA 3EVAA 3P8ZA 4EHLA 5GIPE 4GPTA 1OHHD 2QZSA 5AHOA 2HI0A 1GUZA 2VPYA 5AVSA 2OOSA 1DJNA 2FPIA 2GI4A 2O14A 3QLTA 4HWPA 1K0FA 1Z4JA 3JALB 4GZ5A 1JPJA 3I6ZA 1XQXA 3ZWMA 2JJ1A 4G5OA 3BIJA 3FPBA 1QCDA 2M6KA 4IX9A 4PCLA 1LFAA 1QH1B 3PUJA 4PNZA 4DXWA 3FIJA 4B6PA 1RR6A 4DWVA 1I14A 3M89A 4Q9JA 5F4BA 4YHBA 4FT2A 4L2IB 3RTCA 1Q0DA 1BEZA 4TRJA 4P1ZA 3MGGA 5DI3A 5JPDA 3W5CA 1DAFA 2BL2A 3SX4A 2WUFA 2QZJA 1KZHA 3NHZA 2GHTA 1E0JA 3UJNA 1G2QA 3HRKA 5CVTA 4TWIA 2BFFB 2YV4A 3GEGA 4F7WA 4YAWA 4Z9JA 3AIMA 1OFIA 1K8RA 3GP8A 2CLFB 4NMWA 2VXBA 2Y39A 1WW8A 4M1QA 3WP1B 3K66A 1SAYA 1VXOA 2XUGA 4KVFA 5AK0A 3TTSA 1RRCA 1AKWA 1WXEA 4J2HA 4JN6B 1XU9A 2GAJA 3A7EA 4R5MA 4MVSA 1GO2A 4AJPA 1NVMB 2P91A 3BB1A 2VHXA 5E7IA 2KQUA 4PYLA 5C0OE 4IYRA 1Q0UA 5JECA 4BFTA 1Q11A 3CB4A 3MYFA 4FFBA 4HVAA 4LQ4A 2XZOA 1JX6A 4U1RA 1U7HA 3AUTA 1J1UA 1DNPA 3B3JA 1T9CA 1ZWLA 2NPUA 2Z83A 1ZR4A 4QBFA 2X5JO 4R8SA 4UPDA 2ZM6B 1N77A 2O19A 1UKEA 4GF5A 2CNWD 4PHGA 3TNLA 2FE1A 3UXEA 1HMDA 4FK8A 4ZZ0A 1TXGA 2WWRA 2ASRA 4HUJA 2QD1A 2HHAA 1ZJZA 3CYFA 1OWOA 4ZVVA 1SOAA 4DWJA 3SN6A 5C31A 2JK0A 2ZIFA 3NM5A 4CDMA 1FF9A 2SBTA 3M79A 4F2GA 1EESA 4QXQA 1QFSA 3O95A 1S02A 4V03A 3TLBA 1Q1QA 1MOZA 3OMLA 3JVIA 4UM9D 1YQQA 5J4LA 2HFIA 5H4HA 4C0WA 4ZU6X 5T8KA 3RU9A 5F5HA 2FRDA 1XV5A 3ENQA 1I7DA 1QKKA 1SCUB 4PZEA 4GR4A 1Z7GA 2PL1A 3RIGA 4YAIA 4YWJA 3RWBA 1ZVJA 4PSUA 1PT5A 4DW8A 2ZRLA 4RSGA 5AI5A 5A06A 4MOWA 2G7MC 2QAGB 2I1VB 3FUWA 2OC9A 1FFWA 2QL5A 5JMWA 1KEEA 1EUYA 1V1MA 4XYEA 1PNOA 16PKA 3E9RA 5CPFA 3G8BA 3C62A 3V2UA 2QG6A 3D1LA 2ZREA 4EM6A 5CH8A 4HFNA 2OCAA 4W63A 1UBGA 1KYZA 2VCYA 2C2YA 1KU0A 4EO4A 4IEIA 4ZHSA 5DHPA 3WDMA 4Z0PA 5JNWA 2QZ9A 2AGVA 4I6EA 5AO9A 1SBYA 1E7WA 1U9IC 2WWTA 4XARA 1Y4AE 2AU5A 3PTZA 3QIAA 2F8MA 3HKEB 4B31A 4R1SA 4OHZA 2NYAA 1G7TA 3TCXB 3QBTA 4MNDA 5EFOA 2QG4A 3CY6A 5LKAA 3UHFA 2A1UB 2VNAA 1GA6A 1UPAA 1KR2A 1MAUA 3L79A 1ESNA 2X6RA 3H1BA 4TSFA 4D8XA 5C46F 4J1TA 1NQAO 1VRWA 2R4TA 3CIOA 2PH3A 1Z88A 1B14A 2L69A 3IUPA 1XVVA 5JCXA 3K70C 4XYBA 4ZOAA 1APBA 4FFN