3OA1A

Crystal structure of phosphoprotein/protein p/protein m1 residues 69-297 from rabies virus reveals degradation to c-terminal domain only
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
104
structure length
102
Chain Sequence
EDDLSVEAEIAHQIAESFSKKYKFPSRSILLYNFEQLKMNLDDIVKEAKNVPGVTRLARDGSKLPLRCVLGWVALANSKKFQLLVESNKLSKIMQDDLNRYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Phosphoprotein
publication title Crystal structure of phosphoprotein/Protein P/Protein M1 residues 69-297 from Rabies virus reveals degradation to C-terminal domain only
rcsb
source organism Rabies virus strain pasteur vaccin
total genus 37
structure length 102
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3oa1A00
1VYIA 3OA1A 2WZLA
chains in the Genus database with same CATH superfamily
2KGOA 4XLNF 5T3WA 4ZLDA 1FFTC 4J7TA 4E7ZA 2XXAB 3AG4C 1J8MF 3SP1A 5KYNA 2PX3A 3U9JA 1MMAA 3QVYA 4XLPF 1TFKB 1JR8A 4N6HA 2ZXRA 3ZIBA 4F4BA 1OXKA 4JVSA 3MYIA 5B3SC 1R4TA 3EQLF 1Z63A 2Q9CA 1BR4A 2MHRA 4JJFA 2J9BA 4CS7A 1J8YF 4EBKA 3JRMO 4YT2A 3LNRA 3KMIA 2XS1A 1NFOA 3ECSA 4OIRF 4EWCA 3Q6NA 2R7UA 1ZU5A 4NTBA 2I8BA 4FX5A 5E3CA 3ZDLA 1H9TA 2ZXPA 2XSEA 5B1BC 3MFNA 1HE9A 4C3DA 1CPQA 3G50A 5FCLA 2KSFA 1PCXA 1PV3A 3T6BA 2QTVA 1GQAA 2LD6A 2OJED 2A6HF 2QUPA 3L1MA 3L8JA 3PMRA 5COFA 3W8IA 5JP7A 4KNVA 3S27A 2UUIA 2P0NA 5DQZA 3S28A 1VTMP 3DJUB 3K66A 5CI9A 4BJ6A 5KYUB 3U2LA 1K40A 1BR1A 1V54C 5JVEA 4CSAC 3AG1C 3KYIA 1WOLA 4WGZA 5F28E 1GS9A 1VYIA 1CGME 4U5CE 1NU9C 3QTHA 4FESA 3C8GD 3DZAA 2EIMC 2IBFA 4GEHA 4PFPA 2OU6A 4UDVA 2GA0A 4LLCA 4U5FE 4EBBA 2YWAA 4HEAJ 4C7OB 1QQ3A 3HTKC 3OEOA 4WABA 1YYXA 2F22A 3K33A 4XTKA 3RVYA 2VCBA 3FXHA 1ZYRF 2NUPB 2OOCA 2Y3GA 1TWCA 4J7YA 4MTOA 4U5DE 3SXZA 5IY5C 4P9TA 1TR2A 3LEOA 1SZIA 2ASRA 3DI5A 4XQ1A 4H4KC 3IQ5A 2GAQA 1U0BB 2W4BA 3EG9B 1K05A 3I5QA 3UGPA 4YL0A 1V4AA 1VLSA 1L7CA 1JPJA 3E9VA 5A6AA 3EPVA 3JRTA 4RBNA 4ULVA 1NFNA 3G4XA 2VB6A 4E17A 2L6FA 3ITFA 2J45A 2HKVA 5JUAA 1AUEA 3NKDA 1FR0A 1ORYA 1Y4CA 4JCZA 2YLDA 1M57C 4PR9A 2WVOA 2JX0A 1UG7A 4IAQA 1YA9A 2RSEB 1O3UA 4K1OA 3JZ0A 4CS9A 4CS9C 3MBGA 3FOOA 5T3TA 4G7ZF 2WVNA 1C02A 2FAPB 2OEXA 3AOUA 3Q6MA 2CNWA 3M4BA 3ZQYA 1LVKA 1OW8A 2IXPA 3IHUA 4XWJA 4DJ9A 2YL1A 2HMQA 2J7PA 1TKNA 4DVYP 1TWAA 3C7JA 4XPWA 2PF4E 3EFOB 3L0IA 4IJJA 5JT4A 3NMIA 4H54A 4Q5SF 5DS5A 1OKKD 4Z9JA 2XM0A 3RQEA 3SZRA 3T6GB 3GEEA 1Q0MA 2YL0A 1BBHA 4JIOA 3SXYA 4AE4B 2YZSA 1NBBA 4C3EA 4IWBA 1MNDA 4YT4A 5KYXA 2C03A 4XPYA 1LPEA 1APCA 1LI7A 1OCRC 1IW7F 1LIHA 3EHMA 1T6QA 3F46A 4O6NA 4KI2A 2YLIA 2R25A 1VYKA 1PD0A 4I3MA 2NPUA 4JRZA 3KYJA 4MTFA 2HZ8A 4MVOA 2JD3A 3RKOF 2IM8A 3JYYA 4YN0B 4MVSA 1ZW2A 1M2VB 3AQCA 3V5YA 4BJ5A 3JCUQ 3DJNB 3FHDA 3ASOC 1ZHZA 5BQGA 4N6CA 2XLHA 4I44A 5D91A 3RFYA 3RQFA 5BQIA 2B0JA 3AGUA 3AQBA 1AVOB 3GM2A 3V7OA 2HSQA 2W45A 4B6IA 1OQCA 1EI7A 1D1BA 1DOVA 1QVXA 1YVIA 2L81A 3KPHA 3ZVRA 4CSAA 3EGXB 5B1AC 3S90A 2Y39A 3RW0A 1L3PA 1M2OA 1VMAA 2G3VA 4MVRA 3U3BA 2XL8A 3T9OA 2Y3BA 4OIOF 1D0XA 3UNGC 1T01A 5HSWA 3EH1A 3LESA 2VCCA 4E0IA 4CDAA 1A41A 1BZ4A 2P6VA 2QE9A 3MLGA 3WHNA 2EILC 1RKEB 1BR2A 3MX3A 4LDKA 4MS2A 3E70C 2L9JA 3I5PA 1FTSA 2Q7RA 4E7SA 3M79A 1Y6DA 2CDQA 1LE2A 2R05A 4JW1A 2QNLA 1EA8A 3EJNA 2EPMX 3CAXA 4CX9A 1GGQA 4YWQA 4YK5A 1KU2A 2PP4A 5COGA 5AC5A 1Q0FA 2KC3A 2KQ9A 5E33A 2AVKA 5AC4A 3FAJA 1DOWA 3A11A 1HW1A 3W2VA 2XLOA 1ZHYA 3G4ZA 1QLEC 1G4US 4OINF 1EKYA 1NG1A 2L6HA 3RF3A 3DXJF 2R9RB 3RVZA 3T6JA 4NTFA 4G0HA 4MNDA 1S7ZA 3FAPB 4G78A 2J8WA 1YZAA 2PNOA 2X0CA 2LSEA 3ABKC 3ZTMA 1E2XA 2R7QA 2LIGA 4Q7CA 2QLAA 4JCHA 4QI0A 1SMYF 2R03A 3GWLA 3I4UA 3PDMP 3C62A 3DD7A 1VLTA 2EPKX 5KYUA 1U89A 4CJOA 3DM9B 3DWWA 3VM6A 3ZC4A 3O10A 4MVUA 2CCYA 1Z23A 3K1IA 5JRAA 3IQCA 3U0CA 1HW2A 1FAPB 4DVZA 1WATA 256BA 2Q3TA 2D5RB 3H2UA 5A69A 3C18A 1Z6AA 4KC9A 1A0BA 3SXMA 3PCVA 3GANA 4EUKB 1CGNA 3JSEO 4DRHB 3W4YA 4K7BA 4MW3A 4C7OA 3HNIA 5F5HA 4O7GA 2YEVA 3SNHA 2NSFA 3M1CB 2R7RA 2NUPA 3UMIA 5JS5A 2PBEA 4BG0A 5L3QA 2R7XA 2X51A 2WVQA 3HKKA 4CJGA 1OCOC 2BL2A 4BJ6C 3AG3C 3KH2A 3CEXA 3S9OA 5DS4A 1LS1A 4LERA 1MMNA 2WZFA 3PHF2 3L34A 2ZXWC 4Z9IA 1YJGA 1MMGA 3NMKA 1OKKA 1RCPA 1WGWA 1YLMA 2G3KA 2YRFA 3SXKA 3OWTA 4YJWA 1A7VA 2Q00A 4FWVA 1ZW3A 4MW8A 3GWNA 5CIVA 1HE1A 1ORSC 2CYDA 1H6GA 2YQYA 3IQ6A 1UFBA 2A0UA 1I4YA 2EINC 4LACB 5L3VA 2KW3C 3DMDA 1TQGA 3HNLA 4AK9A 3B0VC 4AX2A 4CDYA 1JPNA 3LJBA 5EHHA 3LLKA 4PJNA 1D1AA 1FNTc 1ZHTA 2P7VA 4GQHA 2YL7A 5L0CA 2XLDA 3AGTA 1OR2A 2IOQA 1S05A 4OD4A 1ZHXA 2R7TA 3X2QC 1O5HA 4QDLA 4E0HA 3ASNC 3UGOA 2M4EA 3GEHA 3RIPA 1E84A 1YARO 3ZG1A 2V26A 2H7BA 1TWGA 3QVZA 3LS1A 1OW6A 2G62A 4D4XA 2R7WA 1OW7A 1SR2A 4AE4A 1Q0GA 3NYMA 3NDBB 3TJ6A 3ZSUA 2XRHA 3NMJA 4EHPA 2H7OA 2L6GA 3QW1A 3EH2A 4JKVA 4QI2A 1MQVA 2DYSC 3S29A 4ER9A 4G7OF 4IAOA 1I5NA 1T5OA 2Y3HA 1O87A 4U5BE 4OIQF 4R32A 1M2VA 3CQZA 2CGEA 5L0JA 4U5EE 4DRJB 3ATPA 3O6XA 2GWWA 1FFHA 1KNYA 4LLEA 4IRUA 1U6HA 2D4UA 2HS5A 1BDJB 2MWQA 3HNJA 3EGXA 3QZCA 4JURI 1N1CA 1OCCC 2A0BA 2B0HA 4JEAA 1NZEA 1QSPA 2LFFA 2I15A 1RKCA 2Y69C 2YHSA 1PD1A 4PJMA 2P61A 1K04A 3WAQA 3ZWIA 3VAYA 1A7EA 4BPMA 2L7AA 2ZXOA 1RKEA 4CS8A 4J30B 2HUJA 1WN0A 4BJ5C 3C63A 1RJ9B 2W4MA 1CPRA 3FVYA 1W2WA 2PX0A 2WZLA 2YVKA 3LS0A 1SYQA 2XLEA 4RDAA 1MNEA 5KYWA 1GM5A 2ICWG 2IXNA 2NUTB 5K0IA 3TK0A 3HJCA 3BEHA 3Q7GA 3VF0A 5DS6A 2XL4A 3B71A 3H2VA 4U9DA 4A2NB 5DQTA 5BQHA 1FMWA 2EPLX 2XLVA 2YL3A 3QW0A 4CDVA 2MYSA 3TULA 2XXAA 2FFHA 3A9CA 1Z7Qc 3U2MA 2TMVP 4MQ9F 1ST6A 1QZXA 3EGDB 2CW0F 5L0GA 3S84A 1ZZPA 3HLZA 3LUTB 2EPNA 1VB5A 4JJGA 4P6IC 2HJ3A 4DBQA 3GORA 3K6BA 1D0YA 5L0HA 4KNWA 1T6UA 2NG1A 2ZD9A 2AWYA 3RQGA 4I1OB 2PFDA 2Q9BA 4HFKB 1M56C 3UR3C 3M4CA 3WG7C 3ABMC 3ZQVA 3RH3A 2KNHA 2EIKC 4PK4A 1B68A 5A6BA 4JEBA 4MVQA 2A68F 2VC9A 3C8ZA 3O39A 1EQ1A 3FOPA 2KJGA 3JSZA 3ZTZA 2XM4A 4HE8D 2VASA 1E85A 2VH3A 1G5ZA 5KYYA 1XWJA 2A6EF 2Z15A 1ZHWA 4ANJA 1LI5A 2RD9A 3BRJA 4X0RA 2DB4A 4O6MA 2W9YA 3NRHA 4GYTA 5DLJA 1E86A 2J9UA 2HMZA 3LAYA 3UMKA 3KKBA 3H65A 4IARA 1H9GA 1C17M 4PFOA 2EPOA 1LS4A 4U9EA 5D92A 3SEOA 5E3AA 3TOLA 1CGOA 3VRCA 3GM1A 3K1IC 4Z9HA 2H7VC 4I1MA 4NCQA 3K1HA 1G4WR 2HSBA 4YL3A 2Q4FA 4YT8A 4ZLCA 4JTDB 3C8GB 4NQFA 4L6RA 3N24A 4O6YA 4BEMJ 1MMDA 4IGGA 4D4NA 2WL8A 4NY3A 5A6BD 3DM5A 5EK0A 1VOMA 3U9MA 5BUOA 4W8KA 4JTAB 2HFIA 2LP4A 3TD7A 2R7SA 4U5GA 3EG9A 3LLIA 2UUHA 1NSGB 1YA7O 2EIJC 3IQTA 3MYFA 3KL4A 4XEFA 3M15A 2AP3A 5FZTA 3R7CA 1HY5A 3TOMA 1KTMA 2R7VA 4W8PA 1D1CA 1IZMA 2J9VA 4G7HF 3S0XA 2LK4A 5EGYA 1Z3IX 1V74B 5TJ5E 1E83A 4OIPF 3U5SA 1VK5A 2OG2A 5JLIA 4CIHA 2BE5F 4LDRA 2VCAA 3POVA 1JMWA 1RXQA 1V55C 1T9KA 2P1AA 4JE9A 1H7IA 4MTGA 1G8XA 3B9QA 3TQOA 4C3BA 1ZU4A 4E18A 1XZPA 2WB7A 2KK1A 2HV7A 2QY9A 2KYHA 2IXMA 4JC7A 5HV9A 3DE8A 3EFOA 1ORJA 3O55A 3Q7LA 4EBJA 2LFDA 2A69F 1Z5ZA 2R7OA 4EKWA 2AWCA 3W2WA 1LM3B 2YKZA 3JTLO 4BJTA 4A4AA 1Q0DA 2O9XA 2YLGA 3V5ZA 4J32B 4AL0A 4N06A 4ULWA 1JRAA 2LCHA 4NC3A 4O79A 3DAFA 3X1OA 5A6JA 1TWHA 4EIYA 4BEJA 2A1DD 2XL6A 3B0UX 2BC5A 1JAFA 3AJMA 2DYRC 2J46A 3F47A 3NKEA 4BJ1A 2NSGA 4RD9A 2OEVA 3DAGA 4IB4A 3U8VA 5A6KA 3JYHA 3JT1A 3C8GA 4DBRA 2HV6A 3DKAA 3SYNA 4WJ0A 2XLMA 3NYLA 3US6A 2H8AA 2E87A 3HNKA 4DRIB 2DGJA 3IPMO 4DOZA 5KYYB 1F1MA 5E2QA 3RYLA 3EZIA 1RJ9A 2M64A 4PJJA 4CBEA 4DXWA 5B3IA 5L0IA 1D0ZA 2LQGA 1LE4A 4HFFB 1Q0KA 2XS8A 4MVZA 4OD5A 5CI8A 2NUTA 1WASA 1HMDA 1LKXA 3GODA 4XEKA 1I4ZA 3R2PA 3FMSA 1R5ID 3DE9A 5L0FA 3NG1A 4K0DA 1WWPA 3B0PA 1OXBA 3N0TA 4ONSA 3FDQA 2GFHA 2XLWA 3EGDA 3NYJA 1A7DA 1TFOB 2ZPAA 2AU5A 5COMA 4U5HA 4YT5A 4CS8C 1WTYA 4WGYA 3UMHA 2HJMA 3B29A 2IYLD 3CZ6A 1YZCA 2C04A 3T4RA 3GM3A 4PJLA 5L0DA 5KYXB 1JOGA 1XZQA 3K7DA 2GDCA 2OCCC 3TJ5A 3J06A 4KBLA 1ZVZA 1RMVA 1FMVA 4M63A 3LNMB 3QMKA 3EZHA 5DVWA 2FGYA 4NTAA 4XEVA 3LEVA 5F5FA 1SF8A 3GEIA 3U8PA 1C03A 1NLXA 2Q9AA 2Y3DA 2CNWD 4XPXA 1QPUA 4AL1A 1NU7D 5GPGB 2JPUA 1OCZC 2J7PD 4CIPA 4N4WA 3EHNA 4YL1A 4Q4ZF 2ETSA 2OKUA 2WZGA 2J0WA 2J0XA 5AGFA 2V3CC 5JSLA 3U3FA 1QKRA 3V5XA 2OQMA 3ABLC 3W8HA 4JTCB 3IEEA 5KYWB 5T1DB 3OA1A 1M6TA 1YDIA 4MVMA 4P9FA 1HMOA 2IXOA 3CSKA 1AEPA 1YYJA 3N2ZB 4PACA 4LDQA 3VYWA 2DI3A 1T6IA 2J9WA 4JZAA 2OJQA 3WODF 3AG2C 3L8IA 1OR3A 1YAUO 4FAPB 2R02A
chains in the Genus database with same CATH topology
2KGOA 4XLNF 5T3WA 4ZLDA 1FFTC 4E7ZA 2XXAB 3AG4C 1J8MF 3SP1A 5KYNA 2PX3A 4XLPF 1MMAA 2ZXRA 3ZIBA 4F4BA 4JVSA 5B3SC 3EQLF 1Z63A 2Q9CA 1BR4A 4JJFA 4CS7A 4YT2A 1J8YF 3LNRA 3KMIA 3ECSA 4OIRF 4EWCA 3Q6NA 2R7UA 1ZU5A 2I8BA 4FX5A 5E3CA 2ZXPA 2XSEA 5B1BC 4C3DA 5FCLA 1PCXA 3T6BA 2QTVA 2A6HF 3PMRA 3W8IA 4KNVA 3S27A 5DQZA 3S28A 3DJUB 3K66A 5CI9A 4BJ6A 5KYUB 1BR1A 1V54C 4CSAC 3AG1C 1VYIA 4U5CE 1NU9C 4FESA 3DZAA 2EIMC 4GEHA 4PFPA 4LLCA 4U5FE 4EBBA 4C7OB 4HEAJ 3HTKC 3OEOA 3K33A 4XTKA 1ZYRF 2NUPB 5IY5C 2Y3GA 1TWCA 4U5DE 1TR2A 1SZIA 4H4KC 2W4BA 3EG9B 3I5QA 3UGPA 1JPJA 3E9VA 3EPVA 3JRTA 4RBNA 5KYYA 2VB6A 3ITFA 2J45A 3NKDA 1M57C 2WVOA 4CS9C 5T3TA 4G7ZF 2WVNA 3Q6MA 2CNWA 1LVKA 2IXPA 4XWJA 2J7PA 1TKNA 4DVYP 1TWAA 2PF4E 3EFOB 3L0IA 4IJJA 4Q5SF 5DS5A 1OKKD 3SZRA 4AE4B 4C3EA 4YT4A 2YZSA 5KYXA 4IWBA 1MNDA 2C03A 1OCRC 1IW7F 3F46A 3EHMA 4O6NA 4KI2A 4I3MA 1VYKA 1PD0A 2JD3A 3RKOF 4YN0B 4BJ5A 1M2VB 3AQCA 3JCUQ 3DJNB 3FHDA 3ASOC 1ZHZA 5D91A 3RFYA 4I44A 2B0JA 3AQBA 3V7OA 2W45A 4B6IA 1D1BA 3ZVRA 2L81A 3EGXB 5B1AC 2Y39A 1M2OA 1VMAA 2G3VA 4OIOF 2Y3BA 1D0XA 3UNGC 5HSWA 3EH1A 3LESA 2P6VA 3MLGA 2EILC 1BR2A 3MX3A 3E70C 2L9JA 3I5PA 1FTSA 4E7SA 2CDQA 4JW1A 3EJNA 4YWQA 1KU2A 2PP4A 2KQ9A 5E33A 3FAJA 3W2VA 1ZHYA 1QLEC 4OINF 1NG1A 3DXJF 3T6JA 4G0HA 4MNDA 1S7ZA 2LSEA 3ABKC 2R7QA 4Q7CA 4QI0A 4JCHA 1SMYF 3I4UA 3DD7A 5KYUA 3DM9B 3ZC4A 1Z23A 4DVZA 2Q3TA 2D5RB 1Z6AA 4KC9A 3GANA 4K7BA 4C7OA 5F5HA 4O7GA 2YEVA 3SNHA 3M1CB 2R7RA 2NUPA 3UMIA 4BG0A 5L3QA 2R7XA 2X51A 2WVQA 1OCOC 4BJ6C 3AG3C 3KH2A 5DS4A 1LS1A 4LERA 1MMNA 2WZFA 3PHF2 3L34A 2ZXWC 1MMGA 1OKKA 1WGWA 2G3KA 3OWTA 4YJWA 4FWVA 2EINC 4LACB 5L3VA 2KW3C 3DMDA 4AK9A 3B0VC 4AX2A 1JPNA 3LJBA 5EHHA 3LLKA 4PJNA 1D1AA 1ZHTA 2P7VA 2IOQA 4OD4A 1ZHXA 2R7TA 3X2QC 1O5HA 4QDLA 3ASNC 3UGOA 2M4EA 3RIPA 3ZG1A 2V26A 2H7BA 1TWGA 3LS1A 2G62A 2R7WA 4AE4A 3NYMA 3NDBB 3ZSUA 2XRHA 2H7OA 3EH2A 4QI2A 2DYSC 3S29A 4G7OF 4IAOA 2Y3HA 1O87A 4U5BE 4OIQF 1M2VA 3CQZA 2CGEA 4U5EE 3O6XA 1FFHA 4LLEA 4IRUA 4JURI 2MWQA 3QZCA 3EGXA 1N1CA 1OCCC 1NZEA 2Y69C 4PJMA 2YHSA 1PD1A 3VAYA 2ZXOA 4CS8A 4J30B 4BJ5C 1RJ9B 2W4MA 3FVYA 1W2WA 2PX0A 2WZLA 3LS0A 4RDAA 5KYWA 1MNEA 2IXNA 2NUTB 3HJCA 5DS6A 3Q7GA 2XL4A 4A2NB 5DQTA 1FMWA 2MYSA 2XXAA 2FFHA 4MQ9F 1ST6A 1QZXA 3EGDB 2CW0F 4P6IC 3HLZA 4JJGA 4DBQA 3K6BA 1D0YA 4KNWA 2NG1A 4I1OB 2PFDA 2Q9BA 4HFKB 1M56C 3UR3C 3WG7C 3ABMC 3RH3A 2KNHA 2EIKC 4PK4A 2A68F 3O39A 2KJGA 3JSZA 4HE8D 2VASA 2VH3A 2A6EF 2Z15A 1ZHWA 4ANJA 4X0RA 4O6MA 2W9YA 3NRHA 4GYTA 5DLJA 2J9UA 3LAYA 3UMKA 3KKBA 3H65A 4PFOA 5D92A 3SEOA 5E3AA 3K1IC 2H7VC 4I1MA 3K1HA 4YT8A 4ZLCA 3N24A 4O6YA 1MMDA 2WL8A 4NY3A 3DM5A 1VOMA 5BUOA 4W8KA 3TD7A 2R7SA 4U5GA 3EG9A 3LLIA 2EIJC 4CSAA 3KL4A 2R7VA 1D1CA 1IZMA 2J9VA 4G7HF 3S0XA 5EGYA 1Z3IX 4OIPF 1VK5A 2OG2A 4CIHA 2BE5F 3POVA 1V55C 4C3BA 1G8XA 3B9QA 1ZU4A 2WB7A 2HV7A 2QY9A 2IXMA 3EFOA 3Q7LA 2A69F 1Z5ZA 2R7OA 3W2WA 4BJTA 2O9XA 4J32B 4N06A 4ULWA 3X1OA 4O79A 3DAFA 1TWHA 4BEJA 2A1DD 3B0UX 3NKEA 3F47A 4CS9A 2DYRC 2J46A 4BJ1A 4RD9A 3DAGA 3JYHA 3JT1A 4DBRA 2HV6A 3SYNA 4WJ0A 3NYLA 2E87A 2DGJA 4DOZA 5KYYB 5E2QA 3RYLA 3EZIA 1RJ9A 4PJJA 4CBEA 1D0ZA 4HFFB 4OD5A 5CI8A 2NUTA 3GODA 1LKXA 3NG1A 4K0DA 3B0PA 3N0TA 3FDQA 2GFHA 3EGDA 3NYJA 2ZPAA 4U5HA 4YT5A 4CS8C 3UMHA 2IYLD 3CZ6A 3T4RA 2C04A 4PJLA 5KYXB 3K7DA 2OCCC 4KBLA 1FMVA 4M63A 3QMKA 3EZHA 5DVWA 2FGYA 3LEVA 5F5FA 1SF8A 2Q9AA 2Y3DA 2CNWD 1NU7D 1OCZC 2J7PD 4Q4ZF 3EHNA 2WZGA 2J0WA 2J0XA 2V3CC 3W8HA 3ABLC 5KYWB 3IEEA 5T1DB 3OA1A 2IXOA 3CSKA 3N2ZB 3VYWA 2J9WA 4JZAA 3WODF 3AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYI A;  3OA1 A;  2WZL A; 
#chains in the Genus database with same CATH topology
 2KGO A;  4XLN F;  5T3W A;  4ZLD A;  1FFT C;  4J7T A;  4E7Z A;  2XXA B;  3AG4 C;  1J8M F;  3SP1 A;  5KYN A;  2PX3 A;  3U9J A;  1MMA A;  3QVY A;  4XLP F;  1TFK B;  1JR8 A;  4N6H A;  2ZXR A;  3ZIB A;  4F4B A;  1OXK A;  4JVS A;  3MYI A;  5B3S C;  1R4T A;  3EQL F;  1Z63 A;  2Q9C A;  1BR4 A;  2MHR A;  4JJF A;  2J9B A;  4CS7 A;  1J8Y F;  4EBK A;  3JRM O;  4YT2 A;  3LNR A;  3KMI A;  2XS1 A;  1NFO A;  3ECS A;  4OIR F;  4EWC A;  3Q6N A;  2R7U A;  1ZU5 A;  4NTB A;  2I8B A;  4FX5 A;  5E3C A;  3ZDL A;  1H9T A;  2ZXP A;  2XSE A;  5B1B C;  3MFN A;  1HE9 A;  4C3D A;  1CPQ A;  3G50 A;  5FCL A;  2KSF A;  1PCX A;  1PV3 A;  3T6B A;  2QTV A;  1GQA A;  2LD6 A;  2OJE D;  2A6H F;  2QUP A;  3L1M A;  3L8J A;  3PMR A;  5COF A;  3W8I A;  5JP7 A;  4KNV A;  3S27 A;  2UUI A;  2P0N A;  5DQZ A;  3S28 A;  1VTM P;  3DJU B;  3K66 A;  5CI9 A;  4BJ6 A;  5KYU B;  3U2L A;  1K40 A;  1BR1 A;  1V54 C;  5JVE A;  4CSA C;  3AG1 C;  3KYI A;  1WOL A;  4WGZ A;  5F28 E;  1GS9 A;  1VYI A;  1CGM E;  4U5C E;  1NU9 C;  3QTH A;  4FES A;  3C8G D;  3DZA A;  2EIM C;  2IBF A;  4GEH A;  4PFP A;  2OU6 A;  4UDV A;  2GA0 A;  4LLC A;  4U5F E;  4EBB A;  2YWA A;  4HEA J;  4C7O B;  1QQ3 A;  3HTK C;  3OEO A;  4WAB A;  1YYX A;  2F22 A;  3K33 A;  4XTK A;  3RVY A;  2VCB A;  3FXH A;  1ZYR F;  2NUP B;  2OOC A;  2Y3G A;  1TWC A;  4J7Y A;  4MTO A;  4U5D E;  3SXZ A;  5IY5 C;  4P9T A;  1TR2 A;  3LEO A;  1SZI A;  2ASR A;  3DI5 A;  4XQ1 A;  4H4K C;  3IQ5 A;  2GAQ A;  1U0B B;  2W4B A;  3EG9 B;  1K05 A;  3I5Q A;  3UGP A;  4YL0 A;  1V4A A;  1VLS A;  1L7C A;  1JPJ A;  3E9V A;  5A6A A;  3EPV A;  3JRT A;  4RBN A;  4ULV A;  1NFN A;  3G4X A;  2VB6 A;  4E17 A;  2L6F A;  3ITF A;  2J45 A;  2HKV A;  5JUA A;  1AUE A;  3NKD A;  1FR0 A;  1ORY A;  1Y4C A;  4JCZ A;  2YLD A;  1M57 C;  4PR9 A;  2WVO A;  2JX0 A;  1UG7 A;  4IAQ A;  1YA9 A;  2RSE B;  1O3U A;  4K1O A;  3JZ0 A;  4CS9 A;  4CS9 C;  3MBG A;  3FOO A;  5T3T A;  4G7Z F;  2WVN A;  1C02 A;  2FAP B;  2OEX A;  3AOU A;  3Q6M A;  2CNW A;  3M4B A;  3ZQY A;  1LVK A;  1OW8 A;  2IXP A;  3IHU A;  4XWJ A;  4DJ9 A;  2YL1 A;  2HMQ A;  2J7P A;  1TKN A;  4DVY P;  1TWA A;  3C7J A;  4XPW A;  2PF4 E;  3EFO B;  3L0I A;  4IJJ A;  5JT4 A;  3NMI A;  4H54 A;  4Q5S F;  5DS5 A;  1OKK D;  4Z9J A;  2XM0 A;  3RQE A;  3SZR A;  3T6G B;  3GEE A;  1Q0M A;  2YL0 A;  1BBH A;  4JIO A;  3SXY A;  4AE4 B;  2YZS A;  1NBB A;  4C3E A;  4IWB A;  1MND A;  4YT4 A;  5KYX A;  2C03 A;  4XPY A;  1LPE A;  1APC A;  1LI7 A;  1OCR C;  1IW7 F;  1LIH A;  3EHM A;  1T6Q A;  3F46 A;  4O6N A;  4KI2 A;  2YLI A;  2R25 A;  1VYK A;  1PD0 A;  4I3M A;  2NPU A;  4JRZ A;  3KYJ A;  4MTF A;  2HZ8 A;  4MVO A;  2JD3 A;  3RKO F;  2IM8 A;  3JYY A;  4YN0 B;  4MVS A;  1ZW2 A;  1M2V B;  3AQC A;  3V5Y A;  4BJ5 A;  3JCU Q;  3DJN B;  3FHD A;  3ASO C;  1ZHZ A;  5BQG A;  4N6C A;  2XLH A;  4I44 A;  5D91 A;  3RFY A;  3RQF A;  5BQI A;  2B0J A;  3AGU A;  3AQB A;  1AVO B;  3GM2 A;  3V7O A;  2HSQ A;  2W45 A;  4B6I A;  1OQC A;  1EI7 A;  1D1B A;  1DOV A;  1QVX A;  1YVI A;  2L81 A;  3KPH A;  3ZVR A;  4CSA A;  3EGX B;  5B1A C;  3S90 A;  2Y39 A;  3RW0 A;  1L3P A;  1M2O A;  1VMA A;  2G3V A;  4MVR A;  3U3B A;  2XL8 A;  3T9O A;  2Y3B A;  4OIO F;  1D0X A;  3UNG C;  1T01 A;  5HSW A;  3EH1 A;  3LES A;  2VCC A;  4E0I A;  4CDA A;  1A41 A;  1BZ4 A;  2P6V A;  2QE9 A;  3MLG A;  3WHN A;  2EIL C;  1RKE B;  1BR2 A;  3MX3 A;  4LDK A;  4MS2 A;  3E70 C;  2L9J A;  3I5P A;  1FTS A;  2Q7R A;  4E7S A;  3M79 A;  1Y6D A;  2CDQ A;  1LE2 A;  2R05 A;  4JW1 A;  2QNL A;  1EA8 A;  3EJN A;  2EPM X;  3CAX A;  4CX9 A;  1GGQ A;  4YWQ A;  4YK5 A;  1KU2 A;  2PP4 A;  5COG A;  5AC5 A;  1Q0F A;  2KC3 A;  2KQ9 A;  5E33 A;  2AVK A;  5AC4 A;  3FAJ A;  1DOW A;  3A11 A;  1HW1 A;  3W2V A;  2XLO A;  1ZHY A;  3G4Z A;  1QLE C;  1G4U S;  4OIN F;  1EKY A;  1NG1 A;  2L6H A;  3RF3 A;  3DXJ F;  2R9R B;  3RVZ A;  3T6J A;  4NTF A;  4G0H A;  4MND A;  1S7Z A;  3FAP B;  4G78 A;  2J8W A;  1YZA A;  2PNO A;  2X0C A;  2LSE A;  3ABK C;  3ZTM A;  1E2X A;  2R7Q A;  2LIG A;  4Q7C A;  2QLA A;  4JCH A;  4QI0 A;  1SMY F;  2R03 A;  3GWL A;  3I4U A;  3PDM P;  3C62 A;  3DD7 A;  1VLT A;  2EPK X;  5KYU A;  1U89 A;  4CJO A;  3DM9 B;  3DWW A;  3VM6 A;  3ZC4 A;  3O10 A;  4MVU A;  2CCY A;  1Z23 A;  3K1I A;  5JRA A;  3IQC A;  3U0C A;  1HW2 A;  1FAP B;  4DVZ A;  1WAT A;  256B A;  2Q3T A;  2D5R B;  3H2U A;  5A69 A;  3C18 A;  1Z6A A;  4KC9 A;  1A0B A;  3SXM A;  3PCV A;  3GAN A;  4EUK B;  1CGN A;  3JSE O;  4DRH B;  3W4Y A;  4K7B A;  4MW3 A;  4C7O A;  3HNI A;  5F5H A;  4O7G A;  2YEV A;  3SNH A;  2NSF A;  3M1C B;  2R7R A;  2NUP A;  3UMI A;  5JS5 A;  2PBE A;  4BG0 A;  5L3Q A;  2R7X A;  2X51 A;  2WVQ A;  3HKK A;  4CJG A;  1OCO C;  2BL2 A;  4BJ6 C;  3AG3 C;  3KH2 A;  3CEX A;  3S9O A;  5DS4 A;  1LS1 A;  4LER A;  1MMN A;  2WZF A;  3PHF 2;  3L34 A;  2ZXW C;  4Z9I A;  1YJG A;  1MMG A;  3NMK A;  1OKK A;  1RCP A;  1WGW A;  1YLM A;  2G3K A;  2YRF A;  3SXK A;  3OWT A;  4YJW A;  1A7V A;  2Q00 A;  4FWV A;  1ZW3 A;  4MW8 A;  3GWN A;  5CIV A;  1HE1 A;  1ORS C;  2CYD A;  1H6G A;  2YQY A;  3IQ6 A;  1UFB A;  2A0U A;  1I4Y A;  2EIN C;  4LAC B;  5L3V A;  2KW3 C;  3DMD A;  1TQG A;  3HNL A;  4AK9 A;  3B0V C;  4AX2 A;  4CDY A;  1JPN A;  3LJB A;  5EHH A;  3LLK A;  4PJN A;  1D1A A;  1FNT c;  1ZHT A;  2P7V A;  4GQH A;  2YL7 A;  5L0C A;  2XLD A;  3AGT A;  1OR2 A;  2IOQ A;  1S05 A;  4OD4 A;  1ZHX A;  2R7T A;  3X2Q C;  1O5H A;  4QDL A;  4E0H A;  3ASN C;  3UGO A;  2M4E A;  3GEH A;  3RIP A;  1E84 A;  1YAR O;  3ZG1 A;  2V26 A;  2H7B A;  1TWG A;  3QVZ A;  3LS1 A;  1OW6 A;  2G62 A;  4D4X A;  2R7W A;  1OW7 A;  1SR2 A;  4AE4 A;  1Q0G A;  3NYM A;  3NDB B;  3TJ6 A;  3ZSU A;  2XRH A;  3NMJ A;  4EHP A;  2H7O A;  2L6G A;  3QW1 A;  3EH2 A;  4JKV A;  4QI2 A;  1MQV A;  2DYS C;  3S29 A;  4ER9 A;  4G7O F;  4IAO A;  1I5N A;  1T5O A;  2Y3H A;  1O87 A;  4U5B E;  4OIQ F;  4R32 A;  1M2V A;  3CQZ A;  2CGE A;  5L0J A;  4U5E E;  4DRJ B;  3ATP A;  3O6X A;  2GWW A;  1FFH A;  1KNY A;  4LLE A;  4IRU A;  1U6H A;  2D4U A;  2HS5 A;  1BDJ B;  2MWQ A;  3HNJ A;  3EGX A;  3QZC A;  4JUR I;  1N1C A;  1OCC C;  2A0B A;  2B0H A;  4JEA A;  1NZE A;  1QSP A;  2LFF A;  2I15 A;  1RKC A;  2Y69 C;  2YHS A;  1PD1 A;  4PJM A;  2P61 A;  1K04 A;  3WAQ A;  3ZWI A;  3VAY A;  1A7E A;  4BPM A;  2L7A A;  2ZXO A;  1RKE A;  4CS8 A;  4J30 B;  2HUJ A;  1WN0 A;  4BJ5 C;  3C63 A;  1RJ9 B;  2W4M A;  1CPR A;  3FVY A;  1W2W A;  2PX0 A;  2WZL A;  2YVK A;  3LS0 A;  1SYQ A;  2XLE A;  4RDA A;  1MNE A;  5KYW A;  1GM5 A;  2ICW G;  2IXN A;  2NUT B;  5K0I A;  3TK0 A;  3HJC A;  3BEH A;  3Q7G A;  3VF0 A;  5DS6 A;  2XL4 A;  3B71 A;  3H2V A;  4U9D A;  4A2N B;  5DQT A;  5BQH A;  1FMW A;  2EPL X;  2XLV A;  2YL3 A;  3QW0 A;  4CDV A;  2MYS A;  3TUL A;  2XXA A;  2FFH A;  3A9C A;  1Z7Q c;  3U2M A;  2TMV P;  4MQ9 F;  1ST6 A;  1QZX A;  3EGD B;  2CW0 F;  5L0G A;  3S84 A;  1ZZP A;  3HLZ A;  3LUT B;  2EPN A;  1VB5 A;  4JJG A;  4P6I C;  2HJ3 A;  4DBQ A;  3GOR A;  3K6B A;  1D0Y A;  5L0H A;  4KNW A;  1T6U A;  2NG1 A;  2ZD9 A;  2AWY A;  3RQG A;  4I1O B;  2PFD A;  2Q9B A;  4HFK B;  1M56 C;  3UR3 C;  3M4C A;  3WG7 C;  3ABM C;  3ZQV A;  3RH3 A;  2KNH A;  2EIK C;  4PK4 A;  1B68 A;  5A6B A;  4JEB A;  4MVQ A;  2A68 F;  2VC9 A;  3C8Z A;  3O39 A;  1EQ1 A;  3FOP A;  2KJG A;  3JSZ A;  3ZTZ A;  2XM4 A;  4HE8 D;  2VAS A;  1E85 A;  2VH3 A;  1G5Z A;  5KYY A;  1XWJ A;  2A6E F;  2Z15 A;  1ZHW A;  4ANJ A;  1LI5 A;  2RD9 A;  3BRJ A;  4X0R A;  2DB4 A;  4O6M A;  2W9Y A;  3NRH A;  4GYT A;  5DLJ A;  1E86 A;  2J9U A;  2HMZ A;  3LAY A;  3UMK A;  3KKB A;  3H65 A;  4IAR A;  1H9G A;  1C17 M;  4PFO A;  2EPO A;  1LS4 A;  4U9E A;  5D92 A;  3SEO A;  5E3A A;  3TOL A;  1CGO A;  3VRC A;  3GM1 A;  3K1I C;  4Z9H A;  2H7V C;  4I1M A;  4NCQ A;  3K1H A;  1G4W R;  2HSB A;  4YL3 A;  2Q4F A;  4YT8 A;  4ZLC A;  4JTD B;  3C8G B;  4NQF A;  4L6R A;  3N24 A;  4O6Y A;  4BEM J;  1MMD A;  4IGG A;  4D4N A;  2WL8 A;  4NY3 A;  5A6B D;  3DM5 A;  5EK0 A;  1VOM A;  3U9M A;  5BUO A;  4W8K A;  4JTA B;  2HFI A;  2LP4 A;  3TD7 A;  2R7S A;  4U5G A;  3EG9 A;  3LLI A;  2UUH A;  1NSG B;  1YA7 O;  2EIJ C;  3IQT A;  3MYF A;  3KL4 A;  4XEF A;  3M15 A;  2AP3 A;  5FZT A;  3R7C A;  1HY5 A;  3TOM A;  1KTM A;  2R7V A;  4W8P A;  1D1C A;  1IZM A;  2J9V A;  4G7H F;  3S0X A;  2LK4 A;  5EGY A;  1Z3I X;  1V74 B;  5TJ5 E;  1E83 A;  4OIP F;  3U5S A;  1VK5 A;  2OG2 A;  5JLI A;  4CIH A;  2BE5 F;  4LDR A;  2VCA A;  3POV A;  1JMW A;  1RXQ A;  1V55 C;  1T9K A;  2P1A A;  4JE9 A;  1H7I A;  4MTG A;  1G8X A;  3B9Q A;  3TQO A;  4C3B A;  1ZU4 A;  4E18 A;  1XZP A;  2WB7 A;  2KK1 A;  2HV7 A;  2QY9 A;  2KYH A;  2IXM A;  4JC7 A;  5HV9 A;  3DE8 A;  3EFO A;  1ORJ A;  3O55 A;  3Q7L A;  4EBJ A;  2LFD A;  2A69 F;  1Z5Z A;  2R7O A;  4EKW A;  2AWC A;  3W2W A;  1LM3 B;  2YKZ A;  3JTL O;  4BJT A;  4A4A A;  1Q0D A;  2O9X A;  2YLG A;  3V5Z A;  4J32 B;  4AL0 A;  4N06 A;  4ULW A;  1JRA A;  2LCH A;  4NC3 A;  4O79 A;  3DAF A;  3X1O A;  5A6J A;  1TWH A;  4EIY A;  4BEJ A;  2A1D D;  2XL6 A;  3B0U X;  2BC5 A;  1JAF A;  3AJM A;  2DYR C;  2J46 A;  3F47 A;  3NKE A;  4BJ1 A;  2NSG A;  4RD9 A;  2OEV A;  3DAG A;  4IB4 A;  3U8V A;  5A6K A;  3JYH A;  3JT1 A;  3C8G A;  4DBR A;  2HV6 A;  3DKA A;  3SYN A;  4WJ0 A;  2XLM A;  3NYL A;  3US6 A;  2H8A A;  2E87 A;  3HNK A;  4DRI B;  2DGJ A;  3IPM O;  4DOZ A;  5KYY B;  1F1M A;  5E2Q A;  3RYL A;  3EZI A;  1RJ9 A;  2M64 A;  4PJJ A;  4CBE A;  4DXW A;  5B3I A;  5L0I A;  1D0Z A;  2LQG A;  1LE4 A;  4HFF B;  1Q0K A;  2XS8 A;  4MVZ A;  4OD5 A;  5CI8 A;  2NUT A;  1WAS A;  1HMD A;  1LKX A;  3GOD A;  4XEK A;  1I4Z A;  3R2P A;  3FMS A;  1R5I D;  3DE9 A;  5L0F A;  3NG1 A;  4K0D A;  1WWP A;  3B0P A;  1OXB A;  3N0T A;  4ONS A;  3FDQ A;  2GFH A;  2XLW A;  3EGD A;  3NYJ A;  1A7D A;  1TFO B;  2ZPA A;  2AU5 A;  5COM A;  4U5H A;  4YT5 A;  4CS8 C;  1WTY A;  4WGY A;  3UMH A;  2HJM A;  3B29 A;  2IYL D;  3CZ6 A;  1YZC A;  2C04 A;  3T4R A;  3GM3 A;  4PJL A;  5L0D A;  5KYX B;  1JOG A;  1XZQ A;  3K7D A;  2GDC A;  2OCC C;  3TJ5 A;  3J06 A;  4KBL A;  1ZVZ A;  1RMV A;  1FMV A;  4M63 A;  3LNM B;  3QMK A;  3EZH A;  5DVW A;  2FGY A;  4NTA A;  4XEV A;  3LEV A;  5F5F A;  1SF8 A;  3GEI A;  3U8P A;  1C03 A;  1NLX A;  2Q9A A;  2Y3D A;  2CNW D;  4XPX A;  1QPU A;  4AL1 A;  1NU7 D;  5GPG B;  2JPU A;  1OCZ C;  2J7P D;  4CIP A;  4N4W A;  3EHN A;  4YL1 A;  4Q4Z F;  2ETS A;  2OKU A;  2WZG A;  2J0W A;  2J0X A;  5AGF A;  2V3C C;  5JSL A;  3U3F A;  1QKR A;  3V5X A;  2OQM A;  3ABL C;  3W8H A;  4JTC B;  3IEE A;  5KYW B;  5T1D B;  3OA1 A;  1M6T A;  1YDI A;  4MVM A;  4P9F A;  1HMO A;  2IXO A;  3CSK A;  1AEP A;  1YYJ A;  3N2Z B;  4PAC A;  4LDQ A;  3VYW A;  2DI3 A;  1T6I A;  2J9W A;  4JZA A;  2OJQ A;  3WOD F;  3AG2 C;  3L8I A;  1OR3 A;  1YAU O;  4FAP B;  2R02 A; 
#chains in the Genus database with same CATH homology
 2KGO A;  4XLN F;  5T3W A;  4ZLD A;  1FFT C;  4E7Z A;  2XXA B;  3AG4 C;  1J8M F;  3SP1 A;  5KYN A;  2PX3 A;  4XLP F;  1MMA A;  2ZXR A;  3ZIB A;  4F4B A;  4JVS A;  5B3S C;  3EQL F;  1Z63 A;  2Q9C A;  1BR4 A;  4JJF A;  4CS7 A;  4YT2 A;  1J8Y F;  3LNR A;  3KMI A;  3ECS A;  4OIR F;  4EWC A;  3Q6N A;  2R7U A;  1ZU5 A;  2I8B A;  4FX5 A;  5E3C A;  2ZXP A;  2XSE A;  5B1B C;  4C3D A;  5FCL A;  1PCX A;  3T6B A;  2QTV A;  2A6H F;  3PMR A;  3W8I A;  4KNV A;  3S27 A;  5DQZ A;  3S28 A;  3DJU B;  3K66 A;  5CI9 A;  4BJ6 A;  5KYU B;  1BR1 A;  1V54 C;  4CSA C;  3AG1 C;  1VYI A;  4U5C E;  1NU9 C;  4FES A;  3DZA A;  2EIM C;  4GEH A;  4PFP A;  4LLC A;  4U5F E;  4EBB A;  4C7O B;  4HEA J;  3HTK C;  3OEO A;  3K33 A;  4XTK A;  1ZYR F;  2NUP B;  5IY5 C;  2Y3G A;  1TWC A;  4U5D E;  1TR2 A;  1SZI A;  4H4K C;  2W4B A;  3EG9 B;  3I5Q A;  3UGP A;  1JPJ A;  3E9V A;  3EPV A;  3JRT A;  4RBN A;  5KYY A;  2VB6 A;  3ITF A;  2J45 A;  3NKD A;  1M57 C;  2WVO A;  4CS9 C;  5T3T A;  4G7Z F;  2WVN A;  3Q6M A;  2CNW A;  1LVK A;  2IXP A;  4XWJ A;  2J7P A;  1TKN A;  4DVY P;  1TWA A;  2PF4 E;  3EFO B;  3L0I A;  4IJJ A;  4Q5S F;  5DS5 A;  1OKK D;  3SZR A;  4AE4 B;  4C3E A;  4YT4 A;  2YZS A;  5KYX A;  4IWB A;  1MND A;  2C03 A;  1OCR C;  1IW7 F;  3F46 A;  3EHM A;  4O6N A;  4KI2 A;  4I3M A;  1VYK A;  1PD0 A;  2JD3 A;  3RKO F;  4YN0 B;  4BJ5 A;  1M2V B;  3AQC A;  3JCU Q;  3DJN B;  3FHD A;  3ASO C;  1ZHZ A;  5D91 A;  3RFY A;  4I44 A;  2B0J A;  3AQB A;  3V7O A;  2W45 A;  4B6I A;  1D1B A;  3ZVR A;  2L81 A;  3EGX B;  5B1A C;  2Y39 A;  1M2O A;  1VMA A;  2G3V A;  4OIO F;  2Y3B A;  1D0X A;  3UNG C;  5HSW A;  3EH1 A;  3LES A;  2P6V A;  3MLG A;  2EIL C;  1BR2 A;  3MX3 A;  3E70 C;  2L9J A;  3I5P A;  1FTS A;  4E7S A;  2CDQ A;  4JW1 A;  3EJN A;  4YWQ A;  1KU2 A;  2PP4 A;  2KQ9 A;  5E33 A;  3FAJ A;  3W2V A;  1ZHY A;  1QLE C;  4OIN F;  1NG1 A;  3DXJ F;  3T6J A;  4G0H A;  4MND A;  1S7Z A;  2LSE A;  3ABK C;  2R7Q A;  4Q7C A;  4QI0 A;  4JCH A;  1SMY F;  3I4U A;  3DD7 A;  5KYU A;  3DM9 B;  3ZC4 A;  1Z23 A;  4DVZ A;  2Q3T A;  2D5R B;  1Z6A A;  4KC9 A;  3GAN A;  4K7B A;  4C7O A;  5F5H A;  4O7G A;  2YEV A;  3SNH A;  3M1C B;  2R7R A;  2NUP A;  3UMI A;  4BG0 A;  5L3Q A;  2R7X A;  2X51 A;  2WVQ A;  1OCO C;  4BJ6 C;  3AG3 C;  3KH2 A;  5DS4 A;  1LS1 A;  4LER A;  1MMN A;  2WZF A;  3PHF 2;  3L34 A;  2ZXW C;  1MMG A;  1OKK A;  1WGW A;  2G3K A;  3OWT A;  4YJW A;  4FWV A;  2EIN C;  4LAC B;  5L3V A;  2KW3 C;  3DMD A;  4AK9 A;  3B0V C;  4AX2 A;  1JPN A;  3LJB A;  5EHH A;  3LLK A;  4PJN A;  1D1A A;  1ZHT A;  2P7V A;  2IOQ A;  4OD4 A;  1ZHX A;  2R7T A;  3X2Q C;  1O5H A;  4QDL A;  3ASN C;  3UGO A;  2M4E A;  3RIP A;  3ZG1 A;  2V26 A;  2H7B A;  1TWG A;  3LS1 A;  2G62 A;  2R7W A;  4AE4 A;  3NYM A;  3NDB B;  3ZSU A;  2XRH A;  2H7O A;  3EH2 A;  4QI2 A;  2DYS C;  3S29 A;  4G7O F;  4IAO A;  2Y3H A;  1O87 A;  4U5B E;  4OIQ F;  1M2V A;  3CQZ A;  2CGE A;  4U5E E;  3O6X A;  1FFH A;  4LLE A;  4IRU A;  4JUR I;  2MWQ A;  3QZC A;  3EGX A;  1N1C A;  1OCC C;  1NZE A;  2Y69 C;  4PJM A;  2YHS A;  1PD1 A;  3VAY A;  2ZXO A;  4CS8 A;  4J30 B;  4BJ5 C;  1RJ9 B;  2W4M A;  3FVY A;  1W2W A;  2PX0 A;  2WZL A;  3LS0 A;  4RDA A;  5KYW A;  1MNE A;  2IXN A;  2NUT B;  3HJC A;  5DS6 A;  3Q7G A;  2XL4 A;  4A2N B;  5DQT A;  1FMW A;  2MYS A;  2XXA A;  2FFH A;  4MQ9 F;  1ST6 A;  1QZX A;  3EGD B;  2CW0 F;  4P6I C;  3HLZ A;  4JJG A;  4DBQ A;  3K6B A;  1D0Y A;  4KNW A;  2NG1 A;  4I1O B;  2PFD A;  2Q9B A;  4HFK B;  1M56 C;  3UR3 C;  3WG7 C;  3ABM C;  3RH3 A;  2KNH A;  2EIK C;  4PK4 A;  2A68 F;  3O39 A;  2KJG A;  3JSZ A;  4HE8 D;  2VAS A;  2VH3 A;  2A6E F;  2Z15 A;  1ZHW A;  4ANJ A;  4X0R A;  4O6M A;  2W9Y A;  3NRH A;  4GYT A;  5DLJ A;  2J9U A;  3LAY A;  3UMK A;  3KKB A;  3H65 A;  4PFO A;  5D92 A;  3SEO A;  5E3A A;  3K1I C;  2H7V C;  4I1M A;  3K1H A;  4YT8 A;  4ZLC A;  3N24 A;  4O6Y A;  1MMD A;  2WL8 A;  4NY3 A;  3DM5 A;  1VOM A;  5BUO A;  4W8K A;  3TD7 A;  2R7S A;  4U5G A;  3EG9 A;  3LLI A;  2EIJ C;  4CSA A;  3KL4 A;  2R7V A;  1D1C A;  1IZM A;  2J9V A;  4G7H F;  3S0X A;  5EGY A;  1Z3I X;  4OIP F;  1VK5 A;  2OG2 A;  4CIH A;  2BE5 F;  3POV A;  1V55 C;  4C3B A;  1G8X A;  3B9Q A;  1ZU4 A;  2WB7 A;  2HV7 A;  2QY9 A;  2IXM A;  3EFO A;  3Q7L A;  2A69 F;  1Z5Z A;  2R7O A;  3W2W A;  4BJT A;  2O9X A;  4J32 B;  4N06 A;  4ULW A;  3X1O A;  4O79 A;  3DAF A;  1TWH A;  4BEJ A;  2A1D D;  3B0U X;  3NKE A;  3F47 A;  4CS9 A;  2DYR C;  2J46 A;  4BJ1 A;  4RD9 A;  3DAG A;  3JYH A;  3JT1 A;  4DBR A;  2HV6 A;  3SYN A;  4WJ0 A;  3NYL A;  2E87 A;  2DGJ A;  4DOZ A;  5KYY B;  5E2Q A;  3RYL A;  3EZI A;  1RJ9 A;  4PJJ A;  4CBE A;  1D0Z A;  4HFF B;  4OD5 A;  5CI8 A;  2NUT A;  3GOD A;  1LKX A;  3NG1 A;  4K0D A;  3B0P A;  3N0T A;  3FDQ A;  2GFH A;  3EGD A;  3NYJ A;  2ZPA A;  4U5H A;  4YT5 A;  4CS8 C;  3UMH A;  2IYL D;  3CZ6 A;  3T4R A;  2C04 A;  4PJL A;  5KYX B;  3K7D A;  2OCC C;  4KBL A;  1FMV A;  4M63 A;  3QMK A;  3EZH A;  5DVW A;  2FGY A;  3LEV A;  5F5F A;  1SF8 A;  2Q9A A;  2Y3D A;  2CNW D;  1NU7 D;  1OCZ C;  2J7P D;  4Q4Z F;  3EHN A;  2WZG A;  2J0W A;  2J0X A;  2V3C C;  3W8H A;  3ABL C;  5KYW B;  3IEE A;  5T1D B;  3OA1 A;  2IXO A;  3CSK A;  3N2Z B;  3VYW A;  2J9W A;  4JZA A;  3WOD F;  3AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...