3OA1A

Crystal structure of phosphoprotein/protein p/protein m1 residues 69-297 from rabies virus reveals degradation to c-terminal domain only
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
104
structure length
102
Chain Sequence
EDDLSVEAEIAHQIAESFSKKYKFPSRSILLYNFEQLKMNLDDIVKEAKNVPGVTRLARDGSKLPLRCVLGWVALANSKKFQLLVESNKLSKIMQDDLNRYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of phosphoprotein/Protein P/Protein M1 residues 69-297 from Rabies virus reveals degradation to C-terminal domain only
rcsb
source organism Rabies virus strain pasteur vaccin
molecule tags Chaperone
molecule keywords Phosphoprotein
total genus 37
structure length 102
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3oa1A00
3OA1A 2WZLA 1VYIA
chains in the Genus database with same CATH superfamily
2CGEA 3AG3C 4BEMJ 1Y6DA 1I4ZA 3NYLA 3U2MA 3S29A 4AE4B 5T1DB 3I5PA 4U5HA 2YVKA 4GQHA 1C02A 3T6GB 4ANJA 4LDQA 4XEKA 4CS8C 1LS4A 1M6TA 4JTAB 1M57C 5L0HA 1H6GA 1ZU4A 2PP4A 2WB7A 1JOGA 2HMZA 2P0NA 5T3WA 3K66A 4CDVA 3U3FA 3UMKA 2KJGA 5AC5A 1ZYRF 4G0HA 5KYNA 4D4NA 1ZZPA 4U9DA 2J8WA 2Q9AA 4MTGA 4YT5A 2VCBA 2PX0A 1HE1A 1U6HA 2LIGA 5IY5C 3HNLA 2AWCA 3SEOA 1RKEB 2OU6A 5K0IA 4BJTA 5L0IA 5D92A 1T9KA 1QVXA 1TKNA 2OKUA 3UNGC 2VC9A 2PF4E 4HE8D 4WJ0A 3FDQA 1FMVA 5L0FA 2L9JA 1NLXA 3OA1A 3MYFA 5KYXB 5DQZA 4JURI 1OR2A 4DXWA 4IJJA 3B0UX 2R05A 4U5FE 5BQIA 1Z5ZA 3W8IA 4MTOA 1FR0A 4K7BA 2J46A 4QI0A 3T4RA 1NZEA 4N4WA 4AL1A 2KGOA 3S90A 3NDBB 3JSEO 4I1MA 1I5NA 3C8GB 2HSBA 2XLHA 3IQ6A 3TOLA 4GYTA 1HW1A 4CDYA 4FAPB 4ZLDA 4JEBA 1T6QA 1OCRC 1Q0MA 2RD9A 2ZD9A 3M4CA 4MVOA 4R32A 4C3DA 4XLPF 1TR2A 4PR9A 1TWHA 1LKXA 5E3AA 4LDRA 4WABA 4CSAA 2YL0A 2XL6A 2XM4A 2KSFA 1W2WA 1WTYA 3LLIA 3M1CB 3DAFA 4U5EE 1K05A 3EFOA 3B71A 4JIOA 4JTDB 1OCZC 3PMRA 1NU7D 3B29A 3SXMA 4JC7A 5L0JA 4J7YA 5JP7A 2YL1A 1SZIA 1E83A 1JMWA 4CS7A 2DB4A 3WODF 4D4XA 1NFNA 1S7ZA 3SXYA 3KPHA 5A6BD 2YL3A 4GEHA 4LERA 3LS0A 3EGDB 3WG7C 3U8PA 3L1MA 1UG7A 1T6IA 3L34A 2WZGA 3RKOF 2NUTA 3DM5A 4CIPA 2XXAA 1ORJA 3QW0A 1TFOB 1A41A 3M4BA 1LE2A 3UGOA 3JYYA 3W8HA 5DQTA 4CIHA 2OQMA 1SMYF 3HTKC 1LI5A 3IEEA 3KMIA 1VLSA 3GM3A 5BQHA 1YYXA 3A9CA 2R25A 3DJUB 2MWQA 3K1HA 3NYJA 1YA7O 1FAPB 3EGXA 3FAJA 4LLCA 3K1IC 1UFBA 4E7ZA 3L8JA 3G4XA 1VLTA 2KK1A 4C7OB 1OCCC 3NMKA 5E33A 3DE8A 1GS9A 4MQ9F 4P6IC 1JAFA 1T01A 1ZHYA 2PNOA 2VCCA 4YWQA 2KNHA 2FFHA 5AGFA 3HNJA 3TQOA 3X1OA 1NSGB 2KW3C 1JR8A 3AGUA 4JTCB 1TFKB 2NUPB 3ABLC 1Q0DA 3HKKA 2Q4FA 2QLAA 1WOLA 4RDAA 2PBEA 3EFOB 2ICWG 3FAPB 3M79A 4U5BE 3KL4A 1QSPA 4MVQA 5KYYB 2IXMA 1AEPA 1H9GA 1O5HA 2EIJC 4X0RA 3AGTA 4JE9A 4JVSA 1BZ4A 2PFDA 3EZIA 1VK5A 2XS8A 3DMDA 3TK0A 3NMIA 4E17A 2AWYA 4I3MA 4BG0A 2VASA 3EJNA 5BUOA 4YT2A 2W4BA 2XRHA 4O6NA 4BJ1A 2NSFA 1PCXA 4LACB 3FXHA 4EHPA 2H8AA 3MBGA 4PK4A 4IAOA 2J9UA 4O6MA 5JSLA 4YL3A 2CNWD 4Z9HA 3ZSUA 1VOMA 1ORYA 4FWVA 4KNWA 4AK9A 4MVRA 4PACA 2EIKC 4DRIB 3TD7A 4H4KC 4OD5A 1ORSC 4OIQF 4RBNA 5DVWA 4MW3A 3S9OA 1D0XA 3GEHA 3LNRA 3DE9A 1G4US 4IGGA 4U5DE 3SNHA 3ZTZA 2R7OA 3QZCA 3O55A 4DRHB 4MNDA 3DKAA 4JZAA 3S27A 4BJ6C 3MLGA 2NG1A 2BL2A 1VYIA 3EHMA 5F5HA 2A68F 3RH3A 2Q9BA 4AL0A 4C3BA 4Q4ZF 4JCZA 2XLMA 1EQ1A 3O10A 3RYLA 3DI5A 3DJNB 3PDMP 3B0VC 4KBLA 2B0JA 2QNLA 4B6IA 1FTSA 1HW2A 4AE4A 3Q6NA 4KNVA 5JVEA 2M4EA 1RXQA 1QLEC 3QVYA 1QZXA 2YLIA 3HLZA 5L0CA 3Q7LA 5A6BA 5A6AA 4YL0A 3VM6A 2D5RB 3GWNA 5KYUA 3HNIA 4P9FA 4U5CE 1ZHWA 4YT8A 4U5GA 4YL1A 1LE4A 4XEVA 2Y69C 5AC4A 3B0PA 2J45A 2OJQA 3ITFA 2R7TA 2XL8A 4O79A 2IOQA 3ECSA 1IW7F 5BQGA 4MVMA 1LPEA 1XWJA 2I8BA 5DS5A 3Q7GA 4Q7CA 3H65A 5HSWA 1RCPA 3ZQVA 4JW1A 2Y3DA 4MW8A 5KYWA 4IAQA 5COFA 1Z23A 1MMNA 1WGWA 3GEEA 4IWBA 1OR3A 1M2VB 1T5OA 4PJMA 4L6RA 4ER9A 1BR1A 2IXOA 1M2VA 2Z15A 3SXZA 1MMGA 1NFOA 1CPRA 2ASRA 5KYYA 1ZW3A 2YRFA 2VCAA 1N1CA 3AG4C 3CAXA 4WGZA 2R02A 3RQFA 3IQ5A 2C04A 1U0BB 4AX2A 4DOZA 2W4MA 1E86A 1T6UA 2LK4A 4J32B 1LIHA 1R5ID 4K0DA 2NUPA 4CDAA 3T9OA 2O9XA 2J9BA 2G3VA 4E0HA 1H9TA 4JCHA 3NKEA 2A6HF 2L7AA 3BEHA 3SYNA 1A7DA 2GFHA 2P7VA 3FOPA 4IRUA 2IBFA 5CI8A 4HEAJ 1OW6A 1CGME 1YDIA 3LNMB 3PCVA 2R7XA 3IQTA 2Y3BA 1APCA 3LAYA 3IHUA 3S0XA 4CS8A 1G5ZA 2JPUA 2XXAB 1QKRA 4WGYA 2G62A 2GDCA 3AG1C 3ATPA 2OJED 3C8GD 3TJ5A 4DBQA 1VTMP 2YZSA 4G78A 3VRCA 3C63A 1EA8A 3ZVRA 2YQYA 2WL8A 1S05A 3F47A 1Y4CA 3EH2A 3N24A 1OKKD 5DLJA 2IYLD 3O39A 1KU2A 1C03A 4N6CA 2R7SA 4XWJA 3OEOA 1E2XA 3JZ0A 2HKVA 3U9MA 3EG9A 4BEJA 3JCUQ 4XTKA 4DVYP 4Z9JA 2A69F 3G50A 4ULVA 2P6VA 2L6FA 3I5QA 4N06A 4NY3A 2YEVA 2X0CA 2J7PD 4ZLCA 2D4UA 3POVA 2DYSC 1NU9C 1ZHTA 1YZCA 2P1AA 3V5ZA 2YHSA 3R2PA 4ONSA 2B0HA 2H7VC 4KI2A 3RFYA 2TMVP 4U9EA 5FZTA 5A6JA 1D1BA 2HS5A 3SZRA 1WWPA 4OIRF 3LS1A 3RIPA 4E0IA 1XZPA 4BJ5C 4BJ5A 1IZMA 1DOWA 1M2OA 2HV7A 2V26A 2XLVA 3N0TA 2HJMA 4XPWA 4EWCA 5A6KA 4OIOF 1TWGA 3ZIBA 4C3EA 2Q7RA 2GAQA 3UGPA 2Q9CA 2R9RB 4O7GA 1MQVA 2Y39A 2LD6A 2CYDA 3DXJF 3KYJA 1A7VA 4JKVA 4W8PA 4BJ6A 1O3UA 3JRMO 3JYHA 3V7OA 3AQBA 4PJNA 4DVZA 3K6BA 1QQ3A 3KH2A 2R7RA 1Q0KA 1SF8A 3LEOA 1FMWA 3FMSA 2E87A 2HMQA 2ZPAA 3VF0A 1AUEA 1B68A 3DAGA 4MVZA 3ABKC 1DOVA 4NQFA 1HMDA 5F5FA 1RKCA 2CW0F 2H7BA 3M15A 2XLWA 5B1BC 3ZWIA 2EPOA 2QE9A 3HNKA 3NKDA 2H7OA 3EPVA 3R7CA 2X51A 4CJGA 1OQCA 5L0GA 2FGYA 3IQCA 1FNTc 1ZHZA 3G4ZA 4FESA 4F4BA 3DWWA 1KTMA 1RJ9B 2R03A 2OEVA 4J7TA 2QY9A 4QI2A 3TJ6A 1JRAA 3CSKA 3NMJA 4MS2A 2G3KA 2KQ9A 1HY5A 4OINF 4EBKA 2XL4A 1C17M 2F22A 2XS1A 4NTBA 1GQAA 3B9QA 1ST6A 3LLKA 4PJLA 4DRJB 256BA 2Q3TA 1EKYA 4NCQA 2NUTB 3EGDA 3RQEA 3HJCA 3K7DA 4J30B 5KYXA 3U9JA 3NRHA 4W8KA 2W45A 4KC9A 2IM8A 4G7HF 3QMKA 5CI9A 3V5XA 3UMIA 3X2QC 4EBBA 1I4YA 3CZ6A 5F28E 5L3QA 2VH3A 3FHDA 3OWTA 1WN0A 1Z6AA 2JD3A 3S84A 2HJ3A 1JPJA 2MYSA 2Q00A 1H7IA 1QPUA 3ZQYA 2ZXPA 3EGXB 1K40A 2L6HA 3DM9B 4H54A 1PV3A 3LEVA 3CEXA 3NG1A 5JLIA 4C7OA 4O6YA 1A7EA 2QUPA 3JSZA 2QTVA 5EGYA 1EI7A 3C8ZA 4HFKB 5E2QA 3ZG1A 1TWCA 3C62A 2I15A 4M63A 3JRTA 2YKZA 1GM5A 1O87A 2LFDA 3GEIA 1FFTC 4PFPA 1ZW2A 5JRAA 3U5SA 4LLEA 4JEAA 2IXPA 1XZQA 2YL7A 3PHF2 5B1AC 4P9TA 5A69A 3E70C 1VMAA 4RD9A 4G7OF 1BR4A 3EG9B 3ABMC 3EHNA 1K04A 3O6XA 1RKEA 1NBBA 2A1DD 3LESA 1E85A 4XPXA 1Q0GA 3GODA 4Z9IA 3AOUA 4CX9A 1CGOA 4IARA 1MNEA 1LI7A 1LM3B 2OOCA 2RSEB 3FVYA 3GWLA 4CBEA 5KYUB 5JUAA 5EK0A 1OXKA 1WASA 2BC5A 3JTLO 3NYMA 5FCLA 2EINC 2V3CC 2Y3HA 3GM1A 1OKKA 1R4TA 2W9YA 5CIVA 5D91A 1TQGA 4EBJA 3QTHA 2XLOA 3UR3C 3ASOC 1LS1A 3MX3A 2EPMX 3F46A 3C8GA 3QW1A 4OD4A 1YZAA 2XLEA 3ASNC 4OIPF 1YAUO 1MNDA 1ZVZA 2UUHA 3I4UA 1ZU5A 2AU5A 3RVYA 4CS9C 2HZ8A 2R7WA 3W2WA 5HV9A 5KYWB 4EUKB 2R7VA 1ZHXA 3IPMO 1G4WR 2XSEA 4XQ1A 1A0BA 1E84A 4XLNF 1M56C 2J0XA 3AQCA 2EILC 4ULWA 1HMOA 1Z3IX 2DI3A 1D1AA 2LP4A 3V5YA 3FOOA 1BR2A 1D0YA 2OCCC 3H2VA 3K33A 5GPGB 2OG2A 4UDVA 4Q5SF 2A6EF 2YLDA 2CNWA 3J06A 1TWAA 4JJGA 3GANA 3EQLF 1SYQA 4N6HA 4QDLA 5JS5A 1LVKA 2HSQA 5DS4A 1Z7Qc 2HFIA 1FFHA 2BE5F 2HUJA 2LCHA 2WZLA 2HV6A 3T6JA 2C03A 3TULA 4K1OA 1Q0FA 1YLMA 3U3BA 2LFFA 3RF3A 2WVNA 3ZDLA 3EH1A 5DS6A 3L8IA 2EPLX 4MVSA 1V54C 4FX5A 3BRJA 4A2NB 4DJ9A 1YYJA 3GORA 2NPUA 4G7ZF 3ZTMA 3C18A 1PD1A 3U0CA 4NTAA 4YK5A 3AJMA 2CDQA 1J8MF 1WATA 1YVIA 3KKBA 3LJBA 2AP3A 3KYIA 2CCYA 4E18A 2JX0A 4YT4A 1VYKA 4E7SA 3RW0A 2A0UA 4LDKA 3U8VA 3S28A 1SR2A 2P61A 4DBRA 5JT4A 2ZXRA 1OXBA 2WZFA 1G8XA 2EIMC 2GWWA 2VB6A 1HE9A 3WHNA 3AG2C 3RVZA 1YJGA 1YA9A 2EPNA 2ZXWC 3N2ZB 2Y3GA 1NG1A 3Q6MA 2IXNA 3CQZA 3SP1A 2KYHA 1V55C 2OEXA 4YJWA 3VAYA 1RMVA 1YARO 1CPQA 1D1CA 2EPKX 3MFNA 1L7CA 3DZAA 3K1IA 4HFFB 1OCOC 1OW8A 1V4AA 1L3PA 2UUIA 1V74B 4JRZA 3U2LA 4EIYA 4NC3A 2R7UA 5T3TA 1BDJB 2ZXOA 3JT1A 1GGQA 3MYIA 3TOMA 4CS9A 3QVZA 2J9WA 3C7JA 4CJOA 1AVOB 4A4AA 4MTFA 1U89A 2J0WA 3VYWA 3WAQA 1VB5A 2L6GA 2NSGA 2FAPB 3E9VA 1RJ9A 3LUTB 3W2VA 4YN0B 3ZC4A 3DD7A 3GM2A 4XEFA 3UMHA 1J8YF 2J9VA 5TJ5E 2M64A 3US6A 1OW7A 3W4YA 2R7QA 5EHHA 3RQGA 2XLDA 2LQGA 3A11A 5L3VA 2KC3A 2J7PA 2MHRA 1D0ZA 4JJFA 2DYRC 3SXKA 5B3SC 2L81A 2PX3A 2YWAA 4XPYA 3EZHA 4MVUA 5L0DA 4I44A 2GA0A 4PJJA 5E3CA 1JPNA 4PFOA 4EKWA 1KNYA 2DGJA 5B3IA 5COGA 1MMAA 3T6BA 3H2UA 4NTFA 2AVKA 4CSAC 2LSEA 2XM0A 1BBHA 2YLGA 3L0IA 1PD0A 4IB4A 4BPMA 1MMDA 2A0BA 1CGNA 5COMA 2WVOA 2WVQA 2ETSA 1Z63A 1F1MA 4I1OB
chains in the Genus database with same CATH topology
2CGEA 3AG3C 3NYLA 3S29A 4AE4B 5T1DB 3I5PA 4U5HA 4CS8C 1M57C 1ZU4A 2PP4A 2WB7A 5T3WA 3K66A 3UMKA 2KJGA 1ZYRF 4G0HA 5KYNA 2Q9AA 4YT5A 2PX0A 5IY5C 3SEOA 4BJTA 5D92A 1TKNA 3UNGC 2PF4E 4HE8D 4WJ0A 3FDQA 1FMVA 2L9JA 3OA1A 5KYXB 5DQZA 4JURI 3B0UX 4IJJA 4U5FE 1Z5ZA 3W8IA 4K7BA 2J46A 4QI0A 3T4RA 1NZEA 2KGOA 3NDBB 4I1MA 4GYTA 4ZLDA 1OCRC 4XLPF 4C3DA 1TR2A 1TWHA 1LKXA 5E3AA 4CSAA 1W2WA 3LLIA 3M1CB 3DAFA 4U5EE 3EFOA 1OCZC 3PMRA 1NU7D 1SZIA 4CS7A 3WODF 1S7ZA 4GEHA 4LERA 3LS0A 3EGDB 3WG7C 3L34A 2XXAA 3RKOF 2WZGA 2NUTA 3DM5A 3UGOA 3W8HA 5DQTA 4CIHA 1SMYF 3HTKC 3IEEA 3KMIA 3DJUB 2MWQA 3K1HA 3NYJA 3EGXA 3FAJA 4LLCA 3K1IC 4E7ZA 4C7OB 1OCCC 5E33A 4P6IC 4MQ9F 4YWQA 1ZHYA 2KNHA 2FFHA 3X1OA 2KW3C 2NUPB 3ABLC 4RDAA 3EFOB 4U5BE 3KL4A 5KYYB 2IXMA 1O5HA 2EIJC 4X0RA 4JVSA 2PFDA 3EZIA 1VK5A 3DMDA 4I3MA 4BG0A 2VASA 3EJNA 5BUOA 4YT2A 2W4BA 2XRHA 4O6NA 4BJ1A 1PCXA 4LACB 4PK4A 4IAOA 2J9UA 4O6MA 2CNWD 3ZSUA 1VOMA 4FWVA 4KNWA 4AK9A 2EIKC 3TD7A 4H4KC 4OD5A 4OIQF 4RBNA 5DVWA 1D0XA 3LNRA 4U5DE 3SNHA 2R7OA 3QZCA 4MNDA 4JZAA 3S27A 4BJ6C 3MLGA 2NG1A 1VYIA 3EHMA 5F5HA 2A68F 3RH3A 2Q9BA 4Q4ZF 4C3BA 2R7SA 3RYLA 3DJNB 3B0VC 4KBLA 2B0JA 4B6IA 1FTSA 4AE4A 3Q6NA 4KNVA 2M4EA 1QLEC 1QZXA 3HLZA 3Q7LA 2D5RB 5KYUA 4U5CE 1ZHWA 4YT8A 4U5GA 2Y69C 3B0PA 2J45A 3ITFA 2R7TA 4O79A 2IOQA 3ECSA 1IW7F 2I8BA 5DS5A 3Q7GA 4Q7CA 3H65A 5HSWA 4JW1A 2Y3DA 5KYWA 1Z23A 1MMNA 1WGWA 4IWBA 1M2VB 4PJMA 1BR1A 2IXOA 1M2VA 2Z15A 1MMGA 5KYYA 1N1CA 3AG4C 2C04A 4AX2A 4DOZA 2W4MA 4J32B 4K0DA 2NUPA 2O9XA 2G3VA 4JCHA 3NKEA 2A6HF 3SYNA 2GFHA 2P7VA 4IRUA 5CI8A 4HEAJ 2R7XA 2Y3BA 3LAYA 3S0XA 4CS8A 2XXAB 2G62A 3AG1C 4DBQA 2YZSA 3ZVRA 2WL8A 3F47A 3N24A 3EH2A 1OKKD 5DLJA 2IYLD 3O39A 1KU2A 4XWJA 3OEOA 3EG9A 4BEJA 3JCUQ 4XTKA 4DVYP 2A69F 2P6VA 3I5QA 5FCLA 4N06A 4NY3A 2YEVA 4ZLCA 2J7PD 3POVA 2DYSC 1NU9C 1ZHTA 2YHSA 2H7VC 4KI2A 3RFYA 1D1BA 3SZRA 4OIRF 3RIPA 3LS1A 4BJ5C 4ANJA 4BJ5A 1IZMA 1M2OA 2HV7A 3N0TA 2V26A 4EWCA 4OIOF 1TWGA 3ZIBA 4C3EA 2Q9CA 4O7GA 2Y39A 3DXJF 4BJ6A 3JYHA 3V7OA 3AQBA 4PJNA 4DVZA 3K6BA 3KH2A 2R7RA 1SF8A 1FMWA 2E87A 2ZPAA 3DAGA 3ABKC 5F5FA 2CW0F 2H7BA 5B1BC 3NKDA 2H7OA 3EPVA 2X51A 2FGYA 1ZHZA 4FESA 4F4BA 1RJ9B 2QY9A 4QI2A 3CSKA 2G3KA 2KQ9A 4OINF 2XL4A 3B9QA 1ST6A 3LLKA 4PJLA 2Q3TA 2NUTB 3EGDA 3HJCA 3K7DA 4J30B 5KYXA 3NRHA 4W8KA 2W45A 4KC9A 4G7HF 3QMKA 5CI9A 3UMIA 3X2QC 4EBBA 3CZ6A 5L3QA 2VH3A 3FHDA 3OWTA 1Z6AA 2JD3A 1JPJA 2MYSA 2ZXPA 3EGXB 3DM9B 3LEVA 3NG1A 4C7OA 4O6YA 3JSZA 2QTVA 5EGYA 5E2QA 3ZG1A 4HFKB 1TWCA 4M63A 3JRTA 1O87A 4PFPA 1FFTC 4LLEA 2IXPA 3PHF2 5B1AC 3E70C 1VMAA 4RD9A 4G7OF 1BR4A 3EG9B 3ABMC 3EHNA 3O6XA 2A1DD 3LESA 3GODA 1MNEA 4CBEA 3FVYA 5KYUB 3NYMA 2V3CC 2EINC 2Y3HA 1OKKA 2W9YA 5D91A 3UR3C 3ASOC 1LS1A 3MX3A 3F46A 4OD4A 3ASNC 4OIPF 1MNDA 3I4UA 1ZU5A 4CS9C 2R7WA 3W2WA 5KYWB 1ZHXA 2XSEA 4XLNF 1M56C 2J0XA 3AQCA 2EILC 4ULWA 1Z3IX 1D1AA 3K33A 1BR2A 1D0YA 2OCCC 2OG2A 4Q5SF 2A6EF 2CNWA 1TWAA 4JJGA 3GANA 3EQLF 4QDLA 1LVKA 5DS4A 1FFHA 2BE5F 2WZLA 2HV6A 3T6JA 2C03A 2WVNA 3EH1A 5DS6A 1V54C 4FX5A 4A2NB 4G7ZF 1PD1A 1J8MF 2CDQA 3KKBA 3LJBA 4YT4A 1VYKA 4E7SA 3S28A 4DBRA 2ZXRA 2WZFA 1G8XA 2EIMC 2VB6A 3AG2C 2ZXWC 3N2ZB 2Y3GA 1NG1A 3Q6MA 2IXNA 3CQZA 3SP1A 3VAYA 1V55C 4YJWA 1D1CA 4HFFB 3DZAA 1OCOC 2R7VA 2R7UA 5T3TA 2ZXOA 3JT1A 4CS9A 2J9WA 3VYWA 2J0WA 3E9VA 1RJ9A 3W2VA 4YN0B 3ZC4A 3DD7A 3UMHA 1J8YF 2J9VA 5EHHA 2R7QA 5L3VA 2J7PA 4JJFA 1D0ZA 5B3SC 2DYRC 3UGPA 2L81A 2PX3A 3EZHA 4I44A 4PJJA 5E3CA 1JPNA 4PFOA 2DGJA 1MMAA 3T6BA 4CSAC 2LSEA 3L0IA 1PD0A 1MMDA 2WVOA 2WVQA 1Z63A 4I1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA1 A;  2WZL A;  1VYI A; 
#chains in the Genus database with same CATH topology
 2CGE A;  3AG3 C;  4BEM J;  1Y6D A;  1I4Z A;  3NYL A;  3U2M A;  3S29 A;  4AE4 B;  5T1D B;  3I5P A;  4U5H A;  2YVK A;  4GQH A;  1C02 A;  3T6G B;  4ANJ A;  4LDQ A;  4XEK A;  4CS8 C;  1LS4 A;  1M6T A;  4JTA B;  1M57 C;  5L0H A;  1H6G A;  1ZU4 A;  2PP4 A;  2WB7 A;  1JOG A;  2HMZ A;  2P0N A;  5T3W A;  3K66 A;  4CDV A;  3U3F A;  3UMK A;  2KJG A;  5AC5 A;  1ZYR F;  4G0H A;  5KYN A;  4D4N A;  1ZZP A;  4U9D A;  2J8W A;  2Q9A A;  4MTG A;  4YT5 A;  2VCB A;  2PX0 A;  1HE1 A;  1U6H A;  2LIG A;  5IY5 C;  3HNL A;  2AWC A;  3SEO A;  1RKE B;  2OU6 A;  5K0I A;  4BJT A;  5L0I A;  5D92 A;  1T9K A;  1QVX A;  1TKN A;  2OKU A;  3UNG C;  2VC9 A;  2PF4 E;  4HE8 D;  4WJ0 A;  3FDQ A;  1FMV A;  5L0F A;  2L9J A;  1NLX A;  3OA1 A;  3MYF A;  5KYX B;  5DQZ A;  4JUR I;  1OR2 A;  4DXW A;  4IJJ A;  3B0U X;  2R05 A;  4U5F E;  5BQI A;  1Z5Z A;  3W8I A;  4MTO A;  1FR0 A;  4K7B A;  2J46 A;  4QI0 A;  3T4R A;  1NZE A;  4N4W A;  4AL1 A;  2KGO A;  3S90 A;  3NDB B;  3JSE O;  4I1M A;  1I5N A;  3C8G B;  2HSB A;  2XLH A;  3IQ6 A;  3TOL A;  4GYT A;  1HW1 A;  4CDY A;  4FAP B;  4ZLD A;  4JEB A;  1T6Q A;  1OCR C;  1Q0M A;  2RD9 A;  2ZD9 A;  3M4C A;  4MVO A;  4R32 A;  4C3D A;  4XLP F;  1TR2 A;  4PR9 A;  1TWH A;  1LKX A;  5E3A A;  4LDR A;  4WAB A;  4CSA A;  2YL0 A;  2XL6 A;  2XM4 A;  2KSF A;  1W2W A;  1WTY A;  3LLI A;  3M1C B;  3DAF A;  4U5E E;  1K05 A;  3EFO A;  3B71 A;  4JIO A;  4JTD B;  1OCZ C;  3PMR A;  1NU7 D;  3B29 A;  3SXM A;  4JC7 A;  5L0J A;  4J7Y A;  5JP7 A;  2YL1 A;  1SZI A;  1E83 A;  1JMW A;  4CS7 A;  2DB4 A;  3WOD F;  4D4X A;  1NFN A;  1S7Z A;  3SXY A;  3KPH A;  5A6B D;  2YL3 A;  4GEH A;  4LER A;  3LS0 A;  3EGD B;  3WG7 C;  3U8P A;  3L1M A;  1UG7 A;  1T6I A;  3L34 A;  2WZG A;  3RKO F;  2NUT A;  3DM5 A;  4CIP A;  2XXA A;  1ORJ A;  3QW0 A;  1TFO B;  1A41 A;  3M4B A;  1LE2 A;  3UGO A;  3JYY A;  3W8H A;  5DQT A;  4CIH A;  2OQM A;  1SMY F;  3HTK C;  1LI5 A;  3IEE A;  3KMI A;  1VLS A;  3GM3 A;  5BQH A;  1YYX A;  3A9C A;  2R25 A;  3DJU B;  2MWQ A;  3K1H A;  3NYJ A;  1YA7 O;  1FAP B;  3EGX A;  3FAJ A;  4LLC A;  3K1I C;  1UFB A;  4E7Z A;  3L8J A;  3G4X A;  1VLT A;  2KK1 A;  4C7O B;  1OCC C;  3NMK A;  5E33 A;  3DE8 A;  1GS9 A;  4MQ9 F;  4P6I C;  1JAF A;  1T01 A;  1ZHY A;  2PNO A;  2VCC A;  4YWQ A;  2KNH A;  2FFH A;  5AGF A;  3HNJ A;  3TQO A;  3X1O A;  1NSG B;  2KW3 C;  1JR8 A;  3AGU A;  4JTC B;  1TFK B;  2NUP B;  3ABL C;  1Q0D A;  3HKK A;  2Q4F A;  2QLA A;  1WOL A;  4RDA A;  2PBE A;  3EFO B;  2ICW G;  3FAP B;  3M79 A;  4U5B E;  3KL4 A;  1QSP A;  4MVQ A;  5KYY B;  2IXM A;  1AEP A;  1H9G A;  1O5H A;  2EIJ C;  4X0R A;  3AGT A;  4JE9 A;  4JVS A;  1BZ4 A;  2PFD A;  3EZI A;  1VK5 A;  2XS8 A;  3DMD A;  3TK0 A;  3NMI A;  4E17 A;  2AWY A;  4I3M A;  4BG0 A;  2VAS A;  3EJN A;  5BUO A;  4YT2 A;  2W4B A;  2XRH A;  4O6N A;  4BJ1 A;  2NSF A;  1PCX A;  4LAC B;  3FXH A;  4EHP A;  2H8A A;  3MBG A;  4PK4 A;  4IAO A;  2J9U A;  4O6M A;  5JSL A;  4YL3 A;  2CNW D;  4Z9H A;  3ZSU A;  1VOM A;  1ORY A;  4FWV A;  4KNW A;  4AK9 A;  4MVR A;  4PAC A;  2EIK C;  4DRI B;  3TD7 A;  4H4K C;  4OD5 A;  1ORS C;  4OIQ F;  4RBN A;  5DVW A;  4MW3 A;  3S9O A;  1D0X A;  3GEH A;  3LNR A;  3DE9 A;  1G4U S;  4IGG A;  4U5D E;  3SNH A;  3ZTZ A;  2R7O A;  3QZC A;  3O55 A;  4DRH B;  4MND A;  3DKA A;  4JZA A;  3S27 A;  4BJ6 C;  3MLG A;  2NG1 A;  2BL2 A;  1VYI A;  3EHM A;  5F5H A;  2A68 F;  3RH3 A;  2Q9B A;  4AL0 A;  4C3B A;  4Q4Z F;  4JCZ A;  2XLM A;  1EQ1 A;  3O10 A;  3RYL A;  3DI5 A;  3DJN B;  3PDM P;  3B0V C;  4KBL A;  2B0J A;  2QNL A;  4B6I A;  1FTS A;  1HW2 A;  4AE4 A;  3Q6N A;  4KNV A;  5JVE A;  2M4E A;  1RXQ A;  1QLE C;  3QVY A;  1QZX A;  2YLI A;  3HLZ A;  5L0C A;  3Q7L A;  5A6B A;  5A6A A;  4YL0 A;  3VM6 A;  2D5R B;  3GWN A;  5KYU A;  3HNI A;  4P9F A;  4U5C E;  1ZHW A;  4YT8 A;  4U5G A;  4YL1 A;  1LE4 A;  4XEV A;  2Y69 C;  5AC4 A;  3B0P A;  2J45 A;  2OJQ A;  3ITF A;  2R7T A;  2XL8 A;  4O79 A;  2IOQ A;  3ECS A;  1IW7 F;  5BQG A;  4MVM A;  1LPE A;  1XWJ A;  2I8B A;  5DS5 A;  3Q7G A;  4Q7C A;  3H65 A;  5HSW A;  1RCP A;  3ZQV A;  4JW1 A;  2Y3D A;  4MW8 A;  5KYW A;  4IAQ A;  5COF A;  1Z23 A;  1MMN A;  1WGW A;  3GEE A;  4IWB A;  1OR3 A;  1M2V B;  1T5O A;  4PJM A;  4L6R A;  4ER9 A;  1BR1 A;  2IXO A;  1M2V A;  2Z15 A;  3SXZ A;  1MMG A;  1NFO A;  1CPR A;  2ASR A;  5KYY A;  1ZW3 A;  2YRF A;  2VCA A;  1N1C A;  3AG4 C;  3CAX A;  4WGZ A;  2R02 A;  3RQF A;  3IQ5 A;  2C04 A;  1U0B B;  4AX2 A;  4DOZ A;  2W4M A;  1E86 A;  1T6U A;  2LK4 A;  4J32 B;  1LIH A;  1R5I D;  4K0D A;  2NUP A;  4CDA A;  3T9O A;  2O9X A;  2J9B A;  2G3V A;  4E0H A;  1H9T A;  4JCH A;  3NKE A;  2A6H F;  2L7A A;  3BEH A;  3SYN A;  1A7D A;  2GFH A;  2P7V A;  3FOP A;  4IRU A;  2IBF A;  5CI8 A;  4HEA J;  1OW6 A;  1CGM E;  1YDI A;  3LNM B;  3PCV A;  2R7X A;  3IQT A;  2Y3B A;  1APC A;  3LAY A;  3IHU A;  3S0X A;  4CS8 A;  1G5Z A;  2JPU A;  2XXA B;  1QKR A;  4WGY A;  2G62 A;  2GDC A;  3AG1 C;  3ATP A;  2OJE D;  3C8G D;  3TJ5 A;  4DBQ A;  1VTM P;  2YZS A;  4G78 A;  3VRC A;  3C63 A;  1EA8 A;  3ZVR A;  2YQY A;  2WL8 A;  1S05 A;  3F47 A;  1Y4C A;  3EH2 A;  3N24 A;  1OKK D;  5DLJ A;  2IYL D;  3O39 A;  1KU2 A;  1C03 A;  4N6C A;  2R7S A;  4XWJ A;  3OEO A;  1E2X A;  3JZ0 A;  2HKV A;  3U9M A;  3EG9 A;  4BEJ A;  3JCU Q;  4XTK A;  4DVY P;  4Z9J A;  2A69 F;  3G50 A;  4ULV A;  2P6V A;  2L6F A;  3I5Q A;  4N06 A;  4NY3 A;  2YEV A;  2X0C A;  2J7P D;  4ZLC A;  2D4U A;  3POV A;  2DYS C;  1NU9 C;  1ZHT A;  1YZC A;  2P1A A;  3V5Z A;  2YHS A;  3R2P A;  4ONS A;  2B0H A;  2H7V C;  4KI2 A;  3RFY A;  2TMV P;  4U9E A;  5FZT A;  5A6J A;  1D1B A;  2HS5 A;  3SZR A;  1WWP A;  4OIR F;  3LS1 A;  3RIP A;  4E0I A;  1XZP A;  4BJ5 C;  4BJ5 A;  1IZM A;  1DOW A;  1M2O A;  2HV7 A;  2V26 A;  2XLV A;  3N0T A;  2HJM A;  4XPW A;  4EWC A;  5A6K A;  4OIO F;  1TWG A;  3ZIB A;  4C3E A;  2Q7R A;  2GAQ A;  3UGP A;  2Q9C A;  2R9R B;  4O7G A;  1MQV A;  2Y39 A;  2LD6 A;  2CYD A;  3DXJ F;  3KYJ A;  1A7V A;  4JKV A;  4W8P A;  4BJ6 A;  1O3U A;  3JRM O;  3JYH A;  3V7O A;  3AQB A;  4PJN A;  4DVZ A;  3K6B A;  1QQ3 A;  3KH2 A;  2R7R A;  1Q0K A;  1SF8 A;  3LEO A;  1FMW A;  3FMS A;  2E87 A;  2HMQ A;  2ZPA A;  3VF0 A;  1AUE A;  1B68 A;  3DAG A;  4MVZ A;  3ABK C;  1DOV A;  4NQF A;  1HMD A;  5F5F A;  1RKC A;  2CW0 F;  2H7B A;  3M15 A;  2XLW A;  5B1B C;  3ZWI A;  2EPO A;  2QE9 A;  3HNK A;  3NKD A;  2H7O A;  3EPV A;  3R7C A;  2X51 A;  4CJG A;  1OQC A;  5L0G A;  2FGY A;  3IQC A;  1FNT c;  1ZHZ A;  3G4Z A;  4FES A;  4F4B A;  3DWW A;  1KTM A;  1RJ9 B;  2R03 A;  2OEV A;  4J7T A;  2QY9 A;  4QI2 A;  3TJ6 A;  1JRA A;  3CSK A;  3NMJ A;  4MS2 A;  2G3K A;  2KQ9 A;  1HY5 A;  4OIN F;  4EBK A;  2XL4 A;  1C17 M;  2F22 A;  2XS1 A;  4NTB A;  1GQA A;  3B9Q A;  1ST6 A;  3LLK A;  4PJL A;  4DRJ B;  256B A;  2Q3T A;  1EKY A;  4NCQ A;  2NUT B;  3EGD A;  3RQE A;  3HJC A;  3K7D A;  4J30 B;  5KYX A;  3U9J A;  3NRH A;  4W8K A;  2W45 A;  4KC9 A;  2IM8 A;  4G7H F;  3QMK A;  5CI9 A;  3V5X A;  3UMI A;  3X2Q C;  4EBB A;  1I4Y A;  3CZ6 A;  5F28 E;  5L3Q A;  2VH3 A;  3FHD A;  3OWT A;  1WN0 A;  1Z6A A;  2JD3 A;  3S84 A;  2HJ3 A;  1JPJ A;  2MYS A;  2Q00 A;  1H7I A;  1QPU A;  3ZQY A;  2ZXP A;  3EGX B;  1K40 A;  2L6H A;  3DM9 B;  4H54 A;  1PV3 A;  3LEV A;  3CEX A;  3NG1 A;  5JLI A;  4C7O A;  4O6Y A;  1A7E A;  2QUP A;  3JSZ A;  2QTV A;  5EGY A;  1EI7 A;  3C8Z A;  4HFK B;  5E2Q A;  3ZG1 A;  1TWC A;  3C62 A;  2I15 A;  4M63 A;  3JRT A;  2YKZ A;  1GM5 A;  1O87 A;  2LFD A;  3GEI A;  1FFT C;  4PFP A;  1ZW2 A;  5JRA A;  3U5S A;  4LLE A;  4JEA A;  2IXP A;  1XZQ A;  2YL7 A;  3PHF 2;  5B1A C;  4P9T A;  5A69 A;  3E70 C;  1VMA A;  4RD9 A;  4G7O F;  1BR4 A;  3EG9 B;  3ABM C;  3EHN A;  1K04 A;  3O6X A;  1RKE A;  1NBB A;  2A1D D;  3LES A;  1E85 A;  4XPX A;  1Q0G A;  3GOD A;  4Z9I A;  3AOU A;  4CX9 A;  1CGO A;  4IAR A;  1MNE A;  1LI7 A;  1LM3 B;  2OOC A;  2RSE B;  3FVY A;  3GWL A;  4CBE A;  5KYU B;  5JUA A;  5EK0 A;  1OXK A;  1WAS A;  2BC5 A;  3JTL O;  3NYM A;  5FCL A;  2EIN C;  2V3C C;  2Y3H A;  3GM1 A;  1OKK A;  1R4T A;  2W9Y A;  5CIV A;  5D91 A;  1TQG A;  4EBJ A;  3QTH A;  2XLO A;  3UR3 C;  3ASO C;  1LS1 A;  3MX3 A;  2EPM X;  3F46 A;  3C8G A;  3QW1 A;  4OD4 A;  1YZA A;  2XLE A;  3ASN C;  4OIP F;  1YAU O;  1MND A;  1ZVZ A;  2UUH A;  3I4U A;  1ZU5 A;  2AU5 A;  3RVY A;  4CS9 C;  2HZ8 A;  2R7W A;  3W2W A;  5HV9 A;  5KYW B;  4EUK B;  2R7V A;  1ZHX A;  3IPM O;  1G4W R;  2XSE A;  4XQ1 A;  1A0B A;  1E84 A;  4XLN F;  1M56 C;  2J0X A;  3AQC A;  2EIL C;  4ULW A;  1HMO A;  1Z3I X;  2DI3 A;  1D1A A;  2LP4 A;  3V5Y A;  3FOO A;  1BR2 A;  1D0Y A;  2OCC C;  3H2V A;  3K33 A;  5GPG B;  2OG2 A;  4UDV A;  4Q5S F;  2A6E F;  2YLD A;  2CNW A;  3J06 A;  1TWA A;  4JJG A;  3GAN A;  3EQL F;  1SYQ A;  4N6H A;  4QDL A;  5JS5 A;  1LVK A;  2HSQ A;  5DS4 A;  1Z7Q c;  2HFI A;  1FFH A;  2BE5 F;  2HUJ A;  2LCH A;  2WZL A;  2HV6 A;  3T6J A;  2C03 A;  3TUL A;  4K1O A;  1Q0F A;  1YLM A;  3U3B A;  2LFF A;  3RF3 A;  2WVN A;  3ZDL A;  3EH1 A;  5DS6 A;  3L8I A;  2EPL X;  4MVS A;  1V54 C;  4FX5 A;  3BRJ A;  4A2N B;  4DJ9 A;  1YYJ A;  3GOR A;  2NPU A;  4G7Z F;  3ZTM A;  3C18 A;  1PD1 A;  3U0C A;  4NTA A;  4YK5 A;  3AJM A;  2CDQ A;  1J8M F;  1WAT A;  1YVI A;  3KKB A;  3LJB A;  2AP3 A;  3KYI A;  2CCY A;  4E18 A;  2JX0 A;  4YT4 A;  1VYK A;  4E7S A;  3RW0 A;  2A0U A;  4LDK A;  3U8V A;  3S28 A;  1SR2 A;  2P61 A;  4DBR A;  5JT4 A;  2ZXR A;  1OXB A;  2WZF A;  1G8X A;  2EIM C;  2GWW A;  2VB6 A;  1HE9 A;  3WHN A;  3AG2 C;  3RVZ A;  1YJG A;  1YA9 A;  2EPN A;  2ZXW C;  3N2Z B;  2Y3G A;  1NG1 A;  3Q6M A;  2IXN A;  3CQZ A;  3SP1 A;  2KYH A;  1V55 C;  2OEX A;  4YJW A;  3VAY A;  1RMV A;  1YAR O;  1CPQ A;  1D1C A;  2EPK X;  3MFN A;  1L7C A;  3DZA A;  3K1I A;  4HFF B;  1OCO C;  1OW8 A;  1V4A A;  1L3P A;  2UUI A;  1V74 B;  4JRZ A;  3U2L A;  4EIY A;  4NC3 A;  2R7U A;  5T3T A;  1BDJ B;  2ZXO A;  3JT1 A;  1GGQ A;  3MYI A;  3TOM A;  4CS9 A;  3QVZ A;  2J9W A;  3C7J A;  4CJO A;  1AVO B;  4A4A A;  4MTF A;  1U89 A;  2J0W A;  3VYW A;  3WAQ A;  1VB5 A;  2L6G A;  2NSG A;  2FAP B;  3E9V A;  1RJ9 A;  3LUT B;  3W2V A;  4YN0 B;  3ZC4 A;  3DD7 A;  3GM2 A;  4XEF A;  3UMH A;  1J8Y F;  2J9V A;  5TJ5 E;  2M64 A;  3US6 A;  1OW7 A;  3W4Y A;  2R7Q A;  5EHH A;  3RQG A;  2XLD A;  2LQG A;  3A11 A;  5L3V A;  2KC3 A;  2J7P A;  2MHR A;  1D0Z A;  4JJF A;  2DYR C;  3SXK A;  5B3S C;  2L81 A;  2PX3 A;  2YWA A;  4XPY A;  3EZH A;  4MVU A;  5L0D A;  4I44 A;  2GA0 A;  4PJJ A;  5E3C A;  1JPN A;  4PFO A;  4EKW A;  1KNY A;  2DGJ A;  5B3I A;  5COG A;  1MMA A;  3T6B A;  3H2U A;  4NTF A;  2AVK A;  4CSA C;  2LSE A;  2XM0 A;  1BBH A;  2YLG A;  3L0I A;  1PD0 A;  4IB4 A;  4BPM A;  1MMD A;  2A0B A;  1CGN A;  5COM A;  2WVO A;  2WVQ A;  2ETS A;  1Z63 A;  1F1M A;  4I1O B; 
#chains in the Genus database with same CATH homology
 2CGE A;  3AG3 C;  3NYL A;  3S29 A;  4AE4 B;  5T1D B;  3I5P A;  4U5H A;  4CS8 C;  1M57 C;  1ZU4 A;  2PP4 A;  2WB7 A;  5T3W A;  3K66 A;  3UMK A;  2KJG A;  1ZYR F;  4G0H A;  5KYN A;  2Q9A A;  4YT5 A;  2PX0 A;  5IY5 C;  3SEO A;  4BJT A;  5D92 A;  1TKN A;  3UNG C;  2PF4 E;  4HE8 D;  4WJ0 A;  3FDQ A;  1FMV A;  2L9J A;  3OA1 A;  5KYX B;  5DQZ A;  4JUR I;  3B0U X;  4IJJ A;  4U5F E;  1Z5Z A;  3W8I A;  4K7B A;  2J46 A;  4QI0 A;  3T4R A;  1NZE A;  2KGO A;  3NDB B;  4I1M A;  4GYT A;  4ZLD A;  1OCR C;  4XLP F;  4C3D A;  1TR2 A;  1TWH A;  1LKX A;  5E3A A;  4CSA A;  1W2W A;  3LLI A;  3M1C B;  3DAF A;  4U5E E;  3EFO A;  1OCZ C;  3PMR A;  1NU7 D;  1SZI A;  4CS7 A;  3WOD F;  1S7Z A;  4GEH A;  4LER A;  3LS0 A;  3EGD B;  3WG7 C;  3L34 A;  2XXA A;  3RKO F;  2WZG A;  2NUT A;  3DM5 A;  3UGO A;  3W8H A;  5DQT A;  4CIH A;  1SMY F;  3HTK C;  3IEE A;  3KMI A;  3DJU B;  2MWQ A;  3K1H A;  3NYJ A;  3EGX A;  3FAJ A;  4LLC A;  3K1I C;  4E7Z A;  4C7O B;  1OCC C;  5E33 A;  4P6I C;  4MQ9 F;  4YWQ A;  1ZHY A;  2KNH A;  2FFH A;  3X1O A;  2KW3 C;  2NUP B;  3ABL C;  4RDA A;  3EFO B;  4U5B E;  3KL4 A;  5KYY B;  2IXM A;  1O5H A;  2EIJ C;  4X0R A;  4JVS A;  2PFD A;  3EZI A;  1VK5 A;  3DMD A;  4I3M A;  4BG0 A;  2VAS A;  3EJN A;  5BUO A;  4YT2 A;  2W4B A;  2XRH A;  4O6N A;  4BJ1 A;  1PCX A;  4LAC B;  4PK4 A;  4IAO A;  2J9U A;  4O6M A;  2CNW D;  3ZSU A;  1VOM A;  4FWV A;  4KNW A;  4AK9 A;  2EIK C;  3TD7 A;  4H4K C;  4OD5 A;  4OIQ F;  4RBN A;  5DVW A;  1D0X A;  3LNR A;  4U5D E;  3SNH A;  2R7O A;  3QZC A;  4MND A;  4JZA A;  3S27 A;  4BJ6 C;  3MLG A;  2NG1 A;  1VYI A;  3EHM A;  5F5H A;  2A68 F;  3RH3 A;  2Q9B A;  4Q4Z F;  4C3B A;  2R7S A;  3RYL A;  3DJN B;  3B0V C;  4KBL A;  2B0J A;  4B6I A;  1FTS A;  4AE4 A;  3Q6N A;  4KNV A;  2M4E A;  1QLE C;  1QZX A;  3HLZ A;  3Q7L A;  2D5R B;  5KYU A;  4U5C E;  1ZHW A;  4YT8 A;  4U5G A;  2Y69 C;  3B0P A;  2J45 A;  3ITF A;  2R7T A;  4O79 A;  2IOQ A;  3ECS A;  1IW7 F;  2I8B A;  5DS5 A;  3Q7G A;  4Q7C A;  3H65 A;  5HSW A;  4JW1 A;  2Y3D A;  5KYW A;  1Z23 A;  1MMN A;  1WGW A;  4IWB A;  1M2V B;  4PJM A;  1BR1 A;  2IXO A;  1M2V A;  2Z15 A;  1MMG A;  5KYY A;  1N1C A;  3AG4 C;  2C04 A;  4AX2 A;  4DOZ A;  2W4M A;  4J32 B;  4K0D A;  2NUP A;  2O9X A;  2G3V A;  4JCH A;  3NKE A;  2A6H F;  3SYN A;  2GFH A;  2P7V A;  4IRU A;  5CI8 A;  4HEA J;  2R7X A;  2Y3B A;  3LAY A;  3S0X A;  4CS8 A;  2XXA B;  2G62 A;  3AG1 C;  4DBQ A;  2YZS A;  3ZVR A;  2WL8 A;  3F47 A;  3N24 A;  3EH2 A;  1OKK D;  5DLJ A;  2IYL D;  3O39 A;  1KU2 A;  4XWJ A;  3OEO A;  3EG9 A;  4BEJ A;  3JCU Q;  4XTK A;  4DVY P;  2A69 F;  2P6V A;  3I5Q A;  5FCL A;  4N06 A;  4NY3 A;  2YEV A;  4ZLC A;  2J7P D;  3POV A;  2DYS C;  1NU9 C;  1ZHT A;  2YHS A;  2H7V C;  4KI2 A;  3RFY A;  1D1B A;  3SZR A;  4OIR F;  3RIP A;  3LS1 A;  4BJ5 C;  4ANJ A;  4BJ5 A;  1IZM A;  1M2O A;  2HV7 A;  3N0T A;  2V26 A;  4EWC A;  4OIO F;  1TWG A;  3ZIB A;  4C3E A;  2Q9C A;  4O7G A;  2Y39 A;  3DXJ F;  4BJ6 A;  3JYH A;  3V7O A;  3AQB A;  4PJN A;  4DVZ A;  3K6B A;  3KH2 A;  2R7R A;  1SF8 A;  1FMW A;  2E87 A;  2ZPA A;  3DAG A;  3ABK C;  5F5F A;  2CW0 F;  2H7B A;  5B1B C;  3NKD A;  2H7O A;  3EPV A;  2X51 A;  2FGY A;  1ZHZ A;  4FES A;  4F4B A;  1RJ9 B;  2QY9 A;  4QI2 A;  3CSK A;  2G3K A;  2KQ9 A;  4OIN F;  2XL4 A;  3B9Q A;  1ST6 A;  3LLK A;  4PJL A;  2Q3T A;  2NUT B;  3EGD A;  3HJC A;  3K7D A;  4J30 B;  5KYX A;  3NRH A;  4W8K A;  2W45 A;  4KC9 A;  4G7H F;  3QMK A;  5CI9 A;  3UMI A;  3X2Q C;  4EBB A;  3CZ6 A;  5L3Q A;  2VH3 A;  3FHD A;  3OWT A;  1Z6A A;  2JD3 A;  1JPJ A;  2MYS A;  2ZXP A;  3EGX B;  3DM9 B;  3LEV A;  3NG1 A;  4C7O A;  4O6Y A;  3JSZ A;  2QTV A;  5EGY A;  5E2Q A;  3ZG1 A;  4HFK B;  1TWC A;  4M63 A;  3JRT A;  1O87 A;  4PFP A;  1FFT C;  4LLE A;  2IXP A;  3PHF 2;  5B1A C;  3E70 C;  1VMA A;  4RD9 A;  4G7O F;  1BR4 A;  3EG9 B;  3ABM C;  3EHN A;  3O6X A;  2A1D D;  3LES A;  3GOD A;  1MNE A;  4CBE A;  3FVY A;  5KYU B;  3NYM A;  2V3C C;  2EIN C;  2Y3H A;  1OKK A;  2W9Y A;  5D91 A;  3UR3 C;  3ASO C;  1LS1 A;  3MX3 A;  3F46 A;  4OD4 A;  3ASN C;  4OIP F;  1MND A;  3I4U A;  1ZU5 A;  4CS9 C;  2R7W A;  3W2W A;  5KYW B;  1ZHX A;  2XSE A;  4XLN F;  1M56 C;  2J0X A;  3AQC A;  2EIL C;  4ULW A;  1Z3I X;  1D1A A;  3K33 A;  1BR2 A;  1D0Y A;  2OCC C;  2OG2 A;  4Q5S F;  2A6E F;  2CNW A;  1TWA A;  4JJG A;  3GAN A;  3EQL F;  4QDL A;  1LVK A;  5DS4 A;  1FFH A;  2BE5 F;  2WZL A;  2HV6 A;  3T6J A;  2C03 A;  2WVN A;  3EH1 A;  5DS6 A;  1V54 C;  4FX5 A;  4A2N B;  4G7Z F;  1PD1 A;  1J8M F;  2CDQ A;  3KKB A;  3LJB A;  4YT4 A;  1VYK A;  4E7S A;  3S28 A;  4DBR A;  2ZXR A;  2WZF A;  1G8X A;  2EIM C;  2VB6 A;  3AG2 C;  2ZXW C;  3N2Z B;  2Y3G A;  1NG1 A;  3Q6M A;  2IXN A;  3CQZ A;  3SP1 A;  3VAY A;  1V55 C;  4YJW A;  1D1C A;  4HFF B;  3DZA A;  1OCO C;  2R7V A;  2R7U A;  5T3T A;  2ZXO A;  3JT1 A;  4CS9 A;  2J9W A;  3VYW A;  2J0W A;  3E9V A;  1RJ9 A;  3W2V A;  4YN0 B;  3ZC4 A;  3DD7 A;  3UMH A;  1J8Y F;  2J9V A;  5EHH A;  2R7Q A;  5L3V A;  2J7P A;  4JJF A;  1D0Z A;  5B3S C;  2DYR C;  3UGP A;  2L81 A;  2PX3 A;  3EZH A;  4I44 A;  4PJJ A;  5E3C A;  1JPN A;  4PFO A;  2DGJ A;  1MMA A;  3T6B A;  4CSA C;  2LSE A;  3L0I A;  1PD0 A;  1MMD A;  2WVO A;  2WVQ A;  1Z63 A;  4I1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...