3OA1A

Crystal structure of phosphoprotein/protein p/protein m1 residues 69-297 from rabies virus reveals degradation to c-terminal domain only
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
104
structure length
102
Chain Sequence
EDDLSVEAEIAHQIAESFSKKYKFPSRSILLYNFEQLKMNLDDIVKEAKNVPGVTRLARDGSKLPLRCVLGWVALANSKKFQLLVESNKLSKIMQDDLNRYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphoprotein
publication title Crystal structure of phosphoprotein/Protein P/Protein M1 residues 69-297 from Rabies virus reveals degradation to C-terminal domain only
rcsb
source organism Rabies virus strain pasteur vaccin
molecule tags Chaperone
total genus 37
structure length 102
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3oa1A00
3OA1A 1VYIA 2WZLA
chains in the Genus database with same CATH superfamily
4DXWA 1CPQA 3MX3A 3OA1A 3MBGA 2KJGA 3SXZA 3Q7LA 5EK0A 3RF3A 4OINF 1APCA 1QQ3A 2NUPB 1Z23A 1SMYF 3JYHA 1EI7A 1W2WA 1BBHA 1EA8A 1JPJA 2ZD9A 2PX0A 4ULVA 1ZU5A 3S28A 2J0WA 4MTOA 3W2WA 3PDMP 3IQTA 2VCBA 3LESA 1D0YA 1HY5A 2EINC 4ER9A 2KSFA 4MVSA 1PD0A 1OXKA 1BR1A 1OCRC 1Z3IX 4U9DA 1SZIA 1JR8A 2XL6A 3S84A 3LLIA 3AQCA 3I4UA 4P9FA 1UG7A 3IQ5A 2O9XA 2IYLD 4YN0B 2HV7A 3ZC4A 3IQ6A 4MTFA 1QSPA 1M56C 1U6HA 1WTYA 1ZHXA 4LERA 2HKVA 1DOVA 2H7VC 2GWWA 1UFBA 2RSEB 3HJCA 3K7DA 4NTFA 3ZTZA 1WWPA 4C3BA 3TD7A 1E86A 4JJFA 2OEVA 4N6HA 3JSZA 2LD6A 2R25A 3B9QA 1E2XA 1AUEA 2XL4A 1N1CA 1D0ZA 2YWAA 2DI3A 4CSAC 3EGDA 3FAJA 4MS2A 4XQ1A 2ETSA 4AK9A 4OIOF 3O39A 4NTBA 2M64A 2CYDA 2P6VA 2J9UA 3IHUA 4HEAJ 4C3EA 4J30B 2FGYA 3ZDLA 3ABLC 1TWHA 3AJMA 4YJWA 1NBBA 2KW3C 3ZG1A 4CS7A 3NMKA 4H4KC 1Z63A 5JRAA 2XXAB 2LSEA 3BEHA 3LEVA 3B29A 3QTHA 1ZVZA 1RXQA 3F47A 5JSLA 3T6GB 1BR4A 5A6JA 3L1MA 4JE9A 2YL0A 1Z6AA 3PMRA 3RVZA 4C7OB 3CAXA 1OR2A 3H2UA 4BJ1A 4CS8A 2MHRA 2JX0A 1LI7A 3W4YA 2PF4E 3X2QC 2J9WA 2XM4A 3VAYA 5AC4A 2OCCC 4ONSA 5E2QA 4E17A 5BQHA 3LLKA 3DAGA 3ATPA 3O10A 2YQYA 2MYSA 4QI2A 1E85A 3UMIA 2OQMA 1A7VA 2J7PA 2J0XA 2YHSA 5F28E 1EQ1A 3EH1A 1QLEC 3UGPA 3M4BA 5L0FA 1FFHA 1KU2A 3FVYA 5T1DB 3TOMA 1OW7A 1K40A 3DWWA 2LK4A 1TWAA 1Q0DA 2EPOA 4LDRA 4JCHA 3TK0A 4D4NA 3S90A 1H9TA 4CJOA 1SF8A 2GAQA 4KI2A 4LLEA 3PHF2 2HJMA 3B0UX 2J45A 2NUTB 3AQBA 2CGEA 1RJ9A 3SNHA 2YKZA 2QNLA 2WL8A 3C8GA 3GEIA 1V4AA 1YA9A 3NMJA 4G7OF 1BZ4A 4XEVA 1K05A 5IY5C 2VC9A 2VCCA 5F5FA 2W4MA 1OR3A 1OCOC 4JC7A 2KQ9A 3ZWIA 2DB4A 1SYQA 4J7TA 2HSBA 5TJ5E 4CS9C 3MFNA 4YT4A 4PFPA 3SZRA 2PFDA 3LEOA 3AGTA 4J32B 2HUJA 3K33A 3Q6NA 2Y3DA 5DLJA 1LS1A 1H9GA 1Q0KA 1T6UA 3C7JA 5KYXA 1ZHYA 5CI9A 2Q7RA 3TOLA 2A68F 5KYWB 1CPRA 2Y3BA 4XWJA 3JZ0A 1EKYA 3DKAA 2CNWA 2EPLX 3HNJA 3HKKA 2Y3GA 4Q5SF 4IB4A 4K1OA 1Y6DA 2RD9A 2YRFA 256BA 3G4XA 3QW1A 2PNOA 1OW8A 1ZYRF 4JCZA 4MNDA 4PFOA 1L3PA 3G4ZA 3DZAA 2I8BA 3NKDA 2R7UA 2H7OA 2VB6A 3L34A 2KK1A 1CGNA 1S05A 2OEXA 4BEMJ 2VCAA 2L6GA 2Q9CA 3KH2A 3WHNA 4M63A 3RFYA 2OJED 2XS1A 3LAYA 4B6IA 3SXYA 1C02A 3CEXA 4ZLDA 1R4TA 1KTMA 1LS4A 3SEOA 3VF0A 1ORYA 4XLPF 2UUHA 2NSFA 3LNMB 3H2VA 4DVZA 4I1OB 4EWCA 3EPVA 3EZIA 4GQHA 4KC9A 4G7ZF 4CS8C 1RKCA 3B0VC 4L6RA 3FDQA 4YT5A 4PJNA 1H7IA 4NTAA 4PJJA 1VTMP 4KNVA 4EBJA 2XS8A 2FFHA 2CW0F 2KYHA 5FZTA 4AE4A 4QDLA 2WZFA 5AGFA 3HNIA 2YLGA 4BJ6C 2HS5A 3GEEA 1HE9A 4I1MA 5DS5A 1OKKD 1VLTA 1VLSA 4J7YA 4PJLA 3WAQA 4DVYP 2H7BA 3ASNC 2Q00A 3K6BA 4EUKB 2R05A 2L7AA 5E3AA 5L3VA 3GANA 1VOMA 3U2LA 4EHPA 3EFOB 3JTLO 2OOCA 1JPNA 2OJQA 3U3BA 3U8VA 3EG9B 3US6A 1GS9A 2XLDA 2WZGA 3VM6A 2EIJC 2IXMA 4MTGA 1C17M 4E7ZA 5BQIA 2LFDA 4U5DE 5L0GA 2R7SA 4MVOA 4CIHA 2ZXWC 4N6CA 3JSEO 5E3CA 3I5QA 2IXPA 1MMAA 3RW0A 1I4YA 1FAPB 4BJ5A 5DQZA 4BEJA 2R7RA 4C7OA 1S7ZA 2LP4A 3DE8A 1Z7Qc 4EIYA 2UUIA 5AC5A 4E7SA 1ORJA 4JTDB 1D1AA 2NG1A 3EHNA 1LKXA 4EBKA 2R7WA 1YA7O 4JTCB 1M2VB 4G78A 4F4BA 3M79A 1YZAA 4RDAA 4YT2A 1NLXA 5A6AA 3FOPA 1T9KA 2FAPB 1YAUO 2AWCA 2ZXPA 3ZTMA 5FCLA 3LS0A 3AG2C 3NRHA 3QW0A 2QLAA 2B0HA 3RKOF 3AGUA 4OIQF 1YLMA 4CDAA 1NU7D 3KKBA 1A7EA 4W8PA 5KYUB 1OXBA 2BC5A 2C03A 2WB7A 3LJBA 5DQTA 3RYLA 3U9JA 2TMVP 1VK5A 4K7BA 1D1BA 3GWLA 4U5FE 2PX3A 4CX9A 1LIHA 2W4BA 3K1IC 1MMGA 1PD1A 4JW1A 2M4EA 4WGYA 1Q0MA 5KYNA 5F5HA 1JMWA 4YT8A 3U5SA 4ANJA 3JT1A 4O7GA 3HTKC 3QZCA 1HW2A 3S27A 1V55C 1RKEA 3JRMO 2IOQA 4FWVA 2R7QA 4YWQA 3UMKA 2F22A 3O6XA 4JVSA 2A6EF 4KBLA 3CSKA 3T4RA 2AWYA 3CZ6A 2XLEA 1TWCA 3IQCA 5K0IA 4JEBA 4YL0A 2IXOA 3T6BA 1SR2A 2Q3TA 3LS1A 3EQLF 4IARA 2PP4A 2J9BA 5KYYB 1NG1A 3U9MA 3GEHA 5JLIA 1D0XA 1YDIA 2AVKA 4WJ0A 1LE4A 1A0BA 2YZSA 4O6NA 3JYYA 5DS6A 5JT4A 1NZEA 4GEHA 1QVXA 1TQGA 2OKUA 2IBFA 4ZLCA 5BQGA 3QMKA 2A0BA 3GM1A 2R7XA 4IRUA 2B0JA 4AX2A 3AOUA 1GM5A 1WGWA 2LQGA 3ITFA 4P6IC 4EKWA 2I15A 3NYJA 5JVEA 4YK5A 1XZPA 1ZW2A 1WN0A 4U5GA 4IJJA 4Z9JA 2LFFA 3U0CA 3UMHA 1MNDA 5A6KA 2D5RB 3RIPA 4BPMA 3TULA 2Z15A 4RBNA 3FMSA 4OD5A 4E0IA 3ECSA 1FNTc 2L81A 4NQFA 4R32A 3RQGA 5CIVA 4NC3A 3RH3A 1ZZPA 1ZHTA 3S9OA 2R02A 2Q4FA 3LUTB 3TJ6A 4MVUA 5CI8A 2J7PD 4DJ9A 2G3KA 2KNHA 5JP7A 3RQFA 3DMDA 2W9YA 1LM3B 3EGDB 5T3WA 4DBQA 2Q9AA 4MW3A 1RMVA 3ZIBA 1TFOB 2Y3HA 1G4US 1HMDA 2ZPAA 2R03A 3KL4A 1V54C 2BE5F 4ULWA 5L0JA 1A41A 1FMWA 3FOOA 4IWBA 3UNGC 2YEVA 4LDKA 2NUPA 4PK4A 4XLNF 3DAFA 4BG0A 4E0HA 1E83A 3C8GD 3E70C 2NPUA 2HZ8A 2R7TA 3N0TA 5A6BA 3J06A 1G5ZA 5GPGB 3JRTA 3T9OA 2L6HA 3N2ZB 4U5EE 2R7OA 2WVQA 4DRHB 1JOGA 2BL2A 1B68A 1YYXA 4I3MA 3SP1A 4NY3A 3M15A 3K66A 2KGOA 4UDVA 3A9CA 3F46A 4Z9IA 1BR2A 1LPEA 2XL8A 4PACA 3C63A 5L0IA 5DVWA 4A2NB 2R7VA 1OCCC 3O55A 2D4UA 2CNWD 1C03A 4K0DA 3C18A 1U89A 3RVYA 1U0BB 4AL0A 3NG1A 4PJMA 4E18A 1FTSA 1HMOA 1M6TA 4N06A 4YL1A 1T6IA 1HE1A 2ICWG 1R5ID 4HFKB 2LCHA 2IXNA 1MQVA 2P0NA 3MYFA 5COMA 2WZLA 3ASOC 4JEAA 4JIOA 2IM8A 2QY9A 4OD4A 1T5OA 3C8GB 3L0IA 5L3QA 3OEOA 3H65A 2NSGA 4U9EA 1O87A 3PCVA 3DM9B 2HMZA 3EHMA 3C8ZA 3NYLA 1QKRA 2XXAA 3U2MA 3SXKA 2J46A 2AU5A 2P7VA 5L0CA 3ABKC 1VB5A 2XSEA 3V5YA 2V26A 4MQ9F 3GORA 4YL3A 5EHHA 3R2PA 2EILC 3LNRA 3X1OA 5BUOA 5KYXB 5HSWA 2HMQA 1IW7F 1DOWA 4BJTA 1TR2A 3BRJA 1AVOB 3DJUB 2DGJA 2QE9A 3GODA 1QPUA 1YZCA 2YVKA 3U3FA 2OG2A 3W8IA 4DRIB 1F1MA 1WASA 2HFIA 3WG7C 4MVQA 4QI0A 1NFOA 4U5BE 3W8HA 3ZVRA 1J8MF 1VMAA 3RQEA 4C3DA 1H6GA 4OIRF 1FFTC 4O79A 4CDYA 4JJGA 3SYNA 1YVIA 4H54A 2YL3A 2WVOA 2GFHA 4FAPB 3UGOA 3IPMO 1NFNA 4N4WA 2YLIA 4JURI 5T3TA 4XPYA 4IGGA 1L7CA 2EIKC 4XPXA 3GWNA 1JAFA 3VRCA 4D4XA 5B3IA 2XLHA 1ZHZA 3POVA 3EZHA 1MNEA 2X51A 2XM0A 3NKEA 4MVRA 1IZMA 2ASRA 4I44A 2NUTA 2V3CC 5JUAA 4CS9A 5A69A 2XRHA 3EJNA 3IEEA 1OW6A 5EGYA 3AG1C 5B1AC 5L0DA 1PV3A 1T6QA 2HJ3A 4W8KA 2L9JA 4AE4B 3G50A 3HNKA 3DI5A 2J9VA 2L6FA 2Q9BA 5KYWA 4XTKA 4G7HF 2Y39A 2GA0A 2XLMA 4DBRA 3DJNB 3EGXB 3L8JA 3MYIA 4LACB 3T6JA 3HNLA 2GDCA 3TQOA 1YARO 4NCQA 2P1AA 3V7OA 2W45A 2YL1A 2VASA 3B71A 5HV9A 5L0HA 1BDJB 1MMDA 3AG4C 1M2OA 4XEFA 4DOZA 1E84A 3U8PA 3HLZA 3QVYA 1G4WR 3N24A 1CGOA 5B1BC 3FAPB 2CCYA 4IAQA 4X0RA 1MMNA 1RCPA 1ZHWA 4IAOA 3TJ5A 3V5XA 5COFA 2Y69C 4G0HA 1FMVA 1O5HA 3DD7A 4XPWA 2AP3A 2C04A 1Y4CA 3ZQYA 3FXHA 4BJ5C 2YLDA 5E33A 1K04A 5DS4A 2G62A 3B0PA 3KYIA 4GYTA 1O3UA 4U5HA 4BJ6A 4LDQA 3DM5A 2MWQA 2R9RB 3MLGA 1CGME 3R7CA 3DXJF 3ABMC 3E9VA 3S0XA 4HFFB 1PCXA 1D1CA 1I4ZA 2WVNA 4MVZA 2X0CA 2HSQA 5COGA 2HV6A 4CIPA 4MW8A 2VH3A 3JCUQ 3QVZA 4Z9HA 4A4AA 2A1DD 1TFKB 2A6HF 4OIPF 2EIMC 2XLVA 3KMIA 1WATA 3EFOA 2XLWA 1GGQA 1VYKA 1OCZC 2CDQA 2E87A 3EG9A 3I5PA 3Q7GA 3W2VA 3WODF 4EBBA 2QUPA 3SXMA 1RKEB 2EPNA 2EPMX 4KNWA 2DYSC 3DE9A 1ST6A 3GM2A 1JRAA 1AEPA 1Q0GA 1OQCA 2A0UA 1I5NA 1XWJA 1LVKA 1M57C 3KPHA 3EH2A 4O6YA 4CBEA 1LI5A 2JD3A 3M1CB 3UR3C 4Q4ZF 1LE2A 1M2VA 1A7DA 3GM3A 4JTAB 1QZXA 1YYJA 3AG3C 2A69F 1ORSC 3CQZA 3Q6MA 4JZAA 3A11A 1NSGB 1OKKA 1YJGA 2LIGA 2ZXOA 3S29A 1ZW3A 3NYMA 3ZQVA 5JS5A 4CJGA 2DYRC 1WOLA 1KNYA 4DRJB 4CSAA 2JPUA 1TKNA 2OU6A 5KYUA 3C62A 3L8IA 4O6MA 2PBEA 4FX5A 4LLCA 4PR9A 2H8AA 3K1IA 1Q0FA 2P61A 4Q7CA 4XEKA 4U5CE 5B3SC 3FHDA 2ZXRA 1XZQA 1HW1A 3KYJA 1VYIA 4MVMA 3VYWA 2KC3A 3NMIA 4AL1A 1RJ9B 3V5ZA 1Z5ZA 5A6BD 2XLOA 4RD9A 4WABA 4JKVA 2J8WA 1FR0A 3ZSUA 2EPKX 3NDBB 3K1HA 4HE8D 1G8XA 1NU9C 4P9TA 4JRZA 5D92A 1ZU4A 1T01A 2QTVA 1GQAA 3M4CA 2G3VA 1J8YF 4FESA 5D91A 2YL7A 1TWGA 3EGXA 4WGZA 3OWTA 4CDVA 5KYYA 1V74B
chains in the Genus database with same CATH topology
3MX3A 3OA1A 2KJGA 3Q7LA 4OINF 2NUPB 1Z23A 1SMYF 3JYHA 1W2WA 1JPJA 3S28A 2PX0A 1ZU5A 2J0WA 3W2WA 3LESA 1D0YA 2EINC 1PD0A 1BR1A 1OCRC 1Z3IX 1SZIA 3LLIA 3AQCA 3I4UA 2O9XA 2IYLD 4YN0B 2HV7A 3ZC4A 1M56C 1ZHXA 4LERA 2H7VC 3HJCA 3K7DA 4C3BA 3TD7A 4JJFA 3JSZA 3B9QA 2XL4A 1N1CA 1D0ZA 4CSAC 3EGDA 3FAJA 4AK9A 4OIOF 3O39A 2P6VA 2J9UA 4C3EA 4HEAJ 4J30B 2FGYA 3ABLC 1TWHA 4YJWA 3ZG1A 4CS7A 2KW3C 1Z63A 4H4KC 2XXAB 2LSEA 3LEVA 3F47A 1BR4A 1Z6AA 3PMRA 4C7OB 4BJ1A 4CS8A 3X2QC 2PF4E 2J9WA 3VAYA 2OCCC 5E2QA 3LLKA 3DAGA 4QI2A 2MYSA 3UMIA 2J7PA 2J0XA 2YHSA 3EH1A 1QLEC 3UGPA 1FFHA 1KU2A 3FVYA 5T1DB 1TWAA 4JCHA 4KI2A 1SF8A 4LLEA 3PHF2 3B0UX 2J45A 2NUTB 3AQBA 2CGEA 1RJ9A 3SNHA 2WL8A 4G7OF 5IY5C 5F5FA 2W4MA 1OCOC 2KQ9A 4CS9C 4YT4A 4PFPA 3SZRA 2PFDA 4J32B 3Q6NA 3K33A 2Y3DA 5DLJA 1LS1A 5KYXA 1ZHYA 5CI9A 5KYWB 2A68F 2Y3BA 4XWJA 2CNWA 2Y3GA 4Q5SF 1ZYRF 4PFOA 4MNDA 3NKDA 3DZAA 2I8BA 2R7UA 2H7OA 2VB6A 3L34A 2Q9CA 3KH2A 4M63A 3RFYA 3LAYA 4B6IA 4ZLDA 3SEOA 4XLPF 4DVZA 4I1OB 4EWCA 3EPVA 3EZIA 4KC9A 4G7ZF 4CS8C 3B0VC 3FDQA 4YT5A 4PJNA 4PJJA 4KNVA 2FFHA 2CW0F 4AE4A 4QDLA 2WZFA 4BJ6C 4I1MA 5DS5A 1OKKD 4PJLA 4DVYP 2H7BA 3ASNC 3K6BA 5E3AA 5L3VA 3GANA 1VOMA 3EFOB 1JPNA 3EG9B 2WZGA 2EIJC 2IXMA 4E7ZA 4U5DE 2R7SA 4CIHA 2ZXWC 5E3CA 3I5QA 2IXPA 1MMAA 4BJ5A 2R7RA 4C7OA 5DQZA 4BEJA 1S7ZA 4E7SA 1D1AA 2NG1A 3EHNA 1LKXA 2R7WA 1M2VB 4F4BA 4YT2A 4RDAA 5FCLA 2ZXPA 3LS0A 3AG2C 3NRHA 3RKOF 4OIQF 1NU7D 3KKBA 5KYUB 3LJBA 2WB7A 2C03A 5DQTA 3RYLA 1VK5A 4K7BA 1D1BA 4U5FE 2PX3A 2W4BA 3K1IC 1MMGA 1PD1A 4JW1A 2M4EA 5KYNA 5F5HA 4YT8A 4ANJA 3JT1A 4O7GA 3HTKC 3QZCA 3S27A 1V55C 2IOQA 4FWVA 2R7QA 4YWQA 3UMKA 3O6XA 4JVSA 2A6EF 4KBLA 3CSKA 3T4RA 3CZ6A 1TWCA 2IXOA 3T6BA 3LS1A 2Q3TA 3EQLF 2PP4A 5KYYB 1NG1A 1D0XA 4WJ0A 2YZSA 4O6NA 5DS6A 1NZEA 4GEHA 4ZLCA 3QMKA 2R7XA 4IRUA 2B0JA 4AX2A 1WGWA 3ITFA 4P6IC 3NYJA 4U5GA 4IJJA 3UMHA 1MNDA 2D5RB 3RIPA 2Z15A 4RBNA 4OD5A 3ECSA 2L81A 3RH3A 1ZHTA 5CI8A 2J7PD 2G3KA 2KNHA 3DMDA 2W9YA 3EGDB 5T3WA 4DBQA 2Q9AA 3ZIBA 2Y3HA 2ZPAA 3KL4A 1V54C 2BE5F 4ULWA 1FMWA 4IWBA 3UNGC 2YEVA 2NUPA 4PK4A 4XLNF 3DAFA 4BG0A 3E70C 2R7TA 3N0TA 3JRTA 3N2ZB 4U5EE 2R7OA 2WVQA 4I3MA 3SP1A 4NY3A 3K66A 2KGOA 3F46A 1BR2A 5DVWA 4A2NB 2R7VA 1OCCC 2CNWD 4K0DA 3NG1A 4PJMA 1FTSA 4N06A 4HFKB 2IXNA 2WZLA 3ASOC 2QY9A 4OD4A 3L0IA 5L3QA 3OEOA 3H65A 1O87A 3DM9B 3EHMA 3NYLA 2XXAA 2J46A 2P7VA 3ABKC 2XSEA 2V26A 4MQ9F 5EHHA 2EILC 3LNRA 3X1OA 5BUOA 5KYXB 5HSWA 1IW7F 4BJTA 1TR2A 3DJUB 3GODA 3W8IA 2DGJA 2OG2A 3WG7C 4QI0A 4U5BE 3W8HA 3ZVRA 1J8MF 1VMAA 4C3DA 4OIRF 1FFTC 4O79A 4JJGA 3SYNA 3UGOA 2WVOA 2GFHA 4JURI 5T3TA 2EIKC 3POVA 1ZHZA 3EZHA 1MNEA 2X51A 3NKEA 1IZMA 2NUTA 4I44A 2V3CC 4CS9A 2XRHA 3EJNA 3IEEA 5EGYA 3AG1C 5B1AC 4W8KA 2L9JA 4AE4B 2J9VA 2Q9BA 5KYWA 4XTKA 4G7HF 2Y39A 4DBRA 3DJNB 3EGXB 4LACB 3T6JA 3V7OA 2W45A 2VASA 1MMDA 3AG4C 1M2OA 4DOZA 3HLZA 3N24A 5B1BC 4X0RA 1MMNA 1ZHWA 4IAOA 2Y69C 4G0HA 1FMVA 1O5HA 3DD7A 2C04A 4BJ5C 5E33A 5DS4A 2G62A 3B0PA 4U5HA 4GYTA 4BJ6A 3DM5A 2MWQA 3MLGA 3DXJF 3ABMC 3E9VA 3S0XA 4HFFB 1PCXA 1D1CA 2WVNA 2HV6A 2VH3A 3JCUQ 2A1DD 2A6HF 4OIPF 2EIMC 3KMIA 3EFOA 1VYKA 2CDQA 1OCZC 3EG9A 2E87A 3I5PA 3Q7GA 3W2VA 3WODF 4EBBA 4KNWA 2DYSC 1ST6A 1LVKA 1M57C 3EH2A 4O6YA 4CBEA 2JD3A 3M1CB 3UR3C 4Q4ZF 1M2VA 1QZXA 3AG3C 2A69F 3CQZA 4JZAA 3Q6MA 2ZXOA 3S29A 1OKKA 3NYMA 2DYRC 4CSAA 1TKNA 5KYUA 4O6MA 4LLCA 4FX5A 5B3SC 4Q7CA 4U5CE 3FHDA 2ZXRA 1VYIA 3VYWA 1RJ9B 1Z5ZA 4RD9A 3ZSUA 3NDBB 3K1HA 4HE8D 1G8XA 1NU9C 5D92A 1ZU4A 2QTVA 2G3VA 1J8YF 4FESA 5D91A 1TWGA 3EGXA 3OWTA 5KYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA1 A;  1VYI A;  2WZL A; 
#chains in the Genus database with same CATH topology
 4DXW A;  1CPQ A;  3MX3 A;  3OA1 A;  3MBG A;  2KJG A;  3SXZ A;  3Q7L A;  5EK0 A;  3RF3 A;  4OIN F;  1APC A;  1QQ3 A;  2NUP B;  1Z23 A;  1SMY F;  3JYH A;  1EI7 A;  1W2W A;  1BBH A;  1EA8 A;  1JPJ A;  2ZD9 A;  2PX0 A;  4ULV A;  1ZU5 A;  3S28 A;  2J0W A;  4MTO A;  3W2W A;  3PDM P;  3IQT A;  2VCB A;  3LES A;  1D0Y A;  1HY5 A;  2EIN C;  4ER9 A;  2KSF A;  4MVS A;  1PD0 A;  1OXK A;  1BR1 A;  1OCR C;  1Z3I X;  4U9D A;  1SZI A;  1JR8 A;  2XL6 A;  3S84 A;  3LLI A;  3AQC A;  3I4U A;  4P9F A;  1UG7 A;  3IQ5 A;  2O9X A;  2IYL D;  4YN0 B;  2HV7 A;  3ZC4 A;  3IQ6 A;  4MTF A;  1QSP A;  1M56 C;  1U6H A;  1WTY A;  1ZHX A;  4LER A;  2HKV A;  1DOV A;  2H7V C;  2GWW A;  1UFB A;  2RSE B;  3HJC A;  3K7D A;  4NTF A;  3ZTZ A;  1WWP A;  4C3B A;  3TD7 A;  1E86 A;  4JJF A;  2OEV A;  4N6H A;  3JSZ A;  2LD6 A;  2R25 A;  3B9Q A;  1E2X A;  1AUE A;  2XL4 A;  1N1C A;  1D0Z A;  2YWA A;  2DI3 A;  4CSA C;  3EGD A;  3FAJ A;  4MS2 A;  4XQ1 A;  2ETS A;  4AK9 A;  4OIO F;  3O39 A;  4NTB A;  2M64 A;  2CYD A;  2P6V A;  2J9U A;  3IHU A;  4HEA J;  4C3E A;  4J30 B;  2FGY A;  3ZDL A;  3ABL C;  1TWH A;  3AJM A;  4YJW A;  1NBB A;  2KW3 C;  3ZG1 A;  4CS7 A;  3NMK A;  4H4K C;  1Z63 A;  5JRA A;  2XXA B;  2LSE A;  3BEH A;  3LEV A;  3B29 A;  3QTH A;  1ZVZ A;  1RXQ A;  3F47 A;  5JSL A;  3T6G B;  1BR4 A;  5A6J A;  3L1M A;  4JE9 A;  2YL0 A;  1Z6A A;  3PMR A;  3RVZ A;  4C7O B;  3CAX A;  1OR2 A;  3H2U A;  4BJ1 A;  4CS8 A;  2MHR A;  2JX0 A;  1LI7 A;  3W4Y A;  2PF4 E;  3X2Q C;  2J9W A;  2XM4 A;  3VAY A;  5AC4 A;  2OCC C;  4ONS A;  5E2Q A;  4E17 A;  5BQH A;  3LLK A;  3DAG A;  3ATP A;  3O10 A;  2YQY A;  2MYS A;  4QI2 A;  1E85 A;  3UMI A;  2OQM A;  1A7V A;  2J7P A;  2J0X A;  2YHS A;  5F28 E;  1EQ1 A;  3EH1 A;  1QLE C;  3UGP A;  3M4B A;  5L0F A;  1FFH A;  1KU2 A;  3FVY A;  5T1D B;  3TOM A;  1OW7 A;  1K40 A;  3DWW A;  2LK4 A;  1TWA A;  1Q0D A;  2EPO A;  4LDR A;  4JCH A;  3TK0 A;  4D4N A;  3S90 A;  1H9T A;  4CJO A;  1SF8 A;  2GAQ A;  4KI2 A;  4LLE A;  3PHF 2;  2HJM A;  3B0U X;  2J45 A;  2NUT B;  3AQB A;  2CGE A;  1RJ9 A;  3SNH A;  2YKZ A;  2QNL A;  2WL8 A;  3C8G A;  3GEI A;  1V4A A;  1YA9 A;  3NMJ A;  4G7O F;  1BZ4 A;  4XEV A;  1K05 A;  5IY5 C;  2VC9 A;  2VCC A;  5F5F A;  2W4M A;  1OR3 A;  1OCO C;  4JC7 A;  2KQ9 A;  3ZWI A;  2DB4 A;  1SYQ A;  4J7T A;  2HSB A;  5TJ5 E;  4CS9 C;  3MFN A;  4YT4 A;  4PFP A;  3SZR A;  2PFD A;  3LEO A;  3AGT A;  4J32 B;  2HUJ A;  3K33 A;  3Q6N A;  2Y3D A;  5DLJ A;  1LS1 A;  1H9G A;  1Q0K A;  1T6U A;  3C7J A;  5KYX A;  1ZHY A;  5CI9 A;  2Q7R A;  3TOL A;  2A68 F;  5KYW B;  1CPR A;  2Y3B A;  4XWJ A;  3JZ0 A;  1EKY A;  3DKA A;  2CNW A;  2EPL X;  3HNJ A;  3HKK A;  2Y3G A;  4Q5S F;  4IB4 A;  4K1O A;  1Y6D A;  2RD9 A;  2YRF A;  256B A;  3G4X A;  3QW1 A;  2PNO A;  1OW8 A;  1ZYR F;  4JCZ A;  4MND A;  4PFO A;  1L3P A;  3G4Z A;  3DZA A;  2I8B A;  3NKD A;  2R7U A;  2H7O A;  2VB6 A;  3L34 A;  2KK1 A;  1CGN A;  1S05 A;  2OEX A;  4BEM J;  2VCA A;  2L6G A;  2Q9C A;  3KH2 A;  3WHN A;  4M63 A;  3RFY A;  2OJE D;  2XS1 A;  3LAY A;  4B6I A;  3SXY A;  1C02 A;  3CEX A;  4ZLD A;  1R4T A;  1KTM A;  1LS4 A;  3SEO A;  3VF0 A;  1ORY A;  4XLP F;  2UUH A;  2NSF A;  3LNM B;  3H2V A;  4DVZ A;  4I1O B;  4EWC A;  3EPV A;  3EZI A;  4GQH A;  4KC9 A;  4G7Z F;  4CS8 C;  1RKC A;  3B0V C;  4L6R A;  3FDQ A;  4YT5 A;  4PJN A;  1H7I A;  4NTA A;  4PJJ A;  1VTM P;  4KNV A;  4EBJ A;  2XS8 A;  2FFH A;  2CW0 F;  2KYH A;  5FZT A;  4AE4 A;  4QDL A;  2WZF A;  5AGF A;  3HNI A;  2YLG A;  4BJ6 C;  2HS5 A;  3GEE A;  1HE9 A;  4I1M A;  5DS5 A;  1OKK D;  1VLT A;  1VLS A;  4J7Y A;  4PJL A;  3WAQ A;  4DVY P;  2H7B A;  3ASN C;  2Q00 A;  3K6B A;  4EUK B;  2R05 A;  2L7A A;  5E3A A;  5L3V A;  3GAN A;  1VOM A;  3U2L A;  4EHP A;  3EFO B;  3JTL O;  2OOC A;  1JPN A;  2OJQ A;  3U3B A;  3U8V A;  3EG9 B;  3US6 A;  1GS9 A;  2XLD A;  2WZG A;  3VM6 A;  2EIJ C;  2IXM A;  4MTG A;  1C17 M;  4E7Z A;  5BQI A;  2LFD A;  4U5D E;  5L0G A;  2R7S A;  4MVO A;  4CIH A;  2ZXW C;  4N6C A;  3JSE O;  5E3C A;  3I5Q A;  2IXP A;  1MMA A;  3RW0 A;  1I4Y A;  1FAP B;  4BJ5 A;  5DQZ A;  4BEJ A;  2R7R A;  4C7O A;  1S7Z A;  2LP4 A;  3DE8 A;  1Z7Q c;  4EIY A;  2UUI A;  5AC5 A;  4E7S A;  1ORJ A;  4JTD B;  1D1A A;  2NG1 A;  3EHN A;  1LKX A;  4EBK A;  2R7W A;  1YA7 O;  4JTC B;  1M2V B;  4G78 A;  4F4B A;  3M79 A;  1YZA A;  4RDA A;  4YT2 A;  1NLX A;  5A6A A;  3FOP A;  1T9K A;  2FAP B;  1YAU O;  2AWC A;  2ZXP A;  3ZTM A;  5FCL A;  3LS0 A;  3AG2 C;  3NRH A;  3QW0 A;  2QLA A;  2B0H A;  3RKO F;  3AGU A;  4OIQ F;  1YLM A;  4CDA A;  1NU7 D;  3KKB A;  1A7E A;  4W8P A;  5KYU B;  1OXB A;  2BC5 A;  2C03 A;  2WB7 A;  3LJB A;  5DQT A;  3RYL A;  3U9J A;  2TMV P;  1VK5 A;  4K7B A;  1D1B A;  3GWL A;  4U5F E;  2PX3 A;  4CX9 A;  1LIH A;  2W4B A;  3K1I C;  1MMG A;  1PD1 A;  4JW1 A;  2M4E A;  4WGY A;  1Q0M A;  5KYN A;  5F5H A;  1JMW A;  4YT8 A;  3U5S A;  4ANJ A;  3JT1 A;  4O7G A;  3HTK C;  3QZC A;  1HW2 A;  3S27 A;  1V55 C;  1RKE A;  3JRM O;  2IOQ A;  4FWV A;  2R7Q A;  4YWQ A;  3UMK A;  2F22 A;  3O6X A;  4JVS A;  2A6E F;  4KBL A;  3CSK A;  3T4R A;  2AWY A;  3CZ6 A;  2XLE A;  1TWC A;  3IQC A;  5K0I A;  4JEB A;  4YL0 A;  2IXO A;  3T6B A;  1SR2 A;  2Q3T A;  3LS1 A;  3EQL F;  4IAR A;  2PP4 A;  2J9B A;  5KYY B;  1NG1 A;  3U9M A;  3GEH A;  5JLI A;  1D0X A;  1YDI A;  2AVK A;  4WJ0 A;  1LE4 A;  1A0B A;  2YZS A;  4O6N A;  3JYY A;  5DS6 A;  5JT4 A;  1NZE A;  4GEH A;  1QVX A;  1TQG A;  2OKU A;  2IBF A;  4ZLC A;  5BQG A;  3QMK A;  2A0B A;  3GM1 A;  2R7X A;  4IRU A;  2B0J A;  4AX2 A;  3AOU A;  1GM5 A;  1WGW A;  2LQG A;  3ITF A;  4P6I C;  4EKW A;  2I15 A;  3NYJ A;  5JVE A;  4YK5 A;  1XZP A;  1ZW2 A;  1WN0 A;  4U5G A;  4IJJ A;  4Z9J A;  2LFF A;  3U0C A;  3UMH A;  1MND A;  5A6K A;  2D5R B;  3RIP A;  4BPM A;  3TUL A;  2Z15 A;  4RBN A;  3FMS A;  4OD5 A;  4E0I A;  3ECS A;  1FNT c;  2L81 A;  4NQF A;  4R32 A;  3RQG A;  5CIV A;  4NC3 A;  3RH3 A;  1ZZP A;  1ZHT A;  3S9O A;  2R02 A;  2Q4F A;  3LUT B;  3TJ6 A;  4MVU A;  5CI8 A;  2J7P D;  4DJ9 A;  2G3K A;  2KNH A;  5JP7 A;  3RQF A;  3DMD A;  2W9Y A;  1LM3 B;  3EGD B;  5T3W A;  4DBQ A;  2Q9A A;  4MW3 A;  1RMV A;  3ZIB A;  1TFO B;  2Y3H A;  1G4U S;  1HMD A;  2ZPA A;  2R03 A;  3KL4 A;  1V54 C;  2BE5 F;  4ULW A;  5L0J A;  1A41 A;  1FMW A;  3FOO A;  4IWB A;  3UNG C;  2YEV A;  4LDK A;  2NUP A;  4PK4 A;  4XLN F;  3DAF A;  4BG0 A;  4E0H A;  1E83 A;  3C8G D;  3E70 C;  2NPU A;  2HZ8 A;  2R7T A;  3N0T A;  5A6B A;  3J06 A;  1G5Z A;  5GPG B;  3JRT A;  3T9O A;  2L6H A;  3N2Z B;  4U5E E;  2R7O A;  2WVQ A;  4DRH B;  1JOG A;  2BL2 A;  1B68 A;  1YYX A;  4I3M A;  3SP1 A;  4NY3 A;  3M15 A;  3K66 A;  2KGO A;  4UDV A;  3A9C A;  3F46 A;  4Z9I A;  1BR2 A;  1LPE A;  2XL8 A;  4PAC A;  3C63 A;  5L0I A;  5DVW A;  4A2N B;  2R7V A;  1OCC C;  3O55 A;  2D4U A;  2CNW D;  1C03 A;  4K0D A;  3C18 A;  1U89 A;  3RVY A;  1U0B B;  4AL0 A;  3NG1 A;  4PJM A;  4E18 A;  1FTS A;  1HMO A;  1M6T A;  4N06 A;  4YL1 A;  1T6I A;  1HE1 A;  2ICW G;  1R5I D;  4HFK B;  2LCH A;  2IXN A;  1MQV A;  2P0N A;  3MYF A;  5COM A;  2WZL A;  3ASO C;  4JEA A;  4JIO A;  2IM8 A;  2QY9 A;  4OD4 A;  1T5O A;  3C8G B;  3L0I A;  5L3Q A;  3OEO A;  3H65 A;  2NSG A;  4U9E A;  1O87 A;  3PCV A;  3DM9 B;  2HMZ A;  3EHM A;  3C8Z A;  3NYL A;  1QKR A;  2XXA A;  3U2M A;  3SXK A;  2J46 A;  2AU5 A;  2P7V A;  5L0C A;  3ABK C;  1VB5 A;  2XSE A;  3V5Y A;  2V26 A;  4MQ9 F;  3GOR A;  4YL3 A;  5EHH A;  3R2P A;  2EIL C;  3LNR A;  3X1O A;  5BUO A;  5KYX B;  5HSW A;  2HMQ A;  1IW7 F;  1DOW A;  4BJT A;  1TR2 A;  3BRJ A;  1AVO B;  3DJU B;  2DGJ A;  2QE9 A;  3GOD A;  1QPU A;  1YZC A;  2YVK A;  3U3F A;  2OG2 A;  3W8I A;  4DRI B;  1F1M A;  1WAS A;  2HFI A;  3WG7 C;  4MVQ A;  4QI0 A;  1NFO A;  4U5B E;  3W8H A;  3ZVR A;  1J8M F;  1VMA A;  3RQE A;  4C3D A;  1H6G A;  4OIR F;  1FFT C;  4O79 A;  4CDY A;  4JJG A;  3SYN A;  1YVI A;  4H54 A;  2YL3 A;  2WVO A;  2GFH A;  4FAP B;  3UGO A;  3IPM O;  1NFN A;  4N4W A;  2YLI A;  4JUR I;  5T3T A;  4XPY A;  4IGG A;  1L7C A;  2EIK C;  4XPX A;  3GWN A;  1JAF A;  3VRC A;  4D4X A;  5B3I A;  2XLH A;  1ZHZ A;  3POV A;  3EZH A;  1MNE A;  2X51 A;  2XM0 A;  3NKE A;  4MVR A;  1IZM A;  2ASR A;  4I44 A;  2NUT A;  2V3C C;  5JUA A;  4CS9 A;  5A69 A;  2XRH A;  3EJN A;  3IEE A;  1OW6 A;  5EGY A;  3AG1 C;  5B1A C;  5L0D A;  1PV3 A;  1T6Q A;  2HJ3 A;  4W8K A;  2L9J A;  4AE4 B;  3G50 A;  3HNK A;  3DI5 A;  2J9V A;  2L6F A;  2Q9B A;  5KYW A;  4XTK A;  4G7H F;  2Y39 A;  2GA0 A;  2XLM A;  4DBR A;  3DJN B;  3EGX B;  3L8J A;  3MYI A;  4LAC B;  3T6J A;  3HNL A;  2GDC A;  3TQO A;  1YAR O;  4NCQ A;  2P1A A;  3V7O A;  2W45 A;  2YL1 A;  2VAS A;  3B71 A;  5HV9 A;  5L0H A;  1BDJ B;  1MMD A;  3AG4 C;  1M2O A;  4XEF A;  4DOZ A;  1E84 A;  3U8P A;  3HLZ A;  3QVY A;  1G4W R;  3N24 A;  1CGO A;  5B1B C;  3FAP B;  2CCY A;  4IAQ A;  4X0R A;  1MMN A;  1RCP A;  1ZHW A;  4IAO A;  3TJ5 A;  3V5X A;  5COF A;  2Y69 C;  4G0H A;  1FMV A;  1O5H A;  3DD7 A;  4XPW A;  2AP3 A;  2C04 A;  1Y4C A;  3ZQY A;  3FXH A;  4BJ5 C;  2YLD A;  5E33 A;  1K04 A;  5DS4 A;  2G62 A;  3B0P A;  3KYI A;  4GYT A;  1O3U A;  4U5H A;  4BJ6 A;  4LDQ A;  3DM5 A;  2MWQ A;  2R9R B;  3MLG A;  1CGM E;  3R7C A;  3DXJ F;  3ABM C;  3E9V A;  3S0X A;  4HFF B;  1PCX A;  1D1C A;  1I4Z A;  2WVN A;  4MVZ A;  2X0C A;  2HSQ A;  5COG A;  2HV6 A;  4CIP A;  4MW8 A;  2VH3 A;  3JCU Q;  3QVZ A;  4Z9H A;  4A4A A;  2A1D D;  1TFK B;  2A6H F;  4OIP F;  2EIM C;  2XLV A;  3KMI A;  1WAT A;  3EFO A;  2XLW A;  1GGQ A;  1VYK A;  1OCZ C;  2CDQ A;  2E87 A;  3EG9 A;  3I5P A;  3Q7G A;  3W2V A;  3WOD F;  4EBB A;  2QUP A;  3SXM A;  1RKE B;  2EPN A;  2EPM X;  4KNW A;  2DYS C;  3DE9 A;  1ST6 A;  3GM2 A;  1JRA A;  1AEP A;  1Q0G A;  1OQC A;  2A0U A;  1I5N A;  1XWJ A;  1LVK A;  1M57 C;  3KPH A;  3EH2 A;  4O6Y A;  4CBE A;  1LI5 A;  2JD3 A;  3M1C B;  3UR3 C;  4Q4Z F;  1LE2 A;  1M2V A;  1A7D A;  3GM3 A;  4JTA B;  1QZX A;  1YYJ A;  3AG3 C;  2A69 F;  1ORS C;  3CQZ A;  3Q6M A;  4JZA A;  3A11 A;  1NSG B;  1OKK A;  1YJG A;  2LIG A;  2ZXO A;  3S29 A;  1ZW3 A;  3NYM A;  3ZQV A;  5JS5 A;  4CJG A;  2DYR C;  1WOL A;  1KNY A;  4DRJ B;  4CSA A;  2JPU A;  1TKN A;  2OU6 A;  5KYU A;  3C62 A;  3L8I A;  4O6M A;  2PBE A;  4FX5 A;  4LLC A;  4PR9 A;  2H8A A;  3K1I A;  1Q0F A;  2P61 A;  4Q7C A;  4XEK A;  4U5C E;  5B3S C;  3FHD A;  2ZXR A;  1XZQ A;  1HW1 A;  3KYJ A;  1VYI A;  4MVM A;  3VYW A;  2KC3 A;  3NMI A;  4AL1 A;  1RJ9 B;  3V5Z A;  1Z5Z A;  5A6B D;  2XLO A;  4RD9 A;  4WAB A;  4JKV A;  2J8W A;  1FR0 A;  3ZSU A;  2EPK X;  3NDB B;  3K1H A;  4HE8 D;  1G8X A;  1NU9 C;  4P9T A;  4JRZ A;  5D92 A;  1ZU4 A;  1T01 A;  2QTV A;  1GQA A;  3M4C A;  2G3V A;  1J8Y F;  4FES A;  5D91 A;  2YL7 A;  1TWG A;  3EGX A;  4WGZ A;  3OWT A;  4CDV A;  5KYY A;  1V74 B; 
#chains in the Genus database with same CATH homology
 3MX3 A;  3OA1 A;  2KJG A;  3Q7L A;  4OIN F;  2NUP B;  1Z23 A;  1SMY F;  3JYH A;  1W2W A;  1JPJ A;  3S28 A;  2PX0 A;  1ZU5 A;  2J0W A;  3W2W A;  3LES A;  1D0Y A;  2EIN C;  1PD0 A;  1BR1 A;  1OCR C;  1Z3I X;  1SZI A;  3LLI A;  3AQC A;  3I4U A;  2O9X A;  2IYL D;  4YN0 B;  2HV7 A;  3ZC4 A;  1M56 C;  1ZHX A;  4LER A;  2H7V C;  3HJC A;  3K7D A;  4C3B A;  3TD7 A;  4JJF A;  3JSZ A;  3B9Q A;  2XL4 A;  1N1C A;  1D0Z A;  4CSA C;  3EGD A;  3FAJ A;  4AK9 A;  4OIO F;  3O39 A;  2P6V A;  2J9U A;  4C3E A;  4HEA J;  4J30 B;  2FGY A;  3ABL C;  1TWH A;  4YJW A;  3ZG1 A;  4CS7 A;  2KW3 C;  1Z63 A;  4H4K C;  2XXA B;  2LSE A;  3LEV A;  3F47 A;  1BR4 A;  1Z6A A;  3PMR A;  4C7O B;  4BJ1 A;  4CS8 A;  3X2Q C;  2PF4 E;  2J9W A;  3VAY A;  2OCC C;  5E2Q A;  3LLK A;  3DAG A;  4QI2 A;  2MYS A;  3UMI A;  2J7P A;  2J0X A;  2YHS A;  3EH1 A;  1QLE C;  3UGP A;  1FFH A;  1KU2 A;  3FVY A;  5T1D B;  1TWA A;  4JCH A;  4KI2 A;  1SF8 A;  4LLE A;  3PHF 2;  3B0U X;  2J45 A;  2NUT B;  3AQB A;  2CGE A;  1RJ9 A;  3SNH A;  2WL8 A;  4G7O F;  5IY5 C;  5F5F A;  2W4M A;  1OCO C;  2KQ9 A;  4CS9 C;  4YT4 A;  4PFP A;  3SZR A;  2PFD A;  4J32 B;  3Q6N A;  3K33 A;  2Y3D A;  5DLJ A;  1LS1 A;  5KYX A;  1ZHY A;  5CI9 A;  5KYW B;  2A68 F;  2Y3B A;  4XWJ A;  2CNW A;  2Y3G A;  4Q5S F;  1ZYR F;  4PFO A;  4MND A;  3NKD A;  3DZA A;  2I8B A;  2R7U A;  2H7O A;  2VB6 A;  3L34 A;  2Q9C A;  3KH2 A;  4M63 A;  3RFY A;  3LAY A;  4B6I A;  4ZLD A;  3SEO A;  4XLP F;  4DVZ A;  4I1O B;  4EWC A;  3EPV A;  3EZI A;  4KC9 A;  4G7Z F;  4CS8 C;  3B0V C;  3FDQ A;  4YT5 A;  4PJN A;  4PJJ A;  4KNV A;  2FFH A;  2CW0 F;  4AE4 A;  4QDL A;  2WZF A;  4BJ6 C;  4I1M A;  5DS5 A;  1OKK D;  4PJL A;  4DVY P;  2H7B A;  3ASN C;  3K6B A;  5E3A A;  5L3V A;  3GAN A;  1VOM A;  3EFO B;  1JPN A;  3EG9 B;  2WZG A;  2EIJ C;  2IXM A;  4E7Z A;  4U5D E;  2R7S A;  4CIH A;  2ZXW C;  5E3C A;  3I5Q A;  2IXP A;  1MMA A;  4BJ5 A;  2R7R A;  4C7O A;  5DQZ A;  4BEJ A;  1S7Z A;  4E7S A;  1D1A A;  2NG1 A;  3EHN A;  1LKX A;  2R7W A;  1M2V B;  4F4B A;  4YT2 A;  4RDA A;  5FCL A;  2ZXP A;  3LS0 A;  3AG2 C;  3NRH A;  3RKO F;  4OIQ F;  1NU7 D;  3KKB A;  5KYU B;  3LJB A;  2WB7 A;  2C03 A;  5DQT A;  3RYL A;  1VK5 A;  4K7B A;  1D1B A;  4U5F E;  2PX3 A;  2W4B A;  3K1I C;  1MMG A;  1PD1 A;  4JW1 A;  2M4E A;  5KYN A;  5F5H A;  4YT8 A;  4ANJ A;  3JT1 A;  4O7G A;  3HTK C;  3QZC A;  3S27 A;  1V55 C;  2IOQ A;  4FWV A;  2R7Q A;  4YWQ A;  3UMK A;  3O6X A;  4JVS A;  2A6E F;  4KBL A;  3CSK A;  3T4R A;  3CZ6 A;  1TWC A;  2IXO A;  3T6B A;  3LS1 A;  2Q3T A;  3EQL F;  2PP4 A;  5KYY B;  1NG1 A;  1D0X A;  4WJ0 A;  2YZS A;  4O6N A;  5DS6 A;  1NZE A;  4GEH A;  4ZLC A;  3QMK A;  2R7X A;  4IRU A;  2B0J A;  4AX2 A;  1WGW A;  3ITF A;  4P6I C;  3NYJ A;  4U5G A;  4IJJ A;  3UMH A;  1MND A;  2D5R B;  3RIP A;  2Z15 A;  4RBN A;  4OD5 A;  3ECS A;  2L81 A;  3RH3 A;  1ZHT A;  5CI8 A;  2J7P D;  2G3K A;  2KNH A;  3DMD A;  2W9Y A;  3EGD B;  5T3W A;  4DBQ A;  2Q9A A;  3ZIB A;  2Y3H A;  2ZPA A;  3KL4 A;  1V54 C;  2BE5 F;  4ULW A;  1FMW A;  4IWB A;  3UNG C;  2YEV A;  2NUP A;  4PK4 A;  4XLN F;  3DAF A;  4BG0 A;  3E70 C;  2R7T A;  3N0T A;  3JRT A;  3N2Z B;  4U5E E;  2R7O A;  2WVQ A;  4I3M A;  3SP1 A;  4NY3 A;  3K66 A;  2KGO A;  3F46 A;  1BR2 A;  5DVW A;  4A2N B;  2R7V A;  1OCC C;  2CNW D;  4K0D A;  3NG1 A;  4PJM A;  1FTS A;  4N06 A;  4HFK B;  2IXN A;  2WZL A;  3ASO C;  2QY9 A;  4OD4 A;  3L0I A;  5L3Q A;  3OEO A;  3H65 A;  1O87 A;  3DM9 B;  3EHM A;  3NYL A;  2XXA A;  2J46 A;  2P7V A;  3ABK C;  2XSE A;  2V26 A;  4MQ9 F;  5EHH A;  2EIL C;  3LNR A;  3X1O A;  5BUO A;  5KYX B;  5HSW A;  1IW7 F;  4BJT A;  1TR2 A;  3DJU B;  3GOD A;  3W8I A;  2DGJ A;  2OG2 A;  3WG7 C;  4QI0 A;  4U5B E;  3W8H A;  3ZVR A;  1J8M F;  1VMA A;  4C3D A;  4OIR F;  1FFT C;  4O79 A;  4JJG A;  3SYN A;  3UGO A;  2WVO A;  2GFH A;  4JUR I;  5T3T A;  2EIK C;  3POV A;  1ZHZ A;  3EZH A;  1MNE A;  2X51 A;  3NKE A;  1IZM A;  2NUT A;  4I44 A;  2V3C C;  4CS9 A;  2XRH A;  3EJN A;  3IEE A;  5EGY A;  3AG1 C;  5B1A C;  4W8K A;  2L9J A;  4AE4 B;  2J9V A;  2Q9B A;  5KYW A;  4XTK A;  4G7H F;  2Y39 A;  4DBR A;  3DJN B;  3EGX B;  4LAC B;  3T6J A;  3V7O A;  2W45 A;  2VAS A;  1MMD A;  3AG4 C;  1M2O A;  4DOZ A;  3HLZ A;  3N24 A;  5B1B C;  4X0R A;  1MMN A;  1ZHW A;  4IAO A;  2Y69 C;  4G0H A;  1FMV A;  1O5H A;  3DD7 A;  2C04 A;  4BJ5 C;  5E33 A;  5DS4 A;  2G62 A;  3B0P A;  4U5H A;  4GYT A;  4BJ6 A;  3DM5 A;  2MWQ A;  3MLG A;  3DXJ F;  3ABM C;  3E9V A;  3S0X A;  4HFF B;  1PCX A;  1D1C A;  2WVN A;  2HV6 A;  2VH3 A;  3JCU Q;  2A1D D;  2A6H F;  4OIP F;  2EIM C;  3KMI A;  3EFO A;  1VYK A;  2CDQ A;  1OCZ C;  3EG9 A;  2E87 A;  3I5P A;  3Q7G A;  3W2V A;  3WOD F;  4EBB A;  4KNW A;  2DYS C;  1ST6 A;  1LVK A;  1M57 C;  3EH2 A;  4O6Y A;  4CBE A;  2JD3 A;  3M1C B;  3UR3 C;  4Q4Z F;  1M2V A;  1QZX A;  3AG3 C;  2A69 F;  3CQZ A;  4JZA A;  3Q6M A;  2ZXO A;  3S29 A;  1OKK A;  3NYM A;  2DYR C;  4CSA A;  1TKN A;  5KYU A;  4O6M A;  4LLC A;  4FX5 A;  5B3S C;  4Q7C A;  4U5C E;  3FHD A;  2ZXR A;  1VYI A;  3VYW A;  1RJ9 B;  1Z5Z A;  4RD9 A;  3ZSU A;  3NDB B;  3K1H A;  4HE8 D;  1G8X A;  1NU9 C;  5D92 A;  1ZU4 A;  2QTV A;  2G3V A;  1J8Y F;  4FES A;  5D91 A;  1TWG A;  3EGX A;  3OWT A;  5KYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...