3OA1A

Crystal structure of phosphoprotein/protein p/protein m1 residues 69-297 from rabies virus reveals degradation to c-terminal domain only
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
104
structure length
102
Chain Sequence
EDDLSVEAEIAHQIAESFSKKYKFPSRSILLYNFEQLKMNLDDIVKEAKNVPGVTRLARDGSKLPLRCVLGWVALANSKKFQLLVESNKLSKIMQDDLNRYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphoprotein
publication title Crystal structure of phosphoprotein/Protein P/Protein M1 residues 69-297 from Rabies virus reveals degradation to C-terminal domain only
rcsb
source organism Rabies virus strain pasteur vaccin
molecule tags Chaperone
total genus 37
structure length 102
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3oa1A00
1VYIA 3OA1A 2WZLA
chains in the Genus database with same CATH superfamily
2A1DD 2PNOA 4OD4A 5T3WA 3SP1A 4MVOA 256BA 3U2MA 2P1AA 1NU7D 1ZHYA 4P9FA 3TD7A 1PV3A 1HE1A 1HY5A 3JCUQ 4Z9IA 2BC5A 4MVSA 3NG1A 4J7YA 1ZW2A 2ICWG 4EUKB 5E3AA 3N0TA 3S28A 2VH3A 4MW8A 2M64A 2QE9A 4U9EA 3K1IA 5JT4A 1B68A 2A0BA 2YWAA 3LJBA 2DI3A 2OJED 4GYTA 4QI2A 3HTKC 1T9KA 3RQGA 3W2WA 3X1OA 3B0PA 2E87A 3GANA 4U5GA 2MYSA 3UMIA 3V5ZA 3RYLA 2A69F 3IQ6A 4JVSA 2C03A 3UNGC 2XLHA 4G7ZF 3UR3C 1K40A 1ST6A 2KGOA 4X0RA 1LKXA 3FDQA 4JKVA 4MTOA 2HS5A 4IJJA 2W45A 4NTBA 2R05A 4E0IA 4D4XA 4E7SA 2XL4A 3RVYA 4JRZA 3T6BA 4LLCA 2DB4A 2J7PD 2QTVA 2XLDA 1MMGA 3T6JA 3DM9B 5CI9A 1I4YA 5BQGA 2UUIA 4U5HA 2KC3A 1QZXA 3ABLC 4HE8D 4CDVA 3R2PA 1YA9A 5L3VA 1I5NA 1QQ3A 3G50A 4MS2A 3JYYA 3RQFA 2J0WA 1OCRC 2UUHA 2TMVP 3C18A 1DOWA 4BEMJ 2G3VA 2KSFA 3RQEA 3AG2C 3POVA 3EHNA 1JPNA 3AG3C 5F5HA 4QI0A 2XS1A 4J7TA 4AX2A 1FNTc 5DLJA 5EGYA 3S90A 4DRHB 1JAFA 3B0VC 3JSEO 2F22A 1O3UA 1SYQA 3DJUB 3NDBB 4PJLA 2YLGA 4CS7A 2Q4FA 1YVIA 5E3CA 3SXKA 1M6TA 2R7VA 1OR2A 3QMKA 1D1CA 4C3DA 2PX3A 1Q0DA 4O6MA 1HMDA 1WGWA 3G4XA 4JTAB 1NFOA 4K1OA 3AGTA 1ZU5A 1QKRA 3EGDB 2MWQA 4HEAJ 2HJ3A 1ORYA 1TR2A 5COFA 3QW1A 3SEOA 2J9VA 1I4ZA 5JSLA 5DQTA 4I3MA 4A2NB 2XS8A 1FTSA 3SXYA 3LLIA 4YK5A 1ZU4A 3ZG1A 2YL3A 2P61A 5JLIA 4HFFB 3QVYA 1QPUA 4Z9JA 3EGXB 4JTDB 1LS1A 2J0XA 3A11A 3C8GA 4U5EE 3FHDA 3GEEA 4BJ5A 1MMNA 3HNIA 1Z5ZA 4GEHA 3EGDA 3B9QA 1VMAA 3E70C 3IPMO 3LAYA 4FX5A 1EKYA 2WZLA 4P9TA 5T1DB 3W8HA 1V74B 1ZYRF 1IZMA 1T6QA 2XRHA 4CIPA 3LLKA 1T01A 3A9CA 4MNDA 4WABA 2A68F 1MMAA 2KJGA 2ZXRA 3GM3A 4D4NA 2R7RA 4IWBA 3NRHA 3U0CA 3EGXA 3FOPA 4MQ9F 3C62A 5FCLA 2GAQA 4N6HA 1BBHA 4DXWA 5B3IA 5L0GA 1FMWA 2XL6A 3ZTZA 3AGUA 4XPYA 2YVKA 3MFNA 2Q9BA 4N4WA 1LVKA 4EKWA 4KI2A 3U3BA 1AVOB 2WZGA 1MNEA 3HJCA 4E17A 4LERA 1BR1A 3AQBA 1A41A 3MYIA 4YN0B 1A7VA 1TWGA 2HUJA 5AGFA 5JP7A 4NTAA 3ZIBA 3RF3A 3F46A 2P7VA 5DQZA 2EIJC 3AG4C 3C8ZA 3EHMA 1OW8A 2GA0A 4U5FE 2YRFA 4IB4A 1BR2A 3OWTA 4NCQA 3TOLA 1A7EA 5KYUB 1Z6AA 2J8WA 2NSGA 4BPMA 3UMHA 2IM8A 4XEKA 5KYNA 3E9VA 1VYKA 4MTGA 4EBJA 2J9BA 2XLEA 4ANJA 2ZXPA 4C3BA 2FAPB 3FMSA 1V55C 3DAGA 2W9YA 1H7IA 3Q6NA 1H9GA 4DJ9A 3DAFA 3JT1A 2YHSA 1YYJA 2B0HA 3WG7C 1PD1A 2Q7RA 1C02A 1G5ZA 3C63A 2LFFA 2OJQA 2OU6A 3GM1A 1S7ZA 4OIRF 5AC5A 3WHNA 4CS9C 5A69A 2OEVA 2W4BA 1OCZC 3PMRA 3R7CA 5JVEA 5KYUA 1CGNA 1LPEA 4BJ6C 1VOMA 3LEOA 3U2LA 2CCYA 3DE9A 1OW6A 1XZQA 3NMKA 5TJ5E 3U5SA 3GEIA 1GGQA 2D4UA 3ECSA 3KMIA 2H7VC 3PCVA 4RD9A 4ULWA 2CYDA 1Q0KA 3X2QC 4UDVA 2CW0F 5A6JA 3FOOA 5GPGB 2EINC 1UFBA 3NYLA 3W2VA 2WVOA 4U5BE 1G8XA 3EG9B 4U5DE 4XPWA 3K66A 4H54A 1NSGB 1TKNA 3U9MA 3V5XA 2AWYA 1VTMP 4MVRA 1Z3IX 4XPXA 1HMOA 1OKKD 2JX0A 4I1OB 2JD3A 5DS4A 3NMIA 4CX9A 2OEXA 4BJ6A 1OW7A 1G4US 2LSEA 3EQLF 2LCHA 3LNMB 3LESA 1EI7A 4YWQA 4YT2A 3CZ6A 2WVQA 1EA8A 3LS1A 1MNDA 2WZFA 3H2UA 3M15A 5L0IA 4WGZA 1VLSA 2Q00A 2VCBA 3NYMA 4U9DA 1ZVZA 4XEFA 3SNHA 1FFTC 2VCAA 3M79A 5DS5A 2QUPA 1MQVA 3GWLA 4W8KA 4N6CA 2IYLD 5A6BA 3EG9A 4XLPF 2YL7A 2P6VA 4XTKA 3ZC4A 3GM2A 2YL1A 1R5ID 3JSZA 2LD6A 5L3QA 4XQ1A 3V5YA 1SF8A 2KW3C 4JCZA 3I4UA 4MVZA 1M56C 4KNVA 3UGPA 2CNWA 4CJGA 4LACB 3W4YA 2L81A 4PJNA 2W4MA 4CBEA 1C17M 3M1CB 2R03A 2V26A 1RKEB 4IAQA 2HMZA 1FFHA 3FAJA 1NG1A 1A0BA 2YKZA 2H7OA 4CS8C 1BZ4A 3OA1A 3HNJA 4Z9HA 3VYWA 1U6HA 4YT5A 5HSWA 4CSAC 3IQTA 2LP4A 2IBFA 4AE4B 3TQOA 1T5OA 3S29A 3C8GB 2YLDA 4J32B 1QLEC 3UMKA 2ASRA 3N2ZB 2R9RB 2P0NA 3EFOB 4WJ0A 4GQHA 4DOZA 1A7DA 1Q0FA 1VB5A 2LK4A 3S0XA 1NZEA 1YDIA 3EPVA 1E85A 2Y3BA 5COMA 2XXAA 3LUTB 2L7AA 1ORSC 2L6HA 2XM4A 2QY9A 2PBEA 3GEHA 1ZZPA 4CDYA 1RKEA 3NMJA 4XLNF 4CS8A 3KL4A 4IGGA 4KC9A 3KYJA 5DVWA 3ZWIA 3T4RA 3H2VA 3M4CA 4AE4A 1FAPB 3I5PA 1KTMA 4MW3A 4O79A 3EFOA 4LLEA 3CEXA 3L0IA 2YL0A 1LS4A 3K33A 1OXBA 4K0DA 3G4ZA 4FWVA 4JZAA 3VRCA 5L0HA 1H9TA 1VYIA 1OCCC 1TWCA 2A6HF 4RDAA 4DRIB 3KYIA 1LIHA 2NPUA 1G4WR 2PP4A 2Y3DA 1WATA 3O39A 3CQZA 2DYSC 3S27A 5FZTA 3JZ0A 3ZSUA 2NG1A 1IW7F 1ZHWA 4JJGA 4KBLA 1V54C 2WB7A 3Q7LA 1V4AA 2EPLX 2KYHA 4IRUA 3EZHA 5DS6A 4DVZA 3SXMA 4OIPF 2DYRC 2Q3TA 4M63A 2QLAA 2OG2A 2LFDA 2GFHA 2NUPB 1T6IA 2XLVA 2IXOA 4DRJB 1VK5A 1ZHXA 2L6GA 3B71A 3BEHA 3QTHA 4J30B 4Q7CA 3RW0A 1QSPA 1QVXA 2R25A 4E18A 2RSEB 1T6UA 3IQ5A 2R7OA 3US6A 2PX0A 4AL1A 3N24A 2G3KA 2XM0A 2Q9AA 4ZLDA 3DI5A 3JTLO 1FR0A 4LDQA 2G62A 1AEPA 3MLGA 2BE5F 2AP3A 2NUTB 4G7OF 3FXHA 2YEVA 3I5QA 3LEVA 5BQHA 1CGME 1GQAA 1E84A 3ASNC 3EH1A 2EIMC 3GODA 2IXNA 4NQFA 1WWPA 2NUPA 4YL3A 3RKOF 2VB6A 4EWCA 3DD7A 4G7HF 4C7OB 4EIYA 1JOGA 4PJMA 4JCHA 4QDLA 4YJWA 1D0ZA 3L1MA 1GS9A 1NFNA 3F47A 3RVZA 4NC3A 1JMWA 2X0CA 1C03A 3TJ5A 2BL2A 1ZHTA 2EPOA 2NUTA 4F4BA 2OQMA 2XLMA 4XWJA 5A6BD 3WAQA 4OD5A 3DZAA 4XEVA 4NY3A 4PFOA 2HFIA 2EPNA 5T3TA 2L6FA 3V7OA 3K1HA 3WODF 3L8JA 5JRAA 2CNWD 4C7OA 3TK0A 1J8YF 2NSFA 4EBKA 5BUOA 2ZXOA 3HNKA 4CDAA 1TQGA 3DWWA 4C3EA 2A6EF 1RJ9B 2VCCA 1OQCA 2I8BA 4P6IC 1SMYF 3PHF2 2J45A 3EJNA 2GDCA 3DKAA 3NYJA 1O5HA 2PFDA 3IHUA 2V3CC 1TFOB 1L3PA 2ETSA 2LIGA 2XLWA 2WL8A 1NU9C 1U0BB 3K1IC 4E0HA 5KYWB 3JRMO 1VLTA 1D0XA 3MYFA 3AQCA 1E83A 2ZXWC 1LI7A 2PF4E 3KPHA 3HNLA 2FGYA 4CS9A 1SZIA 2B0JA 4MVUA 1Z7Qc 3Q7GA 3MX3A 1RJ9A 3GWNA 1KU2A 2HSQA 1LM3B 2MHRA 3AJMA 1L7CA 2CGEA 3DXJF 1YA7O 4YL0A 5JS5A 1DOVA 3BRJA 1RMVA 1AUEA 4B6IA 2OKUA 2ZPAA 4A4AA 2EPKX 3QZCA 4PFPA 3EZIA 4Q5SF 1PD0A 2Q9CA 3C8GD 3LS0A 3QVZA 4MVMA 1D1BA 3CSKA 5KYWA 2EPMX 5IY5C 4ZLCA 1F1MA 5E33A 2Y3HA 2R7SA 4CIHA 1MMDA 2VASA 4HFKB 1Z23A 1JPJA 5B1AC 4LDKA 3FVYA 1YLMA 4PJJA 2XXAB 2XL8A 2HKVA 2WVNA 1YYXA 2LQGA 4G0HA 2KNHA 5A6KA 4ULVA 1J8MF 1ZW3A 2HV6A 2Y69C 3ATPA 4O7GA 4K7BA 3U8PA 2AU5A 4AK9A 2M4EA 1OCOC 2C04A 3K6BA 3B29A 3KKBA 2AVKA 4O6YA 4JW1A 3U8VA 2L9JA 2IXMA 1Y6DA 4H4KC 1RXQA 3VAYA 3L8IA 3JRTA 2Y39A 1BDJB 3RIPA 1ORJA 4OIOF 2IXPA 1CPQA 1JRAA 3QW0A 4PR9A 1GM5A 3ASOC 3VF0A 1TWHA 2A0UA 4WGYA 2R7QA 4U5CE 3TJ6A 3KH2A 4Q4ZF 4CSAA 5COGA 4YL1A 1APCA 4JURI 3RFYA 1H6GA 1Q0MA 4JC7A 2IOQA 5BQIA 1D1AA 1E2XA 1WTYA 3OEOA 2YQYA 4OIQF 3B0UX 2FFHA 1YZCA 4JEBA 1XWJA 2J9WA 1M57C 2R7UA 5L0JA 2YZSA 4BJTA 3SZRA 3SXZA 1KNYA 3K7DA 4PK4A 2R02A 1OXKA 4BJ5C 1N1CA 1Y4CA 2GWWA 4JE9A 1OKKA 2ZD9A 2AWCA 1D0YA 5B1BC 1BR4A 1WOLA 1E86A 3C7JA 3S9OA 4EHPA 1OR3A 3S84A 3AOUA 4IAOA 5AC4A 5B3SC 1JR8A 4ER9A 5KYXB 1TFKB 3M4BA 2J7PA 1ZHZA 4JIOA 3ZDLA 1EQ1A 4BEJA 4MVQA 3ABMC 4I1MA 1LE4A 4RBNA 4DBQA 2HV7A 3ZTMA 3GORA 2Y3GA 1YJGA 4JJFA 4JEAA 3JYHA 1LE2A 2J9UA 1RCPA 4YT4A 1Q0GA 4FAPB 1HE9A 3TULA 2R7XA 4DVYP 5HV9A 1WN0A 4G78A 3ZVRA 2HJMA 2QNLA 1M2OA 4O6NA 2O9XA 4EBBA 2Z15A 5JUAA 4L6RA 4IARA 3NKDA 4BG0A 4BJ1A 5F5FA 4I44A 1YZAA 3DE8A 3RH3A 3IEEA 3SYNA 2OOCA 2R7WA 1K05A 1PCXA 2D5RB 3EH2A 2HZ8A 3O10A 3Q6MA 5KYXA 2DGJA 1HW1A 2HSBA 3FAPB 3H65A 4N06A 2R7TA 3L34A 2OCCC 1RKCA 4OINF 1NBBA 3TOMA 4PACA 2KQ9A 5F28E 1HW2A 3O55A 2CDQA 3IQCA 5E2QA 5CIVA 5L0FA 5L0CA 3DJNB 1YARO 3AG1C 4MTFA 4DBRA 2H8AA 5KYYB 2EIKC 3ZQVA 4AL0A 2XLOA 3ZQYA 2X51A 2EILC 3HLZA 1WASA 5A6AA 3O6XA 1SR2A 5D91A 4E7ZA 3W8IA 2RD9A 4R32A 1M2VB 5EK0A 3CAXA 2I15A 3LNRA 3U9JA 5EHHA 1W2WA 3U3FA 1R4TA 3HKKA 3NKEA 4FESA 4JTCB 3ITFA 3PDMP 1UG7A 5K0IA 5CI8A 5L0DA 3MBGA 4KNWA 4W8PA 4YT8A 3VM6A 1CGOA 2KK1A 3UGOA 2YLIA 1LI5A 4NTFA 1TWAA 5KYYA 4CJOA 2J46A 2XSEA 1Z63A 1CPRA 1XZPA 2JPUA 3ABKC 4LDRA 3T6GB 3T9OA 1FMVA 2H7BA 1K04A 1M2VA 1NLXA 5D92A 3J06A 3DMDA 3DM5A 2HMQA 1U89A 1S05A 1YAUO 2VC9A 4ONSA 1O87A
chains in the Genus database with same CATH topology
2A1DD 3SP1A 4OD4A 5T3WA 1NU7D 1ZHYA 3TD7A 3POVA 3JCUQ 3NG1A 5E3AA 3N0TA 3S28A 2VH3A 3LJBA 4GYTA 4QI2A 3HTKC 3W2WA 3X1OA 3B0PA 2E87A 3GANA 4U5GA 2MYSA 3UMIA 3RYLA 2A69F 4JVSA 2C03A 3UNGC 4G7ZF 3UR3C 1ST6A 3FDQA 2KGOA 4X0RA 1LKXA 4IJJA 2W45A 4E7SA 2XL4A 3T6BA 4LLCA 2J7PD 2QTVA 1MMGA 3T6JA 3DM9B 5CI9A 4U5HA 1QZXA 3ABLC 4HE8D 5L3VA 2J0WA 1OCRC 2G3VA 3AG2C 3EHNA 1JPNA 3AG3C 5F5HA 4QI0A 4AX2A 5DLJA 5EGYA 3B0VC 3NDBB 3DJUB 4PJLA 4CS7A 5E3CA 2R7VA 3QMKA 1D1CA 4C3DA 2PX3A 4O6MA 1WGWA 1ZU5A 3EGDB 2MWQA 4HEAJ 3SEOA 1TR2A 2J9VA 5DQTA 4I3MA 4A2NB 1FTSA 3LLIA 1ZU4A 3ZG1A 4HFFB 3EGXB 1LS1A 2J0XA 4U5EE 3FHDA 4BJ5A 1MMNA 1Z5ZA 4GEHA 3EGDA 3B9QA 1VMAA 3E70C 4FX5A 3LAYA 2WZLA 5T1DB 3W8HA 1ZYRF 1IZMA 2XRHA 3LLKA 4MNDA 2A68F 1MMAA 2KJGA 2ZXRA 2R7RA 4IWBA 3NRHA 3EGXA 4MQ9F 5FCLA 1FMWA 2Q9BA 1LVKA 2WZGA 1MNEA 3HJCA 4LERA 1BR1A 3AQBA 4YN0B 1TWGA 3ZIBA 3F46A 2P7VA 5DQZA 2EIJC 3AG4C 3EHMA 4U5FE 1BR2A 3OWTA 5KYUB 1Z6AA 3UMHA 5KYNA 3E9VA 1VYKA 4ANJA 2ZXPA 4C3BA 1V55C 3DAGA 2W9YA 3Q6NA 3DAFA 3JT1A 2YHSA 3WG7C 1PD1A 4OIRF 3PHF2 1S7ZA 4CS9C 2W4BA 1OCZC 3PMRA 5KYUA 4BJ6C 1VOMA 4RD9A 3KMIA 4ULWA 3ECSA 2H7VC 4KI2A 3X2QC 2CW0F 2EINC 3NYLA 3W2VA 2WVOA 4U5BE 1G8XA 3EG9B 4U5DE 3K66A 1TKNA 1Z3IX 1OKKD 4I1OB 2JD3A 5DS4A 4XLPF 4BJ6A 3EQLF 2LSEA 4YWQA 3LESA 4YT2A 3CZ6A 2WVQA 3LS1A 1MNDA 2WZFA 3NYMA 3SNHA 1FFTC 5DS5A 4W8KA 2IYLD 3EG9A 4XTKA 2P6VA 3ZC4A 3JSZA 5L3QA 1SF8A 2KW3C 3I4UA 1M56C 4KNVA 3UGPA 2CNWA 4LACB 2L81A 4PJNA 2W4MA 4CBEA 3M1CB 2V26A 1FFHA 3FAJA 1NG1A 2H7OA 4CS8C 3OA1A 3VYWA 4CSAC 4YT5A 5HSWA 4AE4B 3S29A 4J32B 1QLEC 3UMKA 3N2ZB 3EFOB 4WJ0A 4DOZA 1NZEA 3EPVA 2Y3BA 2XXAA 2QY9A 4XLNF 4CS8A 3KL4A 4KC9A 5DVWA 3T4RA 4AE4A 3I5PA 4O79A 3EFOA 4LLEA 3L0IA 4K0DA 3K33A 4FWVA 4JZAA 1VYIA 1OCCC 1TWCA 2A6HF 4RDAA 2Y3DA 2PP4A 3O39A 3CQZA 2DYSC 3S27A 3ZSUA 2NG1A 1IW7F 1ZHWA 4JJGA 4KBLA 1V54C 2WB7A 3Q7LA 4IRUA 5DS6A 4OIPF 3EZHA 4DVZA 2DYRC 2Q3TA 4M63A 2OG2A 2GFHA 2NUPB 2IXOA 3S0XA 1VK5A 1ZHXA 4Q7CA 4J30B 2R7OA 2PX0A 3N24A 2G3KA 2Q9AA 4ZLDA 2G62A 3MLGA 2BE5F 2NUTB 4G7OF 2YEVA 3I5QA 3LEVA 3ASNC 3EH1A 2EIMC 3GODA 2IXNA 4EWCA 2NUPA 3RKOF 2VB6A 4G7HF 3DD7A 4C7OB 4PJMA 4JCHA 4QDLA 4YJWA 1D0ZA 3F47A 1ZHTA 2NUTA 4F4BA 4XWJA 4OD5A 3DZAA 4NY3A 4PFOA 5T3TA 3V7OA 3K1HA 3WODF 2CNWD 4C7OA 1J8YF 5BUOA 2ZXOA 4C3EA 2A6EF 1RJ9B 2I8BA 4P6IC 1SMYF 2J45A 3EJNA 3NYJA 1O5HA 2PFDA 2V3CC 2WL8A 1NU9C 3K1IC 5KYWB 1D0XA 3AQCA 2ZXWC 2PF4E 2FGYA 4CS9A 1SZIA 2B0JA 3Q7GA 3MX3A 1RJ9A 1KU2A 2CGEA 3DXJF 4B6IA 2ZPAA 3QZCA 4PFPA 3EZIA 4Q5SF 1PD0A 2Q9CA 5KYWA 3LS0A 1D1BA 3CSKA 5IY5C 4ZLCA 5E33A 2Y3HA 2R7SA 4CIHA 1MMDA 2VASA 4HFKB 1Z23A 1JPJA 5B1AC 3FVYA 4PJJA 2XXAB 2WVNA 4G0HA 2KNHA 1J8MF 2HV6A 4AK9A 2Y69C 4O7GA 4K7BA 2M4EA 1OCOC 2C04A 3K6BA 3KKBA 4O6YA 4JW1A 2L9JA 2IXMA 4H4KC 3VAYA 3JRTA 2Y39A 3RIPA 4OIOF 2IXPA 3ASOC 1TWHA 2R7QA 4U5CE 3KH2A 4Q4ZF 4CSAA 3RFYA 4JURI 2IOQA 1D1AA 3OEOA 4OIQF 3B0UX 2FFHA 2J9WA 1M57C 2R7UA 2YZSA 4BJTA 3SZRA 3K7DA 4PK4A 4BJ5C 1N1CA 1OKKA 1D0YA 5B1BC 1BR4A 4IAOA 5B3SC 5KYXB 2J7PA 1ZHZA 4BEJA 4DBQA 3ABMC 4I1MA 4RBNA 2HV7A 2Y3GA 4JJFA 3JYHA 2J9UA 4YT4A 2R7XA 4DVYP 4EBBA 3ZVRA 4O6NA 1M2OA 2O9XA 5F5FA 2Z15A 4BJ1A 3NKDA 4BG0A 4I44A 3RH3A 3SYNA 2R7WA 3IEEA 2D5RB 1PCXA 3EH2A 3Q6MA 5KYXA 2DGJA 3H65A 4N06A 2R7TA 3L34A 2OCCC 4OINF 2KQ9A 2CDQA 5E2QA 3DJNB 3AG1C 4DBRA 5KYYB 2EIKC 2X51A 2EILC 3HLZA 3O6XA 5D91A 4E7ZA 3W8IA 1M2VB 3LNRA 5EHHA 1W2WA 3NKEA 4FESA 3ITFA 5CI8A 4KNWA 4YT8A 3UGOA 1TWAA 5KYYA 2J46A 2XSEA 1Z63A 3ABKC 1FMVA 2H7BA 1M2VA 5D92A 3DMDA 3DM5A 1O87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYI A;  3OA1 A;  2WZL A; 
#chains in the Genus database with same CATH topology
 2A1D D;  2PNO A;  4OD4 A;  5T3W A;  3SP1 A;  4MVO A;  256B A;  3U2M A;  2P1A A;  1NU7 D;  1ZHY A;  4P9F A;  3TD7 A;  1PV3 A;  1HE1 A;  1HY5 A;  3JCU Q;  4Z9I A;  2BC5 A;  4MVS A;  3NG1 A;  4J7Y A;  1ZW2 A;  2ICW G;  4EUK B;  5E3A A;  3N0T A;  3S28 A;  2VH3 A;  4MW8 A;  2M64 A;  2QE9 A;  4U9E A;  3K1I A;  5JT4 A;  1B68 A;  2A0B A;  2YWA A;  3LJB A;  2DI3 A;  2OJE D;  4GYT A;  4QI2 A;  3HTK C;  1T9K A;  3RQG A;  3W2W A;  3X1O A;  3B0P A;  2E87 A;  3GAN A;  4U5G A;  2MYS A;  3UMI A;  3V5Z A;  3RYL A;  2A69 F;  3IQ6 A;  4JVS A;  2C03 A;  3UNG C;  2XLH A;  4G7Z F;  3UR3 C;  1K40 A;  1ST6 A;  2KGO A;  4X0R A;  1LKX A;  3FDQ A;  4JKV A;  4MTO A;  2HS5 A;  4IJJ A;  2W45 A;  4NTB A;  2R05 A;  4E0I A;  4D4X A;  4E7S A;  2XL4 A;  3RVY A;  4JRZ A;  3T6B A;  4LLC A;  2DB4 A;  2J7P D;  2QTV A;  2XLD A;  1MMG A;  3T6J A;  3DM9 B;  5CI9 A;  1I4Y A;  5BQG A;  2UUI A;  4U5H A;  2KC3 A;  1QZX A;  3ABL C;  4HE8 D;  4CDV A;  3R2P A;  1YA9 A;  5L3V A;  1I5N A;  1QQ3 A;  3G50 A;  4MS2 A;  3JYY A;  3RQF A;  2J0W A;  1OCR C;  2UUH A;  2TMV P;  3C18 A;  1DOW A;  4BEM J;  2G3V A;  2KSF A;  3RQE A;  3AG2 C;  3POV A;  3EHN A;  1JPN A;  3AG3 C;  5F5H A;  4QI0 A;  2XS1 A;  4J7T A;  4AX2 A;  1FNT c;  5DLJ A;  5EGY A;  3S90 A;  4DRH B;  1JAF A;  3B0V C;  3JSE O;  2F22 A;  1O3U A;  1SYQ A;  3DJU B;  3NDB B;  4PJL A;  2YLG A;  4CS7 A;  2Q4F A;  1YVI A;  5E3C A;  3SXK A;  1M6T A;  2R7V A;  1OR2 A;  3QMK A;  1D1C A;  4C3D A;  2PX3 A;  1Q0D A;  4O6M A;  1HMD A;  1WGW A;  3G4X A;  4JTA B;  1NFO A;  4K1O A;  3AGT A;  1ZU5 A;  1QKR A;  3EGD B;  2MWQ A;  4HEA J;  2HJ3 A;  1ORY A;  1TR2 A;  5COF A;  3QW1 A;  3SEO A;  2J9V A;  1I4Z A;  5JSL A;  5DQT A;  4I3M A;  4A2N B;  2XS8 A;  1FTS A;  3SXY A;  3LLI A;  4YK5 A;  1ZU4 A;  3ZG1 A;  2YL3 A;  2P61 A;  5JLI A;  4HFF B;  3QVY A;  1QPU A;  4Z9J A;  3EGX B;  4JTD B;  1LS1 A;  2J0X A;  3A11 A;  3C8G A;  4U5E E;  3FHD A;  3GEE A;  4BJ5 A;  1MMN A;  3HNI A;  1Z5Z A;  4GEH A;  3EGD A;  3B9Q A;  1VMA A;  3E70 C;  3IPM O;  3LAY A;  4FX5 A;  1EKY A;  2WZL A;  4P9T A;  5T1D B;  3W8H A;  1V74 B;  1ZYR F;  1IZM A;  1T6Q A;  2XRH A;  4CIP A;  3LLK A;  1T01 A;  3A9C A;  4MND A;  4WAB A;  2A68 F;  1MMA A;  2KJG A;  2ZXR A;  3GM3 A;  4D4N A;  2R7R A;  4IWB A;  3NRH A;  3U0C A;  3EGX A;  3FOP A;  4MQ9 F;  3C62 A;  5FCL A;  2GAQ A;  4N6H A;  1BBH A;  4DXW A;  5B3I A;  5L0G A;  1FMW A;  2XL6 A;  3ZTZ A;  3AGU A;  4XPY A;  2YVK A;  3MFN A;  2Q9B A;  4N4W A;  1LVK A;  4EKW A;  4KI2 A;  3U3B A;  1AVO B;  2WZG A;  1MNE A;  3HJC A;  4E17 A;  4LER A;  1BR1 A;  3AQB A;  1A41 A;  3MYI A;  4YN0 B;  1A7V A;  1TWG A;  2HUJ A;  5AGF A;  5JP7 A;  4NTA A;  3ZIB A;  3RF3 A;  3F46 A;  2P7V A;  5DQZ A;  2EIJ C;  3AG4 C;  3C8Z A;  3EHM A;  1OW8 A;  2GA0 A;  4U5F E;  2YRF A;  4IB4 A;  1BR2 A;  3OWT A;  4NCQ A;  3TOL A;  1A7E A;  5KYU B;  1Z6A A;  2J8W A;  2NSG A;  4BPM A;  3UMH A;  2IM8 A;  4XEK A;  5KYN A;  3E9V A;  1VYK A;  4MTG A;  4EBJ A;  2J9B A;  2XLE A;  4ANJ A;  2ZXP A;  4C3B A;  2FAP B;  3FMS A;  1V55 C;  3DAG A;  2W9Y A;  1H7I A;  3Q6N A;  1H9G A;  4DJ9 A;  3DAF A;  3JT1 A;  2YHS A;  1YYJ A;  2B0H A;  3WG7 C;  1PD1 A;  2Q7R A;  1C02 A;  1G5Z A;  3C63 A;  2LFF A;  2OJQ A;  2OU6 A;  3GM1 A;  1S7Z A;  4OIR F;  5AC5 A;  3WHN A;  4CS9 C;  5A69 A;  2OEV A;  2W4B A;  1OCZ C;  3PMR A;  3R7C A;  5JVE A;  5KYU A;  1CGN A;  1LPE A;  4BJ6 C;  1VOM A;  3LEO A;  3U2L A;  2CCY A;  3DE9 A;  1OW6 A;  1XZQ A;  3NMK A;  5TJ5 E;  3U5S A;  3GEI A;  1GGQ A;  2D4U A;  3ECS A;  3KMI A;  2H7V C;  3PCV A;  4RD9 A;  4ULW A;  2CYD A;  1Q0K A;  3X2Q C;  4UDV A;  2CW0 F;  5A6J A;  3FOO A;  5GPG B;  2EIN C;  1UFB A;  3NYL A;  3W2V A;  2WVO A;  4U5B E;  1G8X A;  3EG9 B;  4U5D E;  4XPW A;  3K66 A;  4H54 A;  1NSG B;  1TKN A;  3U9M A;  3V5X A;  2AWY A;  1VTM P;  4MVR A;  1Z3I X;  4XPX A;  1HMO A;  1OKK D;  2JX0 A;  4I1O B;  2JD3 A;  5DS4 A;  3NMI A;  4CX9 A;  2OEX A;  4BJ6 A;  1OW7 A;  1G4U S;  2LSE A;  3EQL F;  2LCH A;  3LNM B;  3LES A;  1EI7 A;  4YWQ A;  4YT2 A;  3CZ6 A;  2WVQ A;  1EA8 A;  3LS1 A;  1MND A;  2WZF A;  3H2U A;  3M15 A;  5L0I A;  4WGZ A;  1VLS A;  2Q00 A;  2VCB A;  3NYM A;  4U9D A;  1ZVZ A;  4XEF A;  3SNH A;  1FFT C;  2VCA A;  3M79 A;  5DS5 A;  2QUP A;  1MQV A;  3GWL A;  4W8K A;  4N6C A;  2IYL D;  5A6B A;  3EG9 A;  4XLP F;  2YL7 A;  2P6V A;  4XTK A;  3ZC4 A;  3GM2 A;  2YL1 A;  1R5I D;  3JSZ A;  2LD6 A;  5L3Q A;  4XQ1 A;  3V5Y A;  1SF8 A;  2KW3 C;  4JCZ A;  3I4U A;  4MVZ A;  1M56 C;  4KNV A;  3UGP A;  2CNW A;  4CJG A;  4LAC B;  3W4Y A;  2L81 A;  4PJN A;  2W4M A;  4CBE A;  1C17 M;  3M1C B;  2R03 A;  2V26 A;  1RKE B;  4IAQ A;  2HMZ A;  1FFH A;  3FAJ A;  1NG1 A;  1A0B A;  2YKZ A;  2H7O A;  4CS8 C;  1BZ4 A;  3OA1 A;  3HNJ A;  4Z9H A;  3VYW A;  1U6H A;  4YT5 A;  5HSW A;  4CSA C;  3IQT A;  2LP4 A;  2IBF A;  4AE4 B;  3TQO A;  1T5O A;  3S29 A;  3C8G B;  2YLD A;  4J32 B;  1QLE C;  3UMK A;  2ASR A;  3N2Z B;  2R9R B;  2P0N A;  3EFO B;  4WJ0 A;  4GQH A;  4DOZ A;  1A7D A;  1Q0F A;  1VB5 A;  2LK4 A;  3S0X A;  1NZE A;  1YDI A;  3EPV A;  1E85 A;  2Y3B A;  5COM A;  2XXA A;  3LUT B;  2L7A A;  1ORS C;  2L6H A;  2XM4 A;  2QY9 A;  2PBE A;  3GEH A;  1ZZP A;  4CDY A;  1RKE A;  3NMJ A;  4XLN F;  4CS8 A;  3KL4 A;  4IGG A;  4KC9 A;  3KYJ A;  5DVW A;  3ZWI A;  3T4R A;  3H2V A;  3M4C A;  4AE4 A;  1FAP B;  3I5P A;  1KTM A;  4MW3 A;  4O79 A;  3EFO A;  4LLE A;  3CEX A;  3L0I A;  2YL0 A;  1LS4 A;  3K33 A;  1OXB A;  4K0D A;  3G4Z A;  4FWV A;  4JZA A;  3VRC A;  5L0H A;  1H9T A;  1VYI A;  1OCC C;  1TWC A;  2A6H F;  4RDA A;  4DRI B;  3KYI A;  1LIH A;  2NPU A;  1G4W R;  2PP4 A;  2Y3D A;  1WAT A;  3O39 A;  3CQZ A;  2DYS C;  3S27 A;  5FZT A;  3JZ0 A;  3ZSU A;  2NG1 A;  1IW7 F;  1ZHW A;  4JJG A;  4KBL A;  1V54 C;  2WB7 A;  3Q7L A;  1V4A A;  2EPL X;  2KYH A;  4IRU A;  3EZH A;  5DS6 A;  4DVZ A;  3SXM A;  4OIP F;  2DYR C;  2Q3T A;  4M63 A;  2QLA A;  2OG2 A;  2LFD A;  2GFH A;  2NUP B;  1T6I A;  2XLV A;  2IXO A;  4DRJ B;  1VK5 A;  1ZHX A;  2L6G A;  3B71 A;  3BEH A;  3QTH A;  4J30 B;  4Q7C A;  3RW0 A;  1QSP A;  1QVX A;  2R25 A;  4E18 A;  2RSE B;  1T6U A;  3IQ5 A;  2R7O A;  3US6 A;  2PX0 A;  4AL1 A;  3N24 A;  2G3K A;  2XM0 A;  2Q9A A;  4ZLD A;  3DI5 A;  3JTL O;  1FR0 A;  4LDQ A;  2G62 A;  1AEP A;  3MLG A;  2BE5 F;  2AP3 A;  2NUT B;  4G7O F;  3FXH A;  2YEV A;  3I5Q A;  3LEV A;  5BQH A;  1CGM E;  1GQA A;  1E84 A;  3ASN C;  3EH1 A;  2EIM C;  3GOD A;  2IXN A;  4NQF A;  1WWP A;  2NUP A;  4YL3 A;  3RKO F;  2VB6 A;  4EWC A;  3DD7 A;  4G7H F;  4C7O B;  4EIY A;  1JOG A;  4PJM A;  4JCH A;  4QDL A;  4YJW A;  1D0Z A;  3L1M A;  1GS9 A;  1NFN A;  3F47 A;  3RVZ A;  4NC3 A;  1JMW A;  2X0C A;  1C03 A;  3TJ5 A;  2BL2 A;  1ZHT A;  2EPO A;  2NUT A;  4F4B A;  2OQM A;  2XLM A;  4XWJ A;  5A6B D;  3WAQ A;  4OD5 A;  3DZA A;  4XEV A;  4NY3 A;  4PFO A;  2HFI A;  2EPN A;  5T3T A;  2L6F A;  3V7O A;  3K1H A;  3WOD F;  3L8J A;  5JRA A;  2CNW D;  4C7O A;  3TK0 A;  1J8Y F;  2NSF A;  4EBK A;  5BUO A;  2ZXO A;  3HNK A;  4CDA A;  1TQG A;  3DWW A;  4C3E A;  2A6E F;  1RJ9 B;  2VCC A;  1OQC A;  2I8B A;  4P6I C;  1SMY F;  3PHF 2;  2J45 A;  3EJN A;  2GDC A;  3DKA A;  3NYJ A;  1O5H A;  2PFD A;  3IHU A;  2V3C C;  1TFO B;  1L3P A;  2ETS A;  2LIG A;  2XLW A;  2WL8 A;  1NU9 C;  1U0B B;  3K1I C;  4E0H A;  5KYW B;  3JRM O;  1VLT A;  1D0X A;  3MYF A;  3AQC A;  1E83 A;  2ZXW C;  1LI7 A;  2PF4 E;  3KPH A;  3HNL A;  2FGY A;  4CS9 A;  1SZI A;  2B0J A;  4MVU A;  1Z7Q c;  3Q7G A;  3MX3 A;  1RJ9 A;  3GWN A;  1KU2 A;  2HSQ A;  1LM3 B;  2MHR A;  3AJM A;  1L7C A;  2CGE A;  3DXJ F;  1YA7 O;  4YL0 A;  5JS5 A;  1DOV A;  3BRJ A;  1RMV A;  1AUE A;  4B6I A;  2OKU A;  2ZPA A;  4A4A A;  2EPK X;  3QZC A;  4PFP A;  3EZI A;  4Q5S F;  1PD0 A;  2Q9C A;  3C8G D;  3LS0 A;  3QVZ A;  4MVM A;  1D1B A;  3CSK A;  5KYW A;  2EPM X;  5IY5 C;  4ZLC A;  1F1M A;  5E33 A;  2Y3H A;  2R7S A;  4CIH A;  1MMD A;  2VAS A;  4HFK B;  1Z23 A;  1JPJ A;  5B1A C;  4LDK A;  3FVY A;  1YLM A;  4PJJ A;  2XXA B;  2XL8 A;  2HKV A;  2WVN A;  1YYX A;  2LQG A;  4G0H A;  2KNH A;  5A6K A;  4ULV A;  1J8M F;  1ZW3 A;  2HV6 A;  2Y69 C;  3ATP A;  4O7G A;  4K7B A;  3U8P A;  2AU5 A;  4AK9 A;  2M4E A;  1OCO C;  2C04 A;  3K6B A;  3B29 A;  3KKB A;  2AVK A;  4O6Y A;  4JW1 A;  3U8V A;  2L9J A;  2IXM A;  1Y6D A;  4H4K C;  1RXQ A;  3VAY A;  3L8I A;  3JRT A;  2Y39 A;  1BDJ B;  3RIP A;  1ORJ A;  4OIO F;  2IXP A;  1CPQ A;  1JRA A;  3QW0 A;  4PR9 A;  1GM5 A;  3ASO C;  3VF0 A;  1TWH A;  2A0U A;  4WGY A;  2R7Q A;  4U5C E;  3TJ6 A;  3KH2 A;  4Q4Z F;  4CSA A;  5COG A;  4YL1 A;  1APC A;  4JUR I;  3RFY A;  1H6G A;  1Q0M A;  4JC7 A;  2IOQ A;  5BQI A;  1D1A A;  1E2X A;  1WTY A;  3OEO A;  2YQY A;  4OIQ F;  3B0U X;  2FFH A;  1YZC A;  4JEB A;  1XWJ A;  2J9W A;  1M57 C;  2R7U A;  5L0J A;  2YZS A;  4BJT A;  3SZR A;  3SXZ A;  1KNY A;  3K7D A;  4PK4 A;  2R02 A;  1OXK A;  4BJ5 C;  1N1C A;  1Y4C A;  2GWW A;  4JE9 A;  1OKK A;  2ZD9 A;  2AWC A;  1D0Y A;  5B1B C;  1BR4 A;  1WOL A;  1E86 A;  3C7J A;  3S9O A;  4EHP A;  1OR3 A;  3S84 A;  3AOU A;  4IAO A;  5AC4 A;  5B3S C;  1JR8 A;  4ER9 A;  5KYX B;  1TFK B;  3M4B A;  2J7P A;  1ZHZ A;  4JIO A;  3ZDL A;  1EQ1 A;  4BEJ A;  4MVQ A;  3ABM C;  4I1M A;  1LE4 A;  4RBN A;  4DBQ A;  2HV7 A;  3ZTM A;  3GOR A;  2Y3G A;  1YJG A;  4JJF A;  4JEA A;  3JYH A;  1LE2 A;  2J9U A;  1RCP A;  4YT4 A;  1Q0G A;  4FAP B;  1HE9 A;  3TUL A;  2R7X A;  4DVY P;  5HV9 A;  1WN0 A;  4G78 A;  3ZVR A;  2HJM A;  2QNL A;  1M2O A;  4O6N A;  2O9X A;  4EBB A;  2Z15 A;  5JUA A;  4L6R A;  4IAR A;  3NKD A;  4BG0 A;  4BJ1 A;  5F5F A;  4I44 A;  1YZA A;  3DE8 A;  3RH3 A;  3IEE A;  3SYN A;  2OOC A;  2R7W A;  1K05 A;  1PCX A;  2D5R B;  3EH2 A;  2HZ8 A;  3O10 A;  3Q6M A;  5KYX A;  2DGJ A;  1HW1 A;  2HSB A;  3FAP B;  3H65 A;  4N06 A;  2R7T A;  3L34 A;  2OCC C;  1RKC A;  4OIN F;  1NBB A;  3TOM A;  4PAC A;  2KQ9 A;  5F28 E;  1HW2 A;  3O55 A;  2CDQ A;  3IQC A;  5E2Q A;  5CIV A;  5L0F A;  5L0C A;  3DJN B;  1YAR O;  3AG1 C;  4MTF A;  4DBR A;  2H8A A;  5KYY B;  2EIK C;  3ZQV A;  4AL0 A;  2XLO A;  3ZQY A;  2X51 A;  2EIL C;  3HLZ A;  1WAS A;  5A6A A;  3O6X A;  1SR2 A;  5D91 A;  4E7Z A;  3W8I A;  2RD9 A;  4R32 A;  1M2V B;  5EK0 A;  3CAX A;  2I15 A;  3LNR A;  3U9J A;  5EHH A;  1W2W A;  3U3F A;  1R4T A;  3HKK A;  3NKE A;  4FES A;  4JTC B;  3ITF A;  3PDM P;  1UG7 A;  5K0I A;  5CI8 A;  5L0D A;  3MBG A;  4KNW A;  4W8P A;  4YT8 A;  3VM6 A;  1CGO A;  2KK1 A;  3UGO A;  2YLI A;  1LI5 A;  4NTF A;  1TWA A;  5KYY A;  4CJO A;  2J46 A;  2XSE A;  1Z63 A;  1CPR A;  1XZP A;  2JPU A;  3ABK C;  4LDR A;  3T6G B;  3T9O A;  1FMV A;  2H7B A;  1K04 A;  1M2V A;  1NLX A;  5D92 A;  3J06 A;  3DMD A;  3DM5 A;  2HMQ A;  1U89 A;  1S05 A;  1YAU O;  2VC9 A;  4ONS A;  1O87 A; 
#chains in the Genus database with same CATH homology
 2A1D D;  3SP1 A;  4OD4 A;  5T3W A;  1NU7 D;  1ZHY A;  3TD7 A;  3POV A;  3JCU Q;  3NG1 A;  5E3A A;  3N0T A;  3S28 A;  2VH3 A;  3LJB A;  4GYT A;  4QI2 A;  3HTK C;  3W2W A;  3X1O A;  3B0P A;  2E87 A;  3GAN A;  4U5G A;  2MYS A;  3UMI A;  3RYL A;  2A69 F;  4JVS A;  2C03 A;  3UNG C;  4G7Z F;  3UR3 C;  1ST6 A;  3FDQ A;  2KGO A;  4X0R A;  1LKX A;  4IJJ A;  2W45 A;  4E7S A;  2XL4 A;  3T6B A;  4LLC A;  2J7P D;  2QTV A;  1MMG A;  3T6J A;  3DM9 B;  5CI9 A;  4U5H A;  1QZX A;  3ABL C;  4HE8 D;  5L3V A;  2J0W A;  1OCR C;  2G3V A;  3AG2 C;  3EHN A;  1JPN A;  3AG3 C;  5F5H A;  4QI0 A;  4AX2 A;  5DLJ A;  5EGY A;  3B0V C;  3NDB B;  3DJU B;  4PJL A;  4CS7 A;  5E3C A;  2R7V A;  3QMK A;  1D1C A;  4C3D A;  2PX3 A;  4O6M A;  1WGW A;  1ZU5 A;  3EGD B;  2MWQ A;  4HEA J;  3SEO A;  1TR2 A;  2J9V A;  5DQT A;  4I3M A;  4A2N B;  1FTS A;  3LLI A;  1ZU4 A;  3ZG1 A;  4HFF B;  3EGX B;  1LS1 A;  2J0X A;  4U5E E;  3FHD A;  4BJ5 A;  1MMN A;  1Z5Z A;  4GEH A;  3EGD A;  3B9Q A;  1VMA A;  3E70 C;  4FX5 A;  3LAY A;  2WZL A;  5T1D B;  3W8H A;  1ZYR F;  1IZM A;  2XRH A;  3LLK A;  4MND A;  2A68 F;  1MMA A;  2KJG A;  2ZXR A;  2R7R A;  4IWB A;  3NRH A;  3EGX A;  4MQ9 F;  5FCL A;  1FMW A;  2Q9B A;  1LVK A;  2WZG A;  1MNE A;  3HJC A;  4LER A;  1BR1 A;  3AQB A;  4YN0 B;  1TWG A;  3ZIB A;  3F46 A;  2P7V A;  5DQZ A;  2EIJ C;  3AG4 C;  3EHM A;  4U5F E;  1BR2 A;  3OWT A;  5KYU B;  1Z6A A;  3UMH A;  5KYN A;  3E9V A;  1VYK A;  4ANJ A;  2ZXP A;  4C3B A;  1V55 C;  3DAG A;  2W9Y A;  3Q6N A;  3DAF A;  3JT1 A;  2YHS A;  3WG7 C;  1PD1 A;  4OIR F;  3PHF 2;  1S7Z A;  4CS9 C;  2W4B A;  1OCZ C;  3PMR A;  5KYU A;  4BJ6 C;  1VOM A;  4RD9 A;  3KMI A;  4ULW A;  3ECS A;  2H7V C;  4KI2 A;  3X2Q C;  2CW0 F;  2EIN C;  3NYL A;  3W2V A;  2WVO A;  4U5B E;  1G8X A;  3EG9 B;  4U5D E;  3K66 A;  1TKN A;  1Z3I X;  1OKK D;  4I1O B;  2JD3 A;  5DS4 A;  4XLP F;  4BJ6 A;  3EQL F;  2LSE A;  4YWQ A;  3LES A;  4YT2 A;  3CZ6 A;  2WVQ A;  3LS1 A;  1MND A;  2WZF A;  3NYM A;  3SNH A;  1FFT C;  5DS5 A;  4W8K A;  2IYL D;  3EG9 A;  4XTK A;  2P6V A;  3ZC4 A;  3JSZ A;  5L3Q A;  1SF8 A;  2KW3 C;  3I4U A;  1M56 C;  4KNV A;  3UGP A;  2CNW A;  4LAC B;  2L81 A;  4PJN A;  2W4M A;  4CBE A;  3M1C B;  2V26 A;  1FFH A;  3FAJ A;  1NG1 A;  2H7O A;  4CS8 C;  3OA1 A;  3VYW A;  4CSA C;  4YT5 A;  5HSW A;  4AE4 B;  3S29 A;  4J32 B;  1QLE C;  3UMK A;  3N2Z B;  3EFO B;  4WJ0 A;  4DOZ A;  1NZE A;  3EPV A;  2Y3B A;  2XXA A;  2QY9 A;  4XLN F;  4CS8 A;  3KL4 A;  4KC9 A;  5DVW A;  3T4R A;  4AE4 A;  3I5P A;  4O79 A;  3EFO A;  4LLE A;  3L0I A;  4K0D A;  3K33 A;  4FWV A;  4JZA A;  1VYI A;  1OCC C;  1TWC A;  2A6H F;  4RDA A;  2Y3D A;  2PP4 A;  3O39 A;  3CQZ A;  2DYS C;  3S27 A;  3ZSU A;  2NG1 A;  1IW7 F;  1ZHW A;  4JJG A;  4KBL A;  1V54 C;  2WB7 A;  3Q7L A;  4IRU A;  5DS6 A;  4OIP F;  3EZH A;  4DVZ A;  2DYR C;  2Q3T A;  4M63 A;  2OG2 A;  2GFH A;  2NUP B;  2IXO A;  3S0X A;  1VK5 A;  1ZHX A;  4Q7C A;  4J30 B;  2R7O A;  2PX0 A;  3N24 A;  2G3K A;  2Q9A A;  4ZLD A;  2G62 A;  3MLG A;  2BE5 F;  2NUT B;  4G7O F;  2YEV A;  3I5Q A;  3LEV A;  3ASN C;  3EH1 A;  2EIM C;  3GOD A;  2IXN A;  4EWC A;  2NUP A;  3RKO F;  2VB6 A;  4G7H F;  3DD7 A;  4C7O B;  4PJM A;  4JCH A;  4QDL A;  4YJW A;  1D0Z A;  3F47 A;  1ZHT A;  2NUT A;  4F4B A;  4XWJ A;  4OD5 A;  3DZA A;  4NY3 A;  4PFO A;  5T3T A;  3V7O A;  3K1H A;  3WOD F;  2CNW D;  4C7O A;  1J8Y F;  5BUO A;  2ZXO A;  4C3E A;  2A6E F;  1RJ9 B;  2I8B A;  4P6I C;  1SMY F;  2J45 A;  3EJN A;  3NYJ A;  1O5H A;  2PFD A;  2V3C C;  2WL8 A;  1NU9 C;  3K1I C;  5KYW B;  1D0X A;  3AQC A;  2ZXW C;  2PF4 E;  2FGY A;  4CS9 A;  1SZI A;  2B0J A;  3Q7G A;  3MX3 A;  1RJ9 A;  1KU2 A;  2CGE A;  3DXJ F;  4B6I A;  2ZPA A;  3QZC A;  4PFP A;  3EZI A;  4Q5S F;  1PD0 A;  2Q9C A;  5KYW A;  3LS0 A;  1D1B A;  3CSK A;  5IY5 C;  4ZLC A;  5E33 A;  2Y3H A;  2R7S A;  4CIH A;  1MMD A;  2VAS A;  4HFK B;  1Z23 A;  1JPJ A;  5B1A C;  3FVY A;  4PJJ A;  2XXA B;  2WVN A;  4G0H A;  2KNH A;  1J8M F;  2HV6 A;  4AK9 A;  2Y69 C;  4O7G A;  4K7B A;  2M4E A;  1OCO C;  2C04 A;  3K6B A;  3KKB A;  4O6Y A;  4JW1 A;  2L9J A;  2IXM A;  4H4K C;  3VAY A;  3JRT A;  2Y39 A;  3RIP A;  4OIO F;  2IXP A;  3ASO C;  1TWH A;  2R7Q A;  4U5C E;  3KH2 A;  4Q4Z F;  4CSA A;  3RFY A;  4JUR I;  2IOQ A;  1D1A A;  3OEO A;  4OIQ F;  3B0U X;  2FFH A;  2J9W A;  1M57 C;  2R7U A;  2YZS A;  4BJT A;  3SZR A;  3K7D A;  4PK4 A;  4BJ5 C;  1N1C A;  1OKK A;  1D0Y A;  5B1B C;  1BR4 A;  4IAO A;  5B3S C;  5KYX B;  2J7P A;  1ZHZ A;  4BEJ A;  4DBQ A;  3ABM C;  4I1M A;  4RBN A;  2HV7 A;  2Y3G A;  4JJF A;  3JYH A;  2J9U A;  4YT4 A;  2R7X A;  4DVY P;  4EBB A;  3ZVR A;  4O6N A;  1M2O A;  2O9X A;  5F5F A;  2Z15 A;  4BJ1 A;  3NKD A;  4BG0 A;  4I44 A;  3RH3 A;  3SYN A;  2R7W A;  3IEE A;  2D5R B;  1PCX A;  3EH2 A;  3Q6M A;  5KYX A;  2DGJ A;  3H65 A;  4N06 A;  2R7T A;  3L34 A;  2OCC C;  4OIN F;  2KQ9 A;  2CDQ A;  5E2Q A;  3DJN B;  3AG1 C;  4DBR A;  5KYY B;  2EIK C;  2X51 A;  2EIL C;  3HLZ A;  3O6X A;  5D91 A;  4E7Z A;  3W8I A;  1M2V B;  3LNR A;  5EHH A;  1W2W A;  3NKE A;  4FES A;  3ITF A;  5CI8 A;  4KNW A;  4YT8 A;  3UGO A;  1TWA A;  5KYY A;  2J46 A;  2XSE A;  1Z63 A;  3ABK C;  1FMV A;  2H7B A;  1M2V A;  5D92 A;  3DMD A;  3DM5 A;  1O87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...