3GM1A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2 in complex with paxillin ld4 motif-derived peptides
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
140
structure length
140
Chain Sequence
PTANLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Protein tyrosine kinase 2 beta
publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm1A00
2JX0A 4EBJA 1OW7A 2L6FA 3TULA 3U0CA 2PBEA 1K05A 3C18A 3AJMA 3GM3A 3K7DA 3MFNA 3RQGA 4XEVA 1KNYA 1WTYA 2HSBA 3GM2A 2L6GA 3GM1A 2JPUA 5F28E 1UFBA 2LK4A 3JYYA 1PV3A 1WWPA 3U3FA 3RQFA 3C8GB 3L8JA 1O3UA 4EBKA 1OW8A 2Q00A 4NQFA 3S9OA 3C8GD 4XEKA 3O10A 3JZ0A 3C8GA 3B71A 3BRJA 4R32A 1WOLA 1V4AA 3L8IA 3RQEA 2L6HA 2KK1A 1K40A 1JOGA 2YWAA 4XEFA 1QVXA 1K04A 1KTMA 1ZZPA 1OW6A
chains in the Genus database with same CATH superfamily
2A6HF 2J8WA 2ZXPA 4G7OF 3F47A 2EIJC 1TWHA 2A6EF 3C62A 1YLMA 4JC7A 4CJOA 2XLWA 3GANA 4Z9IA 1EA8A 2AU5A 1OR2A 4NTFA 3ABKC 4O6NA 4A4AA 5JLIA 2J7PA 4MNDA 1CGNA 3AG1C 5E3CA 5L0IA 1EKYA 1AUEA 4AE4B 3K6BA 3RIPA 3RQFA 3SXZA 2Y3HA 1QQ3A 3GODA 1OW8A 2HV6A 3MX3A 2CNWD 2W4MA 4YWQA 3UGPA 4M63A 4WGYA 5DLJA 3R7CA 3DAGA 3LNRA 1WN0A 5JT4A 2AWCA 2P0NA 4KNWA 2LIGA 1PCXA 4JCHA 3B0VC 3AG4C 2XLEA 2DI3A 3ZIBA 4U5GA 3U9MA 3ZQYA 5CIVA 4A2NB 1QZXA 3V5ZA 1V54C 4XQ1A 3X1OA 3JSEO 5T3TA 4AL1A 2X0CA 1YZCA 1ZHTA 4CS8C 3L0IA 3O55A 1RCPA 3RFYA 1T6QA 4YJWA 3X2QC 1L7CA 3FOOA 4G0HA 4MS2A 3RKOF 4DRJB 5E2QA 2R7UA 2YHSA 2B0JA 4BJ5C 3EZHA 3OA1A 1HW2A 4IWBA 2OKUA 5JSLA 3DD7A 3EPVA 5K0IA 4KI2A 1YDIA 2J9BA 3CAXA 3EGXB 4EBKA 4OIQF 1ZVZA 4PJNA 4D4NA 5B1BC 2YL3A 1T01A 2WZGA 3U2MA 5DVWA 2XM0A 3HKKA 1FFTC 2HMQA 1IW7F 3O39A 1H6GA 1OQCA 1Y6DA 4R32A 1FFHA 3L8IA 1EQ1A 2QLAA 5COFA 1FR0A 3NKEA 4LLEA 5A6KA 4DRIB 1KTMA 1H7IA 3RF3A 2ZXOA 2J9UA 2QUPA 1RKEA 1TFKB 4PFOA 2L9JA 3U0CA 3KMIA 4W8KA 4CS7A 1HE9A 3JT1A 3NG1A 2CW0F 3CEXA 2J7PD 2YLGA 4KNVA 4N4WA 4K7BA 2DB4A 5F28E 4CDYA 3L34A 1Z23A 2EINC 1NU9C 1XZPA 3KYIA 1V55C 2OEXA 5CI9A 4YN0B 2IXPA 3IQ5A 3QW1A 3ZSUA 4PJLA 5T3WA 2J45A 1ZU4A 4H4KC 2KC3A 1OCRC 3NYLA 4EHPA 1LPEA 4U5CE 1Z6AA 3EFOB 1J8MF 2LFFA 2C03A 4U5BE 5BUOA 1HY5A 4DBRA 3TJ6A 3WAQA 4EKWA 1D1BA 1ZHWA 1L3PA 2ZD9A 1A7DA 3M1CB 1LE2A 4C3BA 5EHHA 3G4XA 4DJ9A 1JPNA 2KGOA 5KYUB 2P7VA 1FTSA 3KYJA 3TULA 2L81A 3QZCA 2Q9CA 4ZLCA 4U5DE 4JJFA 2YVKA 3JSZA 4YT5A 2R7WA 3EH1A 2XLOA 2Q3TA 3V7OA 3S90A 1WTYA 2KJGA 3ABMC 3GEIA 3HNLA 5KYXB 1ST6A 3AG3C 4NC3A 1C02A 3NKDA 2F22A 1M2VB 2C04A 2IYLD 2Y69C 3NDBB 2Y3GA 2XRHA 1SF8A 3SXMA 2LFDA 2LQGA 3EGDB 1QSPA 2IXMA 4C7OA 4UDVA 4W8PA 1F1MA 5FCLA 2CNWA 2R7OA 3TJ5A 2NUPA 4JTAB 4CS9A 1VMAA 4U9EA 5COMA 1OCCC 1BBHA 3RVZA 3MYFA 3ZC4A 3DE8A 4EUKB 4XLPF 2HJMA 1LM3B 1YAUO 3MYIA 2CDQA 2ASRA 1QLEC 1TWGA 2W9YA 3CZ6A 3K66A 3NMJA 4I3MA 4Z9JA 1ZYRF 3SXKA 3VAYA 3AOUA 3EH2A 4WJ0A 5D91A 1KNYA 3FAPB 2CYDA 3ZG1A 3EQLF 1DOWA 1I4ZA 2A68F 2R03A 2L6GA 1ZHZA 2JPUA 3NMKA 4J30B 2WZLA 2EPOA 2FAPB 3I5QA 1JMWA 1VLSA 3SYNA 1T9KA 1VYKA 4MVZA 4CDAA 4DVYP 1APCA 1ZU5A 2HV7A 2CGEA 1OCOC 3H2UA 4MVRA 3ZDLA 2R25A 2V3CC 2YLIA 4PK4A 5A6AA 2R7QA 4AE4A 5B3SC 4OD4A 2XXAB 1CGOA 4Q7CA 4ANJA 4K1OA 2R7VA 2P6VA 4GEHA 2DGJA 3RQEA 2KK1A 2ZXWC 4AK9A 1FNTc 1NBBA 4NTAA 2GAQA 1A0BA 3EZIA 3IEEA 3U8VA 1AVOB 1Q0FA 5JRAA 2Y3DA 2YL1A 2I15A 3RH3A 3Q7GA 2OJED 1NFNA 3WODF 5E3AA 3AJMA 5EGYA 3N2ZB 1YYJA 1BR1A 2BC5A 2WVNA 2H7VC 1D0XA 1AEPA 4NTBA 3ATPA 4MVQA 5B1AC 1NLXA 1RJ9B 1PD1A 4MW8A 5A6BA 1MQVA 5DQZA 2Q00A 4LDKA 3GWNA 4JEBA 5F5HA 5BQHA 3U9JA 2IOQA 3IPMO 4QI0A 3KL4A 1YA9A 1NZEA 1OCZC 3EGXA 3QMKA 3S0XA 2G3VA 1D0YA 2V26A 3S29A 2P1AA 2HS5A 1K40A 4X0RA 3ITFA 4OINF 3GM1A 3EHNA 2J46A 2M4EA 4CJGA 1M2OA 3AQBA 3DAFA 4MQ9F 3HLZA 4CIHA 1M6TA 1LS1A 5IY5C 4EBBA 2J0XA 3DWWA 3EG9B 4JZAA 1HMOA 3VF0A 1M57C 2XLDA 3MFNA 4ONSA 1OKKA 5DS6A 2HSBA 1RMVA 4GQHA 1WATA 4G78A 3BEHA 1N1CA 3LLKA 3OEOA 4C3EA 4CSAA 3OWTA 3T4RA 2FGYA 3Q7LA 2IBFA 3U3BA 1YYXA 4DBQA 1C03A 3C8GB 1RXQA 4BEJA 5L3VA 2R05A 2WVOA 3GORA 4YL0A 1HE1A 1DOVA 3SXYA 5HSWA 5T1DB 1ORJA 2AP3A 4ER9A 1R5ID 3MLGA 5GPGB 3B0UX 4E17A 2UUIA 2HKVA 1GGQA 2L7AA 3GEHA 3NMIA 4CS9C 2AVKA 3JTLO 2NPUA 1MMGA 4CBEA 4DXWA 4F4BA 4BJ1A 3LS0A 2E87A 2EPNA 3EFOA 4CIPA 2JX0A 2NG1A 5DQTA 2HZ8A 2I8BA 1LS4A 3K33A 2NUTB 3R2PA 3I5PA 1D1CA 1LIHA 3ZTZA 1GQAA 2VCAA 3EJNA 5KYUA 2MWQA 5KYNA 2M64A 3HNIA 4IAOA 3SZRA 4ZLDA 1TQGA 2KW3C 4IAQA 4JRZA 3AGTA 5A6BD 1WWPA 1JAFA 3HNJA 1A7VA 2EPLX 2PP4A 4MTOA 4HEAJ 5CI8A 3L8JA 3IQ6A 3T6GB 4YT4A 5KYXA 1LVKA 2O9XA 2WVQA 1U89A 3H65A 3DXJF 4JIOA 4N6HA 3T9OA 1M2VA 1ZW3A 4JVSA 3B71A 4WABA 3ZVRA 4LDQA 3TK0A 2MYSA 4EWCA 1E86A 4I1MA 1XWJA 1JPJA 1NG1A 3EGDA 2QE9A 2Y39A 1OW6A 4MVMA 1Z7Qc 3NRHA 2GA0A 4BJ6A 4FWVA 2YEVA 4Q5SF 3DM5A 1G8XA 2YLDA 1K05A 1OKKD 3C18A 4HFKB 4OD5A 1Q0MA 3UMIA 4YT8A 4GYTA 2XXAA 4DRHB 2OQMA 3UNGC 4PR9A 2KSFA 3A11A 3QVZA 2LCHA 1B68A 4JTCB 3S84A 3ABLC 4E7SA 4E7ZA 3DKAA 3W2WA 1IZMA 3K1HA 1O3UA 2GDCA 3ZWIA 5L3QA 2PX0A 4AL0A 3LAYA 4JW1A 2H7BA 1RKEB 1VYIA 1VTMP 3C8ZA 3FXHA 1G5ZA 1YVIA 1Z63A 1JOGA 2EIMC 2EIKC 2YWAA 4IJJA 4IB4A 4JTDB 3T6BA 2ICWG 2EPMX 2OEVA 2VB6A 3B29A 4PJMA 5E33A 5JVEA 1E85A 2XS1A 3NYJA 1H9TA 1T5OA 3K1IA 4IRUA 4O79A 1Q0DA 3V5XA 1TR2A 1U0BB 1H9GA 1NU7D 1T6UA 3GM3A 3TQOA 3LEVA 2YL0A 5F5FA 2KNHA 4OIOF 5A6JA 2PF4E 2BL2A 3FAJA 3LNMB 2HMZA 1E83A 1J8YF 1UFBA 1W2WA 5KYWB 3M15A 4CSAC 4XLNF 2BE5F 2LSEA 2LK4A 2LP4A 1CPRA 4ULWA 5EK0A 4L6RA 1LI7A 4NY3A 3I4UA 4MTGA 3DM9B 3TOLA 2R7SA 3IQCA 3S27A 2HFIA 4I44A 1YA7O 3Q6MA 2A69F 3S9OA 3N24A 4YL3A 4AX2A 2UUHA 4XEKA 4EIYA 4HFFB 1RJ9A 2RSEB 4FESA 2L6HA 1C17M 4BEMJ 1SZIA 4H54A 2FFHA 1O5HA 1YARO 2H8AA 3ASOC 4MVSA 2PNOA 4XEFA 4J7YA 4JE9A 3WG7C 4BG0A 1BR4A 5DS5A 4YL1A 3FMSA 4QDLA 4XPYA 1R4TA 2PBEA 3CSKA 3GWLA 2Q7RA 4U5FE 3AGUA 1ORYA 3DJUB 3U5SA 3GM2A 2GFHA 3FHDA 1M56C 2KYHA 3EG9A 3FOPA 4E0IA 1Q0KA 3TD7A 3HTKC 4DVZA 5D92A 1VLTA 3SEOA 3LUTB 3HJCA 3U3FA 5DS4A 5KYYB 4OIRF 5L0JA 4J7TA 2AWYA 1WGWA 4QI2A 3ECSA 3VYWA 2KQ9A 4NQFA 2Y3BA 4YK5A 1TWAA 1EI7A 2XLMA 3G4ZA 5BQIA 4MTFA 2WL8A 2EILC 3C8GA 4KC9A 1KU2A 2Q9AA 4O6YA 5AC4A 3PCVA 5L0DA 1YZAA 4Z9HA 3DJNB 5AGFA 3RW0A 3IHUA 1QKRA 1JRAA 3G50A 3NYMA 3O6XA 2J0WA 1T6IA 2L6FA 4N6CA 5JP7A 4BJ6C 3UGOA 3B0PA 2A0UA 2MHRA 4FAPB 1MNEA 2YRFA 2EPKX 4U5EE 2XL4A 3RVYA 1Q0GA 3JCUQ 5COGA 2NUTA 3JRTA 3DI5A 1E2XA 3M4CA 1YJGA 2J9WA 1PV3A 2R9RB 2QNLA 4G7HF 2NSFA 3DE9A 4XPWA 1CGME 2HSQA 4PACA 2YZSA 3EHMA 4HE8D 5TJ5E 4N06A 1I5NA 4JURI 256BA 3JZ0A 4CDVA 5L0HA 3BRJA 2R7RA 2VASA 2NSGA 1MMDA 1V4AA 2G3KA 2XLVA 2OCCC 4B6IA 1NSGB 2ZPAA 3C63A 3SP1A 3POVA 2GWWA 3K1IC 5BQGA 4C3DA 1FAPB 2OJQA 1VOMA 3B9QA 4D4XA 1G4US 1MMAA 3VRCA 4KBLA 3KKBA 4J32B 4JEAA 2VH3A 2P61A 4LDRA 2XL6A 4XEVA 5AC5A 2IM8A 4K0DA 3ZQVA 2DYSC 5A69A 1GM5A 1I4YA 3U2LA 5L0CA 3V5YA 2PFDA 3W4YA 3C8GD 1V74B 4RD9A 3TOMA 3W2VA 1S7ZA 2YL7A 3FVYA 3PMRA 1WOLA 2XM4A 4XWJA 4E0HA 1SMYF 4LACB 1O87A 1RKCA 2A0BA 3ZTMA 3PHF2 1QVXA 2ETSA 3W8HA 4XPXA 3IQTA 4LLCA 4EBJA 2Q4FA 3DMDA 3UMHA 1ZHXA 5L0FA 3AQCA 1S05A 1PD0A 2WB7A 3E70C 4WGZA 3WHNA 4U5HA 2XS8A 4Q4ZF 4OIPF 1VB5A 3UMKA 1FMWA 1UG7A 4PFPA 2VCBA 3LLIA 2QY9A 3HNKA 1CPQA 2Z15A 4FX5A 3JYYA 3GEEA 4RDAA 1D1AA 1SYQA 2ZXRA 2PX3A 4BJTA 4E18A 1Y4CA 4I1OB 3M79A 2X51A 2YKZA 3QTHA 2B0HA 1A7EA 5KYWA 1U6HA 1D0ZA 3N0TA 1LKXA 1ZHYA 5JUAA 2QTVA 3LEOA 3O10A 5JS5A 2R02A 4MVUA 2R7TA 3Q6NA 1Z3IX 4JJGA 4G7ZF 3SNHA 2OOCA 1K04A 4O6MA 4P9FA 1VK5A 1A41A 3W8IA 1OW7A 1HMDA 1ORSC 2JD3A 3LESA 4JCZA 1GS9A 4CS8A 2H7OA 1TKNA 5L0GA 4YT2A 1LE4A 2J9VA 2VCCA 3RQGA 3E9VA 4XTKA 4DOZA 2TMVP 2R7XA 2HUJA 2LD6A 3M4BA 4BPMA 2YQYA 4IGGA 3F46A 1E84A 1BZ4A 3J06A 4BJ5A 3QVYA 3VM6A 1TFOB 1TWCA 2OU6A 1FMVA 1BDJB 3DZAA 4RBNA 3UR3C 3CQZA 1NFOA 3KH2A 4P9TA 4JKVA 5KYYA 1Z5ZA 4CX9A 4MVOA 1WASA 1OR3A 1JR8A 3MBGA 1OXBA 2W4BA 3T6JA 3QW0A 3FDQA 3S28A 1OXKA 1MNDA 1BR2A 2IXOA 1XZQA 2IXNA 1SR2A 5B3IA 2XSEA 4P6IC 4ULVA 2A1DD 3K7DA 1LI5A 2RD9A 4U9DA 5HV9A 2DYRC 3C7JA 2WZFA 3A9CA 4NCQA 4LERA 1QPUA 2D5RB 2XLHA 2Q9BA 3RYLA 3US6A 4C7OB 3JYHA 3LS1A 4MW3A 1MMNA 1ZW2A 3ASNC 1G4WR 2NUPB 3AG2C 3L1MA 3LJBA 2W45A 2CCYA 4PJJA 5FZTA 2OG2A 1HW1A 3JRMO 4O7GA 3U8PA 3PDMP 2VC9A 4IARA 2D4UA 2G62A 2HJ3A 3H2VA 1ZZPA 3KPHA 2XL8A
chains in the Genus database with same CATH topology
2JX0A 4EBJA 1OW7A 2L6FA 3TULA 3U0CA 2PBEA 1K05A 3C18A 3AJMA 3GM3A 3K7DA 3MFNA 3RQGA 4XEVA 1KNYA 1WTYA 2HSBA 3GM2A 2L6GA 3GM1A 2JPUA 5F28E 1UFBA 2LK4A 3JYYA 1PV3A 1WWPA 3U3FA 3RQFA 3C8GB 3L8JA 1O3UA 4EBKA 1OW8A 2Q00A 4NQFA 3S9OA 3C8GD 4XEKA 3O10A 3JZ0A 3C8GA 3B71A 3BRJA 4R32A 1WOLA 1V4AA 3L8IA 3RQEA 2L6HA 2KK1A 1K40A 1JOGA 2YWAA 4XEFA 1QVXA 1K04A 1KTMA 1ZZPA 1OW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JX0 A;  4EBJ A;  1OW7 A;  2L6F A;  3TUL A;  3U0C A;  2PBE A;  1K05 A;  3C18 A;  3AJM A;  3GM3 A;  3K7D A;  3MFN A;  3RQG A;  4XEV A;  1KNY A;  1WTY A;  2HSB A;  3GM2 A;  2L6G A;  3GM1 A;  2JPU A;  5F28 E;  1UFB A;  2LK4 A;  3JYY A;  1PV3 A;  1WWP A;  3U3F A;  3RQF A;  3C8G B;  3L8J A;  1O3U A;  4EBK A;  1OW8 A;  2Q00 A;  4NQF A;  3S9O A;  3C8G D;  4XEK A;  3O10 A;  3JZ0 A;  3C8G A;  3B71 A;  3BRJ A;  4R32 A;  1WOL A;  1V4A A;  3L8I A;  3RQE A;  2L6H A;  2KK1 A;  1K40 A;  1JOG A;  2YWA A;  4XEF A;  1QVX A;  1K04 A;  1KTM A;  1ZZP A;  1OW6 A; 
#chains in the Genus database with same CATH topology
 2A6H F;  2J8W A;  2ZXP A;  4G7O F;  3F47 A;  2EIJ C;  1TWH A;  2A6E F;  3C62 A;  1YLM A;  4JC7 A;  4CJO A;  2XLW A;  3GAN A;  4Z9I A;  1EA8 A;  2AU5 A;  1OR2 A;  4NTF A;  3ABK C;  4O6N A;  4A4A A;  5JLI A;  2J7P A;  4MND A;  1CGN A;  3AG1 C;  5E3C A;  5L0I A;  1EKY A;  1AUE A;  4AE4 B;  3K6B A;  3RIP A;  3RQF A;  3SXZ A;  2Y3H A;  1QQ3 A;  3GOD A;  1OW8 A;  2HV6 A;  3MX3 A;  2CNW D;  2W4M A;  4YWQ A;  3UGP A;  4M63 A;  4WGY A;  5DLJ A;  3R7C A;  3DAG A;  3LNR A;  1WN0 A;  5JT4 A;  2AWC A;  2P0N A;  4KNW A;  2LIG A;  1PCX A;  4JCH A;  3B0V C;  3AG4 C;  2XLE A;  2DI3 A;  3ZIB A;  4U5G A;  3U9M A;  3ZQY A;  5CIV A;  4A2N B;  1QZX A;  3V5Z A;  1V54 C;  4XQ1 A;  3X1O A;  3JSE O;  5T3T A;  4AL1 A;  2X0C A;  1YZC A;  1ZHT A;  4CS8 C;  3L0I A;  3O55 A;  1RCP A;  3RFY A;  1T6Q A;  4YJW A;  3X2Q C;  1L7C A;  3FOO A;  4G0H A;  4MS2 A;  3RKO F;  4DRJ B;  5E2Q A;  2R7U A;  2YHS A;  2B0J A;  4BJ5 C;  3EZH A;  3OA1 A;  1HW2 A;  4IWB A;  2OKU A;  5JSL A;  3DD7 A;  3EPV A;  5K0I A;  4KI2 A;  1YDI A;  2J9B A;  3CAX A;  3EGX B;  4EBK A;  4OIQ F;  1ZVZ A;  4PJN A;  4D4N A;  5B1B C;  2YL3 A;  1T01 A;  2WZG A;  3U2M A;  5DVW A;  2XM0 A;  3HKK A;  1FFT C;  2HMQ A;  1IW7 F;  3O39 A;  1H6G A;  1OQC A;  1Y6D A;  4R32 A;  1FFH A;  3L8I A;  1EQ1 A;  2QLA A;  5COF A;  1FR0 A;  3NKE A;  4LLE A;  5A6K A;  4DRI B;  1KTM A;  1H7I A;  3RF3 A;  2ZXO A;  2J9U A;  2QUP A;  1RKE A;  1TFK B;  4PFO A;  2L9J A;  3U0C A;  3KMI A;  4W8K A;  4CS7 A;  1HE9 A;  3JT1 A;  3NG1 A;  2CW0 F;  3CEX A;  2J7P D;  2YLG A;  4KNV A;  4N4W A;  4K7B A;  2DB4 A;  5F28 E;  4CDY A;  3L34 A;  1Z23 A;  2EIN C;  1NU9 C;  1XZP A;  3KYI A;  1V55 C;  2OEX A;  5CI9 A;  4YN0 B;  2IXP A;  3IQ5 A;  3QW1 A;  3ZSU A;  4PJL A;  5T3W A;  2J45 A;  1ZU4 A;  4H4K C;  2KC3 A;  1OCR C;  3NYL A;  4EHP A;  1LPE A;  4U5C E;  1Z6A A;  3EFO B;  1J8M F;  2LFF A;  2C03 A;  4U5B E;  5BUO A;  1HY5 A;  4DBR A;  3TJ6 A;  3WAQ A;  4EKW A;  1D1B A;  1ZHW A;  1L3P A;  2ZD9 A;  1A7D A;  3M1C B;  1LE2 A;  4C3B A;  5EHH A;  3G4X A;  4DJ9 A;  1JPN A;  2KGO A;  5KYU B;  2P7V A;  1FTS A;  3KYJ A;  3TUL A;  2L81 A;  3QZC A;  2Q9C A;  4ZLC A;  4U5D E;  4JJF A;  2YVK A;  3JSZ A;  4YT5 A;  2R7W A;  3EH1 A;  2XLO A;  2Q3T A;  3V7O A;  3S90 A;  1WTY A;  2KJG A;  3ABM C;  3GEI A;  3HNL A;  5KYX B;  1ST6 A;  3AG3 C;  4NC3 A;  1C02 A;  3NKD A;  2F22 A;  1M2V B;  2C04 A;  2IYL D;  2Y69 C;  3NDB B;  2Y3G A;  2XRH A;  1SF8 A;  3SXM A;  2LFD A;  2LQG A;  3EGD B;  1QSP A;  2IXM A;  4C7O A;  4UDV A;  4W8P A;  1F1M A;  5FCL A;  2CNW A;  2R7O A;  3TJ5 A;  2NUP A;  4JTA B;  4CS9 A;  1VMA A;  4U9E A;  5COM A;  1OCC C;  1BBH A;  3RVZ A;  3MYF A;  3ZC4 A;  3DE8 A;  4EUK B;  4XLP F;  2HJM A;  1LM3 B;  1YAU O;  3MYI A;  2CDQ A;  2ASR A;  1QLE C;  1TWG A;  2W9Y A;  3CZ6 A;  3K66 A;  3NMJ A;  4I3M A;  4Z9J A;  1ZYR F;  3SXK A;  3VAY A;  3AOU A;  3EH2 A;  4WJ0 A;  5D91 A;  1KNY A;  3FAP B;  2CYD A;  3ZG1 A;  3EQL F;  1DOW A;  1I4Z A;  2A68 F;  2R03 A;  2L6G A;  1ZHZ A;  2JPU A;  3NMK A;  4J30 B;  2WZL A;  2EPO A;  2FAP B;  3I5Q A;  1JMW A;  1VLS A;  3SYN A;  1T9K A;  1VYK A;  4MVZ A;  4CDA A;  4DVY P;  1APC A;  1ZU5 A;  2HV7 A;  2CGE A;  1OCO C;  3H2U A;  4MVR A;  3ZDL A;  2R25 A;  2V3C C;  2YLI A;  4PK4 A;  5A6A A;  2R7Q A;  4AE4 A;  5B3S C;  4OD4 A;  2XXA B;  1CGO A;  4Q7C A;  4ANJ A;  4K1O A;  2R7V A;  2P6V A;  4GEH A;  2DGJ A;  3RQE A;  2KK1 A;  2ZXW C;  4AK9 A;  1FNT c;  1NBB A;  4NTA A;  2GAQ A;  1A0B A;  3EZI A;  3IEE A;  3U8V A;  1AVO B;  1Q0F A;  5JRA A;  2Y3D A;  2YL1 A;  2I15 A;  3RH3 A;  3Q7G A;  2OJE D;  1NFN A;  3WOD F;  5E3A A;  3AJM A;  5EGY A;  3N2Z B;  1YYJ A;  1BR1 A;  2BC5 A;  2WVN A;  2H7V C;  1D0X A;  1AEP A;  4NTB A;  3ATP A;  4MVQ A;  5B1A C;  1NLX A;  1RJ9 B;  1PD1 A;  4MW8 A;  5A6B A;  1MQV A;  5DQZ A;  2Q00 A;  4LDK A;  3GWN A;  4JEB A;  5F5H A;  5BQH A;  3U9J A;  2IOQ A;  3IPM O;  4QI0 A;  3KL4 A;  1YA9 A;  1NZE A;  1OCZ C;  3EGX A;  3QMK A;  3S0X A;  2G3V A;  1D0Y A;  2V26 A;  3S29 A;  2P1A A;  2HS5 A;  1K40 A;  4X0R A;  3ITF A;  4OIN F;  3GM1 A;  3EHN A;  2J46 A;  2M4E A;  4CJG A;  1M2O A;  3AQB A;  3DAF A;  4MQ9 F;  3HLZ A;  4CIH A;  1M6T A;  1LS1 A;  5IY5 C;  4EBB A;  2J0X A;  3DWW A;  3EG9 B;  4JZA A;  1HMO A;  3VF0 A;  1M57 C;  2XLD A;  3MFN A;  4ONS A;  1OKK A;  5DS6 A;  2HSB A;  1RMV A;  4GQH A;  1WAT A;  4G78 A;  3BEH A;  1N1C A;  3LLK A;  3OEO A;  4C3E A;  4CSA A;  3OWT A;  3T4R A;  2FGY A;  3Q7L A;  2IBF A;  3U3B A;  1YYX A;  4DBQ A;  1C03 A;  3C8G B;  1RXQ A;  4BEJ A;  5L3V A;  2R05 A;  2WVO A;  3GOR A;  4YL0 A;  1HE1 A;  1DOV A;  3SXY A;  5HSW A;  5T1D B;  1ORJ A;  2AP3 A;  4ER9 A;  1R5I D;  3MLG A;  5GPG B;  3B0U X;  4E17 A;  2UUI A;  2HKV A;  1GGQ A;  2L7A A;  3GEH A;  3NMI A;  4CS9 C;  2AVK A;  3JTL O;  2NPU A;  1MMG A;  4CBE A;  4DXW A;  4F4B A;  4BJ1 A;  3LS0 A;  2E87 A;  2EPN A;  3EFO A;  4CIP A;  2JX0 A;  2NG1 A;  5DQT A;  2HZ8 A;  2I8B A;  1LS4 A;  3K33 A;  2NUT B;  3R2P A;  3I5P A;  1D1C A;  1LIH A;  3ZTZ A;  1GQA A;  2VCA A;  3EJN A;  5KYU A;  2MWQ A;  5KYN A;  2M64 A;  3HNI A;  4IAO A;  3SZR A;  4ZLD A;  1TQG A;  2KW3 C;  4IAQ A;  4JRZ A;  3AGT A;  5A6B D;  1WWP A;  1JAF A;  3HNJ A;  1A7V A;  2EPL X;  2PP4 A;  4MTO A;  4HEA J;  5CI8 A;  3L8J A;  3IQ6 A;  3T6G B;  4YT4 A;  5KYX A;  1LVK A;  2O9X A;  2WVQ A;  1U89 A;  3H65 A;  3DXJ F;  4JIO A;  4N6H A;  3T9O A;  1M2V A;  1ZW3 A;  4JVS A;  3B71 A;  4WAB A;  3ZVR A;  4LDQ A;  3TK0 A;  2MYS A;  4EWC A;  1E86 A;  4I1M A;  1XWJ A;  1JPJ A;  1NG1 A;  3EGD A;  2QE9 A;  2Y39 A;  1OW6 A;  4MVM A;  1Z7Q c;  3NRH A;  2GA0 A;  4BJ6 A;  4FWV A;  2YEV A;  4Q5S F;  3DM5 A;  1G8X A;  2YLD A;  1K05 A;  1OKK D;  3C18 A;  4HFK B;  4OD5 A;  1Q0M A;  3UMI A;  4YT8 A;  4GYT A;  2XXA A;  4DRH B;  2OQM A;  3UNG C;  4PR9 A;  2KSF A;  3A11 A;  3QVZ A;  2LCH A;  1B68 A;  4JTC B;  3S84 A;  3ABL C;  4E7S A;  4E7Z A;  3DKA A;  3W2W A;  1IZM A;  3K1H A;  1O3U A;  2GDC A;  3ZWI A;  5L3Q A;  2PX0 A;  4AL0 A;  3LAY A;  4JW1 A;  2H7B A;  1RKE B;  1VYI A;  1VTM P;  3C8Z A;  3FXH A;  1G5Z A;  1YVI A;  1Z63 A;  1JOG A;  2EIM C;  2EIK C;  2YWA A;  4IJJ A;  4IB4 A;  4JTD B;  3T6B A;  2ICW G;  2EPM X;  2OEV A;  2VB6 A;  3B29 A;  4PJM A;  5E33 A;  5JVE A;  1E85 A;  2XS1 A;  3NYJ A;  1H9T A;  1T5O A;  3K1I A;  4IRU A;  4O79 A;  1Q0D A;  3V5X A;  1TR2 A;  1U0B B;  1H9G A;  1NU7 D;  1T6U A;  3GM3 A;  3TQO A;  3LEV A;  2YL0 A;  5F5F A;  2KNH A;  4OIO F;  5A6J A;  2PF4 E;  2BL2 A;  3FAJ A;  3LNM B;  2HMZ A;  1E83 A;  1J8Y F;  1UFB A;  1W2W A;  5KYW B;  3M15 A;  4CSA C;  4XLN F;  2BE5 F;  2LSE A;  2LK4 A;  2LP4 A;  1CPR A;  4ULW A;  5EK0 A;  4L6R A;  1LI7 A;  4NY3 A;  3I4U A;  4MTG A;  3DM9 B;  3TOL A;  2R7S A;  3IQC A;  3S27 A;  2HFI A;  4I44 A;  1YA7 O;  3Q6M A;  2A69 F;  3S9O A;  3N24 A;  4YL3 A;  4AX2 A;  2UUH A;  4XEK A;  4EIY A;  4HFF B;  1RJ9 A;  2RSE B;  4FES A;  2L6H A;  1C17 M;  4BEM J;  1SZI A;  4H54 A;  2FFH A;  1O5H A;  1YAR O;  2H8A A;  3ASO C;  4MVS A;  2PNO A;  4XEF A;  4J7Y A;  4JE9 A;  3WG7 C;  4BG0 A;  1BR4 A;  5DS5 A;  4YL1 A;  3FMS A;  4QDL A;  4XPY A;  1R4T A;  2PBE A;  3CSK A;  3GWL A;  2Q7R A;  4U5F E;  3AGU A;  1ORY A;  3DJU B;  3U5S A;  3GM2 A;  2GFH A;  3FHD A;  1M56 C;  2KYH A;  3EG9 A;  3FOP A;  4E0I A;  1Q0K A;  3TD7 A;  3HTK C;  4DVZ A;  5D92 A;  1VLT A;  3SEO A;  3LUT B;  3HJC A;  3U3F A;  5DS4 A;  5KYY B;  4OIR F;  5L0J A;  4J7T A;  2AWY A;  1WGW A;  4QI2 A;  3ECS A;  3VYW A;  2KQ9 A;  4NQF A;  2Y3B A;  4YK5 A;  1TWA A;  1EI7 A;  2XLM A;  3G4Z A;  5BQI A;  4MTF A;  2WL8 A;  2EIL C;  3C8G A;  4KC9 A;  1KU2 A;  2Q9A A;  4O6Y A;  5AC4 A;  3PCV A;  5L0D A;  1YZA A;  4Z9H A;  3DJN B;  5AGF A;  3RW0 A;  3IHU A;  1QKR A;  1JRA A;  3G50 A;  3NYM A;  3O6X A;  2J0W A;  1T6I A;  2L6F A;  4N6C A;  5JP7 A;  4BJ6 C;  3UGO A;  3B0P A;  2A0U A;  2MHR A;  4FAP B;  1MNE A;  2YRF A;  2EPK X;  4U5E E;  2XL4 A;  3RVY A;  1Q0G A;  3JCU Q;  5COG A;  2NUT A;  3JRT A;  3DI5 A;  1E2X A;  3M4C A;  1YJG A;  2J9W A;  1PV3 A;  2R9R B;  2QNL A;  4G7H F;  2NSF A;  3DE9 A;  4XPW A;  1CGM E;  2HSQ A;  4PAC A;  2YZS A;  3EHM A;  4HE8 D;  5TJ5 E;  4N06 A;  1I5N A;  4JUR I;  256B A;  3JZ0 A;  4CDV A;  5L0H A;  3BRJ A;  2R7R A;  2VAS A;  2NSG A;  1MMD A;  1V4A A;  2G3K A;  2XLV A;  2OCC C;  4B6I A;  1NSG B;  2ZPA A;  3C63 A;  3SP1 A;  3POV A;  2GWW A;  3K1I C;  5BQG A;  4C3D A;  1FAP B;  2OJQ A;  1VOM A;  3B9Q A;  4D4X A;  1G4U S;  1MMA A;  3VRC A;  4KBL A;  3KKB A;  4J32 B;  4JEA A;  2VH3 A;  2P61 A;  4LDR A;  2XL6 A;  4XEV A;  5AC5 A;  2IM8 A;  4K0D A;  3ZQV A;  2DYS C;  5A69 A;  1GM5 A;  1I4Y A;  3U2L A;  5L0C A;  3V5Y A;  2PFD A;  3W4Y A;  3C8G D;  1V74 B;  4RD9 A;  3TOM A;  3W2V A;  1S7Z A;  2YL7 A;  3FVY A;  3PMR A;  1WOL A;  2XM4 A;  4XWJ A;  4E0H A;  1SMY F;  4LAC B;  1O87 A;  1RKC A;  2A0B A;  3ZTM A;  3PHF 2;  1QVX A;  2ETS A;  3W8H A;  4XPX A;  3IQT A;  4LLC A;  4EBJ A;  2Q4F A;  3DMD A;  3UMH A;  1ZHX A;  5L0F A;  3AQC A;  1S05 A;  1PD0 A;  2WB7 A;  3E70 C;  4WGZ A;  3WHN A;  4U5H A;  2XS8 A;  4Q4Z F;  4OIP F;  1VB5 A;  3UMK A;  1FMW A;  1UG7 A;  4PFP A;  2VCB A;  3LLI A;  2QY9 A;  3HNK A;  1CPQ A;  2Z15 A;  4FX5 A;  3JYY A;  3GEE A;  4RDA A;  1D1A A;  1SYQ A;  2ZXR A;  2PX3 A;  4BJT A;  4E18 A;  1Y4C A;  4I1O B;  3M79 A;  2X51 A;  2YKZ A;  3QTH A;  2B0H A;  1A7E A;  5KYW A;  1U6H A;  1D0Z A;  3N0T A;  1LKX A;  1ZHY A;  5JUA A;  2QTV A;  3LEO A;  3O10 A;  5JS5 A;  2R02 A;  4MVU A;  2R7T A;  3Q6N A;  1Z3I X;  4JJG A;  4G7Z F;  3SNH A;  2OOC A;  1K04 A;  4O6M A;  4P9F A;  1VK5 A;  1A41 A;  3W8I A;  1OW7 A;  1HMD A;  1ORS C;  2JD3 A;  3LES A;  4JCZ A;  1GS9 A;  4CS8 A;  2H7O A;  1TKN A;  5L0G A;  4YT2 A;  1LE4 A;  2J9V A;  2VCC A;  3RQG A;  3E9V A;  4XTK A;  4DOZ A;  2TMV P;  2R7X A;  2HUJ A;  2LD6 A;  3M4B A;  4BPM A;  2YQY A;  4IGG A;  3F46 A;  1E84 A;  1BZ4 A;  3J06 A;  4BJ5 A;  3QVY A;  3VM6 A;  1TFO B;  1TWC A;  2OU6 A;  1FMV A;  1BDJ B;  3DZA A;  4RBN A;  3UR3 C;  3CQZ A;  1NFO A;  3KH2 A;  4P9T A;  4JKV A;  5KYY A;  1Z5Z A;  4CX9 A;  4MVO A;  1WAS A;  1OR3 A;  1JR8 A;  3MBG A;  1OXB A;  2W4B A;  3T6J A;  3QW0 A;  3FDQ A;  3S28 A;  1OXK A;  1MND A;  1BR2 A;  2IXO A;  1XZQ A;  2IXN A;  1SR2 A;  5B3I A;  2XSE A;  4P6I C;  4ULV A;  2A1D D;  3K7D A;  1LI5 A;  2RD9 A;  4U9D A;  5HV9 A;  2DYR C;  3C7J A;  2WZF A;  3A9C A;  4NCQ A;  4LER A;  1QPU A;  2D5R B;  2XLH A;  2Q9B A;  3RYL A;  3US6 A;  4C7O B;  3JYH A;  3LS1 A;  4MW3 A;  1MMN A;  1ZW2 A;  3ASN C;  1G4W R;  2NUP B;  3AG2 C;  3L1M A;  3LJB A;  2W45 A;  2CCY A;  4PJJ A;  5FZT A;  2OG2 A;  1HW1 A;  3JRM O;  4O7G A;  3U8P A;  3PDM P;  2VC9 A;  4IAR A;  2D4U A;  2G62 A;  2HJ3 A;  3H2V A;  1ZZP A;  3KPH A;  2XL8 A; 
#chains in the Genus database with same CATH homology
 2JX0 A;  4EBJ A;  1OW7 A;  2L6F A;  3TUL A;  3U0C A;  2PBE A;  1K05 A;  3C18 A;  3AJM A;  3GM3 A;  3K7D A;  3MFN A;  3RQG A;  4XEV A;  1KNY A;  1WTY A;  2HSB A;  3GM2 A;  2L6G A;  3GM1 A;  2JPU A;  5F28 E;  1UFB A;  2LK4 A;  3JYY A;  1PV3 A;  1WWP A;  3U3F A;  3RQF A;  3C8G B;  3L8J A;  1O3U A;  4EBK A;  1OW8 A;  2Q00 A;  4NQF A;  3S9O A;  3C8G D;  4XEK A;  3O10 A;  3JZ0 A;  3C8G A;  3B71 A;  3BRJ A;  4R32 A;  1WOL A;  1V4A A;  3L8I A;  3RQE A;  2L6H A;  2KK1 A;  1K40 A;  1JOG A;  2YWA A;  4XEF A;  1QVX A;  1K04 A;  1KTM A;  1ZZP A;  1OW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...