3CAXA

Crystal structure of uncharacterized protein pf0695
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
355
structure length
355
Chain Sequence
LPEGHPLKTLYQENKEIMKDAEMLNLYAKTLATTKDERMREEILGVLEEIVSSLRMVGFTHYNREEMLIFPYIERRGLTVIATVLWTKHDEIRAMIKQLAELLRKREEMPWEEFVEKFKAKAGEVAFALSDMVFRENNIFYPTLKALLSEGEWKAIKMQEDEIGYYKVKPPEWDPGEDVKPLHPWEINPELNVEQLLTLPKEVQQALRGQPLEFDKTQLKREEDIDLGTGYLNIEELKAIFEALPVDVTFIDKDDRVRFFSPGERIFTRTPSVLGRPVQLCHPPKSVYVVNKILKAFKEGRKKEATFWLRLREKYVYIKYVPLFNEKGEYIGTLEMTMDIAPYKKIEGEKRLLDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein PF0695.
rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein PF0695
total genus 119
structure length 355
sequence length 355
ec nomenclature
pdb deposition date 2008-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
A PF13596 PAS_10 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3caxA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3caxA02
1TS8A 2WKQA 1LT0A 1UWPX 3CLOA 3NOUC 2QJ5A 1F9IA 4I3IA 4WL9A 4F3LA 1S1YA 3C2WA 1VB6A 1D06A 2L1MA 3P7NA 4MN6A 1XJ2A 3PYPA 2M1CA 2PYRA 5HD5A 1MZUA 1XFNA 2A24A 3G6OA 4I39A 5G4YA 3LIDA 1T1CA 5HDDA 2PYPA 1DP9A 2WKRA 2YKFA 3H82B 5DKKA 3NOTC 4LRYC 1P97A 4HJ6A 1JNUA 1XFQA 3CWFA 4I5SA 4EXOA 4HH3A 3UMEA 1Y28A 3LI9A 4NXBA 1OTIA 4WLAA 1S1ZA 3A0SA 5HD3A 1TS7A 2A24B 2OWHA 4EERA 1XJ3A 2V0WA 1BYWA 1N9LA 2VV8A 2VLGA 1S67L 2HV1A 2L4RA 5DKLA 4XT2B 3UB9A 2YKHA 5HSQA 3BY9A 3ICYA 3LIEA 3A0VA 4I3JA 1S4SA 2K7SA 2CMNA 1EW0A 2QWSA 3F1NA 5HWTA 3E4PA 1X0OA 4PKYG 5F68A 4F3LB 2P0NA 1LL8A 4HHDA 1OT9A 3PHYA 1P0ZA 5AVFA 4NXGA 1KOUA 3VE4A 4BBTA 4DJ3A 2PR5A 3GECA 2KDKA 3H7WB 1GSWA 3D72A 4L9FA 2H28A 1OJ5A 5F69A 4WN5A 5I5LA 4JGRA 4GHIA 5HDCA 1OTDA 1GSVA 1DP6A 1V9ZA 2ZOHA 2JN7A 3F1PB 3F1NB 4R6LA 5J4EA 3F1PA 1WA9A 3LICA 3LUQA 3MQQA 1F98A 1S4RA 1T1AA 3U9MA 2GJ3A 2I9VA 2QKPA 3H9WA 4EESA 2VV6A 4EQ1A 2VV7A 3LI8A 4L9GA 2ZOIA 3T50A 4BBUA 1OTEA 1LSWA 4HP4A 2PD8A 2INWA 5TBMA 4BBVA 4EETB 5IS1A 1XJ6A 1XJ4A 2W0NA 4EEUA 2QJ7A 2KX6A 2R78A 4JGQA 5J3WA 5DJUA 3NHQA 4GW9A 1N9OA 2B02A 1T1BA 4GS9B 4HOIA 3V5ZA 2PD7A 5F6AA 1T19A 1T18A 5EFWA 3K3CA 3MR0A 4R3AA 1TS6A 4NXEA 4HNBA 3RH8B 4I38A 4R38A 1NWZA 2Z6DA 3E4QA 3SW1A 3LIBA 2PHYA 3H7WA 3MFXA 3NOPC 4HY8A 4WUJA 4KUKA 5TBMB 3OLOA 2V1BA 2P7JA 2V9AA 4PKYA 3GDIA 2PR6A 3UB8A 1V9YA 5HWWA 4GCZA 4HIAA 5IU1A 1DP8A 4GS9A 1ODVA 1OT6A 3LYXA 4HJ4A 4LLOB 3RTYA 2Z6CA 5A8BA 1G28A 3B33A 2BASA 3EWKA 4B9OA 3KX0X 3MQOA 2D01A 3IS2B 1DRMA 4EEPA 4GHIB 3E4OA 2D02A 1UGUA 3IS2A 3F1OB 2EA9A 4NXFA 4YWZA 3VE3A 2W27A 3HJKA 1OTBA 3V5XA 4H6JB 4KUOA 4K08A 4L9EA 2V0UA 4LPZA 3UMDA 2J80A 2OOLA 3IBRA 3V5YA 1GSXA 5J7EA 5F5YA 4DJ2A 5KIZA 4KQDA 3H82A 3A0RA 3FC7A 1TS0A 3F1OA 4JGOA 4JGPA 4LRXC 1OJGA 2L0WA 1N9NA 3ULFA 3UB7A 3VOLA 4H6JA 1S66L 2VEAA 3BWLA 3LIFA 3FG8A 3U9JA 4HQAA 2PDRA 1LSXA 4HI4A 3NJAA 4R70A 4EW7A 5DJTA 3UE6A 3ZQ5A 2V1AA 3EEHA 3LIAA 2OWJA 1D7EA 2JHEA 3C8CA 2QHKA 3MXQA 4HH2A 3K3DA 4M4XA 5G4ZA 4HJ3A 2WKPA 4RQ9A 1LSVA 4MN5A 5HDSA 4E04A 5HWVA 1UWNX 4XT2A 3HJIA 4HP9A 4I3AA 3BY8A 4LRZE 3CAXA 4WF0A 3UB6A 3MJQA 1OTAA 2ZBBA 5HZHA 5AVEA
chains in the Genus database with same CATH superfamily
4BD1A 2NG1A 1S1YA 5JYOA 3AQBA 3K1HA 3FWLA 4JXWA 4PFPA 1E3UD 1XJ2A 3CUEC 4EBLA 3G6OA 4OLGA 3NRHA 1J9MA 1T1CA 2Y2MA 2BL2A 3QP1A 3C5AA 1DOVA 3AJMA 1YLMA 1VYKA 3RQGA 4P9FA 1GGQA 1XJ3A 1XZPA 3OCNA 1N1CA 2PT7A 2QLAA 4PM8A 2LB9A 3UB9A 4R3JA 2OOCA 5I94A 5HPIA 5FCLA 4D60A 1KE4A 3VMAA 3MXSA 5EM1A 2XF3A 4P6BA 2XA7S 4Q0HA 3UPNA 2VX8A 4F3LB 2W45A 3T4OA 3PAGA 4J7YA 4JURI 1ZHWA 1YSPA 4R23A 3LUQA 4Q5SF 1WE4A 4O6NA 2YZSA 3MQ0A 3H9WA 4G7ZF 3GANA 2JC7A 2ZQCA 2NSGA 4R4SA 3IHAA 2PBDP 4N9LA 3HLFA 1A41A 3PBOA 2GFHA 2FZ0A 4E0HA 4CSAC 2W4MA 3AG1C 3DZAA 4MBHA 4OP5A 2R25A 1VLTA 2IM8A 1SR2A 3ITFA 5KZHA 4EUZA 3LIBA 4WEJA 4U5GA 4CDAA 2V1BA 4LDRA 2WL8A 4MVQA 2Y59A 4G3VA 3NKDA 1PWDA 3EWKA 5T3WA 3S27A 2IWCA 5KYUB 2D01A 3EQLF 2C04A 3O55A 2Y39A 2NUPC 5HAIA 2WGWA 1E4DA 4XWJA 3U8PA 2HFIA 3KPHA 3V67A 5FEFA 3NECA 3LFVA 4E3IA 3F1OA 1H8YA 3UNWA 5E2EA 1ZC2A 4MVSA 1ESIA 1QQ3A 2V2FF 1LSXA 2FH5A 3GV9A 3S22A 5CGWA 3MXRA 3QVYA 1CEGA 4G7OF 2C6WB 3TJZC 1FCNA 4I3AA 3S7QA 4KZAA 3VFHA 3KSHA 4O0PA 1K4EA 2XA7M 3QNCA 1TS8A 3Q6NA 3VYWA 5F28E 2A24A 4X0RA 1GHPA 3VF0A 1K56A 2EFUA 3MZEA 2R7WA 4KZ4A 3HLZA 1MMGA 2ZQ8A 1PYYA 3M2KA 3LEVA 2J9VA 4EIYA 3C7VA 3BRMA 1YZCA 3JYYA 4EXOA 4FX5A 3QVZA 4J32B 4C7OB 1ZVZA 5IY5C 4YN0B 2Y4AA 2R9RB 3RYLA 3IBJA 2Q9MA 4FOFA 5EVIB 4K0XA 2K7SA 4ID4A 2G3VA 5AQ7A 4E3MA 4PPRA 1D1AA 2W4BA 2DGJA 3ISGA 1ORYA 4WGZA 1J8MF 3RXXA 3M4CA 2VC9A 3KSGA 2M7UA 2V26A 3MFNA 2Y2LA 3FVYA 3VM6A 3V3RA 4EKWA 3FKVA 3WS0A 3UMIA 2EXAA 2VASA 4BQMA 3M6BA 1BULA 3BJNA 5IHVA 2YHSA 3C8GD 4YFMA 1RCPA 1C02A 4BG0A 3EZHA 4DE3A 2GA0A 5FQKA 5DJUA 4GW9A 2ZD8A 5KYXA 3KO6A 3CJMA 4R4RA 5EVLA 1HW1A 4CIPA 3MFXA 4CLCB 4CDVA 3T9OA 2ETSA 3DKAA 1FR6A 2PR6A 2Y2NA 4E3KA 2W1TB 3ZVRA 2X02A 3VOZA 1BTLA 4YT5A 3QW1A 2V8FA 3MS6A 4KQOA 1DRMA 3BFFA 1EWZA 4GEHA 4AX2A 4U3TA 3GORA 3LR4A 4K08A 4L9EA 5FI2A 3V5YA 4IGGA 1PW8A 1AWIA 2OEVA 2AVXA 1M56C 2A0UA 3SS5A 2VCCA 4JGPA 4ZRRA 4ETZA 3LCEA 1HTZA 1YYXA 4LCLA 3I5PA 2BG1A 2JE5A 5E43A 1O5HA 4HH2A 5G4ZA 4OQ0A 4XTKA 1WATA 1RKEB 2XM0A 4IBRA 4PJLA 3MKFA 4LRZE 3NMJA 4MCWA 3NIAA 4MTFA 4XPWA 3MFDA 4Z9HA 5AVEA 4P9TA 5GHXA 5MC7A 1SZIA 1F9IA 2XL6A 2QUPA 2VGLM 4MN6A 1MMAA 2EPMX 1V4AA 3LIDA 5DKKA 3Q7ZA 4XXRA 4HJ6A 2G2UA 4A5RA 1NLXA 4ZLCA 2EPKX 5JP7A 2CCYA 1EQ1A 2IYLD 4YWQA 3A0SA 1NXYA 4UHUA 1NZOA 1MC0A 3E0YA 1OCOC 3E4PA 3C8GB 3C4OA 4ZJ1A 5AVFA 2OJQA 2BE5F 2IA2A 3ZGAB 2P1AA 4DVYP 5HDCA 2W3EA 2ZOHA 3T4LA 2Q0OA 3LICA 3QNBA 4YL3A 3TK0A 1MWUA 4MQ9F 2L6GA 1OTEA 2A68F 1TEMA 5GLBA 2AWYA 3JSZA 1MY8A 1XJ6A 3N8LA 5EVIA 2KX6A 3G2ZA 4ZDXA 4NTBA 2B02A 1T1BA 2ZM8A 3PBQA 1RJ9B 1HVBA 1NJ4A 5E2HA 3IEEA 4R38A 1NWZA 4XEKA 4PACA 3MMHA 2R02A 4Y0UA 2LD6A 2O9XA 4UAAA 3ZVWA 3W2ZA 4BJTA 2A2LA 2TMVP 1ES3A 3N6IA 4X55A 2XLHA 3N8RA 3S29A 3W4YA 1E86A 2CGEA 3QP6A 4GN2A 4ARZA 3G4XA 3E4OA 2XLEA 2WKIA 1BBHA 3V5XA 2ZMFA 2YEVA 3UE1A 2WKEA 3SEOA 4UA9A 4R32A 4B6IA 2HV7A 3IQ6A 3AOUA 1KE0A 4OOMA 2ZMAA 3EEHA 3LS1A 3O39A 4FD8A 5HDSA 4XT2A 4E6XA 4HP9A 5FQIA 1CEFA 3L8IA 5IT5A 1SCWA 3KYEA 3M6HA 5F5HA 4S2JA 1VB6A 4I44A 4EUKB 5DFXA 1HW2A 3ZIBA 2DYRC 2GDCA 1YM1A 2WKRA 2PAVP 3LR0A 2HJEA 3IPMO 2EILC 3OWTA 4OQIA 1GM5A 4WLAA 3HUOA 2HJ3A 3EFOB 3LY3A 1QKRA 2V8CA 4JXVA 4OH0A 1EI5A 1K54A 2L4RA 2EINC 2LFDA 4EBJA 3T1QB 4I3JA 2Q3TA 3SH8A 3G32A 3BQAA 1I5NA 3F1NA 5HWTA 3UGOA 4PKYG 1O07A 4KZ9A 4MN7A 1P0ZA 3BFEA 3V7OA 1S05A 1M2VA 1YJGA 2L6FA 4YT2A 2XRNA 4B88A 4GHIA 4Y0TA 4P6ZM 2WKHA 5CGSA 3C18A 5HL6A 1ORJA 1S4RA 1LLBA 4EESA 1TFKB 3AGFA 3HNIA 4LLEA 4II7A 1GS9A 3QP5A 4JJFA 4LACB 4YL0A 4UEYA 3FHDA 3F46A 2R78A 3C38A 4EWCA 4MVRA 4DBRA 2RCXA 4GS9B 5KYYB 2DYSC 5BQHA 1NRFA 5FDHA 3RH8B 4QJGA 4FWVA 5B1AC 3S7OA 5CECA 4Q4ZF 4CS8A 1AUEA 3WS4A 2OCCC 2QYBA 1BSGA 5IU1A 1Z23A 4CLCE 1ZZPA 3ZG5A 5CEBA 4QU3A 3RTYA 3B33A 3KX0X 2I8BA 3IS2B 3IS2A 1N9BA 3KSFA 3ZG8B 1OTBA 1KTMA 5HFOA 4I1MA 2ZXWC 4O6MA 4E3LA 2NUTA 3AGEA 2P6VA 3EGDC 1Z7Qc 2BTFP 3IT9A 1G6OA 1OW7A 2W3DA 1FFHA 3KYQA 3EGDB 3K1IC 5TFQA 2L0WA 2P08A 2CNWD 3MYFA 2A1DD 2CYDA 1CK3A 3T6JA 3TD7A 5AQ9A 1WTYA 4ZTKA 3D3OA 4EUVA 3KMIA 5L0HA 4E04A 2XQZA 2OSUA 3W8HA 2EPOA 2Y3BA 5FQJA 1FNTc 4DN0A 5DQTA 2W1TA 3JVVA 3UB5P 1UFBA 4UDVA 4MDZA 2X01A 1QMFA 1G4WR 2L1MA 4JKTA 3X2QC 3TW8A 1T6QA 2YKZA 2Y3GA 2YKFA 1OXBA 4C3BA 1JNUA 4NXBA 4ZJ3A 1S6RA 1OTIA 2R05A 3LJBA 5D92A 1K56D 3RIPA 3WAQA 4XT2B 1VETB 5FQMA 1W7FA 2ZL1A 3LIEA 3WS2A 2AWCA 4CDYA 4RA7A 1QMEA 4OKPA 1BR4A 2E8JA 1RKEA 1KOUA 1FQGA 3NCKA 3KH2A 4L9FA 1YMXA 1RKCA 1NLYA 1GSVA 2ZQDA 3F1PB 2EX8A 2HMZA 3W4PA 1BUEA 1F98A 2HGVA 1FCMA 4ME4A 4DE1A 3DM5A 1JMWA 3M4BA 1L3LA 5DFYA 2Q4FA 1XJ4A 1SKOB 2WAEA 1NFOA 1TDGA 3U2LA 5DTKA 1QPUA 3SZTA 3MX3A 2YRFA 3LS0A 3DXJF 1Z3IX 3FOPA 3K3CA 4E18A 3S0XA 3ABKC 3LAYA 2KGOA 3U2AA 2PHYA 4WUJA 1I4YA 3B71A 1R4TA 1K57C 2IWDA 4KUKA 2GAQA 4HFFB 5E2FA 1GA0A 4CPKA 2W9YA 1APCA 4I1OB 2PU4A 1E84A 2A49A 3MQOA 1NYYA 3UY6A 2HP9A 2WK0A 1JVJA 1OMEA 3E70C 1JR8A 3POVA 2I72A 3B29A 2LQGA 2ZXRA 2ZXOA 2OU6A 3FPVA 5HARA 2J3TD 3ZG1A 4JEBA 4Y7PA 4EBNA 2Y8HA 4RX2A 5L8MA 1Z09A 3TOLA 3BWLA 1MPLA 3UNGC 2AU5A 2PDRA 3MZFA 4N92A 1G8XA 3O88A 2IXMA 2D4UA 2HF6A 3UN7A 3FZCA 4RQ9A 4FH2A 3ZCZA 4BJ6C 5EUAA 3CAXA 4WF0A 4CS9A 1YA7O 3VRCA 1OCCC 4CX9A 3PMRA 3QP4A 1JAFA 3HNJA 5KYWB 1TWHA 1MZUA 3T4SA 1Q0KA 1OXKA 5EGYA 1SYQA 1DP9A 2J7PA 1BLSA 5AC4A 2R03A 3KKBA 3UGPA 3E9VA 1YLWA 1ESUA 3VFFA 2GZAA 2V1ZA 4NQFA 4HBUA 4C75A 3OPHA 3US6A 2ZQ9A 4CJGA 1NSGB 4CLCA 5B3IA 1H0MA 1EW0A 2ZC6B 1X0OA 2O0YA 1K55A 1L3PA 4PK4A 3V39A 5JSLA 1VOMA 1W5DA 2L81A 3RW0A 1GSWA 1O3UA 1BZ4A 2VB6A 3UE3A 1FCOA 3C7JA 4LGWA 3AG4C 2UV0E 4ULVA 4B4ZA 1YLTA 2GJ3A 3TOIA 4MNDA 5U47A 2XH9A 1YA9A 5DS6A 4AL1A 2INWA 4BBVA 3GODA 3IXHA 1Z6FA 1WYCA 2QJ7A 3EPVA 3NYJA 4YNRA 4NKPA 3ATPA 5HSWA 2BLSA 4RYEA 1TDLA 2V20A 5HL1A 1N9OA 1NLZA 1FR1A 5AQAA 2YLGA 5DF7A 3HUNA 1HLUP 4IAOA 2HSBA 3E4QA 2NUPB 3SW1A 4ETXA 5DS4A 3Q6MA 4P87A 1VEUA 4GCZA 4X6TA 1LE4A 3DM9B 5KMWA 1K38A 1M2VB 2P9VB 4GHIB 2D02A 3F1OB 1YT4A 1SKOA 4OD5A 3X1OA 1D1JA 4GJ4A 1L7CA 1GSXA 4F4BA 5KYUA 3C8ZA 3N7WA 1KNYA 4FAPB 1IEMA 1ORSC 3W8IA 1ST6A 1PWGA 3U9JA 2OV5A 5CERA 3ABLC 4JVSA 1W63M 4O7GA 5TJ5E 4XPYA 2YQYA 1LL5A 1UG7A 1Q2QA 3NY4A 4S2NC 3ZHHA 4BJ5A 1MNEA 3IQ5A 1TWAA 4Y5FA 1H9TA 2ZBBA 3L0IA 5DF9A 2XL4A 3WS1A 2OLVA 2HV6A 4QWOA 3HLGA 4C7OA 3P7NA 2RD9A 2ZQ7A 1TR2A 5GLCA 1MKIA 3ZDLA 3CUEA 4WEKA 1OKKA 1DOWA 4I5SA 5M1AA 4HH3A 1I4ZA 3FDQA 1KGFA 3K2NA 1XGIA 3UMKA 5A6JA 3G35A 4GD8A 5HW3A 1W79A 1P9RA 5DKLA 5DTSA 2W3GA 4S2PA 1L0GA 1WYBA 4O7DA 2WZFA 3WODF 1GQAA 2KK1A 4OPZA 4HHDA 3H2VA 4A2NB 2P7VA 5CIVA 3ZG7B 1WASA 1PI4A 4JZAA 1VHMA 3GEIA 2Y2OA 3S1YA 1YLJA 1H7IA 1L0EA 3QTHA 1T1AA 1OCRC 4ANJA 4ONSA 1W8QA 5KYXB 2PD8A 3EQUA 2HZ8A 3SYNA 3OZHA 4DRHB 2IBFA 5KYNA 3U5SA 3N24A 4JGQA 3CPTB 4AE4B 2HZ5A 1XZQA 3V5ZA 4AE4A 2QMIA 1T18A 3SXZA 1ONGA 2ZLYA 3FPWA 3MR0A 4R3AA 4UA7A 1TS6A 2X51A 2K2NA 4Y0OA 4DMZA 1OR2A 1ZHHB 3G4PA 2B5RA 3T4RA 4KZ5A 4MNRA 5GHYA 3T4TA 3VP1A 4HIAA 4X69A 2A6EF 2W1RA 3FAJA 4LLCA 3I7JA 3RH3A 1C17M 1U0BB 1Q0MA 4XEFA 4OINF 1MMNA 3DWWA 2WGWB 1Y4CA 5CGXA 2PP4A 3RFBA 5M19A 1MKMA 3EG9A 2LK4A 2V0UA 2CW0F 3JZ0A 3EG9B 4EHPA 3HLCA 3IH9A 3SOIA 4OIQF 2X71A 4DE2A 4KG5A 3RQEA 4S2MA 2PFDA 2VGJA 2M64A 4JTDB 4FCFA 4X53A 3EFOA 3PR6A 4DJ2A 3ZNYA 2RL3A 5L0DA 1JTGA 1OJGA 4JIOA 3UPPA 5COMA 4RDAA 4ZJ2A 2XD5A 4U5FE 4R70A 4YT8A 3DAFA 3CQZA 1XA7A 5DJTA 2V1AA 4DF6A 1OKKD 5G18A 2R9XA 5T1DB 3DWKA 4DJ9A 2JD3A 1ZHTA 2I15A 1O87A 4XPXA 4CJNA 1NG1A 1YLYA 2P9VA 3SP1A 3WS5A 1H6GA 1LI9A 3RF3A 5L0FA 3S84A 2OEXA 4DXWA 3NOUC 3SH7A 1IYQA 3BEBA 1I5QA 4ULWA 1F2KA 3PYPA 3UPOA 1XFNA 2AP3A 2XFSA 2EWWA 3CG5A 5EK0A 3BM6A 1N4OA 3NOTC 1P97A 2UUIA 1KE3A 4EQIA 5GHZA 3LEOA 1NRJA 1DJCA 1Y28A 2Z2LB 2OAQ1 4CS8C 2GNXA 1S1ZA 3R7WB 2OLUA 2YLDA 4RBNA 1PCXA 4W8PA 5HD3A 2PBYA 3HJCA 3ICYA 4EWFA 3A0VA 1MBLA 2QTVA 3OA1A 1YMSA 2QWSA 1A7EA 3IX3A 4WJ0A 3ZQYA 2P0NA 5FI6A 1NYMA 2EPNA 2Y55A 4QDLA 4WYYA 5HV9A 3OPPA 2HJMA 5F69A 4RVAA 1V9ZA 4MVUA 4MTGA 4IEDA 4MEZA 4PM9A 3W8KA 1DJAA 3AGUA 5F82A 1K25A 4BMWA 4YK5A 4BJ1A 4BL2A 2D5RB 1VQQA 1JWVA 4EETB 2W0NA 3N4IA 2L9JA 2XEPA 2H8AA 2G62A 1YSQA 1SF8A 4WZ4A 4DXBA 2PD7A 1LIHA 3RVYA 5EV0A 2OQMA 4PFOA 5AGFA 3RJUA 2VA0A 3B0PA 2L6HA 5CHJA 2G2WA 4PM7A 3E2LA 4NCQA 3W2WA 1IW7F 4JC7A 2JCHA 3E2KA 5L0IA 2HSQA 4LERA 2VH3A 2XGNA 4U5DE 3JVUA 4N9KA 3D4FA 2IXNA 3VP4A 4P6ZS 4EU0A 2EA9A 2EFXA 3PDMP 3HJKA 4IVIA 5TJJA 3GM1A 3SXYA 4KUOA 4FUWA 4CQHA 3PBNA 3BFGA 2ZQAA 1Q0FA 4U5HA 4KQDA 3A0RA 1GCEA 1HD8A 4OPRA 1N9NA 5FZTA 1IYOA 3NMIA 3LIFA 2O9AA 3HBRA 4KZ3A 2XFTA 4HI4A 1A7VA 2CDQA 2ASRA 1PD1A 4MS2A 2WB7A 1RGYA 3TOMA 4KNVA 2KC3A 4DVZA 5A93A 3KYJA 5HWVA 2XM4A 1UWNX 2P04A 4JXSA 3C30A 1G6AA 1VEUB 2Y79A 1UWPX 2QJ5A 4X1LA 2DCFA 5F1FA 1AXBA 2FGYA 1B68A 3A3IA 4WZ5C 2EIKC 2M1CA 2EIMC 4I39A 5HWWA 4H8RA 2J9BA 1XA1A 2Y2HA 4KZ6A 2HMQA 3W2VA 1IELA 3LEQA 3V3SA 3AG2C 1G68A 4GD6A 3UDXA 3LY4A 3G31A 2OG2A 5HPFA 1OW8A 3ZTZA 4H4KC 2Y69C 2XL8A 3ZTMA 4KZ7A 2OKUA 3VAYA 2LP4A 1FMVA 4JF6A 2DI3A 4DJ3A 2HDQA 1FTSA 2B95A 3H7WB 2LCHA 5L09A 1JOGA 1MXOA 2VGKA 4K0DA 1PZOA 4XLNF 2JN7A 3IF6A 4JKVA 5HAQA 5EVID 3Q7VB 3FAPB 1CGNA 5L0GA 3GTCA 4NK3A 3G2YA 4CBEA 1OQCA 2XDMA 3T1RA 2EWVA 5CEDA 3HREA 3EEAA 5J3WA 5EVIC 3NHQA 2J0WA 3A11A 2F22A 3U0CA 4I3MA 4JBFA 1V54C 1M57C 5BUOA 3ITBA 4HNBA 1MWTA 2JBFA 4HEFA 2V9AA 2WYXA 1MNDA 3UMHA 4YT4A 3DTMA 1ZG6A 3GRJA 5EECA 2Q9BA 3Q7LA 3PAEA 2J3TC 1EROA 1G28A 4ARZB 5JYPA 3ZNTA 4O6YA 3IWQA 1PD0A 4YJWA 5EHHA 1UGUA 4X68A 5D3OA 2ZM0A 4DRTA 1QZXA 4D4XA 1ERMA 2XS8A 2IWBA 2QNLA 4E7SA 3G30A 2JKRI 1STZA 3HTKC 5J7EA 4Q0IA 4A4AA 2KQ9A 2PRFA 1TS0A 5A69A 3SZRA 4MVOA 2VK3A 3FG8A 1ES5A 4OLDA 1I2SA 3NJAA 3HL9A 2H7OA 2JKTI 3ASNC 3LIAA 4LCMA 3C8CA 3HVFA 5FATA 4E3OA 1LSVA 4NEED 4OIRF 1XXMA 1YLPA 5F83A 1ZHYA 3WG7C 1HE9A 2ZPAA 4Q0JA 3MJQA 3BLMA 5FL3A 3BFDA 3QP8A 2KJGA 1LI5A 4F3LA 5EE8A 3T1SA 3O86A 1D06A 4MW3A 1IKGA 3Q82A 3NYMA 4EBKA 1NZEA 1ZTUA 5HDDA 3M79A 3H65A 2PU2A 4JJGA 4LRYC 1VETA 4HESA 4XUZA 1LI0A 1TQGA 4PJJA 4WMCD 3OPLA 2Y2QA 3Q81A 2W3FA 2HP6A 3P09A 1FFTC 3PTEA 1BT5A 4FTXA 1LHYA 4C3QA 4Z9JA 3H2UA 4R3BA 256BA 5JLIA 3ZWIA 2ZXPA 4JF5A 4G78A 5L0CA 4Y15A 2NUPA 1M2OA 4ESPA 2ZC5B 2NSFA 1FR0A 3IHBA 5FASA 5J8XA 1XX2A 3PHYA 3AGDA 4JXGA 3VSLA 4GDBA 3L9KA 2ZL1B 3HCYA 2JX0A 5AC5A 1OTDA 4FESA 1FILA 2P61A 1IYPA 1RCJA 3ZFZA 5COGA 2UWXA 3U9MA 2VV6A 1Q0DA 2IOQA 4NTFA 1K6RA 3MBZA 3DTEA 3R7WA 2EX6A 3HNLA 4OD4A 2Q9NA 3K33A 4P85A 5FAQA 4OVDA 1U89A 3H7WA 4G3WA 2XXAB 4HBTA 4IRUA 4DBQA 4LDQA 5BQIA 2WADA 2QZ6A 2HJ9C 5A92A 1LS4A 3HLBA 4N06A 4IJGA 3LYXA 3LR3A 2Z6CA 4OPYA 4B9OA 1M6TA 2BASA 2R7QA 1SDEA 5T3TA 4N4WA 5KSHA 3P01A 4M63A 1HZOA 4LV0A 4WBGA 5FA7A 3GR2A 4NTAA 2HS5A 5COFA 3U3BA 4KQRA 1R5ID 3FKWA 3NDEA 4JW1A 2R9WA 3ECSA 3EGDA 2WZGA 5KIZA 4MW8A 3ZSUA 4IBXA 2LIGA 1S66L 3AQCA 1HY5A 5FQQA 5B3SC 3UE6A 2EIJC 2MHRA 4P6IC 3C63A 2J9OA 3NKEA 2ZC4B 1D7EA 2WZXA 4HJ3A 4MN5A 1PNEA 1J8YF 3LNMB 4BPMA 3EGXB 1IOUA 2JKFA 4KC9A 3ZVTA 4DKIA 3HLEA 1W63Q 5F1GA 1VTMP 4P0MA 4WL9A 2B0JA 3TRCA 4Z9IA 4ER9A 3ZYTA 4O8GA 3FOOA 2GWWA 1GA9A 2WGIA 3MBGA 3SS4A 5FQ9A 4LV2A 5G4YA 2FAPB 3Q1FA 3SXMA 1KGEA 4LV3A 4IJJA 4S2IA 5CTNA 1D0XA 4NY3A 1BLPA 3TJ6A 4N6HA 2JKTM 2CC1A 1BYWA 3GSGA 1G5ZA 2W3HA 1IYSA 1NY0A 2YKHA 4U9EA 1SKFA 1LE2A 4EV4A 1Z6AA 5GL9A 2ZM2A 3R7CA 5HX9A 2XROA 5EOEA 4IVKA 4CLCC 1D1BA 4BLMA 1PFLA 2KDKA 5TBMA 1RXQA 3IHUA 1K55C 2MJ6A 1DP6A 3JYHA 1NU9C 1H3QA 3CZDA 3TULA 4L9GA 3L1MA 2ZOIA 1LS1A 3OOVA 1LSWA 1T6IA 4HP4A 4LFUA 3A9CA 1ACFA 1TF1A 4CSAA 4OQHA 2EX2A 3G50A 1ERQA 1RP5A 2IXPA 5JRAA 1NU7D 5F6AA 1EKYA 1A0KA 4BJPA 4KNWA 4KBLA 2R7RA 2JPUA 1KVMA 4WMCA 4DE0A 3OEOA 5E2QA 3CHWP 4BEJA 1K57A 1F1MA 1FIKA 4UQIM 1BLHA 3RFYA 2FFYA 3GWLA 2A3UA 1S7ZA 3DE8A 4HJ4A 4EBPA 3IQTA 3VOYA 3R2PA 4NXFA 5TR7A 3VE3A 3S28A 3IXGA 4H6JB 4JPMA 5JUAA 5E3AA 3IBRA 4G7HF 3FV7A 4GKUA 2J8YA 3EH2A 3WHNA 1Y4OA 4N6CA 4OOYA 3L7HA 3WWXA 3EGXC 2PX0A 1JRAA 3R4KA 2VGLS 2H7BA 2QPNA 1ZU5A 3EOIA 3NI9A 3CEXA 3ZQ5A 4MMNA 3K3DA 4RX3A 3NG1A 5FDSA 4IB4A 3NULA 5LBRA 3UB6A 3I5QA 2J7PD 3LNRA 1OTAA 4JLFA 2WVNA 4CS9C 1LT0A 4S2NA 2YLIA 1WWPA 4XEVA 3FMSA 2NUTB 1YAUO 1PI5A 3M15A 4DDSA 4U0TA 4N1HA 2HDUA 4EBBA 2XLDA 3U8VA 1E85A 4UA6A 1XKZA 1K05A 1FSYA 4JTCB 3T6GB 1SZVA 2LB5A 4E3JA 4MBKA 3S7NA 2FFFB 2VLGA 3MF0A 3BRJA 1Y6DA 1PWCA 3BY9A 4X1MA 1WOLA 3MLGA 4K91A 1S4SA 2CNWA 3WRZA 3SXKA 4H54A 5C5KA 3EQVA 3RXWA 4L0LA 3K7DA 2HP5A 3GECA 1M40A 4PM5A 5I5LA 4WN5A 2WVQA 2DRWA 5DVAA 1Q0GA 1O7EA 5JS5A 5M18A 1JWZA 4WABA 2R7VA 4EQ1A 3CPTA 1BDJB 1E3UA 3S4XA 4CLCD 1YQSA 1D0ZA 4EEUA 3M2JA 3MZDA 2B0HA 1FOFA 5F5FA 1HMDA 2VCAA 4R1GA 2ZD9A 1CI9A 4OP8A 1PRQA 2VCBA 2XLVA 2Z6DA 1CJFA 4QY5A 2YL1A 3DJNB 5TBMB 4HY8A 5FI7A 3UB8A 5KSCA 3I4UA 5E3CA 1PZPA 4OQGA 1DP8A 5DS5A 1K0KA 2PF4E 1ODVA 3Q7GA 2ZC3B 5HAPA 3DJUB 1ALQA 5CTMA 4S2KA 2X0CA 3GVBA 1TVFA 2XSEA 1VYIA 4FH4A 2XLNA 4YWZA 5DF8A 4LPZA 5JT4A 2Q9CA 4MVZA 4OIPF 5CXWA 4GB7A 1QSPA 3P98A 4IUKA 3T6BA 3IXBA 4AL0A 1FMWA 3IX4A 3FC7A 4JGOA 4BENA 4UQIS 2YL7A 3UB7A 2AVKA 1JWPA 4U5EE 2E8IA 5CHUA 3OC2A 2Y2GA 4EW7A 4G0HA 3L34A 1YYJA 1PIOA 4C6YA 2KLIA 2H0TA 3A3EA 3B3XA 3LLKA 2KYHA 2XXAA 1XGJA 5DTTA 1NBBA 4XQ1A 2PR5A 2Z2MB 4BJ5C 5HZHA 3IH8A 1A0BA 2O9CA 3G34A 3V5MA 1SDNA 2A6HF 2Q9AA 2PYRA 1GHIA 1JTDA 1BZAA 4D2OA 2E87A 1XWJA 5A6BA 1LKXA 5JVEA 3HKKA 2FFHA 1ZG4A 4QY6A 5EVEA 4IWBA 2Q00A 5A90A 1XFQA 3CWFA 1CPQA 3LI9A 5CHMA 2KOIA 2A24B 2OWHA 1IKIA 1ZU4A 2V0WA 1SHVA 3JPUA 2HV1A 4IAQA 3AG3C 3TQOA 3KL4A 2XLOA 2J9UA 3GWNA 2Y2KA 3T1XA 1ES4A 1T9KA 4BBTA 3K1IA 4NXGA 3VE4A 4E7ZA 5KYWA 4C3EA 2A69F 3D72A 3VP0A 1OJ5A 4JE9A 2H5SA 1BR2A 1LPEA 2Y2IA 4JGRA 4LENA 5K5BA 4U5CE 4GOGA 2RSEB 4E17A 1EA8A 3MQQA 4NETA 4U0XA 2I9VA 2QKPA 5E33A 3T50A 2KNHA 4Q8IA 1OCZC 4AFIA 1G5UA 3ZC4A 3IXDA 3DW0A 2ICWG 4QPRA 5EM0A 2VZWA 1PV3A 4DXCA 3GQZA 3IWOA 3OPRA 3TG9A 1ZW2A 1T19A 1Z5ZA 1PW1A 3SNHA 4NXEA 3UR3C 4I38A 1W2WA 2Z15A 4JTAB 3AGTA 3ULFA 1CGME 1FSWA 4PKYA 1L2SA 1D1CA 1V9YA 3A3FA 4MBFA 5EPHA 3E98A 2XD1A 2DB4A 3BECA 3NDGA 3TJ5A 1CGOA 4O01A 3KSIA 4G3KA 4K0WA 4LV1A 3RQFA 1TD5A 3FXHA 1JPNA 2ACGA 1Y54A 2EXBA 3CMZA 3B9QA 1BLCA 3C7UA 4QHCA 3LLIA 4XLPF 3KYIA 4ZLDA 2GX5A 4E3NA 3GEHA 1XPBA 3UDFA 1GHMA 3O3VA 2EPLX 3LEZA 3IQCA 1KDWA 1K40A 3F47A 2OWJA 4M4XA 2J7VA 1E2XA 3PBTA 2YL3A 2WKPA 4J30B 3DI5A 3HJIA 3LESA 2PX3A 4OPQA 2HUJA 1P9WA 2LSEA 1LL9A 5GLDA 4CJOA 1DY6A 2WUQA 3TE8A 3S9OA 3VSKA 1YDIA 4PJMA 2Y3DA 4OOLA 4FSFA 5HD5A 3U3FA 2A0BA 2PYPA 3JSEO 3QP2A 3QMKA 1YZAA 4YL1A 3DTIA 2H7VC 4JCHA 3B0UX 4MVMA 4QI0A 2QY9A 1MWSA 3DWZA 3IWIA 1K54C 1YLZA 1TS7A 1S67L 1KGGA 4B4XA 3BLSA 5HSQA 1XP4A 3J06A 4PHTA 2CMNA 4X25A 1C3BA 1D0YA 5CI8A 5L0JA 1YKDA 3DAGA 5F68A 4R0QA 1LL8A 1OT9A 2M4EA 1QLEC 1VM1A 4O79A 3DAVA 2LFFA 1SMYF 3N0TA 2Y2PA 5BOHA 5J4EA 5DLJA 3A3DA 5FAPA 1WN0A 4BBUA 4BL3A 4BJ6A 1TFOB 1RJ9A 3IF6C 3BW6A 3B47A 1T5OA 4Y13A 3IF6B 2J45A 4KZ8A 5AJGA 3UE0A 1RMVA 1LI7A 2HPBA 4Z1WA 4IARA 2EX9A 4Q7CA 2XLWA 3QZCA 3GEEA 1TKNA 5FEGA 1NZUA 3ZG0A 3NOPC 1T01A 3JRMO 4JF4A 3GDIA 4KG6A 4ZBEA 1E83A 3K66A 3M1CB 3PHF2 1ZHXA 3S7PA 3S90A 3IQAA 1CPRA 1KDSA 4EEPA 4GDNA 4F94A 3N2ZB 1K04A 1YARO 2W27A 3PXPA 2L7AA 3K6BA 5L07A 3SH9A 3SS3A 4BEMJ 1OW6A 3GM3A 2NUTC 2R7TA 2O99A 3JRTA 5A6BD 1YVIA 2V3CC 3GMWA 3O10A 4KI2A 3O87A 3H82A 3HLDA 5DQZA 4IUHA 3U2MA 4MTOA 5TGFA 4N1XA 3LUTB 2OAP1 2B18A 3JT1A 1H5XA 2OJED 1K6SA 3C4PA 4OONA 1ZKJA 5D91A 5CRFA 2KW3C 2XLMA 1ZW3A 3EHNA 1Z63A 2QE9A 2J0XA 1DJBA 3O6XA 3HUMA 4S2LA 3DE9A 1BR1A 1S0WA 2WKQA 4JEAA 4I3IA 2C5WB 2R7XA 3VP3A 5GLAA 2G7UA 3HLWA 4DRIB 4WZ5A 5DVWA 2ZC7A 4X56A 5FAOA 3VV4A 3NDBB 3NBLA 2MYSA 1Q2PA 2DNSA 3UMEA 1MQVA 4K1OA 5A6AA 4KG2A 1EI7A 2J9WA 2VV8A 1N9LA 3BQ8A 3U4LP 2Y3HA 3N8SA 3NC8A 3CSKA 3ZDJA 1FAPB 4J7TA 3ZG9B 4CIHA 3FYZA 5B1BC 3UO9A 1MWRA 4NG2A 1OR3A 3O5YA 4QI2A 2HDSA 3PBRA 1VMAA 3ITAA 2H28A 3JTLO 3CI6A 3F1NB 4ZAMA 1VK5A 1WA9A 3F1PA 2VKSA 3Q7VA 3LI8A 1CI8A 5K0IA 5A91A 4U5BE 4DOZA 3LO7A 4M3KA 4PAUA 2J3WA 3EJNA 2G3KA 4GQHA 4RD9A 4HFKB 2Q7RA 3JYIA 4HOIA 5L10A 4B93A 4AK9A 5CX7A 1ES2A 4DRJB 1MMDA 1E25A 1QVXA 3BEHA 4QB8A 3NMKA 3MKEA 3EH1A 1OPXA 2UUHA 3G4ZA 2J9PA 2BC5A 4WM9A 2O9BA 3LR5A 3C8GA 1YAXA 4GS9A 1NFNA 2WGVA 3DD7A 5KYYA 3ABMC 1YPRA 3ZQVA 2XRHA 1H9GA 5E2GA 1LM3B 4L6RA 4WGYA 4KQQA 1C03A 3T4QA 2KSFA 1M6KA 2XR0A 3UMDA 2J80A 1TWCA 2OOLA 4PR9A 1H8MA 5FSRA 4IHQA 4Y3IA 2PNOA 2VEAA 4HQAA 5CI9A 4JCZA 3OCLA 2HKVA 3QW0A 1LVKA 4LDKA 3BFCA 3W4QA 4HEAJ 1T6UA 4PMAA 2MWQA 2JHEA 3UDIA 2WZZA 4Y17A 3MSHA 1VB5A 3BY8A 4PM6A 3EZIA 4YOFA 4CS7A 2HDRA 2P74A 3CLOA 1L0DA 5A6KA 4NC3A 5AQBA 1V74B 3C2WA 3RVZA 4OIOF 2C03A 5GPGB 2YWAA 1HE1A 1ZHZA 3H82B 2WAFA 3PCVA 4C3DA 1RGZA 3DMDA 5L3QA 1KVLA 4MLLA 4U9DA 2YVKA 4W8KA 4Z9QA 3KYZA 2YL0A 1IFQA 3WRTA 3BYDA 3D9YA 4EERA 3B0VC 1KU2A 2PBEA 3RKOF 1G4US 3HNKA 5L3VA 1I2WA 1U60A 3MYIA 3CITA 3LGOA 4K7BA 2R7SA 2R7UA 2ZJ9A 4XUXA 2R7OA 3T4KA 1W8YA 3OBFA 4HE8D 3DBAA 4R6LA 4Y2FA 4QD4A 2VV7A 4YINA 3T4JA 4D4NA 2H0YA 5IS1A 3IF5A 2Y2JA 1WGWA 3C62A 1H8ZA 3TSGA 3Q07A 2NPUA 5L2FA 2XSSA 3A3JA 4WELA 1CF0A 4GZBA 5EFWA 4GYTA 3T12B 1F5MA 3NYLA 3V50A 4BD0A 2WVOA 2ZMVA 3OLOA 5BQGA 2P7JA 1ZYRF 2GDNA 3EHMA 3VP2A 2DMWA 1TWGA 3DTKA 1AEPA 1JPJA 1OT6A 4LLOB 4PJNA 5A8BA 2J8WA 2K31A 4GNUA 1U6HA 1AVOB 4KENB 3QHYA 1V55C 1A7DA 1K4FA 1IZMA 1HMOA 3L8JA 4E6WA 2XK1A 4GLQA 2JKGA 3PBSA 5F5YA 2IXOA 4DDYA 3W4OA 3B42A 4S2OA 1L0FA 3VOLA 4LRXC 4JRZA 3IX8A 2VJWA 4H6JA 1J3WA 2M7VA 1VLSA 2JKRM 3JCUQ 2XS1A 3ASOC 3CZ6A 4E0IA 2Y91A 2QHKA 3MXQA 3EGXA 3GM2A 2H10A 4KZBA 2J46A 2WZLA 4BWIA 5EOOA 1CQAA 1ONHA
chains in the Genus database with same CATH topology
1UWPX 3JVVA 2QJ5A 1S1YA 2O9CA 4MDZA 2L1MA 3TW8A 1XJ2A 2M1CA 2PYRA 3CUEC 4I39A 5HWWA 3G6OA 1T1CA 2YKFA 1JNUA 1XFQA 3CWFA 4NXBA 3LI9A 1OTIA 2KOIA 2A24B 2OWHA 5HPFA 1XJ3A 2V0WA 3OCNA 2HV1A 2PT7A 4XT2B 3UB9A 2LB9A 3LIEA 5HPIA 2XA7S 4Q0HA 4F3LB 2VX8A 3T4OA 4BBTA 4DJ3A 4NXGA 1KOUA 3VE4A 3H7WB 3D72A 4L9FA 1OJ5A 1NLYA 4JGRA 5K5BA 1GSVA 1YSPA 3F1PB 2JN7A 3LUQA 3MQQA 3MQ0A 1F98A 2I9VA 3H9WA 2HGVA 2QKPA 4ME4A 3T50A 4AFIA 5DFYA 2EWVA 1XJ4A 3PBOA 2FZ0A 3EEAA 4QPRA 2VZWA 5J3WA 3NHQA 1T19A 3K3CA 4NXEA 4HNBA 3U2AA 4I38A 3LIBA 2PHYA 4WEJA 4WUJA 3ULFA 4KUKA 4PKYA 2V1BA 2V9AA 1V9YA 3E98A 4G3VA 2J3TC 4O01A 1G28A 3EWKA 4ARZB 3KSIA 4G3KA 3MQOA 2D01A 1TD5A 1UGUA 2NUPC 3V67A 3FPVA 2JKRI 1STZA 2GX5A 2J3TD 5J7EA 4Q0IA 3LFVA 2Y8HA 5L8MA 1TS0A 3F1OA 3BWLA 3FG8A 2PDRA 1LSXA 2FH5A 3NJAA 2JKTI 3LIAA 2OWJA 4M4XA 3C8CA 2HF6A 3PBTA 2WKPA 4RQ9A 1LSVA 3TJZC 4NEED 3HJIA 4I3AA 3S7QA 3CAXA 4WF0A 1P9WA 3KSHA 4Q0JA 3MJQA 4O0PA 2XA7M 5FL3A 1TS8A 3TE8A 4F3LA 1D06A 4OOLA 4FSFA 5HD5A 1MZUA 2A24A 3T4SA 1ZTUA 5HDDA 2PYPA 1DP9A 4LRYC 4EXOA 2W3FA 2GZAA 1TS7A 1S67L 3IBJA 4FOFA 5HSQA 4PHTA 4CLCA 2K7SA 2CMNA 1YKDA 1EW0A 1X0OA 2O0YA 5F68A 1LL8A 1OT9A 3PHYA 1GSWA 3HCYA 3UE3A 1OTDA 3KSGA 2M7UA 5J4EA 2GJ3A 3U9MA 2VV6A 4BBUA 3BJNA 2INWA 4BBVA 3BW6A 3B47A 2QJ7A 4YNRA 4NKPA 5AJGA 5DJUA 4GW9A 1N9OA 1NLZA 4Z1WA 3R7WA 3KO6A 3E4QA 3SW1A 4ETXA 3H7WA 3MFXA 3NOPC 4G3WA 4CLCB 3GDIA 2PR6A 2HJ9C 4GCZA 2W1TB 4IJGA 3LYXA 3LR3A 2Z6CA 4B9OA 2BASA 3S7PA 4KQOA 4EEPA 1DRMA 4GHIB 5KSHA 2D02A 3P01A 3F1OB 3LR4A 3PXPA 2W27A 4K08A 4L9EA 2NUTC 2O99A 4GJ4A 3V5YA 1GSXA 5KIZA 3H82A 4JGPA 4ZRRA 4ETZA 4IUHA 1S66L 2OAP1 3U9JA 2B18A 1W63M 3UE6A 1D7EA 4HH2A 5G4ZA 4HJ3A 4MN5A 1IOUA 4LRZE 4MCWA 1W63Q 4Y5FA 2ZBBA 5DF9A 5AVEA 2WKQA 4WL9A 5MC7A 4I3IA 1F9IA 3TRCA 3ZYTA 4O8GA 3P7NA 2VGLM 4MN6A 5G4YA 2G7UA 3LIDA 5DKKA 3CUEA 4WEKA 4HJ6A 3VV4A 4I5SA 4HH3A 3UMEA 3K2NA 3A0SA 2JKTM 2VV8A 1BYWA 1N9LA 3BQ8A 1P9RA 2W3HA 5DKLA 2W3GA 2YKHA 1MC0A 3E0YA 3E4PA 2XROA 4HHDA 5AVFA 3O5YA 4CLCC 2IA2A 3PBRA 2KDKA 5TBMA 2H28A 3CI6A 2MJ6A 5HDCA 1VHMA 2W3EA 1DP6A 2ZOHA 3T4LA 3F1NB 3F1PA 1WA9A 3LICA 2VKSA 1H3QA 1T1AA 3LI8A 4L9GA 2ZOIA 3OOVA 1OTEA 1LSWA 4HP4A 2PD8A 3EQUA 1TF1A 1XJ6A 4PAUA 2J3WA 2KX6A 4JGQA 2B02A 1T1BA 4HOIA 3V5ZA 4B93A 5CX7A 3PBQA 5F6AA 1T18A 3FPWA 4BJPA 4R3AA 3MR0A 1TS6A 2K2NA 4R38A 1NWZA 3MMHA 4DMZA 1ZHHB 1OPXA 3W2ZA 2A2LA 3T4TA 2O9BA 4HIAA 4UQIM 3LR5A 1YAXA 4GS9A 2W1RA 4HJ4A 4ARZA 3E4OA 4NXFA 3VE3A 3V5XA 4H6JB 2ZMFA 3RFBA 1MKMA 3T4QA 2V0UA 3UMDA 2J80A 2OOLA 3IBRA 1H8MA 3PR6A 4DJ2A 1OJGA 4IHQA 4Y3IA 2VEAA 3EGXC 4OOMA 4HQAA 3R4KA 3OCLA 4R70A 5DJTA 2VGLS 3ZQ5A 3EOIA 2V1AA 3EEHA 4MMNA 2JHEA 3K3DA 5HDSA 4XT2A 4HP9A 3BY8A 4YOFA 5LBRA 3UB6A 5IT5A 1OTAA 3CLOA 1LT0A 3NOUC 3C2WA 1VB6A 5DFXA 3PYPA 1XFNA 2EWWA 3H82B 2WKRA 3LR0A 3NOTC 1P97A 2HJEA 1NRJA 3KYZA 1Y28A 1IFQA 2OAQ1 2GNXA 4WLAA 1S1ZA 3R7WB 5HD3A 2LB5A 4EERA 3S7NA 2VLGA 2L4RA 3MF0A 3BY9A 3ICYA 3A0VA 4I3JA 1S4SA 3BQAA 2QWSA 3CITA 3F1NA 5HWTA 4PKYG 4MN7A 5C5KA 2P0NA 3EQVA 3T4KA 1P0ZA 4L0LA 3GECA 5I5LA 5F69A 4WN5A 2XRNA 4GHIA 3OBFA 3DBAA 1V9ZA 4R6LA 4P6ZM 5HL6A 4Y2FA 1S4RA 4EQ1A 4BMWA 4EESA 2VV7A 4CLCD 3T4JA 4II7A 4EETB 5IS1A 2W0NA 4EEUA 4UEYA 1YSQA 2R78A 3C38A 2XSSA 4GS9B 2PD7A 4WELA 5EFWA 1F5MA 3RH8B 2Z6DA 2VA0A 3S7OA 5TBMB 2ZMVA 4HY8A 3OLOA 2P7JA 3UB8A 2QYBA 5IU1A 1DP8A 2DMWA 1ODVA 4CLCE 1OT6A 4LLOB 3RTYA 5A8BA 3B33A 2K31A 3KX0X 3JVUA 3IS2B 4EU0A 4P6ZS 3IS2A 2EA9A 4YWZA 3HJKA 3KSFA 5TJJA 1OTBA 4KUOA 4LPZA 4CQHA 3PBNA 4IUKA 3EGDC 4GLQA 1G6OA 3PBSA 5F5YA 2W3DA 3B42A 3A0RA 3FC7A 3KYQA 4JGOA 4KQDA 4LRXC 3VOLA 2L0WA 4UQIS 1N9NA 2P08A 3UB7A 2VJWA 4H6JA 2M7VA 3LIFA 2O9AA 3OC2A 4HI4A 4EW7A 2JKRM 2QHKA 3D3OA 2KLIA 3MXQA 4EUVA 5HWVA 4E04A 1UWNX 2P04A 3C30A 4BWIA 4DN0A 2Y79A 2PR5A 5HZHA 2W1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS8 A;  2WKQ A;  1LT0 A;  1UWP X;  3CLO A;  3NOU C;  2QJ5 A;  1F9I A;  4I3I A;  4WL9 A;  4F3L A;  1S1Y A;  3C2W A;  1VB6 A;  1D06 A;  2L1M A;  3P7N A;  4MN6 A;  1XJ2 A;  3PYP A;  2M1C A;  2PYR A;  5HD5 A;  1MZU A;  1XFN A;  2A24 A;  3G6O A;  4I39 A;  5G4Y A;  3LID A;  1T1C A;  5HDD A;  2PYP A;  1DP9 A;  2WKR A;  2YKF A;  3H82 B;  5DKK A;  3NOT C;  4LRY C;  1P97 A;  4HJ6 A;  1JNU A;  1XFQ A;  3CWF A;  4I5S A;  4EXO A;  4HH3 A;  3UME A;  1Y28 A;  3LI9 A;  4NXB A;  1OTI A;  4WLA A;  1S1Z A;  3A0S A;  5HD3 A;  1TS7 A;  2A24 B;  2OWH A;  4EER A;  1XJ3 A;  2V0W A;  1BYW A;  1N9L A;  2VV8 A;  2VLG A;  1S67 L;  2HV1 A;  2L4R A;  5DKL A;  4XT2 B;  3UB9 A;  2YKH A;  5HSQ A;  3BY9 A;  3ICY A;  3LIE A;  3A0V A;  4I3J A;  1S4S A;  2K7S A;  2CMN A;  1EW0 A;  2QWS A;  3F1N A;  5HWT A;  3E4P A;  1X0O A;  4PKY G;  5F68 A;  4F3L B;  2P0N A;  1LL8 A;  4HHD A;  1OT9 A;  3PHY A;  1P0Z A;  5AVF A;  4NXG A;  1KOU A;  3VE4 A;  4BBT A;  4DJ3 A;  2PR5 A;  3GEC A;  2KDK A;  3H7W B;  1GSW A;  3D72 A;  4L9F A;  2H28 A;  1OJ5 A;  5F69 A;  4WN5 A;  5I5L A;  4JGR A;  4GHI A;  5HDC A;  1OTD A;  1GSV A;  1DP6 A;  1V9Z A;  2ZOH A;  2JN7 A;  3F1P B;  3F1N B;  4R6L A;  5J4E A;  3F1P A;  1WA9 A;  3LIC A;  3LUQ A;  3MQQ A;  1F98 A;  1S4R A;  1T1A A;  3U9M A;  2GJ3 A;  2I9V A;  2QKP A;  3H9W A;  4EES A;  2VV6 A;  4EQ1 A;  2VV7 A;  3LI8 A;  4L9G A;  2ZOI A;  3T50 A;  4BBU A;  1OTE A;  1LSW A;  4HP4 A;  2PD8 A;  2INW A;  5TBM A;  4BBV A;  4EET B;  5IS1 A;  1XJ6 A;  1XJ4 A;  2W0N A;  4EEU A;  2QJ7 A;  2KX6 A;  2R78 A;  4JGQ A;  5J3W A;  5DJU A;  3NHQ A;  4GW9 A;  1N9O A;  2B02 A;  1T1B A;  4GS9 B;  4HOI A;  3V5Z A;  2PD7 A;  5F6A A;  1T19 A;  1T18 A;  5EFW A;  3K3C A;  3MR0 A;  4R3A A;  1TS6 A;  4NXE A;  4HNB A;  3RH8 B;  4I38 A;  4R38 A;  1NWZ A;  2Z6D A;  3E4Q A;  3SW1 A;  3LIB A;  2PHY A;  3H7W A;  3MFX A;  3NOP C;  4HY8 A;  4WUJ A;  4KUK A;  5TBM B;  3OLO A;  2V1B A;  2P7J A;  2V9A A;  4PKY A;  3GDI A;  2PR6 A;  3UB8 A;  1V9Y A;  5HWW A;  4GCZ A;  4HIA A;  5IU1 A;  1DP8 A;  4GS9 A;  1ODV A;  1OT6 A;  3LYX A;  4HJ4 A;  4LLO B;  3RTY A;  2Z6C A;  5A8B A;  1G28 A;  3B33 A;  2BAS A;  3EWK A;  4B9O A;  3KX0 X;  3MQO A;  2D01 A;  3IS2 B;  1DRM A;  4EEP A;  4GHI B;  3E4O A;  2D02 A;  1UGU A;  3IS2 A;  3F1O B;  2EA9 A;  4NXF A;  4YWZ A;  3VE3 A;  2W27 A;  3HJK A;  1OTB A;  3V5X A;  4H6J B;  4KUO A;  4K08 A;  4L9E A;  2V0U A;  4LPZ A;  3UMD A;  2J80 A;  2OOL A;  3IBR A;  3V5Y A;  1GSX A;  5J7E A;  5F5Y A;  4DJ2 A;  5KIZ A;  4KQD A;  3H82 A;  3A0R A;  3FC7 A;  1TS0 A;  3F1O A;  4JGO A;  4JGP A;  4LRX C;  1OJG A;  2L0W A;  1N9N A;  3ULF A;  3UB7 A;  3VOL A;  4H6J A;  1S66 L;  2VEA A;  3BWL A;  3LIF A;  3FG8 A;  3U9J A;  4HQA A;  2PDR A;  1LSX A;  4HI4 A;  3NJA A;  4R70 A;  4EW7 A;  5DJT A;  3UE6 A;  3ZQ5 A;  2V1A A;  3EEH A;  3LIA A;  2OWJ A;  1D7E A;  2JHE A;  3C8C A;  2QHK A;  3MXQ A;  4HH2 A;  3K3D A;  4M4X A;  5G4Z A;  4HJ3 A;  2WKP A;  4RQ9 A;  1LSV A;  4MN5 A;  5HDS A;  4E04 A;  5HWV A;  1UWN X;  4XT2 A;  3HJI A;  4HP9 A;  4I3A A;  3BY8 A;  4LRZ E;  3CAX A;  4WF0 A;  3UB6 A;  3MJQ A;  1OTA A;  2ZBB A;  5HZH A;  5AVE A; 
#chains in the Genus database with same CATH topology
 4BD1 A;  2NG1 A;  1S1Y A;  5JYO A;  3AQB A;  3K1H A;  3FWL A;  4JXW A;  4PFP A;  1E3U D;  1XJ2 A;  3CUE C;  4EBL A;  3G6O A;  4OLG A;  3NRH A;  1J9M A;  1T1C A;  2Y2M A;  2BL2 A;  3QP1 A;  3C5A A;  1DOV A;  3AJM A;  1YLM A;  1VYK A;  3RQG A;  4P9F A;  1GGQ A;  1XJ3 A;  1XZP A;  3OCN A;  1N1C A;  2PT7 A;  2QLA A;  4PM8 A;  2LB9 A;  3UB9 A;  4R3J A;  2OOC A;  5I94 A;  5HPI A;  5FCL A;  4D60 A;  1KE4 A;  3VMA A;  3MXS A;  5EM1 A;  2XF3 A;  4P6B A;  2XA7 S;  4Q0H A;  3UPN A;  2VX8 A;  4F3L B;  2W45 A;  3T4O A;  3PAG A;  4J7Y A;  4JUR I;  1ZHW A;  1YSP A;  4R23 A;  3LUQ A;  4Q5S F;  1WE4 A;  4O6N A;  2YZS A;  3MQ0 A;  3H9W A;  4G7Z F;  3GAN A;  2JC7 A;  2ZQC A;  2NSG A;  4R4S A;  3IHA A;  2PBD P;  4N9L A;  3HLF A;  1A41 A;  3PBO A;  2GFH A;  2FZ0 A;  4E0H A;  4CSA C;  2W4M A;  3AG1 C;  3DZA A;  4MBH A;  4OP5 A;  2R25 A;  1VLT A;  2IM8 A;  1SR2 A;  3ITF A;  5KZH A;  4EUZ A;  3LIB A;  4WEJ A;  4U5G A;  4CDA A;  2V1B A;  4LDR A;  2WL8 A;  4MVQ A;  2Y59 A;  4G3V A;  3NKD A;  1PWD A;  3EWK A;  5T3W A;  3S27 A;  2IWC A;  5KYU B;  2D01 A;  3EQL F;  2C04 A;  3O55 A;  2Y39 A;  2NUP C;  5HAI A;  2WGW A;  1E4D A;  4XWJ A;  3U8P A;  2HFI A;  3KPH A;  3V67 A;  5FEF A;  3NEC A;  3LFV A;  4E3I A;  3F1O A;  1H8Y A;  3UNW A;  5E2E A;  1ZC2 A;  4MVS A;  1ESI A;  1QQ3 A;  2V2F F;  1LSX A;  2FH5 A;  3GV9 A;  3S22 A;  5CGW A;  3MXR A;  3QVY A;  1CEG A;  4G7O F;  2C6W B;  3TJZ C;  1FCN A;  4I3A A;  3S7Q A;  4KZA A;  3VFH A;  3KSH A;  4O0P A;  1K4E A;  2XA7 M;  3QNC A;  1TS8 A;  3Q6N A;  3VYW A;  5F28 E;  2A24 A;  4X0R A;  1GHP A;  3VF0 A;  1K56 A;  2EFU A;  3MZE A;  2R7W A;  4KZ4 A;  3HLZ A;  1MMG A;  2ZQ8 A;  1PYY A;  3M2K A;  3LEV A;  2J9V A;  4EIY A;  3C7V A;  3BRM A;  1YZC A;  3JYY A;  4EXO A;  4FX5 A;  3QVZ A;  4J32 B;  4C7O B;  1ZVZ A;  5IY5 C;  4YN0 B;  2Y4A A;  2R9R B;  3RYL A;  3IBJ A;  2Q9M A;  4FOF A;  5EVI B;  4K0X A;  2K7S A;  4ID4 A;  2G3V A;  5AQ7 A;  4E3M A;  4PPR A;  1D1A A;  2W4B A;  2DGJ A;  3ISG A;  1ORY A;  4WGZ A;  1J8M F;  3RXX A;  3M4C A;  2VC9 A;  3KSG A;  2M7U A;  2V26 A;  3MFN A;  2Y2L A;  3FVY A;  3VM6 A;  3V3R A;  4EKW A;  3FKV A;  3WS0 A;  3UMI A;  2EXA A;  2VAS A;  4BQM A;  3M6B A;  1BUL A;  3BJN A;  5IHV A;  2YHS A;  3C8G D;  4YFM A;  1RCP A;  1C02 A;  4BG0 A;  3EZH A;  4DE3 A;  2GA0 A;  5FQK A;  5DJU A;  4GW9 A;  2ZD8 A;  5KYX A;  3KO6 A;  3CJM A;  4R4R A;  5EVL A;  1HW1 A;  4CIP A;  3MFX A;  4CLC B;  4CDV A;  3T9O A;  2ETS A;  3DKA A;  1FR6 A;  2PR6 A;  2Y2N A;  4E3K A;  2W1T B;  3ZVR A;  2X02 A;  3VOZ A;  1BTL A;  4YT5 A;  3QW1 A;  2V8F A;  3MS6 A;  4KQO A;  1DRM A;  3BFF A;  1EWZ A;  4GEH A;  4AX2 A;  4U3T A;  3GOR A;  3LR4 A;  4K08 A;  4L9E A;  5FI2 A;  3V5Y A;  4IGG A;  1PW8 A;  1AWI A;  2OEV A;  2AVX A;  1M56 C;  2A0U A;  3SS5 A;  2VCC A;  4JGP A;  4ZRR A;  4ETZ A;  3LCE A;  1HTZ A;  1YYX A;  4LCL A;  3I5P A;  2BG1 A;  2JE5 A;  5E43 A;  1O5H A;  4HH2 A;  5G4Z A;  4OQ0 A;  4XTK A;  1WAT A;  1RKE B;  2XM0 A;  4IBR A;  4PJL A;  3MKF A;  4LRZ E;  3NMJ A;  4MCW A;  3NIA A;  4MTF A;  4XPW A;  3MFD A;  4Z9H A;  5AVE A;  4P9T A;  5GHX A;  5MC7 A;  1SZI A;  1F9I A;  2XL6 A;  2QUP A;  2VGL M;  4MN6 A;  1MMA A;  2EPM X;  1V4A A;  3LID A;  5DKK A;  3Q7Z A;  4XXR A;  4HJ6 A;  2G2U A;  4A5R A;  1NLX A;  4ZLC A;  2EPK X;  5JP7 A;  2CCY A;  1EQ1 A;  2IYL D;  4YWQ A;  3A0S A;  1NXY A;  4UHU A;  1NZO A;  1MC0 A;  3E0Y A;  1OCO C;  3E4P A;  3C8G B;  3C4O A;  4ZJ1 A;  5AVF A;  2OJQ A;  2BE5 F;  2IA2 A;  3ZGA B;  2P1A A;  4DVY P;  5HDC A;  2W3E A;  2ZOH A;  3T4L A;  2Q0O A;  3LIC A;  3QNB A;  4YL3 A;  3TK0 A;  1MWU A;  4MQ9 F;  2L6G A;  1OTE A;  2A68 F;  1TEM A;  5GLB A;  2AWY A;  3JSZ A;  1MY8 A;  1XJ6 A;  3N8L A;  5EVI A;  2KX6 A;  3G2Z A;  4ZDX A;  4NTB A;  2B02 A;  1T1B A;  2ZM8 A;  3PBQ A;  1RJ9 B;  1HVB A;  1NJ4 A;  5E2H A;  3IEE A;  4R38 A;  1NWZ A;  4XEK A;  4PAC A;  3MMH A;  2R02 A;  4Y0U A;  2LD6 A;  2O9X A;  4UAA A;  3ZVW A;  3W2Z A;  4BJT A;  2A2L A;  2TMV P;  1ES3 A;  3N6I A;  4X55 A;  2XLH A;  3N8R A;  3S29 A;  3W4Y A;  1E86 A;  2CGE A;  3QP6 A;  4GN2 A;  4ARZ A;  3G4X A;  3E4O A;  2XLE A;  2WKI A;  1BBH A;  3V5X A;  2ZMF A;  2YEV A;  3UE1 A;  2WKE A;  3SEO A;  4UA9 A;  4R32 A;  4B6I A;  2HV7 A;  3IQ6 A;  3AOU A;  1KE0 A;  4OOM A;  2ZMA A;  3EEH A;  3LS1 A;  3O39 A;  4FD8 A;  5HDS A;  4XT2 A;  4E6X A;  4HP9 A;  5FQI A;  1CEF A;  3L8I A;  5IT5 A;  1SCW A;  3KYE A;  3M6H A;  5F5H A;  4S2J A;  1VB6 A;  4I44 A;  4EUK B;  5DFX A;  1HW2 A;  3ZIB A;  2DYR C;  2GDC A;  1YM1 A;  2WKR A;  2PAV P;  3LR0 A;  2HJE A;  3IPM O;  2EIL C;  3OWT A;  4OQI A;  1GM5 A;  4WLA A;  3HUO A;  2HJ3 A;  3EFO B;  3LY3 A;  1QKR A;  2V8C A;  4JXV A;  4OH0 A;  1EI5 A;  1K54 A;  2L4R A;  2EIN C;  2LFD A;  4EBJ A;  3T1Q B;  4I3J A;  2Q3T A;  3SH8 A;  3G32 A;  3BQA A;  1I5N A;  3F1N A;  5HWT A;  3UGO A;  4PKY G;  1O07 A;  4KZ9 A;  4MN7 A;  1P0Z A;  3BFE A;  3V7O A;  1S05 A;  1M2V A;  1YJG A;  2L6F A;  4YT2 A;  2XRN A;  4B88 A;  4GHI A;  4Y0T A;  4P6Z M;  2WKH A;  5CGS A;  3C18 A;  5HL6 A;  1ORJ A;  1S4R A;  1LLB A;  4EES A;  1TFK B;  3AGF A;  3HNI A;  4LLE A;  4II7 A;  1GS9 A;  3QP5 A;  4JJF A;  4LAC B;  4YL0 A;  4UEY A;  3FHD A;  3F46 A;  2R78 A;  3C38 A;  4EWC A;  4MVR A;  4DBR A;  2RCX A;  4GS9 B;  5KYY B;  2DYS C;  5BQH A;  1NRF A;  5FDH A;  3RH8 B;  4QJG A;  4FWV A;  5B1A C;  3S7O A;  5CEC A;  4Q4Z F;  4CS8 A;  1AUE A;  3WS4 A;  2OCC C;  2QYB A;  1BSG A;  5IU1 A;  1Z23 A;  4CLC E;  1ZZP A;  3ZG5 A;  5CEB A;  4QU3 A;  3RTY A;  3B33 A;  3KX0 X;  2I8B A;  3IS2 B;  3IS2 A;  1N9B A;  3KSF A;  3ZG8 B;  1OTB A;  1KTM A;  5HFO A;  4I1M A;  2ZXW C;  4O6M A;  4E3L A;  2NUT A;  3AGE A;  2P6V A;  3EGD C;  1Z7Q c;  2BTF P;  3IT9 A;  1G6O A;  1OW7 A;  2W3D A;  1FFH A;  3KYQ A;  3EGD B;  3K1I C;  5TFQ A;  2L0W A;  2P08 A;  2CNW D;  3MYF A;  2A1D D;  2CYD A;  1CK3 A;  3T6J A;  3TD7 A;  5AQ9 A;  1WTY A;  4ZTK A;  3D3O A;  4EUV A;  3KMI A;  5L0H A;  4E04 A;  2XQZ A;  2OSU A;  3W8H A;  2EPO A;  2Y3B A;  5FQJ A;  1FNT c;  4DN0 A;  5DQT A;  2W1T A;  3JVV A;  3UB5 P;  1UFB A;  4UDV A;  4MDZ A;  2X01 A;  1QMF A;  1G4W R;  2L1M A;  4JKT A;  3X2Q C;  3TW8 A;  1T6Q A;  2YKZ A;  2Y3G A;  2YKF A;  1OXB A;  4C3B A;  1JNU A;  4NXB A;  4ZJ3 A;  1S6R A;  1OTI A;  2R05 A;  3LJB A;  5D92 A;  1K56 D;  3RIP A;  3WAQ A;  4XT2 B;  1VET B;  5FQM A;  1W7F A;  2ZL1 A;  3LIE A;  3WS2 A;  2AWC A;  4CDY A;  4RA7 A;  1QME A;  4OKP A;  1BR4 A;  2E8J A;  1RKE A;  1KOU A;  1FQG A;  3NCK A;  3KH2 A;  4L9F A;  1YMX A;  1RKC A;  1NLY A;  1GSV A;  2ZQD A;  3F1P B;  2EX8 A;  2HMZ A;  3W4P A;  1BUE A;  1F98 A;  2HGV A;  1FCM A;  4ME4 A;  4DE1 A;  3DM5 A;  1JMW A;  3M4B A;  1L3L A;  5DFY A;  2Q4F A;  1XJ4 A;  1SKO B;  2WAE A;  1NFO A;  1TDG A;  3U2L A;  5DTK A;  1QPU A;  3SZT A;  3MX3 A;  2YRF A;  3LS0 A;  3DXJ F;  1Z3I X;  3FOP A;  3K3C A;  4E18 A;  3S0X A;  3ABK C;  3LAY A;  2KGO A;  3U2A A;  2PHY A;  4WUJ A;  1I4Y A;  3B71 A;  1R4T A;  1K57 C;  2IWD A;  4KUK A;  2GAQ A;  4HFF B;  5E2F A;  1GA0 A;  4CPK A;  2W9Y A;  1APC A;  4I1O B;  2PU4 A;  1E84 A;  2A49 A;  3MQO A;  1NYY A;  3UY6 A;  2HP9 A;  2WK0 A;  1JVJ A;  1OME A;  3E70 C;  1JR8 A;  3POV A;  2I72 A;  3B29 A;  2LQG A;  2ZXR A;  2ZXO A;  2OU6 A;  3FPV A;  5HAR A;  2J3T D;  3ZG1 A;  4JEB A;  4Y7P A;  4EBN A;  2Y8H A;  4RX2 A;  5L8M A;  1Z09 A;  3TOL A;  3BWL A;  1MPL A;  3UNG C;  2AU5 A;  2PDR A;  3MZF A;  4N92 A;  1G8X A;  3O88 A;  2IXM A;  2D4U A;  2HF6 A;  3UN7 A;  3FZC A;  4RQ9 A;  4FH2 A;  3ZCZ A;  4BJ6 C;  5EUA A;  3CAX A;  4WF0 A;  4CS9 A;  1YA7 O;  3VRC A;  1OCC C;  4CX9 A;  3PMR A;  3QP4 A;  1JAF A;  3HNJ A;  5KYW B;  1TWH A;  1MZU A;  3T4S A;  1Q0K A;  1OXK A;  5EGY A;  1SYQ A;  1DP9 A;  2J7P A;  1BLS A;  5AC4 A;  2R03 A;  3KKB A;  3UGP A;  3E9V A;  1YLW A;  1ESU A;  3VFF A;  2GZA A;  2V1Z A;  4NQF A;  4HBU A;  4C75 A;  3OPH A;  3US6 A;  2ZQ9 A;  4CJG A;  1NSG B;  4CLC A;  5B3I A;  1H0M A;  1EW0 A;  2ZC6 B;  1X0O A;  2O0Y A;  1K55 A;  1L3P A;  4PK4 A;  3V39 A;  5JSL A;  1VOM A;  1W5D A;  2L81 A;  3RW0 A;  1GSW A;  1O3U A;  1BZ4 A;  2VB6 A;  3UE3 A;  1FCO A;  3C7J A;  4LGW A;  3AG4 C;  2UV0 E;  4ULV A;  4B4Z A;  1YLT A;  2GJ3 A;  3TOI A;  4MND A;  5U47 A;  2XH9 A;  1YA9 A;  5DS6 A;  4AL1 A;  2INW A;  4BBV A;  3GOD A;  3IXH A;  1Z6F A;  1WYC A;  2QJ7 A;  3EPV A;  3NYJ A;  4YNR A;  4NKP A;  3ATP A;  5HSW A;  2BLS A;  4RYE A;  1TDL A;  2V20 A;  5HL1 A;  1N9O A;  1NLZ A;  1FR1 A;  5AQA A;  2YLG A;  5DF7 A;  3HUN A;  1HLU P;  4IAO A;  2HSB A;  3E4Q A;  2NUP B;  3SW1 A;  4ETX A;  5DS4 A;  3Q6M A;  4P87 A;  1VEU A;  4GCZ A;  4X6T A;  1LE4 A;  3DM9 B;  5KMW A;  1K38 A;  1M2V B;  2P9V B;  4GHI B;  2D02 A;  3F1O B;  1YT4 A;  1SKO A;  4OD5 A;  3X1O A;  1D1J A;  4GJ4 A;  1L7C A;  1GSX A;  4F4B A;  5KYU A;  3C8Z A;  3N7W A;  1KNY A;  4FAP B;  1IEM A;  1ORS C;  3W8I A;  1ST6 A;  1PWG A;  3U9J A;  2OV5 A;  5CER A;  3ABL C;  4JVS A;  1W63 M;  4O7G A;  5TJ5 E;  4XPY A;  2YQY A;  1LL5 A;  1UG7 A;  1Q2Q A;  3NY4 A;  4S2N C;  3ZHH A;  4BJ5 A;  1MNE A;  3IQ5 A;  1TWA A;  4Y5F A;  1H9T A;  2ZBB A;  3L0I A;  5DF9 A;  2XL4 A;  3WS1 A;  2OLV A;  2HV6 A;  4QWO A;  3HLG A;  4C7O A;  3P7N A;  2RD9 A;  2ZQ7 A;  1TR2 A;  5GLC A;  1MKI A;  3ZDL A;  3CUE A;  4WEK A;  1OKK A;  1DOW A;  4I5S A;  5M1A A;  4HH3 A;  1I4Z A;  3FDQ A;  1KGF A;  3K2N A;  1XGI A;  3UMK A;  5A6J A;  3G35 A;  4GD8 A;  5HW3 A;  1W79 A;  1P9R A;  5DKL A;  5DTS A;  2W3G A;  4S2P A;  1L0G A;  1WYB A;  4O7D A;  2WZF A;  3WOD F;  1GQA A;  2KK1 A;  4OPZ A;  4HHD A;  3H2V A;  4A2N B;  2P7V A;  5CIV A;  3ZG7 B;  1WAS A;  1PI4 A;  4JZA A;  1VHM A;  3GEI A;  2Y2O A;  3S1Y A;  1YLJ A;  1H7I A;  1L0E A;  3QTH A;  1T1A A;  1OCR C;  4ANJ A;  4ONS A;  1W8Q A;  5KYX B;  2PD8 A;  3EQU A;  2HZ8 A;  3SYN A;  3OZH A;  4DRH B;  2IBF A;  5KYN A;  3U5S A;  3N24 A;  4JGQ A;  3CPT B;  4AE4 B;  2HZ5 A;  1XZQ A;  3V5Z A;  4AE4 A;  2QMI A;  1T18 A;  3SXZ A;  1ONG A;  2ZLY A;  3FPW A;  3MR0 A;  4R3A A;  4UA7 A;  1TS6 A;  2X51 A;  2K2N A;  4Y0O A;  4DMZ A;  1OR2 A;  1ZHH B;  3G4P A;  2B5R A;  3T4R A;  4KZ5 A;  4MNR A;  5GHY A;  3T4T A;  3VP1 A;  4HIA A;  4X69 A;  2A6E F;  2W1R A;  3FAJ A;  4LLC A;  3I7J A;  3RH3 A;  1C17 M;  1U0B B;  1Q0M A;  4XEF A;  4OIN F;  1MMN A;  3DWW A;  2WGW B;  1Y4C A;  5CGX A;  2PP4 A;  3RFB A;  5M19 A;  1MKM A;  3EG9 A;  2LK4 A;  2V0U A;  2CW0 F;  3JZ0 A;  3EG9 B;  4EHP A;  3HLC A;  3IH9 A;  3SOI A;  4OIQ F;  2X71 A;  4DE2 A;  4KG5 A;  3RQE A;  4S2M A;  2PFD A;  2VGJ A;  2M64 A;  4JTD B;  4FCF A;  4X53 A;  3EFO A;  3PR6 A;  4DJ2 A;  3ZNY A;  2RL3 A;  5L0D A;  1JTG A;  1OJG A;  4JIO A;  3UPP A;  5COM A;  4RDA A;  4ZJ2 A;  2XD5 A;  4U5F E;  4R70 A;  4YT8 A;  3DAF A;  3CQZ A;  1XA7 A;  5DJT A;  2V1A A;  4DF6 A;  1OKK D;  5G18 A;  2R9X A;  5T1D B;  3DWK A;  4DJ9 A;  2JD3 A;  1ZHT A;  2I15 A;  1O87 A;  4XPX A;  4CJN A;  1NG1 A;  1YLY A;  2P9V A;  3SP1 A;  3WS5 A;  1H6G A;  1LI9 A;  3RF3 A;  5L0F A;  3S84 A;  2OEX A;  4DXW A;  3NOU C;  3SH7 A;  1IYQ A;  3BEB A;  1I5Q A;  4ULW A;  1F2K A;  3PYP A;  3UPO A;  1XFN A;  2AP3 A;  2XFS A;  2EWW A;  3CG5 A;  5EK0 A;  3BM6 A;  1N4O A;  3NOT C;  1P97 A;  2UUI A;  1KE3 A;  4EQI A;  5GHZ A;  3LEO A;  1NRJ A;  1DJC A;  1Y28 A;  2Z2L B;  2OAQ 1;  4CS8 C;  2GNX A;  1S1Z A;  3R7W B;  2OLU A;  2YLD A;  4RBN A;  1PCX A;  4W8P A;  5HD3 A;  2PBY A;  3HJC A;  3ICY A;  4EWF A;  3A0V A;  1MBL A;  2QTV A;  3OA1 A;  1YMS A;  2QWS A;  1A7E A;  3IX3 A;  4WJ0 A;  3ZQY A;  2P0N A;  5FI6 A;  1NYM A;  2EPN A;  2Y55 A;  4QDL A;  4WYY A;  5HV9 A;  3OPP A;  2HJM A;  5F69 A;  4RVA A;  1V9Z A;  4MVU A;  4MTG A;  4IED A;  4MEZ A;  4PM9 A;  3W8K A;  1DJA A;  3AGU A;  5F82 A;  1K25 A;  4BMW A;  4YK5 A;  4BJ1 A;  4BL2 A;  2D5R B;  1VQQ A;  1JWV A;  4EET B;  2W0N A;  3N4I A;  2L9J A;  2XEP A;  2H8A A;  2G62 A;  1YSQ A;  1SF8 A;  4WZ4 A;  4DXB A;  2PD7 A;  1LIH A;  3RVY A;  5EV0 A;  2OQM A;  4PFO A;  5AGF A;  3RJU A;  2VA0 A;  3B0P A;  2L6H A;  5CHJ A;  2G2W A;  4PM7 A;  3E2L A;  4NCQ A;  3W2W A;  1IW7 F;  4JC7 A;  2JCH A;  3E2K A;  5L0I A;  2HSQ A;  4LER A;  2VH3 A;  2XGN A;  4U5D E;  3JVU A;  4N9K A;  3D4F A;  2IXN A;  3VP4 A;  4P6Z S;  4EU0 A;  2EA9 A;  2EFX A;  3PDM P;  3HJK A;  4IVI A;  5TJJ A;  3GM1 A;  3SXY A;  4KUO A;  4FUW A;  4CQH A;  3PBN A;  3BFG A;  2ZQA A;  1Q0F A;  4U5H A;  4KQD A;  3A0R A;  1GCE A;  1HD8 A;  4OPR A;  1N9N A;  5FZT A;  1IYO A;  3NMI A;  3LIF A;  2O9A A;  3HBR A;  4KZ3 A;  2XFT A;  4HI4 A;  1A7V A;  2CDQ A;  2ASR A;  1PD1 A;  4MS2 A;  2WB7 A;  1RGY A;  3TOM A;  4KNV A;  2KC3 A;  4DVZ A;  5A93 A;  3KYJ A;  5HWV A;  2XM4 A;  1UWN X;  2P04 A;  4JXS A;  3C30 A;  1G6A A;  1VEU B;  2Y79 A;  1UWP X;  2QJ5 A;  4X1L A;  2DCF A;  5F1F A;  1AXB A;  2FGY A;  1B68 A;  3A3I A;  4WZ5 C;  2EIK C;  2M1C A;  2EIM C;  4I39 A;  5HWW A;  4H8R A;  2J9B A;  1XA1 A;  2Y2H A;  4KZ6 A;  2HMQ A;  3W2V A;  1IEL A;  3LEQ A;  3V3S A;  3AG2 C;  1G68 A;  4GD6 A;  3UDX A;  3LY4 A;  3G31 A;  2OG2 A;  5HPF A;  1OW8 A;  3ZTZ A;  4H4K C;  2Y69 C;  2XL8 A;  3ZTM A;  4KZ7 A;  2OKU A;  3VAY A;  2LP4 A;  1FMV A;  4JF6 A;  2DI3 A;  4DJ3 A;  2HDQ A;  1FTS A;  2B95 A;  3H7W B;  2LCH A;  5L09 A;  1JOG A;  1MXO A;  2VGK A;  4K0D A;  1PZO A;  4XLN F;  2JN7 A;  3IF6 A;  4JKV A;  5HAQ A;  5EVI D;  3Q7V B;  3FAP B;  1CGN A;  5L0G A;  3GTC A;  4NK3 A;  3G2Y A;  4CBE A;  1OQC A;  2XDM A;  3T1R A;  2EWV A;  5CED A;  3HRE A;  3EEA A;  5J3W A;  5EVI C;  3NHQ A;  2J0W A;  3A11 A;  2F22 A;  3U0C A;  4I3M A;  4JBF A;  1V54 C;  1M57 C;  5BUO A;  3ITB A;  4HNB A;  1MWT A;  2JBF A;  4HEF A;  2V9A A;  2WYX A;  1MND A;  3UMH A;  4YT4 A;  3DTM A;  1ZG6 A;  3GRJ A;  5EEC A;  2Q9B A;  3Q7L A;  3PAE A;  2J3T C;  1ERO A;  1G28 A;  4ARZ B;  5JYP A;  3ZNT A;  4O6Y A;  3IWQ A;  1PD0 A;  4YJW A;  5EHH A;  1UGU A;  4X68 A;  5D3O A;  2ZM0 A;  4DRT A;  1QZX A;  4D4X A;  1ERM A;  2XS8 A;  2IWB A;  2QNL A;  4E7S A;  3G30 A;  2JKR I;  1STZ A;  3HTK C;  5J7E A;  4Q0I A;  4A4A A;  2KQ9 A;  2PRF A;  1TS0 A;  5A69 A;  3SZR A;  4MVO A;  2VK3 A;  3FG8 A;  1ES5 A;  4OLD A;  1I2S A;  3NJA A;  3HL9 A;  2H7O A;  2JKT I;  3ASN C;  3LIA A;  4LCM A;  3C8C A;  3HVF A;  5FAT A;  4E3O A;  1LSV A;  4NEE D;  4OIR F;  1XXM A;  1YLP A;  5F83 A;  1ZHY A;  3WG7 C;  1HE9 A;  2ZPA A;  4Q0J A;  3MJQ A;  3BLM A;  5FL3 A;  3BFD A;  3QP8 A;  2KJG A;  1LI5 A;  4F3L A;  5EE8 A;  3T1S A;  3O86 A;  1D06 A;  4MW3 A;  1IKG A;  3Q82 A;  3NYM A;  4EBK A;  1NZE A;  1ZTU A;  5HDD A;  3M79 A;  3H65 A;  2PU2 A;  4JJG A;  4LRY C;  1VET A;  4HES A;  4XUZ A;  1LI0 A;  1TQG A;  4PJJ A;  4WMC D;  3OPL A;  2Y2Q A;  3Q81 A;  2W3F A;  2HP6 A;  3P09 A;  1FFT C;  3PTE A;  1BT5 A;  4FTX A;  1LHY A;  4C3Q A;  4Z9J A;  3H2U A;  4R3B A;  256B A;  5JLI A;  3ZWI A;  2ZXP A;  4JF5 A;  4G78 A;  5L0C A;  4Y15 A;  2NUP A;  1M2O A;  4ESP A;  2ZC5 B;  2NSF A;  1FR0 A;  3IHB A;  5FAS A;  5J8X A;  1XX2 A;  3PHY A;  3AGD A;  4JXG A;  3VSL A;  4GDB A;  3L9K A;  2ZL1 B;  3HCY A;  2JX0 A;  5AC5 A;  1OTD A;  4FES A;  1FIL A;  2P61 A;  1IYP A;  1RCJ A;  3ZFZ A;  5COG A;  2UWX A;  3U9M A;  2VV6 A;  1Q0D A;  2IOQ A;  4NTF A;  1K6R A;  3MBZ A;  3DTE A;  3R7W A;  2EX6 A;  3HNL A;  4OD4 A;  2Q9N A;  3K33 A;  4P85 A;  5FAQ A;  4OVD A;  1U89 A;  3H7W A;  4G3W A;  2XXA B;  4HBT A;  4IRU A;  4DBQ A;  4LDQ A;  5BQI A;  2WAD A;  2QZ6 A;  2HJ9 C;  5A92 A;  1LS4 A;  3HLB A;  4N06 A;  4IJG A;  3LYX A;  3LR3 A;  2Z6C A;  4OPY A;  4B9O A;  1M6T A;  2BAS A;  2R7Q A;  1SDE A;  5T3T A;  4N4W A;  5KSH A;  3P01 A;  4M63 A;  1HZO A;  4LV0 A;  4WBG A;  5FA7 A;  3GR2 A;  4NTA A;  2HS5 A;  5COF A;  3U3B A;  4KQR A;  1R5I D;  3FKW A;  3NDE A;  4JW1 A;  2R9W A;  3ECS A;  3EGD A;  2WZG A;  5KIZ A;  4MW8 A;  3ZSU A;  4IBX A;  2LIG A;  1S66 L;  3AQC A;  1HY5 A;  5FQQ A;  5B3S C;  3UE6 A;  2EIJ C;  2MHR A;  4P6I C;  3C63 A;  2J9O A;  3NKE A;  2ZC4 B;  1D7E A;  2WZX A;  4HJ3 A;  4MN5 A;  1PNE A;  1J8Y F;  3LNM B;  4BPM A;  3EGX B;  1IOU A;  2JKF A;  4KC9 A;  3ZVT A;  4DKI A;  3HLE A;  1W63 Q;  5F1G A;  1VTM P;  4P0M A;  4WL9 A;  2B0J A;  3TRC A;  4Z9I A;  4ER9 A;  3ZYT A;  4O8G A;  3FOO A;  2GWW A;  1GA9 A;  2WGI A;  3MBG A;  3SS4 A;  5FQ9 A;  4LV2 A;  5G4Y A;  2FAP B;  3Q1F A;  3SXM A;  1KGE A;  4LV3 A;  4IJJ A;  4S2I A;  5CTN A;  1D0X A;  4NY3 A;  1BLP A;  3TJ6 A;  4N6H A;  2JKT M;  2CC1 A;  1BYW A;  3GSG A;  1G5Z A;  2W3H A;  1IYS A;  1NY0 A;  2YKH A;  4U9E A;  1SKF A;  1LE2 A;  4EV4 A;  1Z6A A;  5GL9 A;  2ZM2 A;  3R7C A;  5HX9 A;  2XRO A;  5EOE A;  4IVK A;  4CLC C;  1D1B A;  4BLM A;  1PFL A;  2KDK A;  5TBM A;  1RXQ A;  3IHU A;  1K55 C;  2MJ6 A;  1DP6 A;  3JYH A;  1NU9 C;  1H3Q A;  3CZD A;  3TUL A;  4L9G A;  3L1M A;  2ZOI A;  1LS1 A;  3OOV A;  1LSW A;  1T6I A;  4HP4 A;  4LFU A;  3A9C A;  1ACF A;  1TF1 A;  4CSA A;  4OQH A;  2EX2 A;  3G50 A;  1ERQ A;  1RP5 A;  2IXP A;  5JRA A;  1NU7 D;  5F6A A;  1EKY A;  1A0K A;  4BJP A;  4KNW A;  4KBL A;  2R7R A;  2JPU A;  1KVM A;  4WMC A;  4DE0 A;  3OEO A;  5E2Q A;  3CHW P;  4BEJ A;  1K57 A;  1F1M A;  1FIK A;  4UQI M;  1BLH A;  3RFY A;  2FFY A;  3GWL A;  2A3U A;  1S7Z A;  3DE8 A;  4HJ4 A;  4EBP A;  3IQT A;  3VOY A;  3R2P A;  4NXF A;  5TR7 A;  3VE3 A;  3S28 A;  3IXG A;  4H6J B;  4JPM A;  5JUA A;  5E3A A;  3IBR A;  4G7H F;  3FV7 A;  4GKU A;  2J8Y A;  3EH2 A;  3WHN A;  1Y4O A;  4N6C A;  4OOY A;  3L7H A;  3WWX A;  3EGX C;  2PX0 A;  1JRA A;  3R4K A;  2VGL S;  2H7B A;  2QPN A;  1ZU5 A;  3EOI A;  3NI9 A;  3CEX A;  3ZQ5 A;  4MMN A;  3K3D A;  4RX3 A;  3NG1 A;  5FDS A;  4IB4 A;  3NUL A;  5LBR A;  3UB6 A;  3I5Q A;  2J7P D;  3LNR A;  1OTA A;  4JLF A;  2WVN A;  4CS9 C;  1LT0 A;  4S2N A;  2YLI A;  1WWP A;  4XEV A;  3FMS A;  2NUT B;  1YAU O;  1PI5 A;  3M15 A;  4DDS A;  4U0T A;  4N1H A;  2HDU A;  4EBB A;  2XLD A;  3U8V A;  1E85 A;  4UA6 A;  1XKZ A;  1K05 A;  1FSY A;  4JTC B;  3T6G B;  1SZV A;  2LB5 A;  4E3J A;  4MBK A;  3S7N A;  2FFF B;  2VLG A;  3MF0 A;  3BRJ A;  1Y6D A;  1PWC A;  3BY9 A;  4X1M A;  1WOL A;  3MLG A;  4K91 A;  1S4S A;  2CNW A;  3WRZ A;  3SXK A;  4H54 A;  5C5K A;  3EQV A;  3RXW A;  4L0L A;  3K7D A;  2HP5 A;  3GEC A;  1M40 A;  4PM5 A;  5I5L A;  4WN5 A;  2WVQ A;  2DRW A;  5DVA A;  1Q0G A;  1O7E A;  5JS5 A;  5M18 A;  1JWZ A;  4WAB A;  2R7V A;  4EQ1 A;  3CPT A;  1BDJ B;  1E3U A;  3S4X A;  4CLC D;  1YQS A;  1D0Z A;  4EEU A;  3M2J A;  3MZD A;  2B0H A;  1FOF A;  5F5F A;  1HMD A;  2VCA A;  4R1G A;  2ZD9 A;  1CI9 A;  4OP8 A;  1PRQ A;  2VCB A;  2XLV A;  2Z6D A;  1CJF A;  4QY5 A;  2YL1 A;  3DJN B;  5TBM B;  4HY8 A;  5FI7 A;  3UB8 A;  5KSC A;  3I4U A;  5E3C A;  1PZP A;  4OQG A;  1DP8 A;  5DS5 A;  1K0K A;  2PF4 E;  1ODV A;  3Q7G A;  2ZC3 B;  5HAP A;  3DJU B;  1ALQ A;  5CTM A;  4S2K A;  2X0C A;  3GVB A;  1TVF A;  2XSE A;  1VYI A;  4FH4 A;  2XLN A;  4YWZ A;  5DF8 A;  4LPZ A;  5JT4 A;  2Q9C A;  4MVZ A;  4OIP F;  5CXW A;  4GB7 A;  1QSP A;  3P98 A;  4IUK A;  3T6B A;  3IXB A;  4AL0 A;  1FMW A;  3IX4 A;  3FC7 A;  4JGO A;  4BEN A;  4UQI S;  2YL7 A;  3UB7 A;  2AVK A;  1JWP A;  4U5E E;  2E8I A;  5CHU A;  3OC2 A;  2Y2G A;  4EW7 A;  4G0H A;  3L34 A;  1YYJ A;  1PIO A;  4C6Y A;  2KLI A;  2H0T A;  3A3E A;  3B3X A;  3LLK A;  2KYH A;  2XXA A;  1XGJ A;  5DTT A;  1NBB A;  4XQ1 A;  2PR5 A;  2Z2M B;  4BJ5 C;  5HZH A;  3IH8 A;  1A0B A;  2O9C A;  3G34 A;  3V5M A;  1SDN A;  2A6H F;  2Q9A A;  2PYR A;  1GHI A;  1JTD A;  1BZA A;  4D2O A;  2E87 A;  1XWJ A;  5A6B A;  1LKX A;  5JVE A;  3HKK A;  2FFH A;  1ZG4 A;  4QY6 A;  5EVE A;  4IWB A;  2Q00 A;  5A90 A;  1XFQ A;  3CWF A;  1CPQ A;  3LI9 A;  5CHM A;  2KOI A;  2A24 B;  2OWH A;  1IKI A;  1ZU4 A;  2V0W A;  1SHV A;  3JPU A;  2HV1 A;  4IAQ A;  3AG3 C;  3TQO A;  3KL4 A;  2XLO A;  2J9U A;  3GWN A;  2Y2K A;  3T1X A;  1ES4 A;  1T9K A;  4BBT A;  3K1I A;  4NXG A;  3VE4 A;  4E7Z A;  5KYW A;  4C3E A;  2A69 F;  3D72 A;  3VP0 A;  1OJ5 A;  4JE9 A;  2H5S A;  1BR2 A;  1LPE A;  2Y2I A;  4JGR A;  4LEN A;  5K5B A;  4U5C E;  4GOG A;  2RSE B;  4E17 A;  1EA8 A;  3MQQ A;  4NET A;  4U0X A;  2I9V A;  2QKP A;  5E33 A;  3T50 A;  2KNH A;  4Q8I A;  1OCZ C;  4AFI A;  1G5U A;  3ZC4 A;  3IXD A;  3DW0 A;  2ICW G;  4QPR A;  5EM0 A;  2VZW A;  1PV3 A;  4DXC A;  3GQZ A;  3IWO A;  3OPR A;  3TG9 A;  1ZW2 A;  1T19 A;  1Z5Z A;  1PW1 A;  3SNH A;  4NXE A;  3UR3 C;  4I38 A;  1W2W A;  2Z15 A;  4JTA B;  3AGT A;  3ULF A;  1CGM E;  1FSW A;  4PKY A;  1L2S A;  1D1C A;  1V9Y A;  3A3F A;  4MBF A;  5EPH A;  3E98 A;  2XD1 A;  2DB4 A;  3BEC A;  3NDG A;  3TJ5 A;  1CGO A;  4O01 A;  3KSI A;  4G3K A;  4K0W A;  4LV1 A;  3RQF A;  1TD5 A;  3FXH A;  1JPN A;  2ACG A;  1Y54 A;  2EXB A;  3CMZ A;  3B9Q A;  1BLC A;  3C7U A;  4QHC A;  3LLI A;  4XLP F;  3KYI A;  4ZLD A;  2GX5 A;  4E3N A;  3GEH A;  1XPB A;  3UDF A;  1GHM A;  3O3V A;  2EPL X;  3LEZ A;  3IQC A;  1KDW A;  1K40 A;  3F47 A;  2OWJ A;  4M4X A;  2J7V A;  1E2X A;  3PBT A;  2YL3 A;  2WKP A;  4J30 B;  3DI5 A;  3HJI A;  3LES A;  2PX3 A;  4OPQ A;  2HUJ A;  1P9W A;  2LSE A;  1LL9 A;  5GLD A;  4CJO A;  1DY6 A;  2WUQ A;  3TE8 A;  3S9O A;  3VSK A;  1YDI A;  4PJM A;  2Y3D A;  4OOL A;  4FSF A;  5HD5 A;  3U3F A;  2A0B A;  2PYP A;  3JSE O;  3QP2 A;  3QMK A;  1YZA A;  4YL1 A;  3DTI A;  2H7V C;  4JCH A;  3B0U X;  4MVM A;  4QI0 A;  2QY9 A;  1MWS A;  3DWZ A;  3IWI A;  1K54 C;  1YLZ A;  1TS7 A;  1S67 L;  1KGG A;  4B4X A;  3BLS A;  5HSQ A;  1XP4 A;  3J06 A;  4PHT A;  2CMN A;  4X25 A;  1C3B A;  1D0Y A;  5CI8 A;  5L0J A;  1YKD A;  3DAG A;  5F68 A;  4R0Q A;  1LL8 A;  1OT9 A;  2M4E A;  1QLE C;  1VM1 A;  4O79 A;  3DAV A;  2LFF A;  1SMY F;  3N0T A;  2Y2P A;  5BOH A;  5J4E A;  5DLJ A;  3A3D A;  5FAP A;  1WN0 A;  4BBU A;  4BL3 A;  4BJ6 A;  1TFO B;  1RJ9 A;  3IF6 C;  3BW6 A;  3B47 A;  1T5O A;  4Y13 A;  3IF6 B;  2J45 A;  4KZ8 A;  5AJG A;  3UE0 A;  1RMV A;  1LI7 A;  2HPB A;  4Z1W A;  4IAR A;  2EX9 A;  4Q7C A;  2XLW A;  3QZC A;  3GEE A;  1TKN A;  5FEG A;  1NZU A;  3ZG0 A;  3NOP C;  1T01 A;  3JRM O;  4JF4 A;  3GDI A;  4KG6 A;  4ZBE A;  1E83 A;  3K66 A;  3M1C B;  3PHF 2;  1ZHX A;  3S7P A;  3S90 A;  3IQA A;  1CPR A;  1KDS A;  4EEP A;  4GDN A;  4F94 A;  3N2Z B;  1K04 A;  1YAR O;  2W27 A;  3PXP A;  2L7A A;  3K6B A;  5L07 A;  3SH9 A;  3SS3 A;  4BEM J;  1OW6 A;  3GM3 A;  2NUT C;  2R7T A;  2O99 A;  3JRT A;  5A6B D;  1YVI A;  2V3C C;  3GMW A;  3O10 A;  4KI2 A;  3O87 A;  3H82 A;  3HLD A;  5DQZ A;  4IUH A;  3U2M A;  4MTO A;  5TGF A;  4N1X A;  3LUT B;  2OAP 1;  2B18 A;  3JT1 A;  1H5X A;  2OJE D;  1K6S A;  3C4P A;  4OON A;  1ZKJ A;  5D91 A;  5CRF A;  2KW3 C;  2XLM A;  1ZW3 A;  3EHN A;  1Z63 A;  2QE9 A;  2J0X A;  1DJB A;  3O6X A;  3HUM A;  4S2L A;  3DE9 A;  1BR1 A;  1S0W A;  2WKQ A;  4JEA A;  4I3I A;  2C5W B;  2R7X A;  3VP3 A;  5GLA A;  2G7U A;  3HLW A;  4DRI B;  4WZ5 A;  5DVW A;  2ZC7 A;  4X56 A;  5FAO A;  3VV4 A;  3NDB B;  3NBL A;  2MYS A;  1Q2P A;  2DNS A;  3UME A;  1MQV A;  4K1O A;  5A6A A;  4KG2 A;  1EI7 A;  2J9W A;  2VV8 A;  1N9L A;  3BQ8 A;  3U4L P;  2Y3H A;  3N8S A;  3NC8 A;  3CSK A;  3ZDJ A;  1FAP B;  4J7T A;  3ZG9 B;  4CIH A;  3FYZ A;  5B1B C;  3UO9 A;  1MWR A;  4NG2 A;  1OR3 A;  3O5Y A;  4QI2 A;  2HDS A;  3PBR A;  1VMA A;  3ITA A;  2H28 A;  3JTL O;  3CI6 A;  3F1N B;  4ZAM A;  1VK5 A;  1WA9 A;  3F1P A;  2VKS A;  3Q7V A;  3LI8 A;  1CI8 A;  5K0I A;  5A91 A;  4U5B E;  4DOZ A;  3LO7 A;  4M3K A;  4PAU A;  2J3W A;  3EJN A;  2G3K A;  4GQH A;  4RD9 A;  4HFK B;  2Q7R A;  3JYI A;  4HOI A;  5L10 A;  4B93 A;  4AK9 A;  5CX7 A;  1ES2 A;  4DRJ B;  1MMD A;  1E25 A;  1QVX A;  3BEH A;  4QB8 A;  3NMK A;  3MKE A;  3EH1 A;  1OPX A;  2UUH A;  3G4Z A;  2J9P A;  2BC5 A;  4WM9 A;  2O9B A;  3LR5 A;  3C8G A;  1YAX A;  4GS9 A;  1NFN A;  2WGV A;  3DD7 A;  5KYY A;  3ABM C;  1YPR A;  3ZQV A;  2XRH A;  1H9G A;  5E2G A;  1LM3 B;  4L6R A;  4WGY A;  4KQQ A;  1C03 A;  3T4Q A;  2KSF A;  1M6K A;  2XR0 A;  3UMD A;  2J80 A;  1TWC A;  2OOL A;  4PR9 A;  1H8M A;  5FSR A;  4IHQ A;  4Y3I A;  2PNO A;  2VEA A;  4HQA A;  5CI9 A;  4JCZ A;  3OCL A;  2HKV A;  3QW0 A;  1LVK A;  4LDK A;  3BFC A;  3W4Q A;  4HEA J;  1T6U A;  4PMA A;  2MWQ A;  2JHE A;  3UDI A;  2WZZ A;  4Y17 A;  3MSH A;  1VB5 A;  3BY8 A;  4PM6 A;  3EZI A;  4YOF A;  4CS7 A;  2HDR A;  2P74 A;  3CLO A;  1L0D A;  5A6K A;  4NC3 A;  5AQB A;  1V74 B;  3C2W A;  3RVZ A;  4OIO F;  2C03 A;  5GPG B;  2YWA A;  1HE1 A;  1ZHZ A;  3H82 B;  2WAF A;  3PCV A;  4C3D A;  1RGZ A;  3DMD A;  5L3Q A;  1KVL A;  4MLL A;  4U9D A;  2YVK A;  4W8K A;  4Z9Q A;  3KYZ A;  2YL0 A;  1IFQ A;  3WRT A;  3BYD A;  3D9Y A;  4EER A;  3B0V C;  1KU2 A;  2PBE A;  3RKO F;  1G4U S;  3HNK A;  5L3V A;  1I2W A;  1U60 A;  3MYI A;  3CIT A;  3LGO A;  4K7B A;  2R7S A;  2R7U A;  2ZJ9 A;  4XUX A;  2R7O A;  3T4K A;  1W8Y A;  3OBF A;  4HE8 D;  3DBA A;  4R6L A;  4Y2F A;  4QD4 A;  2VV7 A;  4YIN A;  3T4J A;  4D4N A;  2H0Y A;  5IS1 A;  3IF5 A;  2Y2J A;  1WGW A;  3C62 A;  1H8Z A;  3TSG A;  3Q07 A;  2NPU A;  5L2F A;  2XSS A;  3A3J A;  4WEL A;  1CF0 A;  4GZB A;  5EFW A;  4GYT A;  3T12 B;  1F5M A;  3NYL A;  3V50 A;  4BD0 A;  2WVO A;  2ZMV A;  3OLO A;  5BQG A;  2P7J A;  1ZYR F;  2GDN A;  3EHM A;  3VP2 A;  2DMW A;  1TWG A;  3DTK A;  1AEP A;  1JPJ A;  1OT6 A;  4LLO B;  4PJN A;  5A8B A;  2J8W A;  2K31 A;  4GNU A;  1U6H A;  1AVO B;  4KEN B;  3QHY A;  1V55 C;  1A7D A;  1K4F A;  1IZM A;  1HMO A;  3L8J A;  4E6W A;  2XK1 A;  4GLQ A;  2JKG A;  3PBS A;  5F5Y A;  2IXO A;  4DDY A;  3W4O A;  3B42 A;  4S2O A;  1L0F A;  3VOL A;  4LRX C;  4JRZ A;  3IX8 A;  2VJW A;  4H6J A;  1J3W A;  2M7V A;  1VLS A;  2JKR M;  3JCU Q;  2XS1 A;  3ASO C;  3CZ6 A;  4E0I A;  2Y91 A;  2QHK A;  3MXQ A;  3EGX A;  3GM2 A;  2H10 A;  4KZB A;  2J46 A;  2WZL A;  4BWI A;  5EOO A;  1CQA A;  1ONH A; 
#chains in the Genus database with same CATH homology
 1UWP X;  3JVV A;  2QJ5 A;  1S1Y A;  2O9C A;  4MDZ A;  2L1M A;  3TW8 A;  1XJ2 A;  2M1C A;  2PYR A;  3CUE C;  4I39 A;  5HWW A;  3G6O A;  1T1C A;  2YKF A;  1JNU A;  1XFQ A;  3CWF A;  4NXB A;  3LI9 A;  1OTI A;  2KOI A;  2A24 B;  2OWH A;  5HPF A;  1XJ3 A;  2V0W A;  3OCN A;  2HV1 A;  2PT7 A;  4XT2 B;  3UB9 A;  2LB9 A;  3LIE A;  5HPI A;  2XA7 S;  4Q0H A;  4F3L B;  2VX8 A;  3T4O A;  4BBT A;  4DJ3 A;  4NXG A;  1KOU A;  3VE4 A;  3H7W B;  3D72 A;  4L9F A;  1OJ5 A;  1NLY A;  4JGR A;  5K5B A;  1GSV A;  1YSP A;  3F1P B;  2JN7 A;  3LUQ A;  3MQQ A;  3MQ0 A;  1F98 A;  2I9V A;  3H9W A;  2HGV A;  2QKP A;  4ME4 A;  3T50 A;  4AFI A;  5DFY A;  2EWV A;  1XJ4 A;  3PBO A;  2FZ0 A;  3EEA A;  4QPR A;  2VZW A;  5J3W A;  3NHQ A;  1T19 A;  3K3C A;  4NXE A;  4HNB A;  3U2A A;  4I38 A;  3LIB A;  2PHY A;  4WEJ A;  4WUJ A;  3ULF A;  4KUK A;  4PKY A;  2V1B A;  2V9A A;  1V9Y A;  3E98 A;  4G3V A;  2J3T C;  4O01 A;  1G28 A;  3EWK A;  4ARZ B;  3KSI A;  4G3K A;  3MQO A;  2D01 A;  1TD5 A;  1UGU A;  2NUP C;  3V67 A;  3FPV A;  2JKR I;  1STZ A;  2GX5 A;  2J3T D;  5J7E A;  4Q0I A;  3LFV A;  2Y8H A;  5L8M A;  1TS0 A;  3F1O A;  3BWL A;  3FG8 A;  2PDR A;  1LSX A;  2FH5 A;  3NJA A;  2JKT I;  3LIA A;  2OWJ A;  4M4X A;  3C8C A;  2HF6 A;  3PBT A;  2WKP A;  4RQ9 A;  1LSV A;  3TJZ C;  4NEE D;  3HJI A;  4I3A A;  3S7Q A;  3CAX A;  4WF0 A;  1P9W A;  3KSH A;  4Q0J A;  3MJQ A;  4O0P A;  2XA7 M;  5FL3 A;  1TS8 A;  3TE8 A;  4F3L A;  1D06 A;  4OOL A;  4FSF A;  5HD5 A;  1MZU A;  2A24 A;  3T4S A;  1ZTU A;  5HDD A;  2PYP A;  1DP9 A;  4LRY C;  4EXO A;  2W3F A;  2GZA A;  1TS7 A;  1S67 L;  3IBJ A;  4FOF A;  5HSQ A;  4PHT A;  4CLC A;  2K7S A;  2CMN A;  1YKD A;  1EW0 A;  1X0O A;  2O0Y A;  5F68 A;  1LL8 A;  1OT9 A;  3PHY A;  1GSW A;  3HCY A;  3UE3 A;  1OTD A;  3KSG A;  2M7U A;  5J4E A;  2GJ3 A;  3U9M A;  2VV6 A;  4BBU A;  3BJN A;  2INW A;  4BBV A;  3BW6 A;  3B47 A;  2QJ7 A;  4YNR A;  4NKP A;  5AJG A;  5DJU A;  4GW9 A;  1N9O A;  1NLZ A;  4Z1W A;  3R7W A;  3KO6 A;  3E4Q A;  3SW1 A;  4ETX A;  3H7W A;  3MFX A;  3NOP C;  4G3W A;  4CLC B;  3GDI A;  2PR6 A;  2HJ9 C;  4GCZ A;  2W1T B;  4IJG A;  3LYX A;  3LR3 A;  2Z6C A;  4B9O A;  2BAS A;  3S7P A;  4KQO A;  4EEP A;  1DRM A;  4GHI B;  5KSH A;  2D02 A;  3P01 A;  3F1O B;  3LR4 A;  3PXP A;  2W27 A;  4K08 A;  4L9E A;  2NUT C;  2O99 A;  4GJ4 A;  3V5Y A;  1GSX A;  5KIZ A;  3H82 A;  4JGP A;  4ZRR A;  4ETZ A;  4IUH A;  1S66 L;  2OAP 1;  3U9J A;  2B18 A;  1W63 M;  3UE6 A;  1D7E A;  4HH2 A;  5G4Z A;  4HJ3 A;  4MN5 A;  1IOU A;  4LRZ E;  4MCW A;  1W63 Q;  4Y5F A;  2ZBB A;  5DF9 A;  5AVE A;  2WKQ A;  4WL9 A;  5MC7 A;  4I3I A;  1F9I A;  3TRC A;  3ZYT A;  4O8G A;  3P7N A;  2VGL M;  4MN6 A;  5G4Y A;  2G7U A;  3LID A;  5DKK A;  3CUE A;  4WEK A;  4HJ6 A;  3VV4 A;  4I5S A;  4HH3 A;  3UME A;  3K2N A;  3A0S A;  2JKT M;  2VV8 A;  1BYW A;  1N9L A;  3BQ8 A;  1P9R A;  2W3H A;  5DKL A;  2W3G A;  2YKH A;  1MC0 A;  3E0Y A;  3E4P A;  2XRO A;  4HHD A;  5AVF A;  3O5Y A;  4CLC C;  2IA2 A;  3PBR A;  2KDK A;  5TBM A;  2H28 A;  3CI6 A;  2MJ6 A;  5HDC A;  1VHM A;  2W3E A;  1DP6 A;  2ZOH A;  3T4L A;  3F1N B;  3F1P A;  1WA9 A;  3LIC A;  2VKS A;  1H3Q A;  1T1A A;  3LI8 A;  4L9G A;  2ZOI A;  3OOV A;  1OTE A;  1LSW A;  4HP4 A;  2PD8 A;  3EQU A;  1TF1 A;  1XJ6 A;  4PAU A;  2J3W A;  2KX6 A;  4JGQ A;  2B02 A;  1T1B A;  4HOI A;  3V5Z A;  4B93 A;  5CX7 A;  3PBQ A;  5F6A A;  1T18 A;  3FPW A;  4BJP A;  4R3A A;  3MR0 A;  1TS6 A;  2K2N A;  4R38 A;  1NWZ A;  3MMH A;  4DMZ A;  1ZHH B;  1OPX A;  3W2Z A;  2A2L A;  3T4T A;  2O9B A;  4HIA A;  4UQI M;  3LR5 A;  1YAX A;  4GS9 A;  2W1R A;  4HJ4 A;  4ARZ A;  3E4O A;  4NXF A;  3VE3 A;  3V5X A;  4H6J B;  2ZMF A;  3RFB A;  1MKM A;  3T4Q A;  2V0U A;  3UMD A;  2J80 A;  2OOL A;  3IBR A;  1H8M A;  3PR6 A;  4DJ2 A;  1OJG A;  4IHQ A;  4Y3I A;  2VEA A;  3EGX C;  4OOM A;  4HQA A;  3R4K A;  3OCL A;  4R70 A;  5DJT A;  2VGL S;  3ZQ5 A;  3EOI A;  2V1A A;  3EEH A;  4MMN A;  2JHE A;  3K3D A;  5HDS A;  4XT2 A;  4HP9 A;  3BY8 A;  4YOF A;  5LBR A;  3UB6 A;  5IT5 A;  1OTA A;  3CLO A;  1LT0 A;  3NOU C;  3C2W A;  1VB6 A;  5DFX A;  3PYP A;  1XFN A;  2EWW A;  3H82 B;  2WKR A;  3LR0 A;  3NOT C;  1P97 A;  2HJE A;  1NRJ A;  3KYZ A;  1Y28 A;  1IFQ A;  2OAQ 1;  2GNX A;  4WLA A;  1S1Z A;  3R7W B;  5HD3 A;  2LB5 A;  4EER A;  3S7N A;  2VLG A;  2L4R A;  3MF0 A;  3BY9 A;  3ICY A;  3A0V A;  4I3J A;  1S4S A;  3BQA A;  2QWS A;  3CIT A;  3F1N A;  5HWT A;  4PKY G;  4MN7 A;  5C5K A;  2P0N A;  3EQV A;  3T4K A;  1P0Z A;  4L0L A;  3GEC A;  5I5L A;  5F69 A;  4WN5 A;  2XRN A;  4GHI A;  3OBF A;  3DBA A;  1V9Z A;  4R6L A;  4P6Z M;  5HL6 A;  4Y2F A;  1S4R A;  4EQ1 A;  4BMW A;  4EES A;  2VV7 A;  4CLC D;  3T4J A;  4II7 A;  4EET B;  5IS1 A;  2W0N A;  4EEU A;  4UEY A;  1YSQ A;  2R78 A;  3C38 A;  2XSS A;  4GS9 B;  2PD7 A;  4WEL A;  5EFW A;  1F5M A;  3RH8 B;  2Z6D A;  2VA0 A;  3S7O A;  5TBM B;  2ZMV A;  4HY8 A;  3OLO A;  2P7J A;  3UB8 A;  2QYB A;  5IU1 A;  1DP8 A;  2DMW A;  1ODV A;  4CLC E;  1OT6 A;  4LLO B;  3RTY A;  5A8B A;  3B33 A;  2K31 A;  3KX0 X;  3JVU A;  3IS2 B;  4EU0 A;  4P6Z S;  3IS2 A;  2EA9 A;  4YWZ A;  3HJK A;  3KSF A;  5TJJ A;  1OTB A;  4KUO A;  4LPZ A;  4CQH A;  3PBN A;  4IUK A;  3EGD C;  4GLQ A;  1G6O A;  3PBS A;  5F5Y A;  2W3D A;  3B42 A;  3A0R A;  3FC7 A;  3KYQ A;  4JGO A;  4KQD A;  4LRX C;  3VOL A;  2L0W A;  4UQI S;  1N9N A;  2P08 A;  3UB7 A;  2VJW A;  4H6J A;  2M7V A;  3LIF A;  2O9A A;  3OC2 A;  4HI4 A;  4EW7 A;  2JKR M;  2QHK A;  3D3O A;  2KLI A;  3MXQ A;  4EUV A;  5HWV A;  4E04 A;  1UWN X;  2P04 A;  3C30 A;  4BWI A;  4DN0 A;  2Y79 A;  2PR5 A;  5HZH A;  2W1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...