3CAXA

Crystal structure of uncharacterized protein pf0695
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
355
structure length
355
Chain Sequence
LPEGHPLKTLYQENKEIMKDAEMLNLYAKTLATTKDERMREEILGVLEEIVSSLRMVGFTHYNREEMLIFPYIERRGLTVIATVLWTKHDEIRAMIKQLAELLRKREEMPWEEFVEKFKAKAGEVAFALSDMVFRENNIFYPTLKALLSEGEWKAIKMQEDEIGYYKVKPPEWDPGEDVKPLHPWEINPELNVEQLLTLPKEVQQALRGQPLEFDKTQLKREEDIDLGTGYLNIEELKAIFEALPVDVTFIDKDDRVRFFSPGERIFTRTPSVLGRPVQLCHPPKSVYVVNKILKAFKEGRKKEATFWLRLREKYVYIKYVPLFNEKGEYIGTLEMTMDIAPYKKIEGEKRLLDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein PF0695
publication title Crystal structure of uncharacterized protein PF0695.
rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Structural genomics, unknown function
total genus 119
structure length 355
sequence length 355
ec nomenclature
pdb deposition date 2008-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
A PF13596 PAS_10 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3caxA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3caxA02
5IU1A 3LIAA 4HP9A 2VV6A 1T1CA 1S66L 1D7EA 4HJ4A 4WF0A 4BBTA 5G4YA 3MQOA 4DJ2A 4R3AA 3CAXA 3C2WA 4EESA 2YKHA 2YKFA 5F68A 2QHKA 3LIEA 5TBMA 4I5SA 4GS9B 1XJ2A 4EEPA 2V9AA 3F1OA 3FG8A 2QJ5A 1GSXA 1LSXA 5HD3A 4H6JB 4R6LA 1T18A 4HIAA 2OOLA 3F1NB 4PKYG 1S67L 3NOTC 3IS2B 1OJGA 5HSQA 3LICA 4NXBA 5HZHA 3F1PA 1TS8A 4WL9A 1XFQA 4L9EA 3E4OA 3ICYA 2R78A 1F9IA 4HH3A 4BBUA 1N9OA 2V0UA 3MFXA 2EA9A 3H7WB 4WUJA 2HV1A 4I39A 1TS7A 2CMNA 4XT2B 3B33A 3CWFA 1BYWA 2KDKA 3A0RA 3V5ZA 4EERA 2WKPA 3SW1A 2PR5A 3ULFA 4EEUA 5G4ZA 3BWLA 4KUOA 1XJ3A 2PD8A 4GW9A 3MR0A 1JNUA 4M4XA 4KUKA 1Y28A 4DJ3A 1OTBA 3CLOA 3VE4A 3UB6A 1S4RA 2H28A 3T50A 1S1ZA 3MXQA 4HNBA 4KQDA 3E4QA 2M1CA 4I3JA 4K08A 2QKPA 4EXOA 3F1OB 3NJAA 1LSVA 1NWZA 3GECA 1OTAA 2PDRA 5IS1A 5HDCA 1OJ5A 3UB8A 4F3LA 4BBVA 4I3IA 4HY8A 3UB9A 1EW0A 4HJ6A 5HWWA 2I9VA 5DKKA 1OT6A 5J7EA 4GS9A 4MN5A 5KIZA 5A8BA 3NHQA 2QWSA 4YWZA 2V0WA 5J4EA 3F1PB 3UMDA 1UGUA 2PYRA 1G28A 2B02A 2PHYA 4WLAA 4EQ1A 2A24A 4R70A 4GHIA 2OWJA 5HWVA 1DRMA 2Z6DA 2V1BA 3LYXA 3BY8A 2D02A 1WA9A 5F6AA 3IS2A 1XFNA 3A0SA 1P97A 4JGQA 1ODVA 1P0ZA 4RQ9A 5AVFA 4MN6A 3UMEA 5AVEA 2PR6A 2OWHA 3BY9A 2D01A 4NXEA 4LRYC 3LIFA 2K7SA 3MJQA 3K3DA 3H9WA 2P7JA 4LLOB 3FC7A 3H7WA 3EEHA 3E4PA 3V5XA 2L1MA 3G6OA 3A0VA 5F69A 3NOUC 3K3CA 4HHDA 2JN7A 4WN5A 2L0WA 1N9LA 1OTIA 1TS6A 3H82B 4JGPA 4R38A 1T19A 2VV8A 4EETB 3LIBA 1S1YA 4I38A 1LL8A 3RTYA 1D06A 3LI9A 3P7NA 3ZQ5A 3HJKA 5TBMB 1GSWA 1V9ZA 1DP8A 1N9NA 4NXFA 4LPZA 1GSVA 3UB7A 2WKQA 5DJUA 2ZBBA 3HJIA 5EFWA 2GJ3A 2QJ7A 4F3LB 1UWNX 4HJ3A 1OTDA 4JGOA 1T1AA 1DP6A 2ZOIA 2JHEA 1OTEA 5DJTA 4GCZA 5DKLA 5J3WA 3LUQA 5I5LA 2A24B 4GHIB 1S4SA 3C8CA 4L9GA 3GDIA 4H6JA 5HD5A 1TS0A 4LRZE 2V1AA 3RH8B 3U9JA 3F1NA 1DP9A 2KX6A 3U9MA 1LSWA 2Z6CA 5HDSA 3OLOA 3PHYA 1XJ6A 4LRXC 2J80A 4EW7A 3NOPC 2INWA 2VV7A 5HDDA 3KX0X 3EWKA 4I3AA 2L4RA 3IBRA 1XJ4A 2VEAA 1VB6A 2W27A 3UE6A 2P0NA 4HQAA 1OT9A 1UWPX 2PYPA 1LT0A 2WKRA 4XT2A 3VOLA 5HWTA 1V9YA 3LIDA 3D72A 3V5YA 4HH2A 1MZUA 1KOUA 4HOIA 4PKYA 5F5YA 2PD7A 3VE3A 3PYPA 1X0OA 4HI4A 2VLGA 2W0NA 1T1BA 2ZOHA 4NXGA 1F98A 3LI8A 4B9OA 4E04A 4HP4A 2BASA 4JGRA 4L9FA 3MQQA 3H82A
chains in the Genus database with same CATH superfamily
2QPNA 4YK5A 4KZ6A 5IU1A 2OV5A 1JR8A 3QHYA 3M6HA 3GR2A 3UGPA 4YL3A 5L2FA 1K4FA 1ESUA 3EQUA 1F5MA 5EGYA 1LE4A 2ZQ9A 3NYMA 4WF0A 1NRJA 1EI5A 3RVZA 3FOPA 5FI6A 4MVOA 4MLLA 5JYOA 4E7ZA 3JPUA 3N4IA 3IQ5A 3C2WA 4DBQA 3ASNC 1ZHXA 2YKHA 3BEHA 2JKFA 3Q7VA 2J9OA 3LIEA 1JRAA 3CI6A 3CSKA 3BQAA 2OCCC 3JSEO 4GDNA 2XS1A 3TULA 3QNCA 1H8MA 4DXBA 2M4EA 2L81A 3S84A 4GS9B 4I5SA 2G3KA 1PIOA 3RXXA 1ZHYA 2NUTB 3AGTA 5I94A 1NLYA 3OZHA 4N9KA 4WZ4A 2H7OA 2OJED 4E6XA 1NYYA 2YLIA 2QJ5A 2Y91A 4Y17A 3TK0A 5F83A 2Z15A 5E3AA 4CIPA 3M6BA 4R6LA 5BQHA 3U3FA 4B4ZA 3SH8A 4CBEA 1E84A 3GEHA 3HL9A 4PKYG 3T1QB 1H7IA 3GM1A 2XLWA 3FOOA 1CF0A 1LHYA 3O55A 1SCWA 3VP0A 3NOTC 3AG1C 1G68A 3IS2B 3UB5P 1OJGA 3ZVTA 3TW8A 3EHNA 2PNOA 3M4CA 2J8YA 4NXBA 3IX4A 3KSIA 4KQRA 4IHQA 4WL9A 3GWLA 4R32A 2R7WA 1HW2A 5JUAA 4NQFA 2FFFB 5T1DB 3S7QA 4RA7A 1YAUO 2ZQDA 3OPLA 3NCKA 3D9YA 4BBUA 3TOMA 1N9OA 2V0UA 1JTGA 4R4RA 3GVBA 3CG5A 1OKKA 1AXBA 4AX2A 3LEQA 2Y79A 2G2WA 4I39A 1ES3A 2OAP1 2CMNA 5AC5A 1YARO 3EGXB 4XT2B 5HFOA 3VRCA 4P87A 3VSKA 3CWFA 1H8YA 3LR5A 3GEEA 1LIHA 1ES2A 3A0RA 4EUVA 1CGOA 4N6HA 4C75A 1DY6A 3UMIA 1EKYA 1VTMP 1PW8A 2ZMFA 3ATPA 5B3IA 4JPMA 2A0BA 2NG1A 1M40A 4BL3A 2R7QA 4BEMJ 1UFBA 4K91A 5HSWA 3C4PA 4JXVA 3ZQVA 2HP6A 4KUOA 4G7ZF 3S7PA 4PPRA 4ER9A 1XJ3A 3JYHA 4EIYA 2DB4A 5JT4A 1K4EA 2K31A 3M2JA 4KG6A 3SXYA 1LE2A 5JP7A 4LERA 4X6TA 3M79A 2Y2OA 5FQ9A 5HPFA 1M2VB 4YNRA 1K0KA 4C7OA 1L3PA 1E85A 3HLDA 3ZHHA 3QZCA 2PBEA 1OCCC 4MQ9F 3E9VA 1YQSA 2Y2PA 3BJNA 2O99A 1TR2A 2CNWD 3CLOA 3VE4A 2YL0A 3TQOA 1S4RA 5HPIA 4JZAA 1SDEA 1PI4A 4KZ9A 5JSLA 3MXQA 4HNBA 4KQDA 2LCHA 4K08A 3IF6C 5KMWA 4GKUA 3CITA 5L10A 3ZSUA 3DTKA 4ZJ3A 3MLGA 1YMXA 2W3DA 3JRTA 4P85A 3EZHA 2DYRC 4IJGA 2WZGA 3PTEA 4Q0HA 3VFFA 5AQAA 3WRZA 3PHF2 2VA0A 4Z1WA 1OJ5A 1MC0A 1CGME 1GGQA 1KGEA 4E3MA 4BBVA 3Q6MA 1GM5A 4L0LA 2L6FA 4O01A 1L3LA 1JAFA 1U0BB 3WS5A 4MBHA 3SH9A 1OT6A 5E43A 1HY5A 1K04A 1VOMA 3WS4A 4GOGA 1ZYRF 3FVYA 4JE9A 4WEKA 1AWIA 5A90A 2EPLX 5A6JA 1ERMA 5J4EA 2VASA 4UA6A 5FQJA 5GHYA 3F1PB 2W1RA 1M56C 4DBRA 1UGUA 5M18A 3H2VA 3OCNA 3ZDJA 1V54C 3U3BA 2A24A 4R70A 3MZEA 1C03A 3RH3A 4JCZA 1TVFA 4CLCD 1E86A 1YLWA 4S2JA 4Q7CA 2D02A 4KQOA 2ZXWC 2KK1A 3IWIA 3A0SA 1LI9A 2W9YA 5FZTA 4JGQA 1M6KA 4WMCD 1IYQA 5CGWA 1P0ZA 4QY5A 1TWAA 3WG7C 3POVA 1SKOB 3CHWP 3SZTA 2P04A 1YA9A 5DVWA 1ORYA 5AVEA 5HL6A 4S2KA 4A4AA 1ZTUA 1TQGA 4EHPA 1VEUA 4JTAB 1A7VA 5EVID 4U0XA 2K7SA 4F4BA 1LPEA 2V1ZA 3H9WA 4JEAA 4I3MA 5E2EA 4O6YA 4MN7A 3E4PA 3L34A 5FASA 5F69A 4ID4A 3LJBA 4IEDA 3S4XA 1QKRA 3EGDC 3K3CA 4HHDA 2JN7A 3HNJA 4LFUA 1SYQA 2QY9A 3FAJA 1IKGA 3JTLO 4E7SA 1N9LA 4S2PA 1TS6A 2HF6A 2G62A 2WAFA 3IEEA 4R38A 5KZHA 1MY8A 2VV8A 1W8QA 2BTFP 3LIBA 4FOFA 1R5ID 1VLSA 3UNGC 2P6VA 1S1YA 3UPOA 4I38A 2OSUA 2P74A 2Y55A 1D06A 4HEFA 3T4TA 3LI9A 1MMGA 1SZVA 3Q7LA 1L2SA 5EV0A 3ZQ5A 5AJGA 3FKWA 4OQGA 3Q7ZA 5AQBA 5TBMB 1GSWA 1V9ZA 5A92A 4BD0A 1VK5A 3RYLA 1DP8A 3I7JA 3HNKA 3MS6A 4YFMA 1MKIA 1KE0A 2HSBA 5FEFA 2ZBBA 4GJ4A 2QYBA 1OMEA 5EUAA 2Q9CA 3DTMA 4JJFA 3HJIA 1GA9A 3DXJF 2WGIA 1JOGA 2OLUA 2ZL1B 3I5QA 1Z6AA 2XDMA 1A0KA 5EFWA 3V50A 3S28A 2XH9A 2FAPB 3HLCA 1VYKA 1TEMA 2R7OA 3O5YA 4MVMA 1YT4A 4Z9IA 4A5RA 4S2LA 1DP6A 4HESA 2ZM2A 1I4YA 1SMYF 1OQCA 4KZ5A 4EKWA 3W4QA 3T9OA 3G4PA 4JF4A 4KZ8A 2P08A 1MWSA 4BEJA 4GCZA 1IELA 5HAPA 4CS9C 3D4FA 1OKKD 5GLBA 4JVSA 5I5LA 2ZM8A 3E0YA 4G7HF 2D5RB 3WS2A 4GHIB 2W1TA 3C8CA 2Y2HA 4AFIA 3EFOB 2VKSA 3IWOA 2Q9AA 1YYXA 1WYCA 4GB7A 5CHUA 2Y3GA 1TS0A 3EG9B 3X1OA 4N06A 2J8WA 3U9JA 3G32A 3OBFA 3FKVA 2WK0A 2Q3TA 4FSFA 4PJJA 2H0YA 2Z6CA 2YWAA 3MBZA 3Q6NA 3UDFA 3NDEA 3Q82A 4II7A 3GORA 3FWLA 3OCLA 1P9WA 3CPTA 4D4XA 1NLZA 2KW3C 3ZVWA 3B42A 1NU9C 2ZQCA 4WGZA 3JCUQ 3US6A 3KYQA 1ERQA 1H9TA 3JT1A 1PNEA 3EWKA 3NG1A 4LENA 4I3AA 4I1OB 4IB4A 1G6OA 3PBQA 1FAPB 1VHMA 5FQIA 1RP5A 2AVXA 1FQGA 4MVSA 2XFSA 3ZG5A 4PR9A 3KSHA 4S2OA 3K1IC 3G50A 2R9RB 2PYPA 2WKRA 5BQIA 4YT8A 2IWDA 3DAVA 3F46A 2P61A 3P98A 1NY0A 3LIDA 1ZW2A 1PI5A 4LLEA 4UAAA 1KOUA 4PKYA 5TJJA 5M1AA 4HFFB 3KMIA 3ZWIA 5DTTA 1B68A 3N24A 3W4PA 4XPXA 3PYPA 5KSHA 1Q0GA 1I2SA 1RKEA 5EVEA 1BR1A 1O3UA 4JJGA 4KNWA 1GHMA 4IGGA 3HCYA 3AG4C 3DE8A 256BA 4ZJ1A 3BM6A 2JKRI 2XD1A 3MYIA 4QJGA 3U2MA 1I4ZA 2W4BA 3MQQA 3UPPA 3IQ6A 3E2KA 3IXGA 3F47A 2W45A 2C6WB 3LIAA 2HS5A 3G31A 4HP9A 3EH1A 3RQEA 1Q0FA 3FXHA 4G7OF 3ZCZA 1SKFA 3W4YA 2Y2MA 3IF5A 1T1CA 3FAPB 3S7NA 1CQAA 1HMDA 4PM8A 4HJ4A 4P9TA 4KG2A 1S05A 4U5HA 1YSPA 3ZG7B 1N1CA 4QI0A 3FHDA 1KTMA 4BBTA 1HTZA 1IYSA 3MQOA 3CAXA 2KNHA 1XGIA 5F68A 1FTSA 3DW0A 1E4DA 4MW8A 5B3SC 4OPYA 1IYOA 3N8LA 4XUXA 1T6IA 4DKIA 2OKUA 1KE3A 1S7ZA 3X2QC 3N8RA 4R23A 3TJ6A 2V9AA 3F1OA 1H8ZA 2HJ3A 3IBJA 5K0IA 1ZU5A 4KG5A 1E2XA 3NDBB 4FUWA 4DJ9A 1GSXA 1UG7A 1BTLA 4BJ6C 3UN7A 2YLDA 2XXAA 2M64A 3O6XA 3MF0A 3VOZA 4CS7A 4HIAA 2OOLA 5A91A 5E2QA 1S67L 4MBFA 2HSQA 2NUTC 2PU2A 4EBBA 4GN2A 5HSQA 5CI9A 3LS0A 4KI2A 4LGWA 3V3RA 4MNDA 3HUNA 3MKFA 4K0DA 4JTDB 3AJMA 4Z9JA 2HJ9C 2FFYA 2LQGA 1WE4A 1XFQA 1OXBA 2V2FF 4OOMA 3E4OA 3DJUB 3N0TA 5HAIA 2R78A 3T1SA 2J3TC 4HH3A 5L07A 3MFXA 4X1LA 4Y5FA 1PZPA 2WKEA 1QSPA 3W4OA 4HFKB 1W5DA 5FQQA 1FIKA 2HV1A 3CEXA 3ITAA 3W2VA 2PAVP 1BR4A 4P9FA 2XRNA 5DFXA 4CLCB 1A7EA 1NG1A 4R4SA 1BYWA 1CK3A 2KDKA 2OQMA 2X01A 3M1CB 2WVQA 2VCCA 2WVOA 1VLTA 1Y4OA 4EERA 4KQQA 2WKPA 4Y13A 1O07A 3C4OA 5CTMA 4O79A 2Q7RA 2ZJ9A 1K56A 4AK9A 1ORSC 4EBLA 1ALQA 2XL8A 4XPYA 1O5HA 4NTFA 2M7UA 3QP2A 4FH2A 3BWLA 2XQZA 4D60A 3EGXC 4NK3A 2NPUA 2PX0A 5KYUA 3IT9A 4QHCA 3LLIA 1PWCA 1G4WR 1GCEA 1KGFA 1KU2A 2IXPA 2A69F 1PD1A 1W7FA 1XA7A 1XX2A 4GW9A 1L7CA 4GEHA 4YL0A 3MR0A 3IH8A 4UHUA 4P6ZM 4KUKA 3SEOA 2ZPAA 1CGNA 3OPHA 1EROA 3EOIA 3RVYA 3TG9A 1Y28A 5L8MA 4DJ3A 2ZC4B 2FGYA 2HFIA 2LIGA 1YMSA 4O8GA 3DBAA 1N4OA 2GDNA 1PV3A 4QI2A 1F1MA 4E3IA 3GV9A 2O9CA 2M1CA 1QVXA 5DQTA 5C5KA 5BOHA 1NXYA 2H0TA 2P7VA 3NJAA 1STZA 2GNXA 4J7YA 3DD7A 3RFBA 3ZNTA 1LSVA 1S6RA 2R9WA 3MZDA 4PAUA 4XLNF 3T6GB 4N9LA 1OTAA 2XFTA 3NMKA 2PDRA 3ISGA 4CDAA 4R0QA 2DNSA 5E3CA 1K55C 5E2FA 2WKHA 4ULWA 1M6TA 4L6RA 1ONGA 4DE1A 4F3LA 1ZW3A 4U5CE 1RCJA 4BJ6A 1RGZA 4LDQA 1NZEA 2I9VA 2XSSA 5F5FA 1KE4A 4GS9A 2LD6A 3ZDLA 5FL3A 5A8BA 4P0MA 2ZC7A 1H3QA 4C6YA 3BQ8A 3B0PA 2V0WA 2X71A 1BZ4A 3L8IA 5FSRA 1ONHA 1G28A 2B02A 4QDLA 2P1AA 5L3VA 2A68F 2PHYA 4EQ1A 1NYMA 5FQMA 2BE5F 2R7RA 1JTDA 2XM0A 4R3JA 5HWVA 3BECA 1V55C 3PMRA 1BLSA 1D0ZA 1PWGA 4JBFA 4DE3A 3LYXA 2J9PA 4X25A 5F6AA 3TD7A 4Z9HA 4CX9A 4CDYA 3E98A 1G6AA 3IS2A 4FAPB 1RCPA 2EILC 4AE4A 2EX6A 2FZ0A 5FATA 4RX3A 1M2OA 4OPZA 5L0HA 1RJ9B 4RQ9A 2J46A 5GLCA 1C02A 4OIPF 2DCFA 1Q2PA 1MKMA 3UMEA 1XGJA 1GHPA 2AP3A 4NXEA 3PBOA 1AEPA 4WJ0A 4E3KA 2XLEA 2ACGA 1VB5A 1Y4CA 3W2WA 2BL2A 4EU0A 2P7JA 2XEPA 4LLOB 3U8VA 4XQ1A 4ZDXA 2L1MA 3G6OA 4LV1A 5D3OA 5FDSA 4FWVA 3P09A 4FX5A 5G18A 1OCZC 5EVLA 3BFGA 2WL8A 1NRFA 3GTCA 4E3JA 3ZQYA 2EIKC 1PZOA 3GRJA 1PD0A 4PFOA 3WAQA 4OINF 3H82B 1T19A 3U0CA 2L6GA 4C7OB 1YA7O 5BQGA 1BLPA 5CI8A 4U5DE 1LL8A 3IX3A 3W8KA 2HDSA 3LNMB 1ESIA 3DKAA 1YLTA 3BRJA 3MBGA 5A6KA 4E0HA 3P7NA 4QPRA 2QTVA 3RKOF 3UE0A 2Y8HA 1OXKA 1IYPA 3NY4A 3HBRA 1VETB 3PAEA 3A3JA 4KZAA 5FAOA 4LPZA 4PJLA 4WBGA 1A0BA 2R7XA 3ABKC 5DS4A 2MYSA 1Z5ZA 1TKNA 1Z23A 4N4WA 5L0IA 1CI8A 2Y4AA 3MZFA 2GJ3A 3OWTA 2HDRA 1UWNX 4M63A 1Z09A 1K55A 3KO6A 4Q5SF 4X53A 5CXWA 4N6CA 3UO9A 5FI2A 3TE8A 3JYYA 4IWBA 3UMHA 1D1BA 4HBUA 3V5MA 5DJTA 4O7DA 3NC8A 3PR6A 1JPNA 4MVRA 5CEBA 3FYZA 4BD1A 3G4XA 5DKLA 4EBJA 1G8XA 2R02A 3LGOA 5J3WA 2LSEA 5IT5A 3LCEA 3LUQA 4QD4A 2A24B 4XXRA 4ZRRA 1YDIA 3C7JA 5FAPA 4CPKA 4L9GA 3RIPA 2KQ9A 2OEXA 4FD8A 3GDIA 4H6JA 3VSLA 2PBDP 2UWXA 5KYYA 4U5GA 2L6HA 3F1NA 5EK0A 3K66A 5DVAA 1LSWA 4B4XA 1W2WA 5EM0A 4HBTA 1LKXA 3DJNB 1K56D 1LL5A 3N6IA 3PHYA 3IX8A 2C03A 4U0TA 4Y0UA 5BUOA 1XZPA 3T4KA 1MMAA 3EH2A 4LRXC 1ES4A 2WKIA 1PFLA 1Z6FA 3B0UX 3NOPC 2GZAA 3UDIA 2XLOA 1F2KA 2XLDA 3G2ZA 5HL1A 3KX0X 1IW7F 3TOLA 1W79A 4MCWA 1G5UA 3AGDA 1IKIA 1KNYA 3R2PA 4XTKA 1XJ4A 2VEAA 2W27A 2CC1A 3E2LA 4MTGA 2E8JA 3PDMP 4S2NC 2NUPB 2VGLM 4C3BA 1QZXA 3ZG9B 3A3DA 1LT0A 4YT2A 1FNTc 5EHHA 2XA7M 3T12B 5CHJA 3HLWA 3VOLA 5HAQA 5HWTA 4G3KA 2X0CA 1V9YA 4Q0IA 1LI7A 2IBFA 1OR2A 4GYTA 3HLEA 1HMOA 4IARA 4E18A 3ZGAB 4HH2A 2ZM0A 1MZUA 1NLXA 2XLHA 1HE9A 4JURI 1FMWA 2XK1A 3W8HA 3S9OA 1T9KA 1NBBA 1FR0A 3T4SA 1TFOB 2WVNA 3VMAA 3H2UA 4BMWA 3IQCA 2VLGA 1NSGB 5L0DA 1T1BA 5CERA 4S2IA 2YLGA 4OPRA 2W3GA 3LI8A 5FA7A 4B9OA 4K0XA 3WRTA 1CI9A 3GSGA 4KBLA 2RCXA 2J45A 2YKZA 2D4UA 1CJFA 2KLIA 4IUKA 3TOIA 2WAEA 3QW1A 3QP6A 3NRHA 3DWZA 3GODA 3C18A 5KYXB 4DDSA 2Z2MB 3LO7A 3N8SA 1ZHHB 3IF6A 3EQLF 4ESPA 2O0YA 3LUTB 1MPLA 2ICWG 1D7EA 1JWVA 4ZJ2A 1Z3IX 3LESA 1ZU4A 3Q81A 1DJBA 2Z2LB 1JWPA 2I8BA 4YJWA 4DJ2A 4EESA 3T4RA 4JCHA 2YKFA 5E2GA 1WN0A 2Y2JA 4KENB 2VC9A 5TBMA 3VP2A 3LNRA 4J7TA 1QMEA 3SXMA 4JW1A 4BJPA 3A3IA 3G34A 4DN0A 1K05A 2Y3BA 3JYIA 4QY6A 1BUEA 1XJ2A 3DI5A 3GM3A 4PK4A 4EEPA 4LDRA 3EZIA 3OEOA 2VH3A 3AGEA 3O10A 2ZLYA 3S22A 1AUEA 3VP4A 4OIOF 2ZL1A 3BRMA 4BPMA 4Y7PA 2W1TB 1LM3B 2YVKA 3EJNA 5HD3A 1FFHA 4AL1A 3SYNA 4EBPA 4K1OA 1Z63A 2XD5A 4JF5A 5DTSA 3NMJA 2HV7A 2H8AA 1T18A 2VK3A 4N1HA 2DYSC 3B3XA 3ZYTA 1YAXA 4QB8A 5KYWA 2CW0F 3DTEA 1MBLA 4OOLA 4Y3IA 5DS5A 4JXWA 2CCYA 5COFA 1KVMA 2WGWB 2EWVA 3KL4A 5TR7A 3C62A 3CPTB 2QUPA 3MXSA 3C8GA 2J9BA 1TS8A 3I4UA 1BSGA 2KC3A 1ST6A 3UNWA 3CUEC 3MFNA 3JRMO 1IEMA 4LLCA 3EFOA 1YZAA 2G3VA 3VYWA 5M19A 3H65A 2OEVA 3ZG1A 4ARZA 2QZ6A 1MXOA 1LS1A 1FCOA 3Q7GA 1YLZA 3SS4A 4Y15A 3FV7A 1F9IA 5FQKA 3AQCA 2EA9A 3SS3A 4EV4A 2BC5A 4OIQF 3H7WB 5A69A 1C17M 2JCHA 2Y39A 3GANA 4WUJA 3VV4A 3QP8A 2X02A 4OD4A 1FR6A 4R1GA 2J7PA 1SZIA 3B33A 5CTNA 4GD8A 3CZDA 2LP4A 1FCMA 4P6BA 4WELA 3EGDA 3PBRA 3UR3C 4E3NA 3V3SA 2AVKA 4QU3A 2YL7A 2EPMX 1LI5A 3LY4A 3QVYA 2IM8A 2PR5A 4YN0B 4MVQA 3ULFA 1RMVA 2A1DD 2Y2IA 4F94A 4JKVA 4BJ5C 2Y59A 4ZLCA 3V67A 1O7EA 4B93A 4DF6A 1FFTC 2NSGA 3JVUA 1T5OA 3LFVA 2VGJA 4CLCC 3FPWA 3VOYA 4IVIA 3TJ5A 4FCFA 3ITFA 1K6RA 3C7VA 1MWRA 1LL9A 2ETSA 4PM5A 2JX0A 5HW3A 3FDQA 3LR0A 4JRZA 4PJNA 4MMNA 2ZD9A 3LLKA 4M4XA 5L0FA 4JTCB 3G30A 1ZVZA 1WYBA 1P9RA 3B71A 4OQHA 1HVBA 4JEBA 2Y69C 1C3BA 5A93A 1OTBA 4DE2A 2ZQ8A 3KSFA 1OW8A 1XZQA 4X55A 3RF3A 2B0HA 2HZ5A 1YZCA 1YKDA 2H28A 3T50A 3KH2A 3S29A 4I3JA 3DZAA 4CSAC 2B5RA 4MEZA 4WEJA 4EXOA 1K57C 3F1OB 3QP4A 1HD8A 4N92A 2WZFA 4RDAA 2VJWA 3BW6A 3NDGA 2XM4A 1U60A 1W8YA 1YSQA 1ACFA 1NWZA 2HJMA 3GECA 4XUZA 4CS9A 3VP3A 2EPOA 2ZC5B 2V26A 1FMVA 2H7VC 1XPBA 2EX9A 3CZ6A 3L9KA 2DMWA 2W3FA 5U47A 2A6EF 3M4BA 1LLBA 2P9VB 3UB8A 2XXAB 1NZOA 1CPRA 1Q0DA 1YJGA 2KOIA 4I3IA 3U8PA 4Q0JA 4CQHA 5TFQA 1PWDA 3UB9A 1ZHZA 2DRWA 3MFDA 1T6UA 4GNUA 1CEGA 5HWWA 3R7WB 5HX9A 5J7EA 1HW1A 1KGGA 5KIZA 3D3OA 3FPVA 3HTKC 3W2ZA 2OG2A 5JLIA 3NHQA 4B88A 2QWSA 2ZXOA 5L0JA 5AQ9A 3T6BA 4PM7A 3ECSA 4YOFA 1K38A 3C38A 3UE1A 4C3QA 3ASOC 2PT7A 4WLAA 4ONSA 1LI0A 4Y2FA 3GQZA 1SR2A 3QW0A 2XGNA 2OWJA 2J9WA 4ZBEA 3U5SA 1SF8A 1YLMA 2R7SA 1DRMA 3LEZA 3EHMA 3GEIA 2ZQAA 5EOOA 3BY8A 1IFQA 1WA9A 2O9BA 3VP1A 5CEDA 1P97A 1ODVA 4XEKA 3IH9A 3OPPA 1FOFA 2OAQ1 1IOUA 3KYIA 2KYHA 1KDSA 4DXCA 3K1IA 5AVFA 4MN6A 1MQVA 5DFYA 2EIMC 1EI7A 2TMVP 2HJEA 2AWYA 2PR6A 5DQZA 3NYJA 1ZKJA 3RQGA 2D01A 3NKEA 3KKBA 4RD9A 4LRYC 3LIFA 1RGYA 4OVDA 1D0YA 3BFDA 5F28E 1D1AA 2CYDA 3HKKA 3K3DA 1ORJA 2A2LA 3FC7A 2J0WA 2V3CC 2WB7A 1J3WA 4MNRA 5D92A 3NOUC 3IQTA 2HPBA 3T4LA 4OP8A 3PBSA 1PCXA 1H0MA 2R7UA 4ANJA 5EVIB 5EOEA 4O6NA 5T3TA 2B95A 4WN5A 2BLSA 3CMZA 4ULVA 1OTIA 4E0IA 5CHMA 2LB9A 3TJZC 4BG0A 1V74B 2HP5A 3L7HA 4X0RA 1BLHA 1G5ZA 2IXNA 3C30A 4EETB 3SS5A 4DRTA 3L1MA 2WZZA 1E3UA 3JZ0A 2R25A 3AG3C 3ZVRA 4Q4ZF 4KZ3A 4GQHA 4U5EE 5TGFA 1NFNA 1WWPA 5CIVA 5CECA 3LR4A 3RTYA 3RXWA 2XL6A 1WOLA 4GZBA 5LBRA 3HJKA 5HARA 1A41A 4UQIM 3U2LA 3Q7VB 5GL9A 2IXMA 2Q00A 4Q8IA 1EA8A 2I15A 4IAQA 3B47A 4IBRA 2Y2KA 4CSAA 3PXPA 3LS1A 2ASRA 3QP1A 3V39A 1K57A 5DJUA 4MDZA 4CLCE 1Q0MA 4BJ1A 4BQMA 5E33A 4MS2A 3PCVA 2K2NA 1GHIA 3OOVA 4JLFA 2QJ7A 1VM1A 4F3LB 4EUKB 4HJ3A 3QMKA 4JGOA 3HUMA 5FAQA 3C8GD 2WADA 2OOCA 4X56A 3IHAA 2ZOIA 1GQAA 2JHEA 4KNVA 4AL0A 1OTEA 1LS4A 1TWCA 1T6QA 2H5SA 4A2NB 2X51A 1K54C 5IHVA 2NUTA 1JWZA 5DLJA 2IWBA 4LV0A 4I44A 1I5NA 4B6IA 2C04A 3UY6A 1LVKA 4KC9A 2J7PD 3UPNA 5F1GA 2G7UA 5HD5A 2GX5A 2EPNA 3SNHA 1YVIA 5B1AC 1E25A 2HP9A 4AE4B 3MSHA 1DP9A 3A9CA 2KX6A 4ME4A 4OIRF 4CJNA 5JRAA 1EQ1A 4CJOA 2QLAA 1Q0KA 4BL2A 4YT5A 5AQ7A 1BT5A 1PW1A 1XJ6A 2HMZA 4DMZA 1YM1A 2H7BA 3DMDA 3NI9A 2AU5A 2L4RA 4G78A 3IBRA 2GA0A 3V7OA 2EX8A 1U89A 1BDJB 1VB6A 4C3DA 3ZG0A 2P0NA 3QNBA 3AG2C 2YL1A 1OT9A 1UWPX 2Y2QA 1RJ9A 3EGXA 3NBLA 3R7CA 4XT2A 2ZXPA 1V4AA 2YQYA 2O9AA 2QE9A 4NY3A 4GD6A 4OONA 1H9GA 2XSEA 2M7VA 3MX3A 2WUQA 4JXGA 3D72A 5JVEA 3V5YA 5EPHA 2V20A 2F22A 3HUOA 3GMWA 4XEFA 2ZD8A 2JE5A 4HOIA 3K33A 3QTHA 5T3WA 1QPUA 3VE3A 5L09A 3G4ZA 2HKVA 1SDNA 5HV9A 3HLBA 3L0IA 4NTBA 1TFKB 2JKTI 4NEED 1QMFA 2W0NA 2ZOHA 4NXGA 3ITBA 2NUPC 1VMAA 3DE9A 2PU4A 1F98A 3RFYA 4RX2A 1OW6A 4DRJB 3S1YA 4E04A 2BASA 1TDGA 2V8CA 4IUHA 2L7AA 5FCLA 1A7DA 2ZMVA 3QVZA 3WWXA 3FZCA 3H82A 3KSGA 4EBKA 3ABLC 3HREA 2V8FA 2VV6A 2WGVA 4GLQA 1JMWA 1HZOA 1NFOA 2BG1A 2J9UA 1M2VA 4CDVA 3CQZA 1S66L 2XLVA 3OC2A 5EECA 3HVFA 3TRCA 4MBKA 5G4YA 4NCQA 1KDWA 4R3AA 2O9XA 2JKRM 2XRHA 3L8JA 3WHNA 2PFDA 4J32B 2EFUA 2QHKA 3ZFZA 4D4NA 3MQ0A 4YT4A 1VETA 5B1BC 2GWWA 2YRFA 1OW7A 3GM2A 4DVZA 2A3UA 2LK4A 3CJMA 4PFPA 4I1MA 2A0UA 1ZZPA 4JIOA 5IY5C 2XL4A 4EBNA 1GS9A 4P6ZS 4Y0TA 1K54A 2DGJA 3FG8A 4R3BA 1J9MA 4WGYA 1TWGA 1MWTA 4WABA 1J8YF 3DWKA 4EUZA 4JXSA 3BFEA 1LSXA 1I5QA 3M2KA 2IOQA 1ZHWA 3NMIA 5KYNA 4H6JB 1Z7Qc 2GAQA 5L3QA 2Q9MA 4UQIS 1HE1A 4DXWA 2ZC3B 4LCMA 1XP4A 5KYYB 3F1NB 3MYFA 3SXZA 1DJCA 1BBHA 3O3VA 4J30B 2Y2GA 3LICA 1ZG4A 5DF9A 3JVVA 3RQFA 1BZAA 5HZHA 3AGFA 5A6BA 2HV6A 3F1PA 4MW3A 3ZTZA 4Z9QA 4L9EA 2ZXRA 2VCBA 2W3HA 5DF7A 4OOYA 1VEUB 1OCOC 5TJ5E 3KPHA 2QMIA 3K6BA 1VYIA 3ICYA 4IAOA 5FDHA 1R4TA 2VB6A 1DOWA 5JS5A 3M15A 2GFHA 3BEBA 5F82A 2ZC6B 2R7VA 2R7TA 1D1JA 4OPQA 4OLGA 1AVOB 1TS7A 2EPKX 2XF3A 4U9EA 4GDBA 1E3UD 4MVZA 2VZWA 2QNLA 4NKPA 1MMNA 3DAFA 3KYEA 4E3LA 4O7GA 3N2ZB 1SKOA 4IBXA 5CGXA 3LEOA 5DF8A 4HEAJ 1YLJA 3V5ZA 1BULA 2J3WA 4LCLA 3VF0A 4DDYA 2B18A 4OP5A 3G2YA 1MNEA 3SXKA 3SW1A 4NTAA 1FCNA 2G2UA 4EEUA 2J9VA 3RW0A 1I2WA 5G4ZA 5J8XA 3SP1A 4QWOA 2IYLD 2OJQA 2PRFA 2EX2A 3QP5A 5EE8A 3UE3A 2NUPA 3A11A 1L0GA 1XWJA 3HNLA 3B0VC 2PD8A 4RYEA 3NECA 2XLNA 3I5PA 4FH4A 4OH0A 3W8IA 5GHZA 1JNUA 3IF6B 4CS8C 5GPGB 1OCRC 3IXDA 3ZC4A 1FR1A 4YL1A 3IHBA 1QLEC 3PBTA 4WZ5C 2E87A 2PBYA 2E8IA 4RVAA 2L9JA 3ABMC 2KJGA 2J7VA 3S7OA 1ZC2A 2EFXA 3UB6A 2PP4A 2OU6A 4NC3A 2Y2LA 3LR3A 2NSFA 2XR0A 1S1ZA 3E4QA 4NG2A 5KYXA 2MJ6A 3ZG8B 3HJCA 3LAYA 3R4KA 4W8KA 2QKPA 4XWJA 1TF1A 2ZQ7A 2UUHA 3DTIA 3JSZA 4PACA 4U5BE 4O6MA 2J3TD 2W4MA 1Y54A 2HMQA 1G4US 1N9BA 4LV2A 4FTXA 5IS1A 1RKCA 3GWNA 5DTKA 5HDCA 1MWUA 2XLMA 1CPQA 4HY8A 4IJJA 1U6HA 3KYJA 3LEVA 1EW0A 3T4QA 4UA9A 3NIAA 4HJ6A 5KYWB 3T1RA 4CJGA 5L0CA 2EXAA 3ZIBA 5DKKA 4HE8D 1GA0A 4DRIB 4MN5A 5CX7A 3IPMO 2Q9BA 4U3TA 1ZHTA 4BWIA 4IVKA 4WM9A 2A49A 4YWZA 5MC7A 1JPJA 4X68A 3C8GB 4X69A 3WS0A 4Y0OA 3VM6A 3UMKA 3UMDA 2PYRA 3RJUA 4CIHA 4G3WA 4GHIA 5KSCA 1M57C 4ARZB 4X1MA 3ZTMA 4K7BA 1MNDA 3FMSA 4LV3A 2Z6DA 3OA1A 2V1BA 3SOIA 4XPWA 3EG9A 4DVYP 3A3EA 4YWQA 2MHRA 1XFNA 2JKGA 4WYYA 3T4JA 2WGWA 3P01A 1T01A 2JBFA 3EGDB 4S2NA 4DRHB 3EQVA 2B0JA 2OWHA 4MTOA 4BJTA 2H10A 3BY9A 1FSWA 4OLDA 4OKPA 4UEYA 4XLPF 1BLCA 4N1XA 1ES5A 5EM1A 3DAGA 4H8RA 3MJQA 1CEFA 5L0GA 3C7UA 4RBNA 5GLDA 4U5FE 4ZLDA 3H7WA 5COMA 1RKEB 3EEHA 1WTYA 3K2NA 3V5XA 3S90A 3A0VA 3AGUA 4PM9A 1IZMA 2Q9NA 5COGA 2JD3A 3S27A 4ETXA 4EWFA 4G3VA 4E3OA 2L0WA 3KYZA 1MMDA 5GLAA 2R9XA 3SH7A 2I72A 4JGPA 4ETZA 3E70C 5D91A 4U9DA 2HUJA 2EIJC 3C8ZA 5F5HA 3PBNA 4CS8A 3BFCA 4E6WA 1DJAA 3DM5A 2HDUA 4S2MA 4FESA 2A6HF 4WZ5A 2EXBA 3NULA 3MKEA 1FSYA 1JVJA 5EVIC 4LACB 3DM9B 3C63A 1PRQA 2VCAA 2PF4E 2VGLS 1NZUA 4K0WA 2KGOA 1W63M 2VGKA 3HLZA 2R03A 2XA7S 3O87A 2IWCA 1HLUP 3U2AA 1N9NA 4NXFA 1XKZA 3OPRA 2DI3A 2UUIA 1GSVA 3UB7A 2WKQA 2JKTM 2LFFA 1W63Q 1KVLA 3MXRA 3IHUA 3NYLA 3VAYA 4PMAA 4OD5A 2PX3A 3WODF 2JPUA 1NJ4A 3T4OA 3T6JA 2ZMAA 4XEVA 4PJMA 1H6GA 3IXBA 2WZLA 1NU7D 3WS1A 1OTDA 2YEVA 5F1FA 5A6BD 2Y2NA 1T1AA 3PAGA 1YPRA 3ZNYA 5DS6A 1WATA 4IRUA 1FILA 3Q1FA 4OQIA 1PYYA 2Q4FA 3B29A 2C5WB 3HLFA 3U4LP 2IA2A 3O39A 2CGEA 2CNWA 2LFDA 4JC7A 1XXMA 5K5BA 4JKTA 1YLPA 4KZ7A 2Y3DA 3IXHA 4H4KC 4G0HA 5CGSA 3AOUA 4BLMA 3HLGA 3DWWA 2Y3HA 3K1HA 3EEAA 4ZTKA 3BLMA 1S4SA 3MMHA 4KZ4A 2LB5A 2P9VA 4ZAMA 4D2OA 1VQQA 3CUEA 4C3EA 3LY3A 2AWCA 4MTFA 2RL3A 4W8PA 2VX8A 3T1XA 4LRZE 3R7WA 2V1AA 3RH8B 1DOVA 3HNIA 1E83A 4M3KA 3U9MA 1Q2QA 3B9QA 1K40A 1SHVA 2EINC 5HDSA 5AC4A 2IXOA 1WASA 1Y6DA 1YYJA 3O88A 3SZRA 1OPXA 1TDLA 3OLOA 2R05A 1L0EA 2UV0E 2YZSA 2RD9A 4O0PA 3TSGA 2GDCA 2J80A 4EW7A 1QQ3A 3VFHA 3O86A 3IWQA 5FI7A 4P6IC 2INWA 4EWCA 2YL3A 1S0WA 4OQ0A 2VV7A 2KSFA 3J06A 4BENA 5HDDA 1K6SA 2JC7A 3BFFA 3BYDA 3UDXA 4MVUA 4PM6A 3UE6A 3UGOA 2YHSA 3AQBA 2WZXA 4EQIA 2J0XA 2EWWA 2HDQA 4HQAA 3BLSA 5KYUB 4BJ5A 5AGFA 5E2HA 4KZBA 1YLYA 4JF6A 1TWHA 2OLVA 5GHXA 4CLCA 3K7DA 1D1CA 5CRFA 2FH5A 4NETA 4DE0A 2MWQA 3C5AA 2XROA 3A3FA 4PHTA 2HGVA 3G35A 3N7WA 4UA7A 5F5YA 5A6AA 1RXQA 4UDVA 2PD7A 2FFHA 1EWZA 1J8MF 1L0DA 1XA1A 1ZG6A 1WGWA 4WMCA 3IQAA 2Q0OA 1O87A 1X0OA 3Q07A 4LDKA 4HI4A 1BR2A 4E17A 4H54A 1H5XA 4YINA 2WYXA 5FEGA 2HZ8A 1OR3A 3EPVA 1L0FA 1TD5A 1APCA 1D0XA 2CDQA 4HP4A 4JGRA 3NKDA 1K25A 5EVIA 2XS8A 4L9FA 5JYPA 2RSEB 4DOZA 3S0XA 2W3EA
chains in the Genus database with same CATH topology
5IU1A 3LIAA 4HP9A 2VV6A 4GLQA 1ZHHB 1T1CA 2O0YA 3S7NA 1S66L 3EQUA 1F5MA 1D7EA 4HJ4A 4WF0A 1YSPA 1NRJA 3OC2A 3TRCA 4BBTA 5G4YA 3MQOA 4DJ2A 4R3AA 2JKRM 3CAXA 3C2WA 4EESA 2YKHA 2YKFA 5F68A 2QHKA 3LIEA 3MQ0A 5TBMA 3CI6A 3BQAA 4BJPA 1H8MA 4I5SA 4DN0A 4GS9B 1XJ2A 4EEPA 2V9AA 3F1OA 4P6ZS 1NLYA 3FG8A 3IBJA 2QJ5A 2W1TB 1GSXA 1LSXA 5HD3A 4H6JB 4R6LA 4UQIS 1T18A 3MF0A 4HIAA 2OOLA 3F1NB 4PKYG 3ZYTA 1YAXA 1S67L 4OOLA 4Y3IA 3NOTC 3IS2B 1OJGA 2NUTC 5HSQA 2EWVA 3LICA 3TW8A 5DF9A 3JVVA 4NXBA 5HZHA 3F1PA 2HJ9C 3KSIA 1TS8A 4IHQA 4WL9A 1XFQA 4OOMA 3CUEC 4L9EA 3E4OA 2W3HA 3S7QA 4ARZA 3ICYA 2R78A 1F9IA 2J3TC 4HH3A 4BBUA 1N9OA 2V0UA 3MFXA 2EA9A 4Y5FA 3H7WB 2Y79A 4WUJA 3VV4A 2HV1A 4I39A 2OAP1 1TS7A 2CMNA 4XT2B 3B33A 2XRNA 5DFXA 2VZWA 3CWFA 4CLCB 4NKPA 4WELA 3LR5A 1BYWA 2KDKA 3PBRA 3A0RA 4EUVA 3V5ZA 2J3WA 4EERA 2WKPA 2B18A 2ZMFA 3SW1A 2PR5A 3ULFA 4EEUA 2M7UA 5G4ZA 3V67A 3BWLA 4B93A 4KUOA 3EGXC 3S7PA 3UE3A 3JVUA 1XJ3A 3LFVA 4CLCC 3FPWA 2K31A 2PD8A 3LR0A 5HPFA 4GW9A 3MR0A 4MMNA 1JNUA 4M4XA 4P6ZM 4KUKA 4YNRA 1P9RA 3EOIA 3PBTA 1Y28A 5L8MA 4DJ3A 1OTBA 2O99A 3BJNA 3CLOA 4O8GA 3VE4A 3DBAA 3KSFA 3S7OA 3UB6A 1S4RA 1YKDA 2H28A 3LR3A 5HPIA 3T50A 1S1ZA 3MXQA 2O9CA 4HNBA 4KQDA 3E4QA 2M1CA 4I3JA 4K08A 2MJ6A 5C5KA 4WEJA 3CITA 3R4KA 2QKPA 4EXOA 3F1OB 1TF1A 3NJAA 1STZA 2GNXA 3BW6A 2VJWA 3RFBA 1YSQA 2W3DA 1LSVA 1NWZA 4PAUA 3GECA 4IJGA 4Q0HA 2J3TD 1OTAA 2PDRA 2DMWA 2W3FA 2VA0A 5IS1A 4Z1WA 5HDCA 1OJ5A 1MC0A 3UB8A 4F3LA 4BBVA 2KOIA 4HY8A 4I3IA 4Q0JA 4CQHA 4L0LA 3UB9A 1EW0A 4O01A 3T4QA 4HJ6A 5HWWA 3R7WB 2I9VA 5DKKA 2XSSA 1OT6A 5J7EA 4GS9A 4MN5A 5KIZA 3D3OA 3FPVA 5CX7A 5FL3A 5A8BA 3W2ZA 4BWIA 3NHQA 4WEKA 2QWSA 1H3QA 4YWZA 5MC7A 3BQ8A 2V0WA 4YOFA 3C38A 5J4EA 3F1PB 2W1RA 3UMDA 1UGUA 2PYRA 1G28A 2B02A 3OCNA 2PHYA 2PT7A 4WLAA 4EQ1A 2A24A 4R70A 4G3WA 4GHIA 4Y2FA 4ARZB 2OWJA 5HWVA 4CLCD 1DRMA 2Z6DA 2V1BA 3LYXA 3BY8A 2D02A 1IFQA 1WA9A 2O9BA 5F6AA 4KQOA 3E98A 3IS2A 1XFNA 2FZ0A 1P97A 3A0SA 3T4JA 4JGQA 1ODVA 3P01A 2OAQ1 1IOUA 1P0ZA 4RQ9A 5AVFA 4MN6A 3EQVA 5DFYA 2P04A 1MKMA 3UMEA 2HJEA 5AVEA 2PR6A 2OWHA 5HL6A 3BY9A 1ZTUA 2D01A 3PBOA 4NXEA 4UEYA 4LRYC 3LIFA 2K7SA 3MJQA 3K3DA 4EU0A 3H9WA 2P7JA 4LLOB 2A2LA 3FC7A 3H7WA 4MN7A 3EEHA 3K2NA 3E4PA 3V5XA 2L1MA 3G6OA 3A0VA 5F69A 3NOUC 3T4LA 3EGDC 3K3CA 3PBSA 4HHDA 4ETXA 2JN7A 4WN5A 4G3VA 2L0WA 1N9LA 1OTIA 3KYZA 1TS6A 2HF6A 2LB9A 3H82B 3TJZC 4JGPA 4R38A 4ETZA 1T19A 2VV8A 3C30A 4EETB 3LIBA 4FOFA 3PBNA 1S1YA 4I38A 1LL8A 3LR4A 3RTYA 1D06A 3T4TA 3LI9A 3P7NA 5LBRA 4QPRA 3ZQ5A 3HJKA 5AJGA 2Y8HA 4UQIM 2VGLS 5TBMB 1GSWA 1V9ZA 1W63M 1DP8A 2XA7S 3U2AA 1N9NA 4NXFA 3B47A 4LPZA 3PXPA 1GSVA 3UB7A 2WKQA 2JKTM 5DJUA 1W63Q 2ZBBA 4MDZA 4CLCE 4GJ4A 2QYBA 3HJIA 2K2NA 3OOVA 5EFWA 2GJ3A 2QJ7A 3T4OA 4F3LB 1UWNX 4HJ3A 3O5YA 1OTDA 3KO6A 4JGOA 1T1AA 3TE8A 1DP6A 2ZOIA 2JHEA 2P08A 2IA2A 1OTEA 5DJTA 4GCZA 5K5BA 3PR6A 5DKLA 5J3WA 5IT5A 3LUQA 5I5LA 2A24B 3E0YA 3EEAA 4GHIB 4ZRRA 1S4SA 2W1TA 3C8CA 3MMHA 4AFIA 2LB5A 2VKSA 4L9GA 3CUEA 3GDIA 4H6JA 2G7UA 5HD5A 2GX5A 2VX8A 1TS0A 4LRZE 3R7WA 2V1AA 3RH8B 3U9JA 3F1NA 3OBFA 4ME4A 1DP9A 2KX6A 3U9MA 1LSWA 4FSFA 2Z6CA 5HDSA 3OLOA 1OPXA 4II7A 3PHYA 3OCLA 3T4KA 1P9WA 1NLZA 1XJ6A 4LRXC 4O0PA 4DMZA 2J80A 4EW7A 3B42A 3NOPC 2INWA 2GZAA 2VV7A 3KYQA 5HDDA 3KX0X 3EWKA 4I3AA 4MCWA 2L4RA 3IBRA 1G6OA 3PBQA 1XJ4A 1VHMA 2VEAA 1VB6A 2W27A 3UE6A 2P0NA 2EWWA 3KSHA 4HQAA 2VGLM 1OT9A 1UWPX 2PYPA 1LT0A 2WKRA 4XT2A 2XA7M 2O9AA 4CLCA 3VOLA 5HWTA 4G3KA 1V9YA 4Q0IA 2M7VA 3LIDA 2FH5A 3D72A 3V5YA 2XROA 4HH2A 1MZUA 1KOUA 4HOIA 4PKYA 4PHTA 2HGVA 5TJJA 5F5YA 2PD7A 3VE3A 3T4SA 3PYPA 4BMWA 5KSHA 1X0OA 2JKTI 4HI4A 4NEED 2VLGA 2W0NA 1T1BA 2ZOHA 4NXGA 2NUPC 3HCYA 1F98A 2W3GA 3LI8A 1TD5A 4B9OA 4E04A 4HP4A 2BASA 4JGRA 4IUHA 4L9FA 2JKRI 4IUKA 2KLIA 2W3EA 2ZMVA 3MQQA 3H82A 3KSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IU1 A;  3LIA A;  4HP9 A;  2VV6 A;  1T1C A;  1S66 L;  1D7E A;  4HJ4 A;  4WF0 A;  4BBT A;  5G4Y A;  3MQO A;  4DJ2 A;  4R3A A;  3CAX A;  3C2W A;  4EES A;  2YKH A;  2YKF A;  5F68 A;  2QHK A;  3LIE A;  5TBM A;  4I5S A;  4GS9 B;  1XJ2 A;  4EEP A;  2V9A A;  3F1O A;  3FG8 A;  2QJ5 A;  1GSX A;  1LSX A;  5HD3 A;  4H6J B;  4R6L A;  1T18 A;  4HIA A;  2OOL A;  3F1N B;  4PKY G;  1S67 L;  3NOT C;  3IS2 B;  1OJG A;  5HSQ A;  3LIC A;  4NXB A;  5HZH A;  3F1P A;  1TS8 A;  4WL9 A;  1XFQ A;  4L9E A;  3E4O A;  3ICY A;  2R78 A;  1F9I A;  4HH3 A;  4BBU A;  1N9O A;  2V0U A;  3MFX A;  2EA9 A;  3H7W B;  4WUJ A;  2HV1 A;  4I39 A;  1TS7 A;  2CMN A;  4XT2 B;  3B33 A;  3CWF A;  1BYW A;  2KDK A;  3A0R A;  3V5Z A;  4EER A;  2WKP A;  3SW1 A;  2PR5 A;  3ULF A;  4EEU A;  5G4Z A;  3BWL A;  4KUO A;  1XJ3 A;  2PD8 A;  4GW9 A;  3MR0 A;  1JNU A;  4M4X A;  4KUK A;  1Y28 A;  4DJ3 A;  1OTB A;  3CLO A;  3VE4 A;  3UB6 A;  1S4R A;  2H28 A;  3T50 A;  1S1Z A;  3MXQ A;  4HNB A;  4KQD A;  3E4Q A;  2M1C A;  4I3J A;  4K08 A;  2QKP A;  4EXO A;  3F1O B;  3NJA A;  1LSV A;  1NWZ A;  3GEC A;  1OTA A;  2PDR A;  5IS1 A;  5HDC A;  1OJ5 A;  3UB8 A;  4F3L A;  4BBV A;  4I3I A;  4HY8 A;  3UB9 A;  1EW0 A;  4HJ6 A;  5HWW A;  2I9V A;  5DKK A;  1OT6 A;  5J7E A;  4GS9 A;  4MN5 A;  5KIZ A;  5A8B A;  3NHQ A;  2QWS A;  4YWZ A;  2V0W A;  5J4E A;  3F1P B;  3UMD A;  1UGU A;  2PYR A;  1G28 A;  2B02 A;  2PHY A;  4WLA A;  4EQ1 A;  2A24 A;  4R70 A;  4GHI A;  2OWJ A;  5HWV A;  1DRM A;  2Z6D A;  2V1B A;  3LYX A;  3BY8 A;  2D02 A;  1WA9 A;  5F6A A;  3IS2 A;  1XFN A;  3A0S A;  1P97 A;  4JGQ A;  1ODV A;  1P0Z A;  4RQ9 A;  5AVF A;  4MN6 A;  3UME A;  5AVE A;  2PR6 A;  2OWH A;  3BY9 A;  2D01 A;  4NXE A;  4LRY C;  3LIF A;  2K7S A;  3MJQ A;  3K3D A;  3H9W A;  2P7J A;  4LLO B;  3FC7 A;  3H7W A;  3EEH A;  3E4P A;  3V5X A;  2L1M A;  3G6O A;  3A0V A;  5F69 A;  3NOU C;  3K3C A;  4HHD A;  2JN7 A;  4WN5 A;  2L0W A;  1N9L A;  1OTI A;  1TS6 A;  3H82 B;  4JGP A;  4R38 A;  1T19 A;  2VV8 A;  4EET B;  3LIB A;  1S1Y A;  4I38 A;  1LL8 A;  3RTY A;  1D06 A;  3LI9 A;  3P7N A;  3ZQ5 A;  3HJK A;  5TBM B;  1GSW A;  1V9Z A;  1DP8 A;  1N9N A;  4NXF A;  4LPZ A;  1GSV A;  3UB7 A;  2WKQ A;  5DJU A;  2ZBB A;  3HJI A;  5EFW A;  2GJ3 A;  2QJ7 A;  4F3L B;  1UWN X;  4HJ3 A;  1OTD A;  4JGO A;  1T1A A;  1DP6 A;  2ZOI A;  2JHE A;  1OTE A;  5DJT A;  4GCZ A;  5DKL A;  5J3W A;  3LUQ A;  5I5L A;  2A24 B;  4GHI B;  1S4S A;  3C8C A;  4L9G A;  3GDI A;  4H6J A;  5HD5 A;  1TS0 A;  4LRZ E;  2V1A A;  3RH8 B;  3U9J A;  3F1N A;  1DP9 A;  2KX6 A;  3U9M A;  1LSW A;  2Z6C A;  5HDS A;  3OLO A;  3PHY A;  1XJ6 A;  4LRX C;  2J80 A;  4EW7 A;  3NOP C;  2INW A;  2VV7 A;  5HDD A;  3KX0 X;  3EWK A;  4I3A A;  2L4R A;  3IBR A;  1XJ4 A;  2VEA A;  1VB6 A;  2W27 A;  3UE6 A;  2P0N A;  4HQA A;  1OT9 A;  1UWP X;  2PYP A;  1LT0 A;  2WKR A;  4XT2 A;  3VOL A;  5HWT A;  1V9Y A;  3LID A;  3D72 A;  3V5Y A;  4HH2 A;  1MZU A;  1KOU A;  4HOI A;  4PKY A;  5F5Y A;  2PD7 A;  3VE3 A;  3PYP A;  1X0O A;  4HI4 A;  2VLG A;  2W0N A;  1T1B A;  2ZOH A;  4NXG A;  1F98 A;  3LI8 A;  4B9O A;  4E04 A;  4HP4 A;  2BAS A;  4JGR A;  4L9F A;  3MQQ A;  3H82 A; 
#chains in the Genus database with same CATH topology
 2QPN A;  4YK5 A;  4KZ6 A;  5IU1 A;  2OV5 A;  1JR8 A;  3QHY A;  3M6H A;  3GR2 A;  3UGP A;  4YL3 A;  5L2F A;  1K4F A;  1ESU A;  3EQU A;  1F5M A;  5EGY A;  1LE4 A;  2ZQ9 A;  3NYM A;  4WF0 A;  1NRJ A;  1EI5 A;  3RVZ A;  3FOP A;  5FI6 A;  4MVO A;  4MLL A;  5JYO A;  4E7Z A;  3JPU A;  3N4I A;  3IQ5 A;  3C2W A;  4DBQ A;  3ASN C;  1ZHX A;  2YKH A;  3BEH A;  2JKF A;  3Q7V A;  2J9O A;  3LIE A;  1JRA A;  3CI6 A;  3CSK A;  3BQA A;  2OCC C;  3JSE O;  4GDN A;  2XS1 A;  3TUL A;  3QNC A;  1H8M A;  4DXB A;  2M4E A;  2L81 A;  3S84 A;  4GS9 B;  4I5S A;  2G3K A;  1PIO A;  3RXX A;  1ZHY A;  2NUT B;  3AGT A;  5I94 A;  1NLY A;  3OZH A;  4N9K A;  4WZ4 A;  2H7O A;  2OJE D;  4E6X A;  1NYY A;  2YLI A;  2QJ5 A;  2Y91 A;  4Y17 A;  3TK0 A;  5F83 A;  2Z15 A;  5E3A A;  4CIP A;  3M6B A;  4R6L A;  5BQH A;  3U3F A;  4B4Z A;  3SH8 A;  4CBE A;  1E84 A;  3GEH A;  3HL9 A;  4PKY G;  3T1Q B;  1H7I A;  3GM1 A;  2XLW A;  3FOO A;  1CF0 A;  1LHY A;  3O55 A;  1SCW A;  3VP0 A;  3NOT C;  3AG1 C;  1G68 A;  3IS2 B;  3UB5 P;  1OJG A;  3ZVT A;  3TW8 A;  3EHN A;  2PNO A;  3M4C A;  2J8Y A;  4NXB A;  3IX4 A;  3KSI A;  4KQR A;  4IHQ A;  4WL9 A;  3GWL A;  4R32 A;  2R7W A;  1HW2 A;  5JUA A;  4NQF A;  2FFF B;  5T1D B;  3S7Q A;  4RA7 A;  1YAU O;  2ZQD A;  3OPL A;  3NCK A;  3D9Y A;  4BBU A;  3TOM A;  1N9O A;  2V0U A;  1JTG A;  4R4R A;  3GVB A;  3CG5 A;  1OKK A;  1AXB A;  4AX2 A;  3LEQ A;  2Y79 A;  2G2W A;  4I39 A;  1ES3 A;  2OAP 1;  2CMN A;  5AC5 A;  1YAR O;  3EGX B;  4XT2 B;  5HFO A;  3VRC A;  4P87 A;  3VSK A;  3CWF A;  1H8Y A;  3LR5 A;  3GEE A;  1LIH A;  1ES2 A;  3A0R A;  4EUV A;  1CGO A;  4N6H A;  4C75 A;  1DY6 A;  3UMI A;  1EKY A;  1VTM P;  1PW8 A;  2ZMF A;  3ATP A;  5B3I A;  4JPM A;  2A0B A;  2NG1 A;  1M40 A;  4BL3 A;  2R7Q A;  4BEM J;  1UFB A;  4K91 A;  5HSW A;  3C4P A;  4JXV A;  3ZQV A;  2HP6 A;  4KUO A;  4G7Z F;  3S7P A;  4PPR A;  4ER9 A;  1XJ3 A;  3JYH A;  4EIY A;  2DB4 A;  5JT4 A;  1K4E A;  2K31 A;  3M2J A;  4KG6 A;  3SXY A;  1LE2 A;  5JP7 A;  4LER A;  4X6T A;  3M79 A;  2Y2O A;  5FQ9 A;  5HPF A;  1M2V B;  4YNR A;  1K0K A;  4C7O A;  1L3P A;  1E85 A;  3HLD A;  3ZHH A;  3QZC A;  2PBE A;  1OCC C;  4MQ9 F;  3E9V A;  1YQS A;  2Y2P A;  3BJN A;  2O99 A;  1TR2 A;  2CNW D;  3CLO A;  3VE4 A;  2YL0 A;  3TQO A;  1S4R A;  5HPI A;  4JZA A;  1SDE A;  1PI4 A;  4KZ9 A;  5JSL A;  3MXQ A;  4HNB A;  4KQD A;  2LCH A;  4K08 A;  3IF6 C;  5KMW A;  4GKU A;  3CIT A;  5L10 A;  3ZSU A;  3DTK A;  4ZJ3 A;  3MLG A;  1YMX A;  2W3D A;  3JRT A;  4P85 A;  3EZH A;  2DYR C;  4IJG A;  2WZG A;  3PTE A;  4Q0H A;  3VFF A;  5AQA A;  3WRZ A;  3PHF 2;  2VA0 A;  4Z1W A;  1OJ5 A;  1MC0 A;  1CGM E;  1GGQ A;  1KGE A;  4E3M A;  4BBV A;  3Q6M A;  1GM5 A;  4L0L A;  2L6F A;  4O01 A;  1L3L A;  1JAF A;  1U0B B;  3WS5 A;  4MBH A;  3SH9 A;  1OT6 A;  5E43 A;  1HY5 A;  1K04 A;  1VOM A;  3WS4 A;  4GOG A;  1ZYR F;  3FVY A;  4JE9 A;  4WEK A;  1AWI A;  5A90 A;  2EPL X;  5A6J A;  1ERM A;  5J4E A;  2VAS A;  4UA6 A;  5FQJ A;  5GHY A;  3F1P B;  2W1R A;  1M56 C;  4DBR A;  1UGU A;  5M18 A;  3H2V A;  3OCN A;  3ZDJ A;  1V54 C;  3U3B A;  2A24 A;  4R70 A;  3MZE A;  1C03 A;  3RH3 A;  4JCZ A;  1TVF A;  4CLC D;  1E86 A;  1YLW A;  4S2J A;  4Q7C A;  2D02 A;  4KQO A;  2ZXW C;  2KK1 A;  3IWI A;  3A0S A;  1LI9 A;  2W9Y A;  5FZT A;  4JGQ A;  1M6K A;  4WMC D;  1IYQ A;  5CGW A;  1P0Z A;  4QY5 A;  1TWA A;  3WG7 C;  3POV A;  1SKO B;  3CHW P;  3SZT A;  2P04 A;  1YA9 A;  5DVW A;  1ORY A;  5AVE A;  5HL6 A;  4S2K A;  4A4A A;  1ZTU A;  1TQG A;  4EHP A;  1VEU A;  4JTA B;  1A7V A;  5EVI D;  4U0X A;  2K7S A;  4F4B A;  1LPE A;  2V1Z A;  3H9W A;  4JEA A;  4I3M A;  5E2E A;  4O6Y A;  4MN7 A;  3E4P A;  3L34 A;  5FAS A;  5F69 A;  4ID4 A;  3LJB A;  4IED A;  3S4X A;  1QKR A;  3EGD C;  3K3C A;  4HHD A;  2JN7 A;  3HNJ A;  4LFU A;  1SYQ A;  2QY9 A;  3FAJ A;  1IKG A;  3JTL O;  4E7S A;  1N9L A;  4S2P A;  1TS6 A;  2HF6 A;  2G62 A;  2WAF A;  3IEE A;  4R38 A;  5KZH A;  1MY8 A;  2VV8 A;  1W8Q A;  2BTF P;  3LIB A;  4FOF A;  1R5I D;  1VLS A;  3UNG C;  2P6V A;  1S1Y A;  3UPO A;  4I38 A;  2OSU A;  2P74 A;  2Y55 A;  1D06 A;  4HEF A;  3T4T A;  3LI9 A;  1MMG A;  1SZV A;  3Q7L A;  1L2S A;  5EV0 A;  3ZQ5 A;  5AJG A;  3FKW A;  4OQG A;  3Q7Z A;  5AQB A;  5TBM B;  1GSW A;  1V9Z A;  5A92 A;  4BD0 A;  1VK5 A;  3RYL A;  1DP8 A;  3I7J A;  3HNK A;  3MS6 A;  4YFM A;  1MKI A;  1KE0 A;  2HSB A;  5FEF A;  2ZBB A;  4GJ4 A;  2QYB A;  1OME A;  5EUA A;  2Q9C A;  3DTM A;  4JJF A;  3HJI A;  1GA9 A;  3DXJ F;  2WGI A;  1JOG A;  2OLU A;  2ZL1 B;  3I5Q A;  1Z6A A;  2XDM A;  1A0K A;  5EFW A;  3V50 A;  3S28 A;  2XH9 A;  2FAP B;  3HLC A;  1VYK A;  1TEM A;  2R7O A;  3O5Y A;  4MVM A;  1YT4 A;  4Z9I A;  4A5R A;  4S2L A;  1DP6 A;  4HES A;  2ZM2 A;  1I4Y A;  1SMY F;  1OQC A;  4KZ5 A;  4EKW A;  3W4Q A;  3T9O A;  3G4P A;  4JF4 A;  4KZ8 A;  2P08 A;  1MWS A;  4BEJ A;  4GCZ A;  1IEL A;  5HAP A;  4CS9 C;  3D4F A;  1OKK D;  5GLB A;  4JVS A;  5I5L A;  2ZM8 A;  3E0Y A;  4G7H F;  2D5R B;  3WS2 A;  4GHI B;  2W1T A;  3C8C A;  2Y2H A;  4AFI A;  3EFO B;  2VKS A;  3IWO A;  2Q9A A;  1YYX A;  1WYC A;  4GB7 A;  5CHU A;  2Y3G A;  1TS0 A;  3EG9 B;  3X1O A;  4N06 A;  2J8W A;  3U9J A;  3G32 A;  3OBF A;  3FKV A;  2WK0 A;  2Q3T A;  4FSF A;  4PJJ A;  2H0Y A;  2Z6C A;  2YWA A;  3MBZ A;  3Q6N A;  3UDF A;  3NDE A;  3Q82 A;  4II7 A;  3GOR A;  3FWL A;  3OCL A;  1P9W A;  3CPT A;  4D4X A;  1NLZ A;  2KW3 C;  3ZVW A;  3B42 A;  1NU9 C;  2ZQC A;  4WGZ A;  3JCU Q;  3US6 A;  3KYQ A;  1ERQ A;  1H9T A;  3JT1 A;  1PNE A;  3EWK A;  3NG1 A;  4LEN A;  4I3A A;  4I1O B;  4IB4 A;  1G6O A;  3PBQ A;  1FAP B;  1VHM A;  5FQI A;  1RP5 A;  2AVX A;  1FQG A;  4MVS A;  2XFS A;  3ZG5 A;  4PR9 A;  3KSH A;  4S2O A;  3K1I C;  3G50 A;  2R9R B;  2PYP A;  2WKR A;  5BQI A;  4YT8 A;  2IWD A;  3DAV A;  3F46 A;  2P61 A;  3P98 A;  1NY0 A;  3LID A;  1ZW2 A;  1PI5 A;  4LLE A;  4UAA A;  1KOU A;  4PKY A;  5TJJ A;  5M1A A;  4HFF B;  3KMI A;  3ZWI A;  5DTT A;  1B68 A;  3N24 A;  3W4P A;  4XPX A;  3PYP A;  5KSH A;  1Q0G A;  1I2S A;  1RKE A;  5EVE A;  1BR1 A;  1O3U A;  4JJG A;  4KNW A;  1GHM A;  4IGG A;  3HCY A;  3AG4 C;  3DE8 A;  256B A;  4ZJ1 A;  3BM6 A;  2JKR I;  2XD1 A;  3MYI A;  4QJG A;  3U2M A;  1I4Z A;  2W4B A;  3MQQ A;  3UPP A;  3IQ6 A;  3E2K A;  3IXG A;  3F47 A;  2W45 A;  2C6W B;  3LIA A;  2HS5 A;  3G31 A;  4HP9 A;  3EH1 A;  3RQE A;  1Q0F A;  3FXH A;  4G7O F;  3ZCZ A;  1SKF A;  3W4Y A;  2Y2M A;  3IF5 A;  1T1C A;  3FAP B;  3S7N A;  1CQA A;  1HMD A;  4PM8 A;  4HJ4 A;  4P9T A;  4KG2 A;  1S05 A;  4U5H A;  1YSP A;  3ZG7 B;  1N1C A;  4QI0 A;  3FHD A;  1KTM A;  4BBT A;  1HTZ A;  1IYS A;  3MQO A;  3CAX A;  2KNH A;  1XGI A;  5F68 A;  1FTS A;  3DW0 A;  1E4D A;  4MW8 A;  5B3S C;  4OPY A;  1IYO A;  3N8L A;  4XUX A;  1T6I A;  4DKI A;  2OKU A;  1KE3 A;  1S7Z A;  3X2Q C;  3N8R A;  4R23 A;  3TJ6 A;  2V9A A;  3F1O A;  1H8Z A;  2HJ3 A;  3IBJ A;  5K0I A;  1ZU5 A;  4KG5 A;  1E2X A;  3NDB B;  4FUW A;  4DJ9 A;  1GSX A;  1UG7 A;  1BTL A;  4BJ6 C;  3UN7 A;  2YLD A;  2XXA A;  2M64 A;  3O6X A;  3MF0 A;  3VOZ A;  4CS7 A;  4HIA A;  2OOL A;  5A91 A;  5E2Q A;  1S67 L;  4MBF A;  2HSQ A;  2NUT C;  2PU2 A;  4EBB A;  4GN2 A;  5HSQ A;  5CI9 A;  3LS0 A;  4KI2 A;  4LGW A;  3V3R A;  4MND A;  3HUN A;  3MKF A;  4K0D A;  4JTD B;  3AJM A;  4Z9J A;  2HJ9 C;  2FFY A;  2LQG A;  1WE4 A;  1XFQ A;  1OXB A;  2V2F F;  4OOM A;  3E4O A;  3DJU B;  3N0T A;  5HAI A;  2R78 A;  3T1S A;  2J3T C;  4HH3 A;  5L07 A;  3MFX A;  4X1L A;  4Y5F A;  1PZP A;  2WKE A;  1QSP A;  3W4O A;  4HFK B;  1W5D A;  5FQQ A;  1FIK A;  2HV1 A;  3CEX A;  3ITA A;  3W2V A;  2PAV P;  1BR4 A;  4P9F A;  2XRN A;  5DFX A;  4CLC B;  1A7E A;  1NG1 A;  4R4S A;  1BYW A;  1CK3 A;  2KDK A;  2OQM A;  2X01 A;  3M1C B;  2WVQ A;  2VCC A;  2WVO A;  1VLT A;  1Y4O A;  4EER A;  4KQQ A;  2WKP A;  4Y13 A;  1O07 A;  3C4O A;  5CTM A;  4O79 A;  2Q7R A;  2ZJ9 A;  1K56 A;  4AK9 A;  1ORS C;  4EBL A;  1ALQ A;  2XL8 A;  4XPY A;  1O5H A;  4NTF A;  2M7U A;  3QP2 A;  4FH2 A;  3BWL A;  2XQZ A;  4D60 A;  3EGX C;  4NK3 A;  2NPU A;  2PX0 A;  5KYU A;  3IT9 A;  4QHC A;  3LLI A;  1PWC A;  1G4W R;  1GCE A;  1KGF A;  1KU2 A;  2IXP A;  2A69 F;  1PD1 A;  1W7F A;  1XA7 A;  1XX2 A;  4GW9 A;  1L7C A;  4GEH A;  4YL0 A;  3MR0 A;  3IH8 A;  4UHU A;  4P6Z M;  4KUK A;  3SEO A;  2ZPA A;  1CGN A;  3OPH A;  1ERO A;  3EOI A;  3RVY A;  3TG9 A;  1Y28 A;  5L8M A;  4DJ3 A;  2ZC4 B;  2FGY A;  2HFI A;  2LIG A;  1YMS A;  4O8G A;  3DBA A;  1N4O A;  2GDN A;  1PV3 A;  4QI2 A;  1F1M A;  4E3I A;  3GV9 A;  2O9C A;  2M1C A;  1QVX A;  5DQT A;  5C5K A;  5BOH A;  1NXY A;  2H0T A;  2P7V A;  3NJA A;  1STZ A;  2GNX A;  4J7Y A;  3DD7 A;  3RFB A;  3ZNT A;  1LSV A;  1S6R A;  2R9W A;  3MZD A;  4PAU A;  4XLN F;  3T6G B;  4N9L A;  1OTA A;  2XFT A;  3NMK A;  2PDR A;  3ISG A;  4CDA A;  4R0Q A;  2DNS A;  5E3C A;  1K55 C;  5E2F A;  2WKH A;  4ULW A;  1M6T A;  4L6R A;  1ONG A;  4DE1 A;  4F3L A;  1ZW3 A;  4U5C E;  1RCJ A;  4BJ6 A;  1RGZ A;  4LDQ A;  1NZE A;  2I9V A;  2XSS A;  5F5F A;  1KE4 A;  4GS9 A;  2LD6 A;  3ZDL A;  5FL3 A;  5A8B A;  4P0M A;  2ZC7 A;  1H3Q A;  4C6Y A;  3BQ8 A;  3B0P A;  2V0W A;  2X71 A;  1BZ4 A;  3L8I A;  5FSR A;  1ONH A;  1G28 A;  2B02 A;  4QDL A;  2P1A A;  5L3V A;  2A68 F;  2PHY A;  4EQ1 A;  1NYM A;  5FQM A;  2BE5 F;  2R7R A;  1JTD A;  2XM0 A;  4R3J A;  5HWV A;  3BEC A;  1V55 C;  3PMR A;  1BLS A;  1D0Z A;  1PWG A;  4JBF A;  4DE3 A;  3LYX A;  2J9P A;  4X25 A;  5F6A A;  3TD7 A;  4Z9H A;  4CX9 A;  4CDY A;  3E98 A;  1G6A A;  3IS2 A;  4FAP B;  1RCP A;  2EIL C;  4AE4 A;  2EX6 A;  2FZ0 A;  5FAT A;  4RX3 A;  1M2O A;  4OPZ A;  5L0H A;  1RJ9 B;  4RQ9 A;  2J46 A;  5GLC A;  1C02 A;  4OIP F;  2DCF A;  1Q2P A;  1MKM A;  3UME A;  1XGJ A;  1GHP A;  2AP3 A;  4NXE A;  3PBO A;  1AEP A;  4WJ0 A;  4E3K A;  2XLE A;  2ACG A;  1VB5 A;  1Y4C A;  3W2W A;  2BL2 A;  4EU0 A;  2P7J A;  2XEP A;  4LLO B;  3U8V A;  4XQ1 A;  4ZDX A;  2L1M A;  3G6O A;  4LV1 A;  5D3O A;  5FDS A;  4FWV A;  3P09 A;  4FX5 A;  5G18 A;  1OCZ C;  5EVL A;  3BFG A;  2WL8 A;  1NRF A;  3GTC A;  4E3J A;  3ZQY A;  2EIK C;  1PZO A;  3GRJ A;  1PD0 A;  4PFO A;  3WAQ A;  4OIN F;  3H82 B;  1T19 A;  3U0C A;  2L6G A;  4C7O B;  1YA7 O;  5BQG A;  1BLP A;  5CI8 A;  4U5D E;  1LL8 A;  3IX3 A;  3W8K A;  2HDS A;  3LNM B;  1ESI A;  3DKA A;  1YLT A;  3BRJ A;  3MBG A;  5A6K A;  4E0H A;  3P7N A;  4QPR A;  2QTV A;  3RKO F;  3UE0 A;  2Y8H A;  1OXK A;  1IYP A;  3NY4 A;  3HBR A;  1VET B;  3PAE A;  3A3J A;  4KZA A;  5FAO A;  4LPZ A;  4PJL A;  4WBG A;  1A0B A;  2R7X A;  3ABK C;  5DS4 A;  2MYS A;  1Z5Z A;  1TKN A;  1Z23 A;  4N4W A;  5L0I A;  1CI8 A;  2Y4A A;  3MZF A;  2GJ3 A;  3OWT A;  2HDR A;  1UWN X;  4M63 A;  1Z09 A;  1K55 A;  3KO6 A;  4Q5S F;  4X53 A;  5CXW A;  4N6C A;  3UO9 A;  5FI2 A;  3TE8 A;  3JYY A;  4IWB A;  3UMH A;  1D1B A;  4HBU A;  3V5M A;  5DJT A;  4O7D A;  3NC8 A;  3PR6 A;  1JPN A;  4MVR A;  5CEB A;  3FYZ A;  4BD1 A;  3G4X A;  5DKL A;  4EBJ A;  1G8X A;  2R02 A;  3LGO A;  5J3W A;  2LSE A;  5IT5 A;  3LCE A;  3LUQ A;  4QD4 A;  2A24 B;  4XXR A;  4ZRR A;  1YDI A;  3C7J A;  5FAP A;  4CPK A;  4L9G A;  3RIP A;  2KQ9 A;  2OEX A;  4FD8 A;  3GDI A;  4H6J A;  3VSL A;  2PBD P;  2UWX A;  5KYY A;  4U5G A;  2L6H A;  3F1N A;  5EK0 A;  3K66 A;  5DVA A;  1LSW A;  4B4X A;  1W2W A;  5EM0 A;  4HBT A;  1LKX A;  3DJN B;  1K56 D;  1LL5 A;  3N6I A;  3PHY A;  3IX8 A;  2C03 A;  4U0T A;  4Y0U A;  5BUO A;  1XZP A;  3T4K A;  1MMA A;  3EH2 A;  4LRX C;  1ES4 A;  2WKI A;  1PFL A;  1Z6F A;  3B0U X;  3NOP C;  2GZA A;  3UDI A;  2XLO A;  1F2K A;  2XLD A;  3G2Z A;  5HL1 A;  3KX0 X;  1IW7 F;  3TOL A;  1W79 A;  4MCW A;  1G5U A;  3AGD A;  1IKI A;  1KNY A;  3R2P A;  4XTK A;  1XJ4 A;  2VEA A;  2W27 A;  2CC1 A;  3E2L A;  4MTG A;  2E8J A;  3PDM P;  4S2N C;  2NUP B;  2VGL M;  4C3B A;  1QZX A;  3ZG9 B;  3A3D A;  1LT0 A;  4YT2 A;  1FNT c;  5EHH A;  2XA7 M;  3T12 B;  5CHJ A;  3HLW A;  3VOL A;  5HAQ A;  5HWT A;  4G3K A;  2X0C A;  1V9Y A;  4Q0I A;  1LI7 A;  2IBF A;  1OR2 A;  4GYT A;  3HLE A;  1HMO A;  4IAR A;  4E18 A;  3ZGA B;  4HH2 A;  2ZM0 A;  1MZU A;  1NLX A;  2XLH A;  1HE9 A;  4JUR I;  1FMW A;  2XK1 A;  3W8H A;  3S9O A;  1T9K A;  1NBB A;  1FR0 A;  3T4S A;  1TFO B;  2WVN A;  3VMA A;  3H2U A;  4BMW A;  3IQC A;  2VLG A;  1NSG B;  5L0D A;  1T1B A;  5CER A;  4S2I A;  2YLG A;  4OPR A;  2W3G A;  3LI8 A;  5FA7 A;  4B9O A;  4K0X A;  3WRT A;  1CI9 A;  3GSG A;  4KBL A;  2RCX A;  2J45 A;  2YKZ A;  2D4U A;  1CJF A;  2KLI A;  4IUK A;  3TOI A;  2WAE A;  3QW1 A;  3QP6 A;  3NRH A;  3DWZ A;  3GOD A;  3C18 A;  5KYX B;  4DDS A;  2Z2M B;  3LO7 A;  3N8S A;  1ZHH B;  3IF6 A;  3EQL F;  4ESP A;  2O0Y A;  3LUT B;  1MPL A;  2ICW G;  1D7E A;  1JWV A;  4ZJ2 A;  1Z3I X;  3LES A;  1ZU4 A;  3Q81 A;  1DJB A;  2Z2L B;  1JWP A;  2I8B A;  4YJW A;  4DJ2 A;  4EES A;  3T4R A;  4JCH A;  2YKF A;  5E2G A;  1WN0 A;  2Y2J A;  4KEN B;  2VC9 A;  5TBM A;  3VP2 A;  3LNR A;  4J7T A;  1QME A;  3SXM A;  4JW1 A;  4BJP A;  3A3I A;  3G34 A;  4DN0 A;  1K05 A;  2Y3B A;  3JYI A;  4QY6 A;  1BUE A;  1XJ2 A;  3DI5 A;  3GM3 A;  4PK4 A;  4EEP A;  4LDR A;  3EZI A;  3OEO A;  2VH3 A;  3AGE A;  3O10 A;  2ZLY A;  3S22 A;  1AUE A;  3VP4 A;  4OIO F;  2ZL1 A;  3BRM A;  4BPM A;  4Y7P A;  2W1T B;  1LM3 B;  2YVK A;  3EJN A;  5HD3 A;  1FFH A;  4AL1 A;  3SYN A;  4EBP A;  4K1O A;  1Z63 A;  2XD5 A;  4JF5 A;  5DTS A;  3NMJ A;  2HV7 A;  2H8A A;  1T18 A;  2VK3 A;  4N1H A;  2DYS C;  3B3X A;  3ZYT A;  1YAX A;  4QB8 A;  5KYW A;  2CW0 F;  3DTE A;  1MBL A;  4OOL A;  4Y3I A;  5DS5 A;  4JXW A;  2CCY A;  5COF A;  1KVM A;  2WGW B;  2EWV A;  3KL4 A;  5TR7 A;  3C62 A;  3CPT B;  2QUP A;  3MXS A;  3C8G A;  2J9B A;  1TS8 A;  3I4U A;  1BSG A;  2KC3 A;  1ST6 A;  3UNW A;  3CUE C;  3MFN A;  3JRM O;  1IEM A;  4LLC A;  3EFO A;  1YZA A;  2G3V A;  3VYW A;  5M19 A;  3H65 A;  2OEV A;  3ZG1 A;  4ARZ A;  2QZ6 A;  1MXO A;  1LS1 A;  1FCO A;  3Q7G A;  1YLZ A;  3SS4 A;  4Y15 A;  3FV7 A;  1F9I A;  5FQK A;  3AQC A;  2EA9 A;  3SS3 A;  4EV4 A;  2BC5 A;  4OIQ F;  3H7W B;  5A69 A;  1C17 M;  2JCH A;  2Y39 A;  3GAN A;  4WUJ A;  3VV4 A;  3QP8 A;  2X02 A;  4OD4 A;  1FR6 A;  4R1G A;  2J7P A;  1SZI A;  3B33 A;  5CTN A;  4GD8 A;  3CZD A;  2LP4 A;  1FCM A;  4P6B A;  4WEL A;  3EGD A;  3PBR A;  3UR3 C;  4E3N A;  3V3S A;  2AVK A;  4QU3 A;  2YL7 A;  2EPM X;  1LI5 A;  3LY4 A;  3QVY A;  2IM8 A;  2PR5 A;  4YN0 B;  4MVQ A;  3ULF A;  1RMV A;  2A1D D;  2Y2I A;  4F94 A;  4JKV A;  4BJ5 C;  2Y59 A;  4ZLC A;  3V67 A;  1O7E A;  4B93 A;  4DF6 A;  1FFT C;  2NSG A;  3JVU A;  1T5O A;  3LFV A;  2VGJ A;  4CLC C;  3FPW A;  3VOY A;  4IVI A;  3TJ5 A;  4FCF A;  3ITF A;  1K6R A;  3C7V A;  1MWR A;  1LL9 A;  2ETS A;  4PM5 A;  2JX0 A;  5HW3 A;  3FDQ A;  3LR0 A;  4JRZ A;  4PJN A;  4MMN A;  2ZD9 A;  3LLK A;  4M4X A;  5L0F A;  4JTC B;  3G30 A;  1ZVZ A;  1WYB A;  1P9R A;  3B71 A;  4OQH A;  1HVB A;  4JEB A;  2Y69 C;  1C3B A;  5A93 A;  1OTB A;  4DE2 A;  2ZQ8 A;  3KSF A;  1OW8 A;  1XZQ A;  4X55 A;  3RF3 A;  2B0H A;  2HZ5 A;  1YZC A;  1YKD A;  2H28 A;  3T50 A;  3KH2 A;  3S29 A;  4I3J A;  3DZA A;  4CSA C;  2B5R A;  4MEZ A;  4WEJ A;  4EXO A;  1K57 C;  3F1O B;  3QP4 A;  1HD8 A;  4N92 A;  2WZF A;  4RDA A;  2VJW A;  3BW6 A;  3NDG A;  2XM4 A;  1U60 A;  1W8Y A;  1YSQ A;  1ACF A;  1NWZ A;  2HJM A;  3GEC A;  4XUZ A;  4CS9 A;  3VP3 A;  2EPO A;  2ZC5 B;  2V26 A;  1FMV A;  2H7V C;  1XPB A;  2EX9 A;  3CZ6 A;  3L9K A;  2DMW A;  2W3F A;  5U47 A;  2A6E F;  3M4B A;  1LLB A;  2P9V B;  3UB8 A;  2XXA B;  1NZO A;  1CPR A;  1Q0D A;  1YJG A;  2KOI A;  4I3I A;  3U8P A;  4Q0J A;  4CQH A;  5TFQ A;  1PWD A;  3UB9 A;  1ZHZ A;  2DRW A;  3MFD A;  1T6U A;  4GNU A;  1CEG A;  5HWW A;  3R7W B;  5HX9 A;  5J7E A;  1HW1 A;  1KGG A;  5KIZ A;  3D3O A;  3FPV A;  3HTK C;  3W2Z A;  2OG2 A;  5JLI A;  3NHQ A;  4B88 A;  2QWS A;  2ZXO A;  5L0J A;  5AQ9 A;  3T6B A;  4PM7 A;  3ECS A;  4YOF A;  1K38 A;  3C38 A;  3UE1 A;  4C3Q A;  3ASO C;  2PT7 A;  4WLA A;  4ONS A;  1LI0 A;  4Y2F A;  3GQZ A;  1SR2 A;  3QW0 A;  2XGN A;  2OWJ A;  2J9W A;  4ZBE A;  3U5S A;  1SF8 A;  1YLM A;  2R7S A;  1DRM A;  3LEZ A;  3EHM A;  3GEI A;  2ZQA A;  5EOO A;  3BY8 A;  1IFQ A;  1WA9 A;  2O9B A;  3VP1 A;  5CED A;  1P97 A;  1ODV A;  4XEK A;  3IH9 A;  3OPP A;  1FOF A;  2OAQ 1;  1IOU A;  3KYI A;  2KYH A;  1KDS A;  4DXC A;  3K1I A;  5AVF A;  4MN6 A;  1MQV A;  5DFY A;  2EIM C;  1EI7 A;  2TMV P;  2HJE A;  2AWY A;  2PR6 A;  5DQZ A;  3NYJ A;  1ZKJ A;  3RQG A;  2D01 A;  3NKE A;  3KKB A;  4RD9 A;  4LRY C;  3LIF A;  1RGY A;  4OVD A;  1D0Y A;  3BFD A;  5F28 E;  1D1A A;  2CYD A;  3HKK A;  3K3D A;  1ORJ A;  2A2L A;  3FC7 A;  2J0W A;  2V3C C;  2WB7 A;  1J3W A;  4MNR A;  5D92 A;  3NOU C;  3IQT A;  2HPB A;  3T4L A;  4OP8 A;  3PBS A;  1PCX A;  1H0M A;  2R7U A;  4ANJ A;  5EVI B;  5EOE A;  4O6N A;  5T3T A;  2B95 A;  4WN5 A;  2BLS A;  3CMZ A;  4ULV A;  1OTI A;  4E0I A;  5CHM A;  2LB9 A;  3TJZ C;  4BG0 A;  1V74 B;  2HP5 A;  3L7H A;  4X0R A;  1BLH A;  1G5Z A;  2IXN A;  3C30 A;  4EET B;  3SS5 A;  4DRT A;  3L1M A;  2WZZ A;  1E3U A;  3JZ0 A;  2R25 A;  3AG3 C;  3ZVR A;  4Q4Z F;  4KZ3 A;  4GQH A;  4U5E E;  5TGF A;  1NFN A;  1WWP A;  5CIV A;  5CEC A;  3LR4 A;  3RTY A;  3RXW A;  2XL6 A;  1WOL A;  4GZB A;  5LBR A;  3HJK A;  5HAR A;  1A41 A;  4UQI M;  3U2L A;  3Q7V B;  5GL9 A;  2IXM A;  2Q00 A;  4Q8I A;  1EA8 A;  2I15 A;  4IAQ A;  3B47 A;  4IBR A;  2Y2K A;  4CSA A;  3PXP A;  3LS1 A;  2ASR A;  3QP1 A;  3V39 A;  1K57 A;  5DJU A;  4MDZ A;  4CLC E;  1Q0M A;  4BJ1 A;  4BQM A;  5E33 A;  4MS2 A;  3PCV A;  2K2N A;  1GHI A;  3OOV A;  4JLF A;  2QJ7 A;  1VM1 A;  4F3L B;  4EUK B;  4HJ3 A;  3QMK A;  4JGO A;  3HUM A;  5FAQ A;  3C8G D;  2WAD A;  2OOC A;  4X56 A;  3IHA A;  2ZOI A;  1GQA A;  2JHE A;  4KNV A;  4AL0 A;  1OTE A;  1LS4 A;  1TWC A;  1T6Q A;  2H5S A;  4A2N B;  2X51 A;  1K54 C;  5IHV A;  2NUT A;  1JWZ A;  5DLJ A;  2IWB A;  4LV0 A;  4I44 A;  1I5N A;  4B6I A;  2C04 A;  3UY6 A;  1LVK A;  4KC9 A;  2J7P D;  3UPN A;  5F1G A;  2G7U A;  5HD5 A;  2GX5 A;  2EPN A;  3SNH A;  1YVI A;  5B1A C;  1E25 A;  2HP9 A;  4AE4 B;  3MSH A;  1DP9 A;  3A9C A;  2KX6 A;  4ME4 A;  4OIR F;  4CJN A;  5JRA A;  1EQ1 A;  4CJO A;  2QLA A;  1Q0K A;  4BL2 A;  4YT5 A;  5AQ7 A;  1BT5 A;  1PW1 A;  1XJ6 A;  2HMZ A;  4DMZ A;  1YM1 A;  2H7B A;  3DMD A;  3NI9 A;  2AU5 A;  2L4R A;  4G78 A;  3IBR A;  2GA0 A;  3V7O A;  2EX8 A;  1U89 A;  1BDJ B;  1VB6 A;  4C3D A;  3ZG0 A;  2P0N A;  3QNB A;  3AG2 C;  2YL1 A;  1OT9 A;  1UWP X;  2Y2Q A;  1RJ9 A;  3EGX A;  3NBL A;  3R7C A;  4XT2 A;  2ZXP A;  1V4A A;  2YQY A;  2O9A A;  2QE9 A;  4NY3 A;  4GD6 A;  4OON A;  1H9G A;  2XSE A;  2M7V A;  3MX3 A;  2WUQ A;  4JXG A;  3D72 A;  5JVE A;  3V5Y A;  5EPH A;  2V20 A;  2F22 A;  3HUO A;  3GMW A;  4XEF A;  2ZD8 A;  2JE5 A;  4HOI A;  3K33 A;  3QTH A;  5T3W A;  1QPU A;  3VE3 A;  5L09 A;  3G4Z A;  2HKV A;  1SDN A;  5HV9 A;  3HLB A;  3L0I A;  4NTB A;  1TFK B;  2JKT I;  4NEE D;  1QMF A;  2W0N A;  2ZOH A;  4NXG A;  3ITB A;  2NUP C;  1VMA A;  3DE9 A;  2PU4 A;  1F98 A;  3RFY A;  4RX2 A;  1OW6 A;  4DRJ B;  3S1Y A;  4E04 A;  2BAS A;  1TDG A;  2V8C A;  4IUH A;  2L7A A;  5FCL A;  1A7D A;  2ZMV A;  3QVZ A;  3WWX A;  3FZC A;  3H82 A;  3KSG A;  4EBK A;  3ABL C;  3HRE A;  2V8F A;  2VV6 A;  2WGV A;  4GLQ A;  1JMW A;  1HZO A;  1NFO A;  2BG1 A;  2J9U A;  1M2V A;  4CDV A;  3CQZ A;  1S66 L;  2XLV A;  3OC2 A;  5EEC A;  3HVF A;  3TRC A;  4MBK A;  5G4Y A;  4NCQ A;  1KDW A;  4R3A A;  2O9X A;  2JKR M;  2XRH A;  3L8J A;  3WHN A;  2PFD A;  4J32 B;  2EFU A;  2QHK A;  3ZFZ A;  4D4N A;  3MQ0 A;  4YT4 A;  1VET A;  5B1B C;  2GWW A;  2YRF A;  1OW7 A;  3GM2 A;  4DVZ A;  2A3U A;  2LK4 A;  3CJM A;  4PFP A;  4I1M A;  2A0U A;  1ZZP A;  4JIO A;  5IY5 C;  2XL4 A;  4EBN A;  1GS9 A;  4P6Z S;  4Y0T A;  1K54 A;  2DGJ A;  3FG8 A;  4R3B A;  1J9M A;  4WGY A;  1TWG A;  1MWT A;  4WAB A;  1J8Y F;  3DWK A;  4EUZ A;  4JXS A;  3BFE A;  1LSX A;  1I5Q A;  3M2K A;  2IOQ A;  1ZHW A;  3NMI A;  5KYN A;  4H6J B;  1Z7Q c;  2GAQ A;  5L3Q A;  2Q9M A;  4UQI S;  1HE1 A;  4DXW A;  2ZC3 B;  4LCM A;  1XP4 A;  5KYY B;  3F1N B;  3MYF A;  3SXZ A;  1DJC A;  1BBH A;  3O3V A;  4J30 B;  2Y2G A;  3LIC A;  1ZG4 A;  5DF9 A;  3JVV A;  3RQF A;  1BZA A;  5HZH A;  3AGF A;  5A6B A;  2HV6 A;  3F1P A;  4MW3 A;  3ZTZ A;  4Z9Q A;  4L9E A;  2ZXR A;  2VCB A;  2W3H A;  5DF7 A;  4OOY A;  1VEU B;  1OCO C;  5TJ5 E;  3KPH A;  2QMI A;  3K6B A;  1VYI A;  3ICY A;  4IAO A;  5FDH A;  1R4T A;  2VB6 A;  1DOW A;  5JS5 A;  3M15 A;  2GFH A;  3BEB A;  5F82 A;  2ZC6 B;  2R7V A;  2R7T A;  1D1J A;  4OPQ A;  4OLG A;  1AVO B;  1TS7 A;  2EPK X;  2XF3 A;  4U9E A;  4GDB A;  1E3U D;  4MVZ A;  2VZW A;  2QNL A;  4NKP A;  1MMN A;  3DAF A;  3KYE A;  4E3L A;  4O7G A;  3N2Z B;  1SKO A;  4IBX A;  5CGX A;  3LEO A;  5DF8 A;  4HEA J;  1YLJ A;  3V5Z A;  1BUL A;  2J3W A;  4LCL A;  3VF0 A;  4DDY A;  2B18 A;  4OP5 A;  3G2Y A;  1MNE A;  3SXK A;  3SW1 A;  4NTA A;  1FCN A;  2G2U A;  4EEU A;  2J9V A;  3RW0 A;  1I2W A;  5G4Z A;  5J8X A;  3SP1 A;  4QWO A;  2IYL D;  2OJQ A;  2PRF A;  2EX2 A;  3QP5 A;  5EE8 A;  3UE3 A;  2NUP A;  3A11 A;  1L0G A;  1XWJ A;  3HNL A;  3B0V C;  2PD8 A;  4RYE A;  3NEC A;  2XLN A;  3I5P A;  4FH4 A;  4OH0 A;  3W8I A;  5GHZ A;  1JNU A;  3IF6 B;  4CS8 C;  5GPG B;  1OCR C;  3IXD A;  3ZC4 A;  1FR1 A;  4YL1 A;  3IHB A;  1QLE C;  3PBT A;  4WZ5 C;  2E87 A;  2PBY A;  2E8I A;  4RVA A;  2L9J A;  3ABM C;  2KJG A;  2J7V A;  3S7O A;  1ZC2 A;  2EFX A;  3UB6 A;  2PP4 A;  2OU6 A;  4NC3 A;  2Y2L A;  3LR3 A;  2NSF A;  2XR0 A;  1S1Z A;  3E4Q A;  4NG2 A;  5KYX A;  2MJ6 A;  3ZG8 B;  3HJC A;  3LAY A;  3R4K A;  4W8K A;  2QKP A;  4XWJ A;  1TF1 A;  2ZQ7 A;  2UUH A;  3DTI A;  3JSZ A;  4PAC A;  4U5B E;  4O6M A;  2J3T D;  2W4M A;  1Y54 A;  2HMQ A;  1G4U S;  1N9B A;  4LV2 A;  4FTX A;  5IS1 A;  1RKC A;  3GWN A;  5DTK A;  5HDC A;  1MWU A;  2XLM A;  1CPQ A;  4HY8 A;  4IJJ A;  1U6H A;  3KYJ A;  3LEV A;  1EW0 A;  3T4Q A;  4UA9 A;  3NIA A;  4HJ6 A;  5KYW B;  3T1R A;  4CJG A;  5L0C A;  2EXA A;  3ZIB A;  5DKK A;  4HE8 D;  1GA0 A;  4DRI B;  4MN5 A;  5CX7 A;  3IPM O;  2Q9B A;  4U3T A;  1ZHT A;  4BWI A;  4IVK A;  4WM9 A;  2A49 A;  4YWZ A;  5MC7 A;  1JPJ A;  4X68 A;  3C8G B;  4X69 A;  3WS0 A;  4Y0O A;  3VM6 A;  3UMK A;  3UMD A;  2PYR A;  3RJU A;  4CIH A;  4G3W A;  4GHI A;  5KSC A;  1M57 C;  4ARZ B;  4X1M A;  3ZTM A;  4K7B A;  1MND A;  3FMS A;  4LV3 A;  2Z6D A;  3OA1 A;  2V1B A;  3SOI A;  4XPW A;  3EG9 A;  4DVY P;  3A3E A;  4YWQ A;  2MHR A;  1XFN A;  2JKG A;  4WYY A;  3T4J A;  2WGW A;  3P01 A;  1T01 A;  2JBF A;  3EGD B;  4S2N A;  4DRH B;  3EQV A;  2B0J A;  2OWH A;  4MTO A;  4BJT A;  2H10 A;  3BY9 A;  1FSW A;  4OLD A;  4OKP A;  4UEY A;  4XLP F;  1BLC A;  4N1X A;  1ES5 A;  5EM1 A;  3DAG A;  4H8R A;  3MJQ A;  1CEF A;  5L0G A;  3C7U A;  4RBN A;  5GLD A;  4U5F E;  4ZLD A;  3H7W A;  5COM A;  1RKE B;  3EEH A;  1WTY A;  3K2N A;  3V5X A;  3S90 A;  3A0V A;  3AGU A;  4PM9 A;  1IZM A;  2Q9N A;  5COG A;  2JD3 A;  3S27 A;  4ETX A;  4EWF A;  4G3V A;  4E3O A;  2L0W A;  3KYZ A;  1MMD A;  5GLA A;  2R9X A;  3SH7 A;  2I72 A;  4JGP A;  4ETZ A;  3E70 C;  5D91 A;  4U9D A;  2HUJ A;  2EIJ C;  3C8Z A;  5F5H A;  3PBN A;  4CS8 A;  3BFC A;  4E6W A;  1DJA A;  3DM5 A;  2HDU A;  4S2M A;  4FES A;  2A6H F;  4WZ5 A;  2EXB A;  3NUL A;  3MKE A;  1FSY A;  1JVJ A;  5EVI C;  4LAC B;  3DM9 B;  3C63 A;  1PRQ A;  2VCA A;  2PF4 E;  2VGL S;  1NZU A;  4K0W A;  2KGO A;  1W63 M;  2VGK A;  3HLZ A;  2R03 A;  2XA7 S;  3O87 A;  2IWC A;  1HLU P;  3U2A A;  1N9N A;  4NXF A;  1XKZ A;  3OPR A;  2DI3 A;  2UUI A;  1GSV A;  3UB7 A;  2WKQ A;  2JKT M;  2LFF A;  1W63 Q;  1KVL A;  3MXR A;  3IHU A;  3NYL A;  3VAY A;  4PMA A;  4OD5 A;  2PX3 A;  3WOD F;  2JPU A;  1NJ4 A;  3T4O A;  3T6J A;  2ZMA A;  4XEV A;  4PJM A;  1H6G A;  3IXB A;  2WZL A;  1NU7 D;  3WS1 A;  1OTD A;  2YEV A;  5F1F A;  5A6B D;  2Y2N A;  1T1A A;  3PAG A;  1YPR A;  3ZNY A;  5DS6 A;  1WAT A;  4IRU A;  1FIL A;  3Q1F A;  4OQI A;  1PYY A;  2Q4F A;  3B29 A;  2C5W B;  3HLF A;  3U4L P;  2IA2 A;  3O39 A;  2CGE A;  2CNW A;  2LFD A;  4JC7 A;  1XXM A;  5K5B A;  4JKT A;  1YLP A;  4KZ7 A;  2Y3D A;  3IXH A;  4H4K C;  4G0H A;  5CGS A;  3AOU A;  4BLM A;  3HLG A;  3DWW A;  2Y3H A;  3K1H A;  3EEA A;  4ZTK A;  3BLM A;  1S4S A;  3MMH A;  4KZ4 A;  2LB5 A;  2P9V A;  4ZAM A;  4D2O A;  1VQQ A;  3CUE A;  4C3E A;  3LY3 A;  2AWC A;  4MTF A;  2RL3 A;  4W8P A;  2VX8 A;  3T1X A;  4LRZ E;  3R7W A;  2V1A A;  3RH8 B;  1DOV A;  3HNI A;  1E83 A;  4M3K A;  3U9M A;  1Q2Q A;  3B9Q A;  1K40 A;  1SHV A;  2EIN C;  5HDS A;  5AC4 A;  2IXO A;  1WAS A;  1Y6D A;  1YYJ A;  3O88 A;  3SZR A;  1OPX A;  1TDL A;  3OLO A;  2R05 A;  1L0E A;  2UV0 E;  2YZS A;  2RD9 A;  4O0P A;  3TSG A;  2GDC A;  2J80 A;  4EW7 A;  1QQ3 A;  3VFH A;  3O86 A;  3IWQ A;  5FI7 A;  4P6I C;  2INW A;  4EWC A;  2YL3 A;  1S0W A;  4OQ0 A;  2VV7 A;  2KSF A;  3J06 A;  4BEN A;  5HDD A;  1K6S A;  2JC7 A;  3BFF A;  3BYD A;  3UDX A;  4MVU A;  4PM6 A;  3UE6 A;  3UGO A;  2YHS A;  3AQB A;  2WZX A;  4EQI A;  2J0X A;  2EWW A;  2HDQ A;  4HQA A;  3BLS A;  5KYU B;  4BJ5 A;  5AGF A;  5E2H A;  4KZB A;  1YLY A;  4JF6 A;  1TWH A;  2OLV A;  5GHX A;  4CLC A;  3K7D A;  1D1C A;  5CRF A;  2FH5 A;  4NET A;  4DE0 A;  2MWQ A;  3C5A A;  2XRO A;  3A3F A;  4PHT A;  2HGV A;  3G35 A;  3N7W A;  4UA7 A;  5F5Y A;  5A6A A;  1RXQ A;  4UDV A;  2PD7 A;  2FFH A;  1EWZ A;  1J8M F;  1L0D A;  1XA1 A;  1ZG6 A;  1WGW A;  4WMC A;  3IQA A;  2Q0O A;  1O87 A;  1X0O A;  3Q07 A;  4LDK A;  4HI4 A;  1BR2 A;  4E17 A;  4H54 A;  1H5X A;  4YIN A;  2WYX A;  5FEG A;  2HZ8 A;  1OR3 A;  3EPV A;  1L0F A;  1TD5 A;  1APC A;  1D0X A;  2CDQ A;  4HP4 A;  4JGR A;  3NKD A;  1K25 A;  5EVI A;  2XS8 A;  4L9F A;  5JYP A;  2RSE B;  4DOZ A;  3S0X A;  2W3E A; 
#chains in the Genus database with same CATH homology
 5IU1 A;  3LIA A;  4HP9 A;  2VV6 A;  4GLQ A;  1ZHH B;  1T1C A;  2O0Y A;  3S7N A;  1S66 L;  3EQU A;  1F5M A;  1D7E A;  4HJ4 A;  4WF0 A;  1YSP A;  1NRJ A;  3OC2 A;  3TRC A;  4BBT A;  5G4Y A;  3MQO A;  4DJ2 A;  4R3A A;  2JKR M;  3CAX A;  3C2W A;  4EES A;  2YKH A;  2YKF A;  5F68 A;  2QHK A;  3LIE A;  3MQ0 A;  5TBM A;  3CI6 A;  3BQA A;  4BJP A;  1H8M A;  4I5S A;  4DN0 A;  4GS9 B;  1XJ2 A;  4EEP A;  2V9A A;  3F1O A;  4P6Z S;  1NLY A;  3FG8 A;  3IBJ A;  2QJ5 A;  2W1T B;  1GSX A;  1LSX A;  5HD3 A;  4H6J B;  4R6L A;  4UQI S;  1T18 A;  3MF0 A;  4HIA A;  2OOL A;  3F1N B;  4PKY G;  3ZYT A;  1YAX A;  1S67 L;  4OOL A;  4Y3I A;  3NOT C;  3IS2 B;  1OJG A;  2NUT C;  5HSQ A;  2EWV A;  3LIC A;  3TW8 A;  5DF9 A;  3JVV A;  4NXB A;  5HZH A;  3F1P A;  2HJ9 C;  3KSI A;  1TS8 A;  4IHQ A;  4WL9 A;  1XFQ A;  4OOM A;  3CUE C;  4L9E A;  3E4O A;  2W3H A;  3S7Q A;  4ARZ A;  3ICY A;  2R78 A;  1F9I A;  2J3T C;  4HH3 A;  4BBU A;  1N9O A;  2V0U A;  3MFX A;  2EA9 A;  4Y5F A;  3H7W B;  2Y79 A;  4WUJ A;  3VV4 A;  2HV1 A;  4I39 A;  2OAP 1;  1TS7 A;  2CMN A;  4XT2 B;  3B33 A;  2XRN A;  5DFX A;  2VZW A;  3CWF A;  4CLC B;  4NKP A;  4WEL A;  3LR5 A;  1BYW A;  2KDK A;  3PBR A;  3A0R A;  4EUV A;  3V5Z A;  2J3W A;  4EER A;  2WKP A;  2B18 A;  2ZMF A;  3SW1 A;  2PR5 A;  3ULF A;  4EEU A;  2M7U A;  5G4Z A;  3V67 A;  3BWL A;  4B93 A;  4KUO A;  3EGX C;  3S7P A;  3UE3 A;  3JVU A;  1XJ3 A;  3LFV A;  4CLC C;  3FPW A;  2K31 A;  2PD8 A;  3LR0 A;  5HPF A;  4GW9 A;  3MR0 A;  4MMN A;  1JNU A;  4M4X A;  4P6Z M;  4KUK A;  4YNR A;  1P9R A;  3EOI A;  3PBT A;  1Y28 A;  5L8M A;  4DJ3 A;  1OTB A;  2O99 A;  3BJN A;  3CLO A;  4O8G A;  3VE4 A;  3DBA A;  3KSF A;  3S7O A;  3UB6 A;  1S4R A;  1YKD A;  2H28 A;  3LR3 A;  5HPI A;  3T50 A;  1S1Z A;  3MXQ A;  2O9C A;  4HNB A;  4KQD A;  3E4Q A;  2M1C A;  4I3J A;  4K08 A;  2MJ6 A;  5C5K A;  4WEJ A;  3CIT A;  3R4K A;  2QKP A;  4EXO A;  3F1O B;  1TF1 A;  3NJA A;  1STZ A;  2GNX A;  3BW6 A;  2VJW A;  3RFB A;  1YSQ A;  2W3D A;  1LSV A;  1NWZ A;  4PAU A;  3GEC A;  4IJG A;  4Q0H A;  2J3T D;  1OTA A;  2PDR A;  2DMW A;  2W3F A;  2VA0 A;  5IS1 A;  4Z1W A;  5HDC A;  1OJ5 A;  1MC0 A;  3UB8 A;  4F3L A;  4BBV A;  2KOI A;  4HY8 A;  4I3I A;  4Q0J A;  4CQH A;  4L0L A;  3UB9 A;  1EW0 A;  4O01 A;  3T4Q A;  4HJ6 A;  5HWW A;  3R7W B;  2I9V A;  5DKK A;  2XSS A;  1OT6 A;  5J7E A;  4GS9 A;  4MN5 A;  5KIZ A;  3D3O A;  3FPV A;  5CX7 A;  5FL3 A;  5A8B A;  3W2Z A;  4BWI A;  3NHQ A;  4WEK A;  2QWS A;  1H3Q A;  4YWZ A;  5MC7 A;  3BQ8 A;  2V0W A;  4YOF A;  3C38 A;  5J4E A;  3F1P B;  2W1R A;  3UMD A;  1UGU A;  2PYR A;  1G28 A;  2B02 A;  3OCN A;  2PHY A;  2PT7 A;  4WLA A;  4EQ1 A;  2A24 A;  4R70 A;  4G3W A;  4GHI A;  4Y2F A;  4ARZ B;  2OWJ A;  5HWV A;  4CLC D;  1DRM A;  2Z6D A;  2V1B A;  3LYX A;  3BY8 A;  2D02 A;  1IFQ A;  1WA9 A;  2O9B A;  5F6A A;  4KQO A;  3E98 A;  3IS2 A;  1XFN A;  2FZ0 A;  1P97 A;  3A0S A;  3T4J A;  4JGQ A;  1ODV A;  3P01 A;  2OAQ 1;  1IOU A;  1P0Z A;  4RQ9 A;  5AVF A;  4MN6 A;  3EQV A;  5DFY A;  2P04 A;  1MKM A;  3UME A;  2HJE A;  5AVE A;  2PR6 A;  2OWH A;  5HL6 A;  3BY9 A;  1ZTU A;  2D01 A;  3PBO A;  4NXE A;  4UEY A;  4LRY C;  3LIF A;  2K7S A;  3MJQ A;  3K3D A;  4EU0 A;  3H9W A;  2P7J A;  4LLO B;  2A2L A;  3FC7 A;  3H7W A;  4MN7 A;  3EEH A;  3K2N A;  3E4P A;  3V5X A;  2L1M A;  3G6O A;  3A0V A;  5F69 A;  3NOU C;  3T4L A;  3EGD C;  3K3C A;  3PBS A;  4HHD A;  4ETX A;  2JN7 A;  4WN5 A;  4G3V A;  2L0W A;  1N9L A;  1OTI A;  3KYZ A;  1TS6 A;  2HF6 A;  2LB9 A;  3H82 B;  3TJZ C;  4JGP A;  4R38 A;  4ETZ A;  1T19 A;  2VV8 A;  3C30 A;  4EET B;  3LIB A;  4FOF A;  3PBN A;  1S1Y A;  4I38 A;  1LL8 A;  3LR4 A;  3RTY A;  1D06 A;  3T4T A;  3LI9 A;  3P7N A;  5LBR A;  4QPR A;  3ZQ5 A;  3HJK A;  5AJG A;  2Y8H A;  4UQI M;  2VGL S;  5TBM B;  1GSW A;  1V9Z A;  1W63 M;  1DP8 A;  2XA7 S;  3U2A A;  1N9N A;  4NXF A;  3B47 A;  4LPZ A;  3PXP A;  1GSV A;  3UB7 A;  2WKQ A;  2JKT M;  5DJU A;  1W63 Q;  2ZBB A;  4MDZ A;  4CLC E;  4GJ4 A;  2QYB A;  3HJI A;  2K2N A;  3OOV A;  5EFW A;  2GJ3 A;  2QJ7 A;  3T4O A;  4F3L B;  1UWN X;  4HJ3 A;  3O5Y A;  1OTD A;  3KO6 A;  4JGO A;  1T1A A;  3TE8 A;  1DP6 A;  2ZOI A;  2JHE A;  2P08 A;  2IA2 A;  1OTE A;  5DJT A;  4GCZ A;  5K5B A;  3PR6 A;  5DKL A;  5J3W A;  5IT5 A;  3LUQ A;  5I5L A;  2A24 B;  3E0Y A;  3EEA A;  4GHI B;  4ZRR A;  1S4S A;  2W1T A;  3C8C A;  3MMH A;  4AFI A;  2LB5 A;  2VKS A;  4L9G A;  3CUE A;  3GDI A;  4H6J A;  2G7U A;  5HD5 A;  2GX5 A;  2VX8 A;  1TS0 A;  4LRZ E;  3R7W A;  2V1A A;  3RH8 B;  3U9J A;  3F1N A;  3OBF A;  4ME4 A;  1DP9 A;  2KX6 A;  3U9M A;  1LSW A;  4FSF A;  2Z6C A;  5HDS A;  3OLO A;  1OPX A;  4II7 A;  3PHY A;  3OCL A;  3T4K A;  1P9W A;  1NLZ A;  1XJ6 A;  4LRX C;  4O0P A;  4DMZ A;  2J80 A;  4EW7 A;  3B42 A;  3NOP C;  2INW A;  2GZA A;  2VV7 A;  3KYQ A;  5HDD A;  3KX0 X;  3EWK A;  4I3A A;  4MCW A;  2L4R A;  3IBR A;  1G6O A;  3PBQ A;  1XJ4 A;  1VHM A;  2VEA A;  1VB6 A;  2W27 A;  3UE6 A;  2P0N A;  2EWW A;  3KSH A;  4HQA A;  2VGL M;  1OT9 A;  1UWP X;  2PYP A;  1LT0 A;  2WKR A;  4XT2 A;  2XA7 M;  2O9A A;  4CLC A;  3VOL A;  5HWT A;  4G3K A;  1V9Y A;  4Q0I A;  2M7V A;  3LID A;  2FH5 A;  3D72 A;  3V5Y A;  2XRO A;  4HH2 A;  1MZU A;  1KOU A;  4HOI A;  4PKY A;  4PHT A;  2HGV A;  5TJJ A;  5F5Y A;  2PD7 A;  3VE3 A;  3T4S A;  3PYP A;  4BMW A;  5KSH A;  1X0O A;  2JKT I;  4HI4 A;  4NEE D;  2VLG A;  2W0N A;  1T1B A;  2ZOH A;  4NXG A;  2NUP C;  3HCY A;  1F98 A;  2W3G A;  3LI8 A;  1TD5 A;  4B9O A;  4E04 A;  4HP4 A;  2BAS A;  4JGR A;  4IUH A;  4L9F A;  2JKR I;  4IUK A;  2KLI A;  2W3E A;  2ZMV A;  3MQQ A;  3H82 A;  3KSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...