3CAXA

Crystal structure of uncharacterized protein pf0695
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
355
structure length
355
Chain Sequence
b'LPEGHPLKTLYQENKEIMKDAEMLNLYAKTLATTKDERMREEILGVLEEIVSSLRMVGFTHYNREEMLIFPYIERRGLTVIATVLWTKHDEIRAMIKQLAELLRKREEMPWEEFVEKFKAKAGEVAFALSDMVFRENNIFYPTLKALLSEGEWKAIKMQEDEIGYYKVKPPEWDPGEDVKPLHPWEINPELNVEQLLTLPKEVQQALRGQPLEFDKTQLKREEDIDLGTGYLNIEELKAIFEALPVDVTFIDKDDRVRFFSPGERIFTRTPSVLGRPVQLCHPPKSVYVVNKILKAFKEGRKKEATFWLRLREKYVYIKYVPLFNEKGEYIGTLEMTMDIAPYKKIEGEKRLLDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein PF0695
publication title Crystal structure of uncharacterized protein PF0695.
rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Structural genomics, unknown function
total genus 119
structure length 355
sequence length 355
ec nomenclature
pdb deposition date 2008-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
A PF13596 PAS_10 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3caxA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3caxA02
1OJGA 2VV7A 3CWFA 5HSQA 1G28A 1D7EA 4NXBA 3FC7A 3CLOA 5F68A 2W0NA 4DJ2A 5J3WA 3NHQA 4EQ1A 4KUOA 2V0UA 3UB8A 4HH3A 2QWSA 3HJIA 1TS6A 4HJ6A 1S1ZA 4EESA 3K3CA 4BBVA 1F9IA 3LIAA 4LRZE 3NJAA 4DJ3A 1N9OA 4JGOA 1V9YA 3BY8A 1XJ6A 5DJTA 4EERA 2A24A 1LT0A 3H82A 1DRMA 2JHEA 2M1CA 2V1AA 2PDRA 1DP9A 5F5YA 5A8BA 4NXEA 4R38A 3MQOA 4HJ4A 1OTIA 3F1NB 3E4OA 3P7NA 2VV8A 4MN5A 5I5LA 3NOTC 5AVFA 1DP6A 5HDDA 3BWLA 1T19A 3B33A 3IS2B 4I3JA 2KX6A 5F6AA 4EW7A 4E04A 2ZBBA 3F1PA 4PKYA 3H9WA 1GSWA 3GECA 4PKYG 4WN5A 2PD7A 2V1BA 2CMNA 5HWWA 4JGPA 4MN6A 4KQDA 4EETB 3D72A 4JGRA 4LRXC 3E4QA 3LI8A 4HNBA 1OTEA 3K3DA 2B02A 2P0NA 1UWNX 4GCZA 4HH2A 1DP8A 3LIEA 1P0ZA 3MXQA 2GJ3A 4HI4A 4YWZA 5TBMB 2ZOHA 3EEHA 5J4EA 2R78A 5J7EA 4GHIB 1S67L 5F69A 4EXOA 2INWA 4B9OA 4EEPA 5G4ZA 2PR6A 3V5ZA 5DJUA 3A0SA 2L0WA 3EWKA 1KOUA 2W27A 3VOLA 4K08A 1T18A 3RTYA 2WKQA 4HQAA 3NOPC 3KX0X 4WLAA 2L4RA 3PYPA 4NXFA 1GSXA 3F1NA 3UE6A 1GSVA 3LUQA 2K7SA 1LSVA 1S4SA 4WUJA 1T1AA 2V0WA 5HDSA 1S1YA 3HJKA 2WKPA 5AVEA 4HIAA 3A0VA 2OOLA 3IS2A 1D06A 1Y28A 5HDCA 4WF0A 2Z6CA 3C8CA 1XJ2A 4GS9A 3LI9A 4GS9B 2P7JA 4I3AA 3V5XA 1LSXA 3F1OB 5HD5A 1ODVA 2KDKA 2VV6A 3U9MA 5IS1A 2L1MA 3UB7A 3UMEA 1OT6A 4LPZA 3LYXA 3RH8B 3MFXA 1OT9A 4HP4A 4EEUA 2EA9A 2HV1A 1JNUA 1TS0A 1UWPX 3UMDA 4M4XA 1LSWA 2QJ5A 4L9EA 3A0RA 2PHYA 3ULFA 4F3LB 2H28A 5IU1A 2OWJA 4R6LA 3GDIA 4LLOB 1OTBA 3OLOA 5TBMA 3H7WB 4I38A 2QKPA 4I5SA 4GHIA 5EFWA 1VB6A 2PR5A 4I3IA 4L9GA 2V9AA 2ZOIA 4NXGA 3FG8A 4HOIA 2YKHA 2YKFA 3UB6A 4XT2A 4XT2B 3T50A 2OWHA 1XJ4A 1MZUA 4WL9A 4R3AA 2WKRA 3BY9A 1LL8A 5KIZA 3MQQA 3LIDA 5DKKA 3ICYA 3VE3A 1S4RA 3ZQ5A 1OJ5A 4HY8A 2D02A 4H6JA 1TS8A 1P97A 2Z6DA 4H6JB 1S66L 2A24B 2BASA 3H82B 3VE4A 4HJ3A 2PYPA 1NWZA 5HWVA 2PYRA 1BYWA 3SW1A 3NOUC 4R70A 2QJ7A 5G4YA 5HD3A 1XFNA 3F1OA 3PHYA 1EW0A 4JGQA 2VLGA 2PD8A 3E4PA 3LIBA 4BBUA 2JN7A 4BBTA 3MR0A 3LICA 3C2WA 3UB9A 4I39A 1XFQA 4L9FA 4LRYC 3CAXA 3F1PB 4KUKA 3LIFA 3MJQA 1XJ3A 2I9VA 5HWTA 1UGUA 1N9LA 1F98A 2J80A 1T1BA 1N9NA 1OTAA 4HP9A 3U9JA 1OTDA 4GW9A 4RQ9A 1TS7A 2D01A 2VEAA 5DKLA 1T1CA 1V9ZA 1WA9A 1X0OA 4F3LA 3G6OA 4HHDA 3V5YA 3IBRA 5HZHA 2QHKA 3H7WA
chains in the Genus database with same CATH superfamily
1OJGA 3F46A 2BL2A 1I4YA 1M40A 1Z63A 2W3GA 3IF6B 4NXBA 3FC7A 1ALQA 2JKTI 3AGUA 3QP4A 5F68A 3O39A 4XTKA 2W0NA 2XRHA 1Q0MA 2EPMX 2EPOA 1RKEA 1KGGA 3NHQA 3R7CA 4EQ1A 4Z9JA 2WUQA 1KTMA 4LDKA 2XLEA 3CEXA 4OIQF 2NUTC 1TS6A 3ZNYA 2GX5A 4PM5A 3ZQYA 2A1DD 1WWPA 1TWHA 5CX7A 3FHDA 4GDNA 3U2MA 3LS0A 4C7OA 2V8CA 3NJAA 2ZM0A 4O7DA 2X02A 4Y17A 4RDAA 3OPRA 1D1CA 5B1AC 3E2LA 4N9LA 4DVZA 4CSAA 3X2QC 4QPRA 3NBLA 1K55A 1DJCA 1YVIA 5F5FA 1XJ6A 4EV4A 3HUMA 5DJTA 4OOYA 3EG9A 2OV5A 4EERA 4KG6A 2OAP1 1YM1A 1LT0A 3H82A 3K6BA 3IXGA 2HKVA 1FOFA 3ABLC 3JVUA 2BE5F 5F5YA 4NXEA 2QTVA 4R38A 4QWOA 2LB9A 3PBOA 5FI2A 1OW8A 1XGJA 4OQ0A 2AWYA 4CDYA 3HNLA 4C75A 3GWNA 4PACA 4X0RA 2R7QA 1ZHHB 2HZ5A 2P9VB 1LI0A 3LLKA 3LR4A 3QP8A 3EGXB 3MQ0A 5FZTA 2EIKC 1Y4OA 3CPTB 1LL5A 2W3DA 5D91A 5EUAA 5A69A 3N0TA 1ZHZA 5GLCA 2PX3A 2KX6A 1K57C 5F6AA 3C4PA 4E04A 4MS2A 3M2JA 3DMDA 4OOMA 1NJ4A 3F1PA 5L0GA 2Y4AA 1PIOA 1GA0A 1CQAA 4LV3A 3S84A 5EVID 2HMZA 4JJGA 3RH3A 2YVKA 1VETA 4DDYA 4JIOA 5JRAA 1CI9A 1MPLA 5HAQA 4UQIS 1J8YF 5AQ9A 3SS4A 1OW6A 2VB6A 3FOPA 3I7JA 4XEVA 4BL3A 1QMFA 4JGPA 4MN6A 3ZIBA 4KQDA 3D72A 3T4KA 3A3IA 2IBFA 1HLUP 1T9KA 3E4QA 5GL9A 4LLCA 3FYZA 4DBRA 2JE5A 3K3DA 4MVQA 1BLHA 3MS6A 3CUEA 4ETZA 3HTKC 1RP5A 4KZBA 5CGSA 2I72A 3L7HA 2KSFA 3S9OA 3RJUA 4RX3A 5E2FA 4MW8A 4QY5A 3TQOA 4WJ0A 2EFUA 1L0EA 4BJ5A 2OKUA 2R7UA 3RW0A 3HBRA 3KYEA 3MXQA 4X6TA 5F83A 1V74B 2QE9A 1QZXA 3SH7A 3S27A 4NCQA 2EINC 1CPRA 4CIPA 2ZOHA 2HP5A 1ZG4A 4C3BA 3KH2A 1GA9A 1PNEA 4P87A 1C03A 4GEHA 1K04A 1S67L 2FH5A 4WMCA 1Y6DA 4HFFB 4N6CA 2ZM2A 3RQGA 4GD8A 3LR0A 1UFBA 4FX5A 3IXHA 5HV9A 1YYJA 1EA8A 2Z15A 1SCWA 2NUPC 1ZKJA 3WRTA 2EIMC 3BFEA 5DJUA 4GNUA 3A0SA 4BLMA 4IJGA 4E3JA 5A90A 3SS5A 1WASA 3L8JA 4KC9A 2L0WA 3ITFA 3T4RA 2CW0F 3RTYA 4WMCD 4G3KA 3VSLA 4HQAA 2JC7A 2DRWA 3NOPC 3KX0X 3JCUQ 4KZ7A 1GSXA 1U89A 1GSVA 2ZQ8A 1K25A 5HL1A 1G5ZA 4WUJA 4O7GA 3EFOB 3B0VC 3HJKA 1PD1A 4HESA 1H3QA 3EQUA 1NFNA 1BULA 3AGFA 1E4DA 1RGYA 4K0XA 2G2UA 4HIAA 2ZQ7A 2OOLA 3UO9A 1ZTUA 5FEGA 1AUEA 4WF0A 2EXBA 2XR0A 3GQZA 4GS9A 3SP1A 3Q7LA 3LI9A 4DVYP 1LPEA 5KYXA 2P7JA 3KPHA 4DOZA 5GLAA 1LIHA 4MCWA 4LV2A 1D1AA 2G62A 4ZBEA 3F1OB 1VHMA 1MMAA 4YNRA 2PBEA 3POVA 2KC3A 1IELA 5EVIC 3ZFZA 3HL9A 4G7ZF 2HPBA 1ES4A 1W63M 3U9MA 2ACGA 2OU6A 3HLFA 3Q7VB 3DZAA 5HX9A 2XSSA 2VGKA 1FMWA 3GM1A 3UMEA 1VOMA 5E33A 4PAUA 3T4OA 2RD9A 3RH8B 2PBYA 3Q6MA 2J8YA 1CJFA 1YLMA 1F5MA 3A9CA 4OQIA 2O9CA 3LO7A 3KSGA 2LB5A 3AJMA 1EQ1A 3EEAA 3T4LA 1KE4A 2ICWG 2OEXA 4J7YA 3G4PA 4OD5A 4MBKA 1UWPX 3EH1A 5A93A 3RXWA 2WZZA 4GYTA 2QJ5A 2ZL1A 1Q0GA 3VRCA 1ZZPA 3VYWA 1WYBA 1I5QA 1E86A 4X69A 4JZAA 3FAPB 1E83A 4UQIM 2PAVP 5IU1A 4P0MA 4IGGA 1HW1A 4LLOB 3M6HA 1YQSA 4EWFA 5L8MA 3ASOC 2R02A 2ZQ9A 2Y3DA 5AQBA 4E17A 1FQGA 3U3BA 4ETXA 1PI5A 3PAEA 4JLFA 4KQQA 3BEBA 2PT7A 4GHIA 3VAYA 2R7TA 1NZOA 2IWDA 1JR8A 4KZ5A 5FAPA 1OXBA 1ERQA 2Q9AA 4GB7A 3E70C 3W8HA 2C5WB 2ZOIA 4NXGA 1YLTA 4HOIA 5FL3A 4BJ5C 1G6OA 5EVLA 3U0CA 4JURI 4XT2B 1NZEA 2H10A 2J9WA 2UWXA 1XJ4A 1BR2A 4GN2A 2ZMFA 3N7WA 5FEFA 3LS1A 4O8GA 3QTHA 3M4CA 2O0YA 4P6BA 2LD6A 2UUHA 1EI7A 4NY3A 2AVXA 5D3OA 3KO6A 3U5SA 1ESIA 4QI2A 1LL8A 2X71A 5HAIA 3S7OA 5M19A 4IVKA 3TULA 3GANA 1FR6A 3LIDA 3MQQA 3C7UA 3E0YA 2V1ZA 4JTCB 3S1YA 2W1RA 2EX2A 3ICYA 2R7WA 4Q8IA 1BZAA 3G50A 4WEKA 1DOVA 2UUIA 3GEHA 2Q9CA 2D02A 1SKOB 1TS8A 4H6JA 4Y0OA 2IXPA 2QY9A 4LCMA 1I4ZA 4NTAA 1SF8A 2ZQDA 3T6JA 2QNLA 3VE4A 2JKRM 5AQAA 1LI5A 4MTFA 1JVJA 1FCNA 3V5MA 3RFBA 2CNWA 4YT5A 5HWVA 4DE2A 3V3RA 2L6GA 4M63A 2V2FF 4ZRRA 2HDRA 1TQGA 1O87A 1NRFA 5KYUB 4R70A 2QJ7A 2AU5A 4K0WA 3S7QA 3D9YA 5FI6A 1XFNA 2LP4A 4XEKA 3PHYA 1VLSA 1BLPA 5IHVA 1Q0FA 1ZHYA 4S2PA 5HW3A 3L0IA 1K0KA 3IPMO 4XLNF 1MWRA 1OQCA 4LV0A 1KU2A 4WZ5C 3NKDA 2CNWD 1JOGA 2ZXOA 5KYYA 2E8IA 3LICA 4YL3A 3C8GB 4X1MA 5DF8A 4B88A 1ZU5A 3EZHA 5C5KA 4JJFA 4I39A 1HMDA 3UB9A 3MBZA 2EPNA 3X1OA 1C17M 3LIFA 3WWXA 4DN0A 3FXHA 2WGWB 2DI3A 1KE0A 1UGUA 3G35A 2W3HA 1P9RA 2G7UA 1XZQA 1OCCC 3UB5P 4X56A 4BWIA 2VH3A 5B1BC 2Q9MA 3VOZA 3MYFA 2E87A 4FCFA 4QD4A 1MMGA 5CI9A 4JCZA 3FPVA 4UAAA 4LGWA 5CIVA 3G6OA 2ZQCA 1Q0DA 3R2PA 1LHYA 3C30A 1ZC2A 3EHNA 3IBRA 4DXCA 5AQ7A 5FSRA 1KDSA 4MNRA 4PMAA 1A41A 2ZM8A 4U0TA 3H2UA 2ZLYA 4NC3A 5HSQA 1QVXA 1ZU4A 1PW1A 3VP1A 3VF0A 3SH8A 5EE8A 2Y79A 4L6RA 4CS8C 1Z3IX 3FVYA 3AG3C 3S7NA 3TD7A 3LR5A 1YLZA 1TF1A 5JUAA 4KUOA 4CX9A 2HV6A 3NULA 4HH3A 2Y55A 4Y0TA 1DOWA 2KYHA 3O6XA 4OIOF 1K4FA 4MTGA 2B5RA 2A0UA 4UA9A 5GHZA 4HJ6A 1E25A 1S1ZA 1MWSA 3K3CA 1LM3B 4BBVA 5FQIA 2PU2A 2MYSA 4BQMA 1OXKA 1HE9A 1XPBA 2CDQA 2GWWA 4DJ3A 1E85A 1N9OA 3OCNA 4JGOA 2LIGA 5FDSA 3OCLA 4EUZA 3VM6A 2A68F 1SDNA 1V9YA 3BY8A 2H7OA 1I2WA 4NG2A 4NTFA 1M2VA 2W1TA 4C3QA 3CZDA 1J8MF 4EUKB 3T1RA 1VEUA 3W4OA 3NMJA 3JYHA 1LE4A 5KYWA 3VOYA 3D3OA 2XM0A 2JHEA 2V1AA 2E8JA 1ZHTA 3U4LP 5DTKA 1YKDA 3JPUA 4Q0HA 4Y3IA 1Z5ZA 3QMKA 4FAPB 1YARO 1K57A 5J8XA 1QKRA 1BSGA 4HJ4A 4XUXA 1TEMA 1OTIA 3L8IA 4CLCC 3E4OA 5BQGA 1MMNA 4NQFA 3HLWA 4E3IA 2WVQA 3NDEA 3CSKA 5I5LA 1CGOA 2Y3GA 4GDBA 1FIKA 4G0HA 1L0DA 2J7VA 3EGXA 5AVFA 3I5PA 1DP6A 3BWLA 3IEEA 5COMA 3LLIA 1A7DA 5JSLA 3S28A 4E0IA 5CHUA 3B33A 2DMWA 2IWCA 3DTIA 3GEEA 3L1MA 4XQ1A 4I3JA 2IXOA 4JTDB 3WS2A 1ZYRF 4D4XA 2ZBBA 3IH9A 2EWVA 4PKYA 2ASRA 4AE4B 3DE9A 2Y91A 3C8ZA 4GKUA 2V3CC 2V26A 3FKVA 3A3FA 3N6IA 3PCVA 4PKYG 2B0HA 2ZC7A 4WN5A 4YT4A 2CMNA 2WKIA 2R9XA 2KNHA 1EI5A 1I2SA 2Y2OA 5FA7A 3IHUA 1PI4A 2Y2QA 4JXGA 3S90A 4LV1A 2XRNA 1OCOC 1YA7O 3MXSA 4D2OA 5G18A 3UE3A 3C7JA 3LI8A 3DKAA 4FSFA 4YL1A 2R7XA 2B02A 1JPNA 3OPPA 1D0XA 5DF9A 5F1GA 1JPJA 5FQJA 1GQAA 4MN7A 5T1DB 4GCZA 2QMIA 4IBRA 2EX9A 4DRIB 3IWOA 3CITA 3PBNA 3V50A 5HL6A 2NUPA 4U5EE 1DP8A 1FSYA 1BBHA 1VYKA 2QUPA 4HI4A 2P6VA 5CTMA 4UA7A 1LS4A 1LL9A 1QMEA 1GS9A 4J32B 4PJMA 3IX8A 3EEHA 1TWAA 2DYSC 3IQTA 4NETA 2Y2GA 3NI9A 3BRJA 4QU3A 1IZMA 2JCHA 1ACFA 3IF6C 3WS0A 3EGDB 5DS5A 2J9VA 1H6GA 2PR6A 3DAVA 2AVKA 3C4OA 1MY8A 3DWZA 4Y15A 2GAQA 3DM9B 2A0BA 1HW2A 2WK0A 3JT1A 5A6KA 3OBFA 4J30B 1V54C 1K6SA 5FI7A 1SHVA 4U5FE 3EWKA 4X68A 2RSEB 2R7SA 4O6NA 1TVFA 3QZCA 1T18A 4BJ6C 1NZUA 3HLCA 4MLLA 4JKVA 1BTLA 3UGPA 3AGTA 5TR7A 2ZXRA 3OPHA 3OC2A 2I8BA 3F1NA 4C3DA 5CI8A 5M18A 1LSVA 1IFQA 3NDGA 3MX3A 1XA1A 5DVWA 3LGOA 5T3TA 1NG1A 2RCXA 5L2FA 5EVIA 1TD5A 2PBDP 3GM2A 1GCEA 4EBNA 1GHIA 3NCKA 5B3SC 5AVEA 4I3MA 3OPLA 3IS2A 5FDHA 3NIAA 5T3WA 1D06A 3IX3A 1Y28A 4P85A 2IXMA 5HDCA 2Y2JA 3C8CA 1XJ2A 3JSEO 4N9KA 3T9OA 4OPQA 4DDSA 4KBLA 3ZG7B 4MBFA 5GLBA 5E3AA 3V5XA 2KJGA 5E3CA 4FH4A 2OSUA 4IWBA 5BQIA 2WZFA 5FAQA 5CHMA 5HD5A 4OPRA 3R7WA 2ETSA 3C38A 3EGXC 4R1GA 1ZVZA 2XD1A 3S29A 2XLWA 3C63A 2Y2PA 2A69F 3ZWIA 3T1QB 3NYMA 4O6YA 3UB7A 2JX0A 4W8KA 1Z6FA 1G6AA 2OQMA 2EX6A 3LYXA 3MFXA 4EWCA 5BQHA 3LFVA 1XWJA 4B6IA 1T5OA 4R4SA 2A3UA 1H8YA 4E3LA 5B3IA 3ZSUA 3WS1A 1SDEA 1B68A 3UMDA 3UPOA 4MVOA 1GHMA 3U2LA 4P9FA 2YEVA 2L6FA 4GLQA 3QW1A 1IYQA 5IY5C 3V39A 3VMAA 4PK4A 2VGLS 1AEPA 3QP5A 2H28A 2MJ6A 2Q3TA 3NRHA 2ZC6B 1NY0A 5TBMA 5L0IA 3DBAA 5DLJA 1TDGA 3UNGC 3HLDA 4I38A 2QKPA 4CDVA 3ATPA 2XEPA 4LFUA 1ONHA 4ARZB 3UE1A 3EOIA 1H0MA 1VB5A 2PR5A 3KSIA 2G2WA 3HLEA 3FG8A 2YKHA 1K38A 4YOFA 2VGJA 3LEQA 4MEZA 4XT2A 3UB6A 4OP5A 3DJNB 2R03A 1M6KA 2WZGA 1VK5A 1CK3A 3ZG5A 5DTTA 2XSEA 2M7UA 1YJGA 4R3AA 1MBLA 3TOLA 4IEDA 2QLAA 2Y2IA 3M2KA 4HE8D 4DMZA 4C7OB 3KL4A 4F4BA 4D4NA 2HDUA 4QI0A 5KIZA 3GV9A 4JPMA 5L0JA 3FMSA 4OQHA 2Y69C 1K54A 3DD7A 1H9GA 1H7IA 1TWGA 1FCMA 4OONA 2XL8A 1TR2A 2P04A 2J45A 1E84A 4U5BE 3EG9B 1AWIA 3NKEA 1MKIA 1ST6A 1S66L 2BASA 4GQHA 4WZ5A 3MBGA 4OINF 3H82B 4Z9HA 3BFGA 4OPZA 2XLDA 1NYYA 4XEFA 1W5DA 4HJ3A 2PYPA 1JWPA 1R5ID 5EECA 1TFOB 2H7BA 1SR2A 3Q7GA 4MTOA 5KYUA 3JRTA 3E98A 3PBRA 4E3OA 4JW1A 2VX8A 3KYJA 5HD3A 1DJBA 5E2QA 1Z7Qc 3DTKA 4MVZA 1L3PA 1EW0A 2Q9BA 2M4EA 4OQGA 1N1CA 2A6HF 5AGFA 4BJ1A 5K0IA 2PD8A 5L0CA 1HE1A 5DFYA 1OW7A 1M6TA 2ZXPA 4WEJA 1QLEC 3CI6A 3KSHA 1MKMA 3EZIA 3C2WA 1G5UA 3Q81A 4OKPA 5CECA 1AVOB 3MZEA 4PM6A 3F1PB 2AP3A 5A91A 4K0DA 1W7FA 1VMAA 3MXRA 3WODF 1XJ3A 5HWTA 4JEAA 1PWCA 5TJ5E 2IM8A 1Z09A 3VP3A 2OJQA 1N9NA 1KNYA 4UHUA 3C5AA 2Q9NA 4HP9A 2HMQA 1VETB 1S6RA 4KQOA 1OTDA 3MZDA 1G4US 4CS8A 4GW9A 5E2GA 5MC7A 4PJLA 1T1CA 3BRMA 1V9ZA 3ASNC 4F3LA 4HEFA 4HHDA 1S0WA 4QB8A 3OOVA 5L0DA 2JKGA 3S7PA 3KYQA 4JVSA 3M15A 4XWJA 3EJNA 4CJOA 2XH9A 3N8SA 2YLDA 3I4UA 4YL0A 4LDQA 1YSQA 3H7WA 5L0HA 4LERA 2VV7A 3W4PA 3CWFA 2XGNA 2XFSA 2XROA 3TE8A 3ZCZA 1VYIA 2Q4FA 2FFFB 3RIPA 3LUTB 4WM9A 2J3TC 1T6QA 1NXYA 3GWLA 3CLOA 3LY3A 1O5HA 2YZSA 1PCXA 3FAJA 2EXAA 3HKKA 5CERA 4JXVA 2V0UA 3UB8A 5AJGA 2VGLM 3LESA 3ITAA 3RVZA 2QWSA 3HJIA 2ZQAA 2LFDA 5EVEA 2WVNA 1FFHA 2YLIA 4J7TA 4W8PA 4N1HA 3LIAA 3K66A 4ULVA 2C6WB 2J9BA 4N4WA 4KI2A 4AL1A 5L3VA 4GD6A 2Z2MB 2XS8A 5A6JA 4OH0A 5L09A 4MW3A 4CLCA 3G4ZA 2XDMA 4N92A 2XA7S 4G7HF 3K2NA 5FQKA 4C3EA 2Y2NA 4JF4A 3T1SA 4Q4ZF 1ORSC 5EM0A 2ZC4B 1HMOA 1PV3A 1RCPA 5CHJA 1WE4A 4CLCE 2VCBA 2P74A 2Y2KA 3HVFA 5BOHA 2IYLD 2A24A 1YZCA 2V8FA 5GPGB 1DRMA 2XXAB 2O9AA 2M1CA 2EILC 2XLNA 4Q0JA 2PDRA 3TJ6A 1HVBA 1DP9A 5A8BA 1H9TA 3UE0A 4CLCD 4UDVA 3P7NA 2VV8A 1RKCA 1ORJA 4R32A 5DQZA 1K54C 3PAGA 4MN5A 3ZGAB 4XUZA 1IYOA 2LCHA 4IUHA 4KZ6A 1BZ4A 4CIHA 3NOTC 4LENA 5HDDA 2BTFP 1LVKA 2XLOA 2YRFA 1A0BA 1Y4CA 2RL3A 3UPNA 4JRZA 2BLSA 3GEIA 3K1IA 4G7OF 2XFTA 3KYIA 5A92A 3T4JA 4EW7A 3V3SA 2Y8HA 4ANJA 1K40A 3IXDA 3QNCA 5KYXB 2QPNA 2KQ9A 3H9WA 4MMNA 5CGXA 1M56C 4LLEA 3ITBA 1GSWA 3VP0A 3H65A 1OCZC 3GECA 4LCLA 4BL2A 3P09A 4YWQA 4ZLDA 1H5XA 2P7VA 3ZTZA 2D5RB 2C04A 2FAPB 3LAYA 2PD7A 1DJAA 2WAFA 4JF6A 1XZPA 4X55A 3MLGA 1OR3A 1VLTA 2Y2MA 3BW6A 3NC8A 2ZPAA 5AC4A 1MMDA 4R4RA 4U9DA 4EETB 4MVRA 1C3BA 3MKEA 1KE3A 2X51A 3B29A 4OVDA 4K1OA 5TFQA 3ZQVA 4JXWA 4JGRA 4LRXC 4OPYA 4JF5A 2ZXWC 2Y39A 4D60A 4HNBA 4X53A 3QVYA 3Q6NA 1TKNA 1OTEA 2P0NA 1PW8A 2QZ6A 3CJMA 1UWNX 3RYLA 1DY6A 2W4MA 4KG2A 4P6IC 2R7OA 2ZL1B 3IF6A 2PRFA 1NLZA 1CF0A 3DXJF 3DWKA 4E0HA 2P61A 2R7VA 3LNRA 3UR3C 3IQ6A 3C62A 3EQLF 1P0ZA 3OA1A 5KZHA 4MVUA 3WG7C 4BG0A 1BR1A 3NY4A 2WB7A 1E3UA 2LQGA 3PXPA 3BEHA 4AK9A 2R78A 1YYXA 1YAUO 4GHIB 3RXXA 3U8VA 4BJ6A 2GNXA 4K7BA 1K56D 5F69A 4O0PA 4G3VA 4EXOA 4YJWA 2INWA 4B9OA 2OAQ1 3BECA 3ZG1A 2XLHA 2XL4A 2XM4A 5FAOA 1Y54A 4FUWA 5DF7A 1ZW2A 3GMWA 4U5HA 4PR9A 3PDMP 1IOUA 1E3UD 3G2YA 4Z9IA 1I5NA 1PWGA 3MKFA 5GLDA 4EBBA 3D4FA 2XF3A 1KOUA 3I5QA 3W4QA 3G32A 2O9BA 3VOLA 1CGNA 3J06A 4A5RA 3QP6A 3GODA 3VV4A 4WLAA 3T12B 2L4RA 1O3UA 2CGEA 1T01A 3SYNA 5JS5A 3PYPA 4N6HA 2HDSA 4NXFA 2ZD9A 1V55C 4UEYA 3QNBA 1A7EA 3UE6A 1SMYF 2M7VA 4EU0A 3O86A 3K1HA 4A4AA 4EBJA 1ESUA 5EV0A 2XA7M 2P9VA 2V0WA 1IYPA 4OLDA 5HDSA 4Z1WA 3UDXA 1S1YA 4DKIA 1CGME 3OZHA 3MF0A 3CPTA 5JP7A 4ZJ3A 4YK5A 4R3JA 4JCHA 1BDJB 3RF3A 5COFA 3FOOA 3SXKA 4DJ9A 3MFDA 2HDQA 2VA0A 1JTGA 4O01A 1S7ZA 2YLGA 1Z23A 5E2EA 3ZG0A 2J46A 2KGOA 4CDAA 2ZC3B 3RKOF 1MWUA 3DTEA 4EBPA 1NLYA 2UV0E 1JTDA 5TJJA 1R4TA 4JXSA 2X0CA 1LSXA 4CQHA 3IBJA 2WAEA 4JEBA 4JE9A 2LFFA 4KZ4A 2X01A 3T4TA 2YKZA 1F1MA 1RJ9B 1O07A 2VV6A 4OIRF 1L0GA 4Z9QA 5EHHA 2B18A 3K1IC 3ZHHA 2HJMA 2PF4E 5GHYA 1WGWA 3QW0A 4ZTKA 2HJ3A 1OT6A 4NKPA 4BEJA 1RCJA 2H0YA 4GOGA 1OT9A 5HARA 3AG4C 3L9KA 2Q00A 1F2KA 3ZVRA 2EA9A 1JRAA 2OJED 1WTYA 1GM5A 1Q2QA 3EH2A 3IT9A 3L34A 1ES3A 3A11A 3W8KA 4CJGA 1FR0A 4PM8A 4M4XA 1T6IA 1LS1A 1LSWA 5A6BD 3PHF2 1D0ZA 1L3LA 3WHNA 3A0RA 3MFNA 4S2NA 4E18A 4H8RA 1VM1A 2EPLX 4CS9A 4KQRA 1OCRC 1G8XA 2W45A 3ULFA 2H7VC 3B0UX 4NK3A 3H2VA 4U5CE 2HS5A 3N8RA 5AC5A 3B3XA 4OIPF 3OLOA 3NG1A 2NUTB 1JWZA 2ZJ9A 4R3BA 2NG1A 2XL6A 4EHPA 1PZPA 4FOFA 4S2MA 2VASA 4BEMJ 1UG7A 3S0XA 5EFWA 4H54A 1EROA 2YL7A 1U6HA 2GDNA 2C03A 4ARZA 4HBTA 4XLPF 1EKYA 5DFXA 1RXQA 1VB6A 5TGFA 4L9GA 1BLCA 3T1XA 1N9BA 1MQVA 4YT2A 5CTNA 3KKBA 1D0YA 2HSBA 3MZFA 4WELA 1CPQA 4XXRA 2WKEA 1O7EA 2NSFA 3Q7ZA 3RFYA 1SZIA 3SS3A 4RBNA 3ZDLA 3MMHA 4CBEA 2GZAA 3M79A 4WL9A 2Q0OA 5DTSA 3K7DA 4IAOA 3DTMA 5L10A 1H8ZA 1FFTC 2WKRA 3BY9A 5HPFA 4K91A 4P6ZS 3EGDC 5CXWA 4ID4A 1WOLA 5JT4A 3T4SA 2L9JA 5DKKA 1J9MA 4IHQA 1ORYA 4XPYA 4U5GA 2V20A 3ZG8B 1CI8A 2J9PA 2QYBA 4DE0A 4FWVA 4Y0UA 2HUJA 1M2VB 2W1TB 3ZQ5A 4IJJA 3IXBA 2IOQA 1P97A 3RQEA 1VEUB 3EFOA 3N24A 4G3WA 2YL1A 3P01A 5KYWB 5L3QA 4N06A 2HZ8A 2WZXA 2YL0A 5FQQA 2P08A 4L0LA 3ZYTA 1XGIA 3DAFA 1PYYA 5EOEA 1BYWA 3G30A 3AGDA 3SW1A 1PFLA 2ZC5B 2BG1A 1M2OA 3PBTA 5G4YA 1L0FA 4MQ9F 3T6BA 3F1OA 4EKWA 1MC0A 4B4XA 2K31A 2VLGA 1TWCA 2G3VA 3MSHA 1FR1A 2D4UA 3ZTMA 3JYIA 4CJNA 4YN0B 1OPXA 1JWVA 3CG5A 4E3NA 2JN7A 4GZBA 4U5DE 3Q7VA 4U0XA 4EUVA 1FILA 3HCYA 4BBTA 3BLSA 3MR0A 1IKGA 4G78A 1IYSA 2KOIA 3HLBA 3AOUA 5EOOA 1XFQA 1YMXA 4L9FA 3AGEA 4LRYC 4WGZA 3CAXA 3AG1C 4KUKA 2DCFA 1EWZA 5M1AA 2J0WA 2YWAA 1ZHWA 3T6GB 3QVZA 4Q0IA 2VC9A 1D1JA 1T1BA 2J80A 4PM9A 5EPHA 1OTAA 1PWDA 3Q1FA 1BR4A 2GDCA 1KVLA 3ZVWA 4OD4A 3U9JA 1KDWA 3HUNA 1SKFA 3IWQA 4RQ9A 1BUEA 1TS7A 1G4WR 1W63Q 3ISGA 1YPRA 1SZVA 5FQMA 3FV7A 2D01A 5DKLA 1WA9A 5A6AA 1X0OA 3UPPA 5I94A 5CEDA 2OLVA 2LK4A 4FH2A 1HY5A 5DS4A 4XPXA 5HZHA 3NMIA 4Q7CA 2OCCC 1FSWA 1W2WA 1ZW3A 2WVOA 1G28A 1D7EA 1IKIA 1N4OA 1TFKB 3B9QA 3GM3A 3Q07A 4KZAA 3NYJA 2J3TD 2HP9A 2YL3A 3AQCA 3GTCA 3M6BA 1JMWA 5FATA 3EPVA 2P1AA 2NUPB 4S2NC 3HLZA 4CS9C 4DJ2A 5J3WA 3SXMA 1XX2A 2GFHA 4Y2FA 1RKEB 1K6RA 3FPWA 2XK1A 1CEGA 3IF5A 3P98A 2LSEA 3WAQA 3M1CB 1IEMA 5KMWA 3KYZA 3W8IA 2HV7A 1K4EA 4IBXA 4EESA 1IW7F 1JAFA 1F9IA 3SOIA 4F94A 1OMEA 3G2ZA 4LRZE 4QY6A 5U47A 3TSGA 4N1XA 1E2XA 3QHYA 1P9WA 1PZOA 4BPMA 1GHPA 3NECA 4ONSA 3U2AA 2M64A 1FMVA 1YZAA 3DM5A 2J9UA 3JVVA 4B4ZA 3N2ZB 2R25A 4DBQA 4E7SA 1OKKA 3E9VA 1SKOA 1YDIA 2R9RB 2GA0A 4UA6A 3PMRA 5F1FA 2XXAA 1TDLA 4Y5FA 1ONGA 4MVSA 1NLXA 4ULWA 3MQOA 3UDIA 5GHXA 3DAGA 4PJNA 1BLSA 3W4YA 3F1NB 2A6EF 4KZ3A 2Y2LA 2R05A 4CSAC 1MNEA 4O6MA 4A2NB 4P6ZM 3B42A 1OKKD 1K55C 3FWLA 3G34A 2CYDA 5K5BA 5EM1A 3ZC4A 5EVIB 3B0PA 1AXBA 4HFKB 1T19A 3O87A 3PBSA 3O5YA 1V4AA 1Q2PA 3GVBA 4AL0A 3U3FA 2VJWA 3C8GA 3IS2B 2CCYA 2OLUA 1WYCA 3SH9A 2FZ0A 4II7A 4BJTA 1YT4A 3FDQA 2W3FA 4U3TA 4BD1A 2WGWA 3DWWA 3TJZC 2VK3A 3V67A 4X1LA 1PRQA 2BC5A 2I15A 3R7WB 4MDZA 1D1BA 4OLGA 3UN7A 3C8GD 2V1BA 5HWWA 1HZOA 5HPIA 2F22A 4R23A 1WATA 3W2VA 4FD8A 2PFDA 4RA7A 1ERMA 3T4QA 4ZDXA 3US6A 2IA2A 4AFIA 1MWTA 3V7OA 2WYXA 1T6UA 2WZLA 5F82A 2H5SA 3NMKA 2Z2LB 3ZG9B 3ZNTA 3JRMO 3ZDJA 2Q7RA 4DF6A 3F47A 5COGA 2O99A 2DYRC 3U8PA 4WABA 3ZVTA 5HSWA 4S2KA 4HH2A 4OOLA 3S22A 5F28E 3LJBA 2A2LA 5DQTA 1W8QA 4I1OB 3A3EA 3A3DA 3B47A 1Z6AA 3N4IA 2JBFA 3LIEA 3B71A 3BJNA 3G4XA 1NBBA 4B93A 2GJ3A 3BLMA 3SNHA 3PR6A 4YWZA 2DGJA 4ZJ1A 5TBMB 4EQIA 2PP4A 3WRZA 3FKWA 3LEOA 4RX2A 5J4EA 2YHSA 5J7EA 3CUEC 3C18A 2H0TA 5KYNA 4I44A 2FFHA 5HFOA 2CC1A 4AX2A 3TK0A 2XS1A 4YT8A 4PJJA 5HAPA 4EEPA 3LY4A 3N8LA 3W2ZA 3OWTA 5G4ZA 3BFFA 4KZ9A 1L7CA 3V5ZA 2B0JA 1FCOA 4RD9A 5CRFA 1ES5A 5DVAA 4O79A 1YLJA 3WS5A 4ESPA 2MWQA 3GORA 4MBHA 4E7ZA 3O88A 4PHTA 4PM7A 2W27A 3MYIA 4RVAA 4KNWA 1VTMP 5E43A 2HSQA 4K08A 4RYEA 2DB4A 2WKQA 2W3EA 4KNVA 1OR2A 5FQ9A 1APCA 5IT5A 2OEVA 5FCLA 3IQAA 3UMKA 4Y7PA 5L07A 3BQAA 1S05A 4HBUA 4DE1A 3TOIA 3SEOA 3LUQA 2K7SA 4E3MA 3IQ5A 3IHBA 4PFPA 1S4SA 1T1AA 5DS6A 2L6HA 3S4XA 2KK1A 2R9WA 2HF6A 3UMIA 4S2IA 1QPUA 2EX8A 2KLIA 3KSFA 2IWBA 3HNKA 2WKPA 2KW3C 3G31A 1YA9A 3KMIA 2J7PA 3A0VA 3JZ0A 3ABMC 4CPKA 1LI9A 4KENB 3LCEA 5FASA 3DE8A 2Z6CA 2O9XA 3JTLO 3UGOA 4GS9B 4YINA 4AE4A 4QJGA 1M57C 4I3AA 2H8AA 1CEFA 4JKTA 4PPRA 5F5HA 3BFCA 2IXNA 4MNDA 1GGQA 4NTBA 1ODVA 2J3WA 3DJUB 1RJ9A 4Q5SF 3Q82A 1KVMA 2KDKA 2EPKX 3CQZA 2J7PD 2HP6A 2Y59A 3ECSA 3ABKC 5IS1A 4BD0A 4I1MA 1YLWA 2W4BA 2L1MA 2WGVA 1SYQA 3JSZA 4FESA 4LPZA 4QHCA 4DRHB 4IVIA 2XQZA 4HP4A 2G3KA 2FGYA 2OOCA 3CMZA 4EEUA 3UY6A 2J9OA 5JVEA 4DXWA 1YMSA 1ZHXA 2HV1A 4ME4A 1NU7D 1JNUA 1W79A 2VCAA 2HGVA 2AWCA 3WS4A 4EIYA 3M4BA 1TS0A 3TJ5A 3IHAA 2WKHA 4L9EA 4XPWA 1J3WA 3LEZA 1WN0A 1FNTc 3BM6A 2WADA 3VFFA 4S2LA 2JKTM 1NYMA 3VP2A 1K56A 3OEOA 3SXYA 2PHYA 3QP2A 3R4KA 2YQYA 4F3LB 3O55A 5BUOA 2OWJA 3JYYA 4R6LA 3IQCA 4NEED 3GDIA 1NSGB 4WBGA 1LKXA 2HJEA 1RMVA 2VZWA 1OTBA 3IH8A 2NUTA 4IRUA 4JTAB 1MNDA 3EHMA 1Q0KA 4JC7A 3H7WB 4I5SA 1STZA 2PU4A 4IUKA 3CZ6A 3PBQA 3TW8A 4E6XA 1LE2A 1YLPA 1NFOA 3EGDA 3HLGA 4I3IA 3RQFA 3IX4A 3SZRA 1XXMA 2NPUA 3HUOA 3DI5A 2VKSA 1L2SA 2V9AA 4R0QA 5JYPA 1KGFA 2YKFA 5EK0A 3RVYA 2WL8A 2JPUA 2ZMAA 2MHRA 3PTEA 1K05A 3T50A 1XP4A 4WYYA 2OWHA 2B95A 1MZUA 2A49A 2EFXA 1W8YA 2PX0A 3BFDA 3VSKA 5JYOA 2OG2A 4E6WA 2EWWA 4LDRA 4M3KA 5EGYA 2ZMVA 1HTZA 5D92A 2ZD8A 2JKFA 3UMHA 2XLMA 2HJ9C 4CLCB 3AG2C 4DE3A 1MXOA 2FFYA 3E2KA 4EBKA 4S2OA 4HEAJ 2XLVA 3VE3A 1S4RA 3UDFA 4ZJ2A 5LBRA 4DRTA 1OJ5A 3O10A 2VCCA 4HY8A 2Y3BA 1KGEA 2Z6DA 1H8MA 1ZG6A 4H6JB 3TG9A 1QQ3A 4BMWA 1ES2A 2A24B 5KSHA 3A3JA 3LEVA 1XA7A 4IARA 4BENA 3VFHA 2DNSA 2TMVP 2W9YA 4DRJB 1NWZA 3EQVA 3QP1A 2PYRA 4WGYA 4ER9A 3GRJA 4IB4A 1YSPA 4S2JA 1FAPB 1U0BB 3NDBB 1RGZA 3NOUC 1YLYA 2WGIA 3BQ8A 3HNIA 2XD5A 3TOMA 4ZAMA 4QDLA 2EIJC 1BT5A 1LI7A 1VQQA 4H4KC 4C6YA 3HJCA 3SXZA 1LLBA 3GR2A 4KG5A 5E2HA 4ZLCA 256BA 4JGQA 4GJ4A 3TRCA 3UNWA 2JKRI 3E4PA 3LIBA 3GSGA 3C7VA 4BBUA 3LNMB 4KZ8A 5KYYB 1NRJA 2PNOA 1QSPA 3VP4A 2HFIA 1A0KA 5A6BA 3HREA 4BJPA 3LR3A 4EBLA 4JBFA 1A7VA 1XKZA 1FTSA 3K33A 3MJQA 4Y13A 2I9VA 3NYLA 2JD3A 1PD0A 4CS7A 3AQBA 3W2WA 1N9LA 4OP8A 3CHWP 1HD8A 1F98A 3O3VA 4IAQA 3FZCA 5CGWA 1NU9C 4X25A 1G68A 2Y2HA 2J0XA 3HNJA 2L81A 3BYDA 4MVMA 1C02A 5JLIA 2K2NA 5CEBA 4FTXA 2VEAA 4YFMA 4P9TA 4U9EA 2Y3HA 2L7AA 2J8WA 1U60A 5KSCA 3V5YA 2R7RA 4LACB 1YAXA 4WZ4A 4PFOA 3SZTA 5L0FA 3DW0A 2NSGA 3IWIA 2QHKA 4E3KA 4DXBA
chains in the Genus database with same CATH topology
1OJGA 2VV7A 3CWFA 5HSQA 1G28A 1D7EA 2XROA 2W3GA 2Y79A 3TE8A 2J3TD 4NXBA 3FC7A 2JKTI 2J3TC 3CLOA 5F68A 2W0NA 3S7NA 4DJ2A 3LR5A 5J3WA 1TF1A 3NHQA 4EQ1A 4Y2FA 4KUOA 2V0UA 3FPWA 3UB8A 4HH3A 5AJGA 2VGLM 2QWSA 3HJIA 2NUTC 1TS6A 3KYZA 4HJ6A 2GX5A 1S1ZA 4EESA 3K3CA 4BBVA 5CX7A 1F9IA 3LIAA 4LRZE 1P9WA 3NJAA 3U2AA 4CLCA 4DJ3A 3JVVA 1N9OA 3OCNA 2XA7S 3K2NA 4JGOA 4QPRA 3OCLA 1V9YA 3BY8A 2W1TA 1XJ6A 5DJTA 4EERA 4CLCE 2OAP1 2A24A 1LT0A 3H82A 4Y5FA 1DRMA 3D3OA 2O9AA 2JHEA 2M1CA 2V1AA 4Q0JA 2PDRA 3JVUA 1DP9A 5F5YA 5A8BA 1YKDA 4Q0HA 4Y3IA 4NXEA 4R38A 4CLCD 2LB9A 3MQOA 3PBOA 4HJ4A 1OTIA 3F1NB 4CLCC 3E4OA 3P7NA 2VV8A 4P6ZM 3B42A 4MN5A 5I5LA 4IUHA 1ZHHB 5K5BA 3LR4A 3NOTC 5AVFA 1DP6A 5HDDA 3MQ0A 3BWLA 1T19A 2W3DA 3PBSA 3O5YA 3B33A 2DMWA 2VJWA 3IS2B 4I3JA 2KX6A 5F6AA 3T4JA 4EW7A 2Y8HA 2FZ0A 4E04A 2ZBBA 4II7A 2EWVA 4OOMA 3F1PA 4PKYA 3H9WA 2W3FA 4MMNA 3TJZC 1GSWA 3V67A 3GECA 3R7WB 4MDZA 4PKYG 4WN5A 2PD7A 4UQIS 2V1BA 2CMNA 5HWWA 5HPIA 3BW6A 4JGPA 4MN6A 3T4QA 4KQDA 4EETB 2IA2A 3D72A 4AFIA 3T4KA 2XRNA 4JGRA 4LRXC 3E4QA 3UE3A 3LI8A 4HNBA 1OTEA 4FSFA 3K3DA 3CUEA 2B02A 4ETZA 2P0NA 2O99A 1UWNX 5DF9A 4MN7A 4GCZA 4HH2A 4OOLA 1NLZA 3CITA 3PBNA 2A2LA 5HL6A 3B47A 1DP8A 3LIEA 3BJNA 1P0ZA 3MXQA 4B93A 2GJ3A 3PR6A 4HI4A 4YWZA 5TBMB 2ZOHA 3PXPA 3EEHA 5J4EA 2R78A 5J7EA 3CUEC 4GHIB 1S67L 2GNXA 2FH5A 5F69A 4O0PA 4G3VA 4EXOA 2INWA 4B9OA 2OAQ1 3LR0A 4EEPA 3W2ZA 5G4ZA 2PR6A 2NUPC 3V5ZA 1IOUA 5DJUA 3A0SA 3OBFA 4IJGA 2L0WA 3EWKA 4PHTA 1KOUA 2W27A 2O9BA 3VOLA 4K08A 1T18A 3RTYA 2WKQA 2W3EA 4G3KA 4HQAA 5IT5A 3NOPC 3KX0X 3VV4A 4WLAA 2L4RA 3BQAA 3OC2A 3PYPA 4NXFA 1GSXA 3F1NA 4UEYA 3UE6A 1GSVA 3LUQA 2M7VA 2K7SA 4EU0A 1LSVA 1S4SA 1IFQA 1T1AA 4WUJA 2XA7M 2HF6A 2V0WA 5HDSA 4Z1WA 2KLIA 3KSFA 1S1YA 3HJKA 1H3QA 1TD5A 3EQUA 3MF0A 2WKPA 5AVEA 4HIAA 3A0VA 2OOLA 3IS2A 1D06A 1ZTUA 2VA0A 1Y28A 5HDCA 4O01A 4WF0A 2Z6CA 3C8CA 1XJ2A 4GS9A 3LI9A 4GS9B 2P7JA 1NLYA 4MCWA 5TJJA 4I3AA 3V5XA 1LSXA 4CQHA 3F1OB 1VHMA 3IBJA 4YNRA 5HD5A 1ODVA 2J3WA 3T4TA 3R7WA 2KDKA 3C38A 3EGXC 2VV6A 1W63M 3U9MA 5IS1A 2XSSA 2B18A 2L1MA 3UB7A 3UMEA 4PAUA 3T4OA 1OT6A 4LPZA 4NKPA 3LYXA 3RH8B 3MFXA 1OT9A 4HP4A 4EEUA 1F5MA 3LFVA 2O9CA 2EA9A 3KSGA 2HV1A 2LB5A 4ME4A 1JNUA 3EEAA 3T4LA 2HGVA 1TS0A 1UWPX 3UMDA 4M4XA 1LSWA 2QJ5A 4L9EA 2JKTM 4GLQA 3A0RA 2VGLS 2PHYA 3R4KA 3ULFA 4F3LB 4UQIM 2H28A 5IU1A 2MJ6A 2OWJA 4R6LA 4NEED 3GDIA 2HJEA 2VZWA 4LLOB 1OTBA 3OLOA 5L8MA 5TBMA 4ETXA 3DBAA 3H7WB 4I38A 2QKPA 4I5SA 4FOFA 1STZA 2PT7A 4GHIA 4IUKA 5EFWA 3PBQA 3TW8A 4ARZA 4ARZB 5DFXA 3EOIA 1VB6A 2PR5A 4I3IA 4L9GA 3KSIA 2VKSA 2V9AA 3FG8A 2ZOIA 4NXGA 4HOIA 2YKHA 5FL3A 2YKFA 4YOFA 1G6OA 3UB6A 4WELA 4XT2A 4XT2B 3T50A 2OWHA 1XJ4A 1MZUA 2ZMFA 3MMHA 2GZAA 4WL9A 2M7UA 4R3AA 4O8GA 2EWWA 2O0YA 4DMZA 2ZMVA 2WKRA 3BY9A 5HPFA 4P6ZS 3KO6A 1LL8A 3EGDC 5KIZA 3S7OA 3T4SA 2HJ9C 4CLCB 3MQQA 3LIDA 5DKKA 3E0YA 4IHQA 2W1RA 3ICYA 3VE3A 1S4RA 2QYBA 4WEKA 5LBRA 2W1TB 1OJ5A 3ZQ5A 2P04A 4HY8A 2D02A 4H6JA 1TS8A 1P97A 2Z6DA 1H8MA 4BMWA 4H6JB 4G3WA 1S66L 2A24B 5KSHA 2BASA 3P01A 3H82B 3VE4A 2JKRM 4HJ3A 2PYPA 1NWZA 3EQVA 3RFBA 5HWVA 2PYRA 2P08A 4L0LA 4ZRRA 3ZYTA 1YSPA 1BYWA 3SW1A 3NOUC 3BQ8A 3E98A 3PBRA 4R70A 2QJ7A 3PBTA 5G4YA 2VX8A 3S7QA 5HD3A 1XFNA 3F1OA 3PHYA 1MC0A 1EW0A 4JGQA 2K31A 2VLGA 4GJ4A 3TRCA 2PD8A 2JKRI 1OPXA 3E4PA 3LIBA 5DFYA 4BBUA 2JN7A 4WEJA 4EUVA 3HCYA 4BBTA 1NRJA 3MR0A 3LICA 3CI6A 3KSHA 1MKMA 3C2WA 5C5KA 3UB9A 4I39A 4BJPA 2KOIA 3LR3A 1XFQA 4L9FA 4LRYC 3CAXA 3F1PB 4KUKA 3LIFA 3MJQA 4DN0A 1XJ3A 2I9VA 5HWTA 1UGUA 1N9LA 2W3HA 1P9RA 1F98A 2G7UA 2J80A 1T1BA 4Q0IA 1N9NA 1OTAA 4HP9A 4BWIA 3U9JA 4KQOA 1OTDA 4GW9A 2K2NA 4RQ9A 1TS7A 1W63Q 5MC7A 2D01A 2VEAA 3FPVA 5DKLA 1T1CA 1V9ZA 1WA9A 1X0OA 4F3LA 3G6OA 4HHDA 3OOVA 3S7PA 3KYQA 3V5YA 3C30A 1YAXA 3IBRA 5HZHA 2QHKA 1YSQA 3H7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJG A;  2VV7 A;  3CWF A;  5HSQ A;  1G28 A;  1D7E A;  4NXB A;  3FC7 A;  3CLO A;  5F68 A;  2W0N A;  4DJ2 A;  5J3W A;  3NHQ A;  4EQ1 A;  4KUO A;  2V0U A;  3UB8 A;  4HH3 A;  2QWS A;  3HJI A;  1TS6 A;  4HJ6 A;  1S1Z A;  4EES A;  3K3C A;  4BBV A;  1F9I A;  3LIA A;  4LRZ E;  3NJA A;  4DJ3 A;  1N9O A;  4JGO A;  1V9Y A;  3BY8 A;  1XJ6 A;  5DJT A;  4EER A;  2A24 A;  1LT0 A;  3H82 A;  1DRM A;  2JHE A;  2M1C A;  2V1A A;  2PDR A;  1DP9 A;  5F5Y A;  5A8B A;  4NXE A;  4R38 A;  3MQO A;  4HJ4 A;  1OTI A;  3F1N B;  3E4O A;  3P7N A;  2VV8 A;  4MN5 A;  5I5L A;  3NOT C;  5AVF A;  1DP6 A;  5HDD A;  3BWL A;  1T19 A;  3B33 A;  3IS2 B;  4I3J A;  2KX6 A;  5F6A A;  4EW7 A;  4E04 A;  2ZBB A;  3F1P A;  4PKY A;  3H9W A;  1GSW A;  3GEC A;  4PKY G;  4WN5 A;  2PD7 A;  2V1B A;  2CMN A;  5HWW A;  4JGP A;  4MN6 A;  4KQD A;  4EET B;  3D72 A;  4JGR A;  4LRX C;  3E4Q A;  3LI8 A;  4HNB A;  1OTE A;  3K3D A;  2B02 A;  2P0N A;  1UWN X;  4GCZ A;  4HH2 A;  1DP8 A;  3LIE A;  1P0Z A;  3MXQ A;  2GJ3 A;  4HI4 A;  4YWZ A;  5TBM B;  2ZOH A;  3EEH A;  5J4E A;  2R78 A;  5J7E A;  4GHI B;  1S67 L;  5F69 A;  4EXO A;  2INW A;  4B9O A;  4EEP A;  5G4Z A;  2PR6 A;  3V5Z A;  5DJU A;  3A0S A;  2L0W A;  3EWK A;  1KOU A;  2W27 A;  3VOL A;  4K08 A;  1T18 A;  3RTY A;  2WKQ A;  4HQA A;  3NOP C;  3KX0 X;  4WLA A;  2L4R A;  3PYP A;  4NXF A;  1GSX A;  3F1N A;  3UE6 A;  1GSV A;  3LUQ A;  2K7S A;  1LSV A;  1S4S A;  4WUJ A;  1T1A A;  2V0W A;  5HDS A;  1S1Y A;  3HJK A;  2WKP A;  5AVE A;  4HIA A;  3A0V A;  2OOL A;  3IS2 A;  1D06 A;  1Y28 A;  5HDC A;  4WF0 A;  2Z6C A;  3C8C A;  1XJ2 A;  4GS9 A;  3LI9 A;  4GS9 B;  2P7J A;  4I3A A;  3V5X A;  1LSX A;  3F1O B;  5HD5 A;  1ODV A;  2KDK A;  2VV6 A;  3U9M A;  5IS1 A;  2L1M A;  3UB7 A;  3UME A;  1OT6 A;  4LPZ A;  3LYX A;  3RH8 B;  3MFX A;  1OT9 A;  4HP4 A;  4EEU A;  2EA9 A;  2HV1 A;  1JNU A;  1TS0 A;  1UWP X;  3UMD A;  4M4X A;  1LSW A;  2QJ5 A;  4L9E A;  3A0R A;  2PHY A;  3ULF A;  4F3L B;  2H28 A;  5IU1 A;  2OWJ A;  4R6L A;  3GDI A;  4LLO B;  1OTB A;  3OLO A;  5TBM A;  3H7W B;  4I38 A;  2QKP A;  4I5S A;  4GHI A;  5EFW A;  1VB6 A;  2PR5 A;  4I3I A;  4L9G A;  2V9A A;  2ZOI A;  4NXG A;  3FG8 A;  4HOI A;  2YKH A;  2YKF A;  3UB6 A;  4XT2 A;  4XT2 B;  3T50 A;  2OWH A;  1XJ4 A;  1MZU A;  4WL9 A;  4R3A A;  2WKR A;  3BY9 A;  1LL8 A;  5KIZ A;  3MQQ A;  3LID A;  5DKK A;  3ICY A;  3VE3 A;  1S4R A;  3ZQ5 A;  1OJ5 A;  4HY8 A;  2D02 A;  4H6J A;  1TS8 A;  1P97 A;  2Z6D A;  4H6J B;  1S66 L;  2A24 B;  2BAS A;  3H82 B;  3VE4 A;  4HJ3 A;  2PYP A;  1NWZ A;  5HWV A;  2PYR A;  1BYW A;  3SW1 A;  3NOU C;  4R70 A;  2QJ7 A;  5G4Y A;  5HD3 A;  1XFN A;  3F1O A;  3PHY A;  1EW0 A;  4JGQ A;  2VLG A;  2PD8 A;  3E4P A;  3LIB A;  4BBU A;  2JN7 A;  4BBT A;  3MR0 A;  3LIC A;  3C2W A;  3UB9 A;  4I39 A;  1XFQ A;  4L9F A;  4LRY C;  3CAX A;  3F1P B;  4KUK A;  3LIF A;  3MJQ A;  1XJ3 A;  2I9V A;  5HWT A;  1UGU A;  1N9L A;  1F98 A;  2J80 A;  1T1B A;  1N9N A;  1OTA A;  4HP9 A;  3U9J A;  1OTD A;  4GW9 A;  4RQ9 A;  1TS7 A;  2D01 A;  2VEA A;  5DKL A;  1T1C A;  1V9Z A;  1WA9 A;  1X0O A;  4F3L A;  3G6O A;  4HHD A;  3V5Y A;  3IBR A;  5HZH A;  2QHK A;  3H7W A; 
#chains in the Genus database with same CATH topology
 1OJG A;  3F46 A;  2BL2 A;  1I4Y A;  1M40 A;  1Z63 A;  2W3G A;  3IF6 B;  4NXB A;  3FC7 A;  1ALQ A;  2JKT I;  3AGU A;  3QP4 A;  5F68 A;  3O39 A;  4XTK A;  2W0N A;  2XRH A;  1Q0M A;  2EPM X;  2EPO A;  1RKE A;  1KGG A;  3NHQ A;  3R7C A;  4EQ1 A;  4Z9J A;  2WUQ A;  1KTM A;  4LDK A;  2XLE A;  3CEX A;  4OIQ F;  2NUT C;  1TS6 A;  3ZNY A;  2GX5 A;  4PM5 A;  3ZQY A;  2A1D D;  1WWP A;  1TWH A;  5CX7 A;  3FHD A;  4GDN A;  3U2M A;  3LS0 A;  4C7O A;  2V8C A;  3NJA A;  2ZM0 A;  4O7D A;  2X02 A;  4Y17 A;  4RDA A;  3OPR A;  1D1C A;  5B1A C;  3E2L A;  4N9L A;  4DVZ A;  4CSA A;  3X2Q C;  4QPR A;  3NBL A;  1K55 A;  1DJC A;  1YVI A;  5F5F A;  1XJ6 A;  4EV4 A;  3HUM A;  5DJT A;  4OOY A;  3EG9 A;  2OV5 A;  4EER A;  4KG6 A;  2OAP 1;  1YM1 A;  1LT0 A;  3H82 A;  3K6B A;  3IXG A;  2HKV A;  1FOF A;  3ABL C;  3JVU A;  2BE5 F;  5F5Y A;  4NXE A;  2QTV A;  4R38 A;  4QWO A;  2LB9 A;  3PBO A;  5FI2 A;  1OW8 A;  1XGJ A;  4OQ0 A;  2AWY A;  4CDY A;  3HNL A;  4C75 A;  3GWN A;  4PAC A;  4X0R A;  2R7Q A;  1ZHH B;  2HZ5 A;  2P9V B;  1LI0 A;  3LLK A;  3LR4 A;  3QP8 A;  3EGX B;  3MQ0 A;  5FZT A;  2EIK C;  1Y4O A;  3CPT B;  1LL5 A;  2W3D A;  5D91 A;  5EUA A;  5A69 A;  3N0T A;  1ZHZ A;  5GLC A;  2PX3 A;  2KX6 A;  1K57 C;  5F6A A;  3C4P A;  4E04 A;  4MS2 A;  3M2J A;  3DMD A;  4OOM A;  1NJ4 A;  3F1P A;  5L0G A;  2Y4A A;  1PIO A;  1GA0 A;  1CQA A;  4LV3 A;  3S84 A;  5EVI D;  2HMZ A;  4JJG A;  3RH3 A;  2YVK A;  1VET A;  4DDY A;  4JIO A;  5JRA A;  1CI9 A;  1MPL A;  5HAQ A;  4UQI S;  1J8Y F;  5AQ9 A;  3SS4 A;  1OW6 A;  2VB6 A;  3FOP A;  3I7J A;  4XEV A;  4BL3 A;  1QMF A;  4JGP A;  4MN6 A;  3ZIB A;  4KQD A;  3D72 A;  3T4K A;  3A3I A;  2IBF A;  1HLU P;  1T9K A;  3E4Q A;  5GL9 A;  4LLC A;  3FYZ A;  4DBR A;  2JE5 A;  3K3D A;  4MVQ A;  1BLH A;  3MS6 A;  3CUE A;  4ETZ A;  3HTK C;  1RP5 A;  4KZB A;  5CGS A;  2I72 A;  3L7H A;  2KSF A;  3S9O A;  3RJU A;  4RX3 A;  5E2F A;  4MW8 A;  4QY5 A;  3TQO A;  4WJ0 A;  2EFU A;  1L0E A;  4BJ5 A;  2OKU A;  2R7U A;  3RW0 A;  3HBR A;  3KYE A;  3MXQ A;  4X6T A;  5F83 A;  1V74 B;  2QE9 A;  1QZX A;  3SH7 A;  3S27 A;  4NCQ A;  2EIN C;  1CPR A;  4CIP A;  2ZOH A;  2HP5 A;  1ZG4 A;  4C3B A;  3KH2 A;  1GA9 A;  1PNE A;  4P87 A;  1C03 A;  4GEH A;  1K04 A;  1S67 L;  2FH5 A;  4WMC A;  1Y6D A;  4HFF B;  4N6C A;  2ZM2 A;  3RQG A;  4GD8 A;  3LR0 A;  1UFB A;  4FX5 A;  3IXH A;  5HV9 A;  1YYJ A;  1EA8 A;  2Z15 A;  1SCW A;  2NUP C;  1ZKJ A;  3WRT A;  2EIM C;  3BFE A;  5DJU A;  4GNU A;  3A0S A;  4BLM A;  4IJG A;  4E3J A;  5A90 A;  3SS5 A;  1WAS A;  3L8J A;  4KC9 A;  2L0W A;  3ITF A;  3T4R A;  2CW0 F;  3RTY A;  4WMC D;  4G3K A;  3VSL A;  4HQA A;  2JC7 A;  2DRW A;  3NOP C;  3KX0 X;  3JCU Q;  4KZ7 A;  1GSX A;  1U89 A;  1GSV A;  2ZQ8 A;  1K25 A;  5HL1 A;  1G5Z A;  4WUJ A;  4O7G A;  3EFO B;  3B0V C;  3HJK A;  1PD1 A;  4HES A;  1H3Q A;  3EQU A;  1NFN A;  1BUL A;  3AGF A;  1E4D A;  1RGY A;  4K0X A;  2G2U A;  4HIA A;  2ZQ7 A;  2OOL A;  3UO9 A;  1ZTU A;  5FEG A;  1AUE A;  4WF0 A;  2EXB A;  2XR0 A;  3GQZ A;  4GS9 A;  3SP1 A;  3Q7L A;  3LI9 A;  4DVY P;  1LPE A;  5KYX A;  2P7J A;  3KPH A;  4DOZ A;  5GLA A;  1LIH A;  4MCW A;  4LV2 A;  1D1A A;  2G62 A;  4ZBE A;  3F1O B;  1VHM A;  1MMA A;  4YNR A;  2PBE A;  3POV A;  2KC3 A;  1IEL A;  5EVI C;  3ZFZ A;  3HL9 A;  4G7Z F;  2HPB A;  1ES4 A;  1W63 M;  3U9M A;  2ACG A;  2OU6 A;  3HLF A;  3Q7V B;  3DZA A;  5HX9 A;  2XSS A;  2VGK A;  1FMW A;  3GM1 A;  3UME A;  1VOM A;  5E33 A;  4PAU A;  3T4O A;  2RD9 A;  3RH8 B;  2PBY A;  3Q6M A;  2J8Y A;  1CJF A;  1YLM A;  1F5M A;  3A9C A;  4OQI A;  2O9C A;  3LO7 A;  3KSG A;  2LB5 A;  3AJM A;  1EQ1 A;  3EEA A;  3T4L A;  1KE4 A;  2ICW G;  2OEX A;  4J7Y A;  3G4P A;  4OD5 A;  4MBK A;  1UWP X;  3EH1 A;  5A93 A;  3RXW A;  2WZZ A;  4GYT A;  2QJ5 A;  2ZL1 A;  1Q0G A;  3VRC A;  1ZZP A;  3VYW A;  1WYB A;  1I5Q A;  1E86 A;  4X69 A;  4JZA A;  3FAP B;  1E83 A;  4UQI M;  2PAV P;  5IU1 A;  4P0M A;  4IGG A;  1HW1 A;  4LLO B;  3M6H A;  1YQS A;  4EWF A;  5L8M A;  3ASO C;  2R02 A;  2ZQ9 A;  2Y3D A;  5AQB A;  4E17 A;  1FQG A;  3U3B A;  4ETX A;  1PI5 A;  3PAE A;  4JLF A;  4KQQ A;  3BEB A;  2PT7 A;  4GHI A;  3VAY A;  2R7T A;  1NZO A;  2IWD A;  1JR8 A;  4KZ5 A;  5FAP A;  1OXB A;  1ERQ A;  2Q9A A;  4GB7 A;  3E70 C;  3W8H A;  2C5W B;  2ZOI A;  4NXG A;  1YLT A;  4HOI A;  5FL3 A;  4BJ5 C;  1G6O A;  5EVL A;  3U0C A;  4JUR I;  4XT2 B;  1NZE A;  2H10 A;  2J9W A;  2UWX A;  1XJ4 A;  1BR2 A;  4GN2 A;  2ZMF A;  3N7W A;  5FEF A;  3LS1 A;  4O8G A;  3QTH A;  3M4C A;  2O0Y A;  4P6B A;  2LD6 A;  2UUH A;  1EI7 A;  4NY3 A;  2AVX A;  5D3O A;  3KO6 A;  3U5S A;  1ESI A;  4QI2 A;  1LL8 A;  2X71 A;  5HAI A;  3S7O A;  5M19 A;  4IVK A;  3TUL A;  3GAN A;  1FR6 A;  3LID A;  3MQQ A;  3C7U A;  3E0Y A;  2V1Z A;  4JTC B;  3S1Y A;  2W1R A;  2EX2 A;  3ICY A;  2R7W A;  4Q8I A;  1BZA A;  3G50 A;  4WEK A;  1DOV A;  2UUI A;  3GEH A;  2Q9C A;  2D02 A;  1SKO B;  1TS8 A;  4H6J A;  4Y0O A;  2IXP A;  2QY9 A;  4LCM A;  1I4Z A;  4NTA A;  1SF8 A;  2ZQD A;  3T6J A;  2QNL A;  3VE4 A;  2JKR M;  5AQA A;  1LI5 A;  4MTF A;  1JVJ A;  1FCN A;  3V5M A;  3RFB A;  2CNW A;  4YT5 A;  5HWV A;  4DE2 A;  3V3R A;  2L6G A;  4M63 A;  2V2F F;  4ZRR A;  2HDR A;  1TQG A;  1O87 A;  1NRF A;  5KYU B;  4R70 A;  2QJ7 A;  2AU5 A;  4K0W A;  3S7Q A;  3D9Y A;  5FI6 A;  1XFN A;  2LP4 A;  4XEK A;  3PHY A;  1VLS A;  1BLP A;  5IHV A;  1Q0F A;  1ZHY A;  4S2P A;  5HW3 A;  3L0I A;  1K0K A;  3IPM O;  4XLN F;  1MWR A;  1OQC A;  4LV0 A;  1KU2 A;  4WZ5 C;  3NKD A;  2CNW D;  1JOG A;  2ZXO A;  5KYY A;  2E8I A;  3LIC A;  4YL3 A;  3C8G B;  4X1M A;  5DF8 A;  4B88 A;  1ZU5 A;  3EZH A;  5C5K A;  4JJF A;  4I39 A;  1HMD A;  3UB9 A;  3MBZ A;  2EPN A;  3X1O A;  1C17 M;  3LIF A;  3WWX A;  4DN0 A;  3FXH A;  2WGW B;  2DI3 A;  1KE0 A;  1UGU A;  3G35 A;  2W3H A;  1P9R A;  2G7U A;  1XZQ A;  1OCC C;  3UB5 P;  4X56 A;  4BWI A;  2VH3 A;  5B1B C;  2Q9M A;  3VOZ A;  3MYF A;  2E87 A;  4FCF A;  4QD4 A;  1MMG A;  5CI9 A;  4JCZ A;  3FPV A;  4UAA A;  4LGW A;  5CIV A;  3G6O A;  2ZQC A;  1Q0D A;  3R2P A;  1LHY A;  3C30 A;  1ZC2 A;  3EHN A;  3IBR A;  4DXC A;  5AQ7 A;  5FSR A;  1KDS A;  4MNR A;  4PMA A;  1A41 A;  2ZM8 A;  4U0T A;  3H2U A;  2ZLY A;  4NC3 A;  5HSQ A;  1QVX A;  1ZU4 A;  1PW1 A;  3VP1 A;  3VF0 A;  3SH8 A;  5EE8 A;  2Y79 A;  4L6R A;  4CS8 C;  1Z3I X;  3FVY A;  3AG3 C;  3S7N A;  3TD7 A;  3LR5 A;  1YLZ A;  1TF1 A;  5JUA A;  4KUO A;  4CX9 A;  2HV6 A;  3NUL A;  4HH3 A;  2Y55 A;  4Y0T A;  1DOW A;  2KYH A;  3O6X A;  4OIO F;  1K4F A;  4MTG A;  2B5R A;  2A0U A;  4UA9 A;  5GHZ A;  4HJ6 A;  1E25 A;  1S1Z A;  1MWS A;  3K3C A;  1LM3 B;  4BBV A;  5FQI A;  2PU2 A;  2MYS A;  4BQM A;  1OXK A;  1HE9 A;  1XPB A;  2CDQ A;  2GWW A;  4DJ3 A;  1E85 A;  1N9O A;  3OCN A;  4JGO A;  2LIG A;  5FDS A;  3OCL A;  4EUZ A;  3VM6 A;  2A68 F;  1SDN A;  1V9Y A;  3BY8 A;  2H7O A;  1I2W A;  4NG2 A;  4NTF A;  1M2V A;  2W1T A;  4C3Q A;  3CZD A;  1J8M F;  4EUK B;  3T1R A;  1VEU A;  3W4O A;  3NMJ A;  3JYH A;  1LE4 A;  5KYW A;  3VOY A;  3D3O A;  2XM0 A;  2JHE A;  2V1A A;  2E8J A;  1ZHT A;  3U4L P;  5DTK A;  1YKD A;  3JPU A;  4Q0H A;  4Y3I A;  1Z5Z A;  3QMK A;  4FAP B;  1YAR O;  1K57 A;  5J8X A;  1QKR A;  1BSG A;  4HJ4 A;  4XUX A;  1TEM A;  1OTI A;  3L8I A;  4CLC C;  3E4O A;  5BQG A;  1MMN A;  4NQF A;  3HLW A;  4E3I A;  2WVQ A;  3NDE A;  3CSK A;  5I5L A;  1CGO A;  2Y3G A;  4GDB A;  1FIK A;  4G0H A;  1L0D A;  2J7V A;  3EGX A;  5AVF A;  3I5P A;  1DP6 A;  3BWL A;  3IEE A;  5COM A;  3LLI A;  1A7D A;  5JSL A;  3S28 A;  4E0I A;  5CHU A;  3B33 A;  2DMW A;  2IWC A;  3DTI A;  3GEE A;  3L1M A;  4XQ1 A;  4I3J A;  2IXO A;  4JTD B;  3WS2 A;  1ZYR F;  4D4X A;  2ZBB A;  3IH9 A;  2EWV A;  4PKY A;  2ASR A;  4AE4 B;  3DE9 A;  2Y91 A;  3C8Z A;  4GKU A;  2V3C C;  2V26 A;  3FKV A;  3A3F A;  3N6I A;  3PCV A;  4PKY G;  2B0H A;  2ZC7 A;  4WN5 A;  4YT4 A;  2CMN A;  2WKI A;  2R9X A;  2KNH A;  1EI5 A;  1I2S A;  2Y2O A;  5FA7 A;  3IHU A;  1PI4 A;  2Y2Q A;  4JXG A;  3S90 A;  4LV1 A;  2XRN A;  1OCO C;  1YA7 O;  3MXS A;  4D2O A;  5G18 A;  3UE3 A;  3C7J A;  3LI8 A;  3DKA A;  4FSF A;  4YL1 A;  2R7X A;  2B02 A;  1JPN A;  3OPP A;  1D0X A;  5DF9 A;  5F1G A;  1JPJ A;  5FQJ A;  1GQA A;  4MN7 A;  5T1D B;  4GCZ A;  2QMI A;  4IBR A;  2EX9 A;  4DRI B;  3IWO A;  3CIT A;  3PBN A;  3V50 A;  5HL6 A;  2NUP A;  4U5E E;  1DP8 A;  1FSY A;  1BBH A;  1VYK A;  2QUP A;  4HI4 A;  2P6V A;  5CTM A;  4UA7 A;  1LS4 A;  1LL9 A;  1QME A;  1GS9 A;  4J32 B;  4PJM A;  3IX8 A;  3EEH A;  1TWA A;  2DYS C;  3IQT A;  4NET A;  2Y2G A;  3NI9 A;  3BRJ A;  4QU3 A;  1IZM A;  2JCH A;  1ACF A;  3IF6 C;  3WS0 A;  3EGD B;  5DS5 A;  2J9V A;  1H6G A;  2PR6 A;  3DAV A;  2AVK A;  3C4O A;  1MY8 A;  3DWZ A;  4Y15 A;  2GAQ A;  3DM9 B;  2A0B A;  1HW2 A;  2WK0 A;  3JT1 A;  5A6K A;  3OBF A;  4J30 B;  1V54 C;  1K6S A;  5FI7 A;  1SHV A;  4U5F E;  3EWK A;  4X68 A;  2RSE B;  2R7S A;  4O6N A;  1TVF A;  3QZC A;  1T18 A;  4BJ6 C;  1NZU A;  3HLC A;  4MLL A;  4JKV A;  1BTL A;  3UGP A;  3AGT A;  5TR7 A;  2ZXR A;  3OPH A;  3OC2 A;  2I8B A;  3F1N A;  4C3D A;  5CI8 A;  5M18 A;  1LSV A;  1IFQ A;  3NDG A;  3MX3 A;  1XA1 A;  5DVW A;  3LGO A;  5T3T A;  1NG1 A;  2RCX A;  5L2F A;  5EVI A;  1TD5 A;  2PBD P;  3GM2 A;  1GCE A;  4EBN A;  1GHI A;  3NCK A;  5B3S C;  5AVE A;  4I3M A;  3OPL A;  3IS2 A;  5FDH A;  3NIA A;  5T3W A;  1D06 A;  3IX3 A;  1Y28 A;  4P85 A;  2IXM A;  5HDC A;  2Y2J A;  3C8C A;  1XJ2 A;  3JSE O;  4N9K A;  3T9O A;  4OPQ A;  4DDS A;  4KBL A;  3ZG7 B;  4MBF A;  5GLB A;  5E3A A;  3V5X A;  2KJG A;  5E3C A;  4FH4 A;  2OSU A;  4IWB A;  5BQI A;  2WZF A;  5FAQ A;  5CHM A;  5HD5 A;  4OPR A;  3R7W A;  2ETS A;  3C38 A;  3EGX C;  4R1G A;  1ZVZ A;  2XD1 A;  3S29 A;  2XLW A;  3C63 A;  2Y2P A;  2A69 F;  3ZWI A;  3T1Q B;  3NYM A;  4O6Y A;  3UB7 A;  2JX0 A;  4W8K A;  1Z6F A;  1G6A A;  2OQM A;  2EX6 A;  3LYX A;  3MFX A;  4EWC A;  5BQH A;  3LFV A;  1XWJ A;  4B6I A;  1T5O A;  4R4S A;  2A3U A;  1H8Y A;  4E3L A;  5B3I A;  3ZSU A;  3WS1 A;  1SDE A;  1B68 A;  3UMD A;  3UPO A;  4MVO A;  1GHM A;  3U2L A;  4P9F A;  2YEV A;  2L6F A;  4GLQ A;  3QW1 A;  1IYQ A;  5IY5 C;  3V39 A;  3VMA A;  4PK4 A;  2VGL S;  1AEP A;  3QP5 A;  2H28 A;  2MJ6 A;  2Q3T A;  3NRH A;  2ZC6 B;  1NY0 A;  5TBM A;  5L0I A;  3DBA A;  5DLJ A;  1TDG A;  3UNG C;  3HLD A;  4I38 A;  2QKP A;  4CDV A;  3ATP A;  2XEP A;  4LFU A;  1ONH A;  4ARZ B;  3UE1 A;  3EOI A;  1H0M A;  1VB5 A;  2PR5 A;  3KSI A;  2G2W A;  3HLE A;  3FG8 A;  2YKH A;  1K38 A;  4YOF A;  2VGJ A;  3LEQ A;  4MEZ A;  4XT2 A;  3UB6 A;  4OP5 A;  3DJN B;  2R03 A;  1M6K A;  2WZG A;  1VK5 A;  1CK3 A;  3ZG5 A;  5DTT A;  2XSE A;  2M7U A;  1YJG A;  4R3A A;  1MBL A;  3TOL A;  4IED A;  2QLA A;  2Y2I A;  3M2K A;  4HE8 D;  4DMZ A;  4C7O B;  3KL4 A;  4F4B A;  4D4N A;  2HDU A;  4QI0 A;  5KIZ A;  3GV9 A;  4JPM A;  5L0J A;  3FMS A;  4OQH A;  2Y69 C;  1K54 A;  3DD7 A;  1H9G A;  1H7I A;  1TWG A;  1FCM A;  4OON A;  2XL8 A;  1TR2 A;  2P04 A;  2J45 A;  1E84 A;  4U5B E;  3EG9 B;  1AWI A;  3NKE A;  1MKI A;  1ST6 A;  1S66 L;  2BAS A;  4GQH A;  4WZ5 A;  3MBG A;  4OIN F;  3H82 B;  4Z9H A;  3BFG A;  4OPZ A;  2XLD A;  1NYY A;  4XEF A;  1W5D A;  4HJ3 A;  2PYP A;  1JWP A;  1R5I D;  5EEC A;  1TFO B;  2H7B A;  1SR2 A;  3Q7G A;  4MTO A;  5KYU A;  3JRT A;  3E98 A;  3PBR A;  4E3O A;  4JW1 A;  2VX8 A;  3KYJ A;  5HD3 A;  1DJB A;  5E2Q A;  1Z7Q c;  3DTK A;  4MVZ A;  1L3P A;  1EW0 A;  2Q9B A;  2M4E A;  4OQG A;  1N1C A;  2A6H F;  5AGF A;  4BJ1 A;  5K0I A;  2PD8 A;  5L0C A;  1HE1 A;  5DFY A;  1OW7 A;  1M6T A;  2ZXP A;  4WEJ A;  1QLE C;  3CI6 A;  3KSH A;  1MKM A;  3EZI A;  3C2W A;  1G5U A;  3Q81 A;  4OKP A;  5CEC A;  1AVO B;  3MZE A;  4PM6 A;  3F1P B;  2AP3 A;  5A91 A;  4K0D A;  1W7F A;  1VMA A;  3MXR A;  3WOD F;  1XJ3 A;  5HWT A;  4JEA A;  1PWC A;  5TJ5 E;  2IM8 A;  1Z09 A;  3VP3 A;  2OJQ A;  1N9N A;  1KNY A;  4UHU A;  3C5A A;  2Q9N A;  4HP9 A;  2HMQ A;  1VET B;  1S6R A;  4KQO A;  1OTD A;  3MZD A;  1G4U S;  4CS8 A;  4GW9 A;  5E2G A;  5MC7 A;  4PJL A;  1T1C A;  3BRM A;  1V9Z A;  3ASN C;  4F3L A;  4HEF A;  4HHD A;  1S0W A;  4QB8 A;  3OOV A;  5L0D A;  2JKG A;  3S7P A;  3KYQ A;  4JVS A;  3M15 A;  4XWJ A;  3EJN A;  4CJO A;  2XH9 A;  3N8S A;  2YLD A;  3I4U A;  4YL0 A;  4LDQ A;  1YSQ A;  3H7W A;  5L0H A;  4LER A;  2VV7 A;  3W4P A;  3CWF A;  2XGN A;  2XFS A;  2XRO A;  3TE8 A;  3ZCZ A;  1VYI A;  2Q4F A;  2FFF B;  3RIP A;  3LUT B;  4WM9 A;  2J3T C;  1T6Q A;  1NXY A;  3GWL A;  3CLO A;  3LY3 A;  1O5H A;  2YZS A;  1PCX A;  3FAJ A;  2EXA A;  3HKK A;  5CER A;  4JXV A;  2V0U A;  3UB8 A;  5AJG A;  2VGL M;  3LES A;  3ITA A;  3RVZ A;  2QWS A;  3HJI A;  2ZQA A;  2LFD A;  5EVE A;  2WVN A;  1FFH A;  2YLI A;  4J7T A;  4W8P A;  4N1H A;  3LIA A;  3K66 A;  4ULV A;  2C6W B;  2J9B A;  4N4W A;  4KI2 A;  4AL1 A;  5L3V A;  4GD6 A;  2Z2M B;  2XS8 A;  5A6J A;  4OH0 A;  5L09 A;  4MW3 A;  4CLC A;  3G4Z A;  2XDM A;  4N92 A;  2XA7 S;  4G7H F;  3K2N A;  5FQK A;  4C3E A;  2Y2N A;  4JF4 A;  3T1S A;  4Q4Z F;  1ORS C;  5EM0 A;  2ZC4 B;  1HMO A;  1PV3 A;  1RCP A;  5CHJ A;  1WE4 A;  4CLC E;  2VCB A;  2P74 A;  2Y2K A;  3HVF A;  5BOH A;  2IYL D;  2A24 A;  1YZC A;  2V8F A;  5GPG B;  1DRM A;  2XXA B;  2O9A A;  2M1C A;  2EIL C;  2XLN A;  4Q0J A;  2PDR A;  3TJ6 A;  1HVB A;  1DP9 A;  5A8B A;  1H9T A;  3UE0 A;  4CLC D;  4UDV A;  3P7N A;  2VV8 A;  1RKC A;  1ORJ A;  4R32 A;  5DQZ A;  1K54 C;  3PAG A;  4MN5 A;  3ZGA B;  4XUZ A;  1IYO A;  2LCH A;  4IUH A;  4KZ6 A;  1BZ4 A;  4CIH A;  3NOT C;  4LEN A;  5HDD A;  2BTF P;  1LVK A;  2XLO A;  2YRF A;  1A0B A;  1Y4C A;  2RL3 A;  3UPN A;  4JRZ A;  2BLS A;  3GEI A;  3K1I A;  4G7O F;  2XFT A;  3KYI A;  5A92 A;  3T4J A;  4EW7 A;  3V3S A;  2Y8H A;  4ANJ A;  1K40 A;  3IXD A;  3QNC A;  5KYX B;  2QPN A;  2KQ9 A;  3H9W A;  4MMN A;  5CGX A;  1M56 C;  4LLE A;  3ITB A;  1GSW A;  3VP0 A;  3H65 A;  1OCZ C;  3GEC A;  4LCL A;  4BL2 A;  3P09 A;  4YWQ A;  4ZLD A;  1H5X A;  2P7V A;  3ZTZ A;  2D5R B;  2C04 A;  2FAP B;  3LAY A;  2PD7 A;  1DJA A;  2WAF A;  4JF6 A;  1XZP A;  4X55 A;  3MLG A;  1OR3 A;  1VLT A;  2Y2M A;  3BW6 A;  3NC8 A;  2ZPA A;  5AC4 A;  1MMD A;  4R4R A;  4U9D A;  4EET B;  4MVR A;  1C3B A;  3MKE A;  1KE3 A;  2X51 A;  3B29 A;  4OVD A;  4K1O A;  5TFQ A;  3ZQV A;  4JXW A;  4JGR A;  4LRX C;  4OPY A;  4JF5 A;  2ZXW C;  2Y39 A;  4D60 A;  4HNB A;  4X53 A;  3QVY A;  3Q6N A;  1TKN A;  1OTE A;  2P0N A;  1PW8 A;  2QZ6 A;  3CJM A;  1UWN X;  3RYL A;  1DY6 A;  2W4M A;  4KG2 A;  4P6I C;  2R7O A;  2ZL1 B;  3IF6 A;  2PRF A;  1NLZ A;  1CF0 A;  3DXJ F;  3DWK A;  4E0H A;  2P61 A;  2R7V A;  3LNR A;  3UR3 C;  3IQ6 A;  3C62 A;  3EQL F;  1P0Z A;  3OA1 A;  5KZH A;  4MVU A;  3WG7 C;  4BG0 A;  1BR1 A;  3NY4 A;  2WB7 A;  1E3U A;  2LQG A;  3PXP A;  3BEH A;  4AK9 A;  2R78 A;  1YYX A;  1YAU O;  4GHI B;  3RXX A;  3U8V A;  4BJ6 A;  2GNX A;  4K7B A;  1K56 D;  5F69 A;  4O0P A;  4G3V A;  4EXO A;  4YJW A;  2INW A;  4B9O A;  2OAQ 1;  3BEC A;  3ZG1 A;  2XLH A;  2XL4 A;  2XM4 A;  5FAO A;  1Y54 A;  4FUW A;  5DF7 A;  1ZW2 A;  3GMW A;  4U5H A;  4PR9 A;  3PDM P;  1IOU A;  1E3U D;  3G2Y A;  4Z9I A;  1I5N A;  1PWG A;  3MKF A;  5GLD A;  4EBB A;  3D4F A;  2XF3 A;  1KOU A;  3I5Q A;  3W4Q A;  3G32 A;  2O9B A;  3VOL A;  1CGN A;  3J06 A;  4A5R A;  3QP6 A;  3GOD A;  3VV4 A;  4WLA A;  3T12 B;  2L4R A;  1O3U A;  2CGE A;  1T01 A;  3SYN A;  5JS5 A;  3PYP A;  4N6H A;  2HDS A;  4NXF A;  2ZD9 A;  1V55 C;  4UEY A;  3QNB A;  1A7E A;  3UE6 A;  1SMY F;  2M7V A;  4EU0 A;  3O86 A;  3K1H A;  4A4A A;  4EBJ A;  1ESU A;  5EV0 A;  2XA7 M;  2P9V A;  2V0W A;  1IYP A;  4OLD A;  5HDS A;  4Z1W A;  3UDX A;  1S1Y A;  4DKI A;  1CGM E;  3OZH A;  3MF0 A;  3CPT A;  5JP7 A;  4ZJ3 A;  4YK5 A;  4R3J A;  4JCH A;  1BDJ B;  3RF3 A;  5COF A;  3FOO A;  3SXK A;  4DJ9 A;  3MFD A;  2HDQ A;  2VA0 A;  1JTG A;  4O01 A;  1S7Z A;  2YLG A;  1Z23 A;  5E2E A;  3ZG0 A;  2J46 A;  2KGO A;  4CDA A;  2ZC3 B;  3RKO F;  1MWU A;  3DTE A;  4EBP A;  1NLY A;  2UV0 E;  1JTD A;  5TJJ A;  1R4T A;  4JXS A;  2X0C A;  1LSX A;  4CQH A;  3IBJ A;  2WAE A;  4JEB A;  4JE9 A;  2LFF A;  4KZ4 A;  2X01 A;  3T4T A;  2YKZ A;  1F1M A;  1RJ9 B;  1O07 A;  2VV6 A;  4OIR F;  1L0G A;  4Z9Q A;  5EHH A;  2B18 A;  3K1I C;  3ZHH A;  2HJM A;  2PF4 E;  5GHY A;  1WGW A;  3QW0 A;  4ZTK A;  2HJ3 A;  1OT6 A;  4NKP A;  4BEJ A;  1RCJ A;  2H0Y A;  4GOG A;  1OT9 A;  5HAR A;  3AG4 C;  3L9K A;  2Q00 A;  1F2K A;  3ZVR A;  2EA9 A;  1JRA A;  2OJE D;  1WTY A;  1GM5 A;  1Q2Q A;  3EH2 A;  3IT9 A;  3L34 A;  1ES3 A;  3A11 A;  3W8K A;  4CJG A;  1FR0 A;  4PM8 A;  4M4X A;  1T6I A;  1LS1 A;  1LSW A;  5A6B D;  3PHF 2;  1D0Z A;  1L3L A;  3WHN A;  3A0R A;  3MFN A;  4S2N A;  4E18 A;  4H8R A;  1VM1 A;  2EPL X;  4CS9 A;  4KQR A;  1OCR C;  1G8X A;  2W45 A;  3ULF A;  2H7V C;  3B0U X;  4NK3 A;  3H2V A;  4U5C E;  2HS5 A;  3N8R A;  5AC5 A;  3B3X A;  4OIP F;  3OLO A;  3NG1 A;  2NUT B;  1JWZ A;  2ZJ9 A;  4R3B A;  2NG1 A;  2XL6 A;  4EHP A;  1PZP A;  4FOF A;  4S2M A;  2VAS A;  4BEM J;  1UG7 A;  3S0X A;  5EFW A;  4H54 A;  1ERO A;  2YL7 A;  1U6H A;  2GDN A;  2C03 A;  4ARZ A;  4HBT A;  4XLP F;  1EKY A;  5DFX A;  1RXQ A;  1VB6 A;  5TGF A;  4L9G A;  1BLC A;  3T1X A;  1N9B A;  1MQV A;  4YT2 A;  5CTN A;  3KKB A;  1D0Y A;  2HSB A;  3MZF A;  4WEL A;  1CPQ A;  4XXR A;  2WKE A;  1O7E A;  2NSF A;  3Q7Z A;  3RFY A;  1SZI A;  3SS3 A;  4RBN A;  3ZDL A;  3MMH A;  4CBE A;  2GZA A;  3M79 A;  4WL9 A;  2Q0O A;  5DTS A;  3K7D A;  4IAO A;  3DTM A;  5L10 A;  1H8Z A;  1FFT C;  2WKR A;  3BY9 A;  5HPF A;  4K91 A;  4P6Z S;  3EGD C;  5CXW A;  4ID4 A;  1WOL A;  5JT4 A;  3T4S A;  2L9J A;  5DKK A;  1J9M A;  4IHQ A;  1ORY A;  4XPY A;  4U5G A;  2V20 A;  3ZG8 B;  1CI8 A;  2J9P A;  2QYB A;  4DE0 A;  4FWV A;  4Y0U A;  2HUJ A;  1M2V B;  2W1T B;  3ZQ5 A;  4IJJ A;  3IXB A;  2IOQ A;  1P97 A;  3RQE A;  1VEU B;  3EFO A;  3N24 A;  4G3W A;  2YL1 A;  3P01 A;  5KYW B;  5L3Q A;  4N06 A;  2HZ8 A;  2WZX A;  2YL0 A;  5FQQ A;  2P08 A;  4L0L A;  3ZYT A;  1XGI A;  3DAF A;  1PYY A;  5EOE A;  1BYW A;  3G30 A;  3AGD A;  3SW1 A;  1PFL A;  2ZC5 B;  2BG1 A;  1M2O A;  3PBT A;  5G4Y A;  1L0F A;  4MQ9 F;  3T6B A;  3F1O A;  4EKW A;  1MC0 A;  4B4X A;  2K31 A;  2VLG A;  1TWC A;  2G3V A;  3MSH A;  1FR1 A;  2D4U A;  3ZTM A;  3JYI A;  4CJN A;  4YN0 B;  1OPX A;  1JWV A;  3CG5 A;  4E3N A;  2JN7 A;  4GZB A;  4U5D E;  3Q7V A;  4U0X A;  4EUV A;  1FIL A;  3HCY A;  4BBT A;  3BLS A;  3MR0 A;  1IKG A;  4G78 A;  1IYS A;  2KOI A;  3HLB A;  3AOU A;  5EOO A;  1XFQ A;  1YMX A;  4L9F A;  3AGE A;  4LRY C;  4WGZ A;  3CAX A;  3AG1 C;  4KUK A;  2DCF A;  1EWZ A;  5M1A A;  2J0W A;  2YWA A;  1ZHW A;  3T6G B;  3QVZ A;  4Q0I A;  2VC9 A;  1D1J A;  1T1B A;  2J80 A;  4PM9 A;  5EPH A;  1OTA A;  1PWD A;  3Q1F A;  1BR4 A;  2GDC A;  1KVL A;  3ZVW A;  4OD4 A;  3U9J A;  1KDW A;  3HUN A;  1SKF A;  3IWQ A;  4RQ9 A;  1BUE A;  1TS7 A;  1G4W R;  1W63 Q;  3ISG A;  1YPR A;  1SZV A;  5FQM A;  3FV7 A;  2D01 A;  5DKL A;  1WA9 A;  5A6A A;  1X0O A;  3UPP A;  5I94 A;  5CED A;  2OLV A;  2LK4 A;  4FH2 A;  1HY5 A;  5DS4 A;  4XPX A;  5HZH A;  3NMI A;  4Q7C A;  2OCC C;  1FSW A;  1W2W A;  1ZW3 A;  2WVO A;  1G28 A;  1D7E A;  1IKI A;  1N4O A;  1TFK B;  3B9Q A;  3GM3 A;  3Q07 A;  4KZA A;  3NYJ A;  2J3T D;  2HP9 A;  2YL3 A;  3AQC A;  3GTC A;  3M6B A;  1JMW A;  5FAT A;  3EPV A;  2P1A A;  2NUP B;  4S2N C;  3HLZ A;  4CS9 C;  4DJ2 A;  5J3W A;  3SXM A;  1XX2 A;  2GFH A;  4Y2F A;  1RKE B;  1K6R A;  3FPW A;  2XK1 A;  1CEG A;  3IF5 A;  3P98 A;  2LSE A;  3WAQ A;  3M1C B;  1IEM A;  5KMW A;  3KYZ A;  3W8I A;  2HV7 A;  1K4E A;  4IBX A;  4EES A;  1IW7 F;  1JAF A;  1F9I A;  3SOI A;  4F94 A;  1OME A;  3G2Z A;  4LRZ E;  4QY6 A;  5U47 A;  3TSG A;  4N1X A;  1E2X A;  3QHY A;  1P9W A;  1PZO A;  4BPM A;  1GHP A;  3NEC A;  4ONS A;  3U2A A;  2M64 A;  1FMV A;  1YZA A;  3DM5 A;  2J9U A;  3JVV A;  4B4Z A;  3N2Z B;  2R25 A;  4DBQ A;  4E7S A;  1OKK A;  3E9V A;  1SKO A;  1YDI A;  2R9R B;  2GA0 A;  4UA6 A;  3PMR A;  5F1F A;  2XXA A;  1TDL A;  4Y5F A;  1ONG A;  4MVS A;  1NLX A;  4ULW A;  3MQO A;  3UDI A;  5GHX A;  3DAG A;  4PJN A;  1BLS A;  3W4Y A;  3F1N B;  2A6E F;  4KZ3 A;  2Y2L A;  2R05 A;  4CSA C;  1MNE A;  4O6M A;  4A2N B;  4P6Z M;  3B42 A;  1OKK D;  1K55 C;  3FWL A;  3G34 A;  2CYD A;  5K5B A;  5EM1 A;  3ZC4 A;  5EVI B;  3B0P A;  1AXB A;  4HFK B;  1T19 A;  3O87 A;  3PBS A;  3O5Y A;  1V4A A;  1Q2P A;  3GVB A;  4AL0 A;  3U3F A;  2VJW A;  3C8G A;  3IS2 B;  2CCY A;  2OLU A;  1WYC A;  3SH9 A;  2FZ0 A;  4II7 A;  4BJT A;  1YT4 A;  3FDQ A;  2W3F A;  4U3T A;  4BD1 A;  2WGW A;  3DWW A;  3TJZ C;  2VK3 A;  3V67 A;  4X1L A;  1PRQ A;  2BC5 A;  2I15 A;  3R7W B;  4MDZ A;  1D1B A;  4OLG A;  3UN7 A;  3C8G D;  2V1B A;  5HWW A;  1HZO A;  5HPI A;  2F22 A;  4R23 A;  1WAT A;  3W2V A;  4FD8 A;  2PFD A;  4RA7 A;  1ERM A;  3T4Q A;  4ZDX A;  3US6 A;  2IA2 A;  4AFI A;  1MWT A;  3V7O A;  2WYX A;  1T6U A;  2WZL A;  5F82 A;  2H5S A;  3NMK A;  2Z2L B;  3ZG9 B;  3ZNT A;  3JRM O;  3ZDJ A;  2Q7R A;  4DF6 A;  3F47 A;  5COG A;  2O99 A;  2DYR C;  3U8P A;  4WAB A;  3ZVT A;  5HSW A;  4S2K A;  4HH2 A;  4OOL A;  3S22 A;  5F28 E;  3LJB A;  2A2L A;  5DQT A;  1W8Q A;  4I1O B;  3A3E A;  3A3D A;  3B47 A;  1Z6A A;  3N4I A;  2JBF A;  3LIE A;  3B71 A;  3BJN A;  3G4X A;  1NBB A;  4B93 A;  2GJ3 A;  3BLM A;  3SNH A;  3PR6 A;  4YWZ A;  2DGJ A;  4ZJ1 A;  5TBM B;  4EQI A;  2PP4 A;  3WRZ A;  3FKW A;  3LEO A;  4RX2 A;  5J4E A;  2YHS A;  5J7E A;  3CUE C;  3C18 A;  2H0T A;  5KYN A;  4I44 A;  2FFH A;  5HFO A;  2CC1 A;  4AX2 A;  3TK0 A;  2XS1 A;  4YT8 A;  4PJJ A;  5HAP A;  4EEP A;  3LY4 A;  3N8L A;  3W2Z A;  3OWT A;  5G4Z A;  3BFF A;  4KZ9 A;  1L7C A;  3V5Z A;  2B0J A;  1FCO A;  4RD9 A;  5CRF A;  1ES5 A;  5DVA A;  4O79 A;  1YLJ A;  3WS5 A;  4ESP A;  2MWQ A;  3GOR A;  4MBH A;  4E7Z A;  3O88 A;  4PHT A;  4PM7 A;  2W27 A;  3MYI A;  4RVA A;  4KNW A;  1VTM P;  5E43 A;  2HSQ A;  4K08 A;  4RYE A;  2DB4 A;  2WKQ A;  2W3E A;  4KNV A;  1OR2 A;  5FQ9 A;  1APC A;  5IT5 A;  2OEV A;  5FCL A;  3IQA A;  3UMK A;  4Y7P A;  5L07 A;  3BQA A;  1S05 A;  4HBU A;  4DE1 A;  3TOI A;  3SEO A;  3LUQ A;  2K7S A;  4E3M A;  3IQ5 A;  3IHB A;  4PFP A;  1S4S A;  1T1A A;  5DS6 A;  2L6H A;  3S4X A;  2KK1 A;  2R9W A;  2HF6 A;  3UMI A;  4S2I A;  1QPU A;  2EX8 A;  2KLI A;  3KSF A;  2IWB A;  3HNK A;  2WKP A;  2KW3 C;  3G31 A;  1YA9 A;  3KMI A;  2J7P A;  3A0V A;  3JZ0 A;  3ABM C;  4CPK A;  1LI9 A;  4KEN B;  3LCE A;  5FAS A;  3DE8 A;  2Z6C A;  2O9X A;  3JTL O;  3UGO A;  4GS9 B;  4YIN A;  4AE4 A;  4QJG A;  1M57 C;  4I3A A;  2H8A A;  1CEF A;  4JKT A;  4PPR A;  5F5H A;  3BFC A;  2IXN A;  4MND A;  1GGQ A;  4NTB A;  1ODV A;  2J3W A;  3DJU B;  1RJ9 A;  4Q5S F;  3Q82 A;  1KVM A;  2KDK A;  2EPK X;  3CQZ A;  2J7P D;  2HP6 A;  2Y59 A;  3ECS A;  3ABK C;  5IS1 A;  4BD0 A;  4I1M A;  1YLW A;  2W4B A;  2L1M A;  2WGV A;  1SYQ A;  3JSZ A;  4FES A;  4LPZ A;  4QHC A;  4DRH B;  4IVI A;  2XQZ A;  4HP4 A;  2G3K A;  2FGY A;  2OOC A;  3CMZ A;  4EEU A;  3UY6 A;  2J9O A;  5JVE A;  4DXW A;  1YMS A;  1ZHX A;  2HV1 A;  4ME4 A;  1NU7 D;  1JNU A;  1W79 A;  2VCA A;  2HGV A;  2AWC A;  3WS4 A;  4EIY A;  3M4B A;  1TS0 A;  3TJ5 A;  3IHA A;  2WKH A;  4L9E A;  4XPW A;  1J3W A;  3LEZ A;  1WN0 A;  1FNT c;  3BM6 A;  2WAD A;  3VFF A;  4S2L A;  2JKT M;  1NYM A;  3VP2 A;  1K56 A;  3OEO A;  3SXY A;  2PHY A;  3QP2 A;  3R4K A;  2YQY A;  4F3L B;  3O55 A;  5BUO A;  2OWJ A;  3JYY A;  4R6L A;  3IQC A;  4NEE D;  3GDI A;  1NSG B;  4WBG A;  1LKX A;  2HJE A;  1RMV A;  2VZW A;  1OTB A;  3IH8 A;  2NUT A;  4IRU A;  4JTA B;  1MND A;  3EHM A;  1Q0K A;  4JC7 A;  3H7W B;  4I5S A;  1STZ A;  2PU4 A;  4IUK A;  3CZ6 A;  3PBQ A;  3TW8 A;  4E6X A;  1LE2 A;  1YLP A;  1NFO A;  3EGD A;  3HLG A;  4I3I A;  3RQF A;  3IX4 A;  3SZR A;  1XXM A;  2NPU A;  3HUO A;  3DI5 A;  2VKS A;  1L2S A;  2V9A A;  4R0Q A;  5JYP A;  1KGF A;  2YKF A;  5EK0 A;  3RVY A;  2WL8 A;  2JPU A;  2ZMA A;  2MHR A;  3PTE A;  1K05 A;  3T50 A;  1XP4 A;  4WYY A;  2OWH A;  2B95 A;  1MZU A;  2A49 A;  2EFX A;  1W8Y A;  2PX0 A;  3BFD A;  3VSK A;  5JYO A;  2OG2 A;  4E6W A;  2EWW A;  4LDR A;  4M3K A;  5EGY A;  2ZMV A;  1HTZ A;  5D92 A;  2ZD8 A;  2JKF A;  3UMH A;  2XLM A;  2HJ9 C;  4CLC B;  3AG2 C;  4DE3 A;  1MXO A;  2FFY A;  3E2K A;  4EBK A;  4S2O A;  4HEA J;  2XLV A;  3VE3 A;  1S4R A;  3UDF A;  4ZJ2 A;  5LBR A;  4DRT A;  1OJ5 A;  3O10 A;  2VCC A;  4HY8 A;  2Y3B A;  1KGE A;  2Z6D A;  1H8M A;  1ZG6 A;  4H6J B;  3TG9 A;  1QQ3 A;  4BMW A;  1ES2 A;  2A24 B;  5KSH A;  3A3J A;  3LEV A;  1XA7 A;  4IAR A;  4BEN A;  3VFH A;  2DNS A;  2TMV P;  2W9Y A;  4DRJ B;  1NWZ A;  3EQV A;  3QP1 A;  2PYR A;  4WGY A;  4ER9 A;  3GRJ A;  4IB4 A;  1YSP A;  4S2J A;  1FAP B;  1U0B B;  3NDB B;  1RGZ A;  3NOU C;  1YLY A;  2WGI A;  3BQ8 A;  3HNI A;  2XD5 A;  3TOM A;  4ZAM A;  4QDL A;  2EIJ C;  1BT5 A;  1LI7 A;  1VQQ A;  4H4K C;  4C6Y A;  3HJC A;  3SXZ A;  1LLB A;  3GR2 A;  4KG5 A;  5E2H A;  4ZLC A;  256B A;  4JGQ A;  4GJ4 A;  3TRC A;  3UNW A;  2JKR I;  3E4P A;  3LIB A;  3GSG A;  3C7V A;  4BBU A;  3LNM B;  4KZ8 A;  5KYY B;  1NRJ A;  2PNO A;  1QSP A;  3VP4 A;  2HFI A;  1A0K A;  5A6B A;  3HRE A;  4BJP A;  3LR3 A;  4EBL A;  4JBF A;  1A7V A;  1XKZ A;  1FTS A;  3K33 A;  3MJQ A;  4Y13 A;  2I9V A;  3NYL A;  2JD3 A;  1PD0 A;  4CS7 A;  3AQB A;  3W2W A;  1N9L A;  4OP8 A;  3CHW P;  1HD8 A;  1F98 A;  3O3V A;  4IAQ A;  3FZC A;  5CGW A;  1NU9 C;  4X25 A;  1G68 A;  2Y2H A;  2J0X A;  3HNJ A;  2L81 A;  3BYD A;  4MVM A;  1C02 A;  5JLI A;  2K2N A;  5CEB A;  4FTX A;  2VEA A;  4YFM A;  4P9T A;  4U9E A;  2Y3H A;  2L7A A;  2J8W A;  1U60 A;  5KSC A;  3V5Y A;  2R7R A;  4LAC B;  1YAX A;  4WZ4 A;  4PFO A;  3SZT A;  5L0F A;  3DW0 A;  2NSG A;  3IWI A;  2QHK A;  4E3K A;  4DXB A; 
#chains in the Genus database with same CATH homology
 1OJG A;  2VV7 A;  3CWF A;  5HSQ A;  1G28 A;  1D7E A;  2XRO A;  2W3G A;  2Y79 A;  3TE8 A;  2J3T D;  4NXB A;  3FC7 A;  2JKT I;  2J3T C;  3CLO A;  5F68 A;  2W0N A;  3S7N A;  4DJ2 A;  3LR5 A;  5J3W A;  1TF1 A;  3NHQ A;  4EQ1 A;  4Y2F A;  4KUO A;  2V0U A;  3FPW A;  3UB8 A;  4HH3 A;  5AJG A;  2VGL M;  2QWS A;  3HJI A;  2NUT C;  1TS6 A;  3KYZ A;  4HJ6 A;  2GX5 A;  1S1Z A;  4EES A;  3K3C A;  4BBV A;  5CX7 A;  1F9I A;  3LIA A;  4LRZ E;  1P9W A;  3NJA A;  3U2A A;  4CLC A;  4DJ3 A;  3JVV A;  1N9O A;  3OCN A;  2XA7 S;  3K2N A;  4JGO A;  4QPR A;  3OCL A;  1V9Y A;  3BY8 A;  2W1T A;  1XJ6 A;  5DJT A;  4EER A;  4CLC E;  2OAP 1;  2A24 A;  1LT0 A;  3H82 A;  4Y5F A;  1DRM A;  3D3O A;  2O9A A;  2JHE A;  2M1C A;  2V1A A;  4Q0J A;  2PDR A;  3JVU A;  1DP9 A;  5F5Y A;  5A8B A;  1YKD A;  4Q0H A;  4Y3I A;  4NXE A;  4R38 A;  4CLC D;  2LB9 A;  3MQO A;  3PBO A;  4HJ4 A;  1OTI A;  3F1N B;  4CLC C;  3E4O A;  3P7N A;  2VV8 A;  4P6Z M;  3B42 A;  4MN5 A;  5I5L A;  4IUH A;  1ZHH B;  5K5B A;  3LR4 A;  3NOT C;  5AVF A;  1DP6 A;  5HDD A;  3MQ0 A;  3BWL A;  1T19 A;  2W3D A;  3PBS A;  3O5Y A;  3B33 A;  2DMW A;  2VJW A;  3IS2 B;  4I3J A;  2KX6 A;  5F6A A;  3T4J A;  4EW7 A;  2Y8H A;  2FZ0 A;  4E04 A;  2ZBB A;  4II7 A;  2EWV A;  4OOM A;  3F1P A;  4PKY A;  3H9W A;  2W3F A;  4MMN A;  3TJZ C;  1GSW A;  3V67 A;  3GEC A;  3R7W B;  4MDZ A;  4PKY G;  4WN5 A;  2PD7 A;  4UQI S;  2V1B A;  2CMN A;  5HWW A;  5HPI A;  3BW6 A;  4JGP A;  4MN6 A;  3T4Q A;  4KQD A;  4EET B;  2IA2 A;  3D72 A;  4AFI A;  3T4K A;  2XRN A;  4JGR A;  4LRX C;  3E4Q A;  3UE3 A;  3LI8 A;  4HNB A;  1OTE A;  4FSF A;  3K3D A;  3CUE A;  2B02 A;  4ETZ A;  2P0N A;  2O99 A;  1UWN X;  5DF9 A;  4MN7 A;  4GCZ A;  4HH2 A;  4OOL A;  1NLZ A;  3CIT A;  3PBN A;  2A2L A;  5HL6 A;  3B47 A;  1DP8 A;  3LIE A;  3BJN A;  1P0Z A;  3MXQ A;  4B93 A;  2GJ3 A;  3PR6 A;  4HI4 A;  4YWZ A;  5TBM B;  2ZOH A;  3PXP A;  3EEH A;  5J4E A;  2R78 A;  5J7E A;  3CUE C;  4GHI B;  1S67 L;  2GNX A;  2FH5 A;  5F69 A;  4O0P A;  4G3V A;  4EXO A;  2INW A;  4B9O A;  2OAQ 1;  3LR0 A;  4EEP A;  3W2Z A;  5G4Z A;  2PR6 A;  2NUP C;  3V5Z A;  1IOU A;  5DJU A;  3A0S A;  3OBF A;  4IJG A;  2L0W A;  3EWK A;  4PHT A;  1KOU A;  2W27 A;  2O9B A;  3VOL A;  4K08 A;  1T18 A;  3RTY A;  2WKQ A;  2W3E A;  4G3K A;  4HQA A;  5IT5 A;  3NOP C;  3KX0 X;  3VV4 A;  4WLA A;  2L4R A;  3BQA A;  3OC2 A;  3PYP A;  4NXF A;  1GSX A;  3F1N A;  4UEY A;  3UE6 A;  1GSV A;  3LUQ A;  2M7V A;  2K7S A;  4EU0 A;  1LSV A;  1S4S A;  1IFQ A;  1T1A A;  4WUJ A;  2XA7 M;  2HF6 A;  2V0W A;  5HDS A;  4Z1W A;  2KLI A;  3KSF A;  1S1Y A;  3HJK A;  1H3Q A;  1TD5 A;  3EQU A;  3MF0 A;  2WKP A;  5AVE A;  4HIA A;  3A0V A;  2OOL A;  3IS2 A;  1D06 A;  1ZTU A;  2VA0 A;  1Y28 A;  5HDC A;  4O01 A;  4WF0 A;  2Z6C A;  3C8C A;  1XJ2 A;  4GS9 A;  3LI9 A;  4GS9 B;  2P7J A;  1NLY A;  4MCW A;  5TJJ A;  4I3A A;  3V5X A;  1LSX A;  4CQH A;  3F1O B;  1VHM A;  3IBJ A;  4YNR A;  5HD5 A;  1ODV A;  2J3W A;  3T4T A;  3R7W A;  2KDK A;  3C38 A;  3EGX C;  2VV6 A;  1W63 M;  3U9M A;  5IS1 A;  2XSS A;  2B18 A;  2L1M A;  3UB7 A;  3UME A;  4PAU A;  3T4O A;  1OT6 A;  4LPZ A;  4NKP A;  3LYX A;  3RH8 B;  3MFX A;  1OT9 A;  4HP4 A;  4EEU A;  1F5M A;  3LFV A;  2O9C A;  2EA9 A;  3KSG A;  2HV1 A;  2LB5 A;  4ME4 A;  1JNU A;  3EEA A;  3T4L A;  2HGV A;  1TS0 A;  1UWP X;  3UMD A;  4M4X A;  1LSW A;  2QJ5 A;  4L9E A;  2JKT M;  4GLQ A;  3A0R A;  2VGL S;  2PHY A;  3R4K A;  3ULF A;  4F3L B;  4UQI M;  2H28 A;  5IU1 A;  2MJ6 A;  2OWJ A;  4R6L A;  4NEE D;  3GDI A;  2HJE A;  2VZW A;  4LLO B;  1OTB A;  3OLO A;  5L8M A;  5TBM A;  4ETX A;  3DBA A;  3H7W B;  4I38 A;  2QKP A;  4I5S A;  4FOF A;  1STZ A;  2PT7 A;  4GHI A;  4IUK A;  5EFW A;  3PBQ A;  3TW8 A;  4ARZ A;  4ARZ B;  5DFX A;  3EOI A;  1VB6 A;  2PR5 A;  4I3I A;  4L9G A;  3KSI A;  2VKS A;  2V9A A;  3FG8 A;  2ZOI A;  4NXG A;  4HOI A;  2YKH A;  5FL3 A;  2YKF A;  4YOF A;  1G6O A;  3UB6 A;  4WEL A;  4XT2 A;  4XT2 B;  3T50 A;  2OWH A;  1XJ4 A;  1MZU A;  2ZMF A;  3MMH A;  2GZA A;  4WL9 A;  2M7U A;  4R3A A;  4O8G A;  2EWW A;  2O0Y A;  4DMZ A;  2ZMV A;  2WKR A;  3BY9 A;  5HPF A;  4P6Z S;  3KO6 A;  1LL8 A;  3EGD C;  5KIZ A;  3S7O A;  3T4S A;  2HJ9 C;  4CLC B;  3MQQ A;  3LID A;  5DKK A;  3E0Y A;  4IHQ A;  2W1R A;  3ICY A;  3VE3 A;  1S4R A;  2QYB A;  4WEK A;  5LBR A;  2W1T B;  1OJ5 A;  3ZQ5 A;  2P04 A;  4HY8 A;  2D02 A;  4H6J A;  1TS8 A;  1P97 A;  2Z6D A;  1H8M A;  4BMW A;  4H6J B;  4G3W A;  1S66 L;  2A24 B;  5KSH A;  2BAS A;  3P01 A;  3H82 B;  3VE4 A;  2JKR M;  4HJ3 A;  2PYP A;  1NWZ A;  3EQV A;  3RFB A;  5HWV A;  2PYR A;  2P08 A;  4L0L A;  4ZRR A;  3ZYT A;  1YSP A;  1BYW A;  3SW1 A;  3NOU C;  3BQ8 A;  3E98 A;  3PBR A;  4R70 A;  2QJ7 A;  3PBT A;  5G4Y A;  2VX8 A;  3S7Q A;  5HD3 A;  1XFN A;  3F1O A;  3PHY A;  1MC0 A;  1EW0 A;  4JGQ A;  2K31 A;  2VLG A;  4GJ4 A;  3TRC A;  2PD8 A;  2JKR I;  1OPX A;  3E4P A;  3LIB A;  5DFY A;  4BBU A;  2JN7 A;  4WEJ A;  4EUV A;  3HCY A;  4BBT A;  1NRJ A;  3MR0 A;  3LIC A;  3CI6 A;  3KSH A;  1MKM A;  3C2W A;  5C5K A;  3UB9 A;  4I39 A;  4BJP A;  2KOI A;  3LR3 A;  1XFQ A;  4L9F A;  4LRY C;  3CAX A;  3F1P B;  4KUK A;  3LIF A;  3MJQ A;  4DN0 A;  1XJ3 A;  2I9V A;  5HWT A;  1UGU A;  1N9L A;  2W3H A;  1P9R A;  1F98 A;  2G7U A;  2J80 A;  1T1B A;  4Q0I A;  1N9N A;  1OTA A;  4HP9 A;  4BWI A;  3U9J A;  4KQO A;  1OTD A;  4GW9 A;  2K2N A;  4RQ9 A;  1TS7 A;  1W63 Q;  5MC7 A;  2D01 A;  2VEA A;  3FPV A;  5DKL A;  1T1C A;  1V9Z A;  1WA9 A;  1X0O A;  4F3L A;  3G6O A;  4HHD A;  3OOV A;  3S7P A;  3KYQ A;  3V5Y A;  3C30 A;  1YAX A;  3IBR A;  5HZH A;  2QHK A;  1YSQ A;  3H7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...