3CAXA

Crystal structure of uncharacterized protein pf0695
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
355
structure length
355
Chain Sequence
LPEGHPLKTLYQENKEIMKDAEMLNLYAKTLATTKDERMREEILGVLEEIVSSLRMVGFTHYNREEMLIFPYIERRGLTVIATVLWTKHDEIRAMIKQLAELLRKREEMPWEEFVEKFKAKAGEVAFALSDMVFRENNIFYPTLKALLSEGEWKAIKMQEDEIGYYKVKPPEWDPGEDVKPLHPWEINPELNVEQLLTLPKEVQQALRGQPLEFDKTQLKREEDIDLGTGYLNIEELKAIFEALPVDVTFIDKDDRVRFFSPGERIFTRTPSVLGRPVQLCHPPKSVYVVNKILKAFKEGRKKEATFWLRLREKYVYIKYVPLFNEKGEYIGTLEMTMDIAPYKKIEGEKRLLDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein PF0695
publication title Crystal structure of uncharacterized protein PF0695.
rcsb
source organism Pyrococcus furiosus dsm 3638
total genus 119
structure length 355
sequence length 355
ec nomenclature
pdb deposition date 2008-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
A PF13596 PAS_10 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3caxA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3caxA02
2VEAA 1LL8A 4HH2A 1UWPX 4EERA 1BYWA 4DJ3A 3IBRA 4EQ1A 3C2WA 3PHYA 1VB6A 5HWTA 2ZBBA 3K3DA 5A8BA 1F9IA 1NWZA 2HV1A 4R70A 4F3LB 3LIFA 3BY9A 4HJ3A 4L9EA 1EW0A 4MN5A 1OT6A 2L0WA 4PKYA 5J7EA 1DP8A 3UB6A 1UWNX 2QKPA 4HIAA 3LI8A 1OJGA 3A0VA 3ZQ5A 2V9AA 2J80A 2ZOIA 3F1PB 4XT2B 1OJ5A 5DKKA 2GJ3A 3F1NB 5I5LA 2YKFA 1T1AA 4BBUA 1TS8A 3GDIA 3LIBA 1GSWA 3RTYA 1T19A 3PYPA 4KUKA 2P0NA 1P0ZA 1XJ2A 3RH8B 2EA9A 1LSXA 5IS1A 1T18A 4HI4A 4LRZE 4GW9A 2JN7A 2D01A 4L9GA 4NXBA 4HOIA 2H28A 4NXFA 3LICA 5G4YA 4HY8A 1OTDA 4WLAA 3A0SA 3F1OA 5HD5A 1WA9A 2W0NA 1S4SA 3NOUC 3E4OA 3E4QA 3OLOA 4F3LA 4EXOA 3U9JA 4KQDA 5DKLA 1T1CA 3V5XA 3VE4A 1T1BA 4HJ4A 2VV7A 1ODVA 4LRYC 5F5YA 2I9VA 3D72A 4H6JA 3NJAA 4MN6A 5F68A 3IS2B 4EETB 4XT2A 4WN5A 1S67L 4R6LA 5HZHA 2OWHA 5HDSA 4HH3A 4I3JA 5F6AA 2PD7A 3SW1A 1S1YA 4GS9B 3NOTC 1X0OA 1XJ4A 3EEHA 2PYPA 2QWSA 5DJTA 3H7WB 1XJ3A 4NXGA 4HJ6A 1F98A 2A24A 1V9ZA 3P7NA 3KX0X 3GECA 4EW7A 1DP9A 1OTEA 3MR0A 2V0UA 2L4RA 2V1AA 3BWLA 1Y28A 2W27A 2KX6A 3LI9A 5TBMA 5HWVA 3CLOA 2ZOHA 4GCZA 3LIAA 4YWZA 3VOLA 2JHEA 1GSVA 1G28A 4JGOA 1XFQA 2P7JA 3UMDA 4HHDA 3IS2A 2B02A 2QJ5A 3CWFA 4EEUA 3A0RA 1D7EA 3ULFA 4WUJA 4I39A 4RQ9A 3UB9A 1OTBA 4LPZA 4KUOA 3LIEA 5J4EA 2PR5A 1P97A 4NXEA 5DJUA 5HDCA 2M1CA 4R38A 3MQOA 2PYRA 2OOLA 4DJ2A 3H82B 4GS9A 4LLOB 4JGQA 2KDKA 2V1BA 2K7SA 2PR6A 2QJ7A 2INWA 4JGRA 4EEPA 4HNBA 1MZUA 4B9OA 2D02A 1TS6A 1S66L 3UB8A 3LUQA 3F1PA 4HP9A 3MQQA 3F1NA 1DRMA 3EWKA 3UE6A 5EFWA 1LSWA 4I5SA 3ICYA 5HDDA 2WKQA 5HD3A 4L9FA 3UB7A 3K3CA 4I3IA 4EESA 3HJKA 1TS7A 4I38A 5IU1A 4PKYG 3VE3A 1N9OA 1UGUA 5J3WA 3V5ZA 3F1OB 3LIDA 4GHIB 5F69A 3MXQA 1N9LA 2Z6DA 1XJ6A 2VV8A 3U9MA 2YKHA 3CAXA 5HSQA 2VV6A 3H82A 4BBVA 2PHYA 3UMEA 3B33A 1V9YA 4H6JB 2VLGA 2R78A 4HP4A 2PDRA 3FC7A 4JGPA 1OTAA 1TS0A 4HQAA 1N9NA 1XFNA 3C8CA 2V0WA 2OWJA 1OT9A 4BBTA 2CMNA 4WF0A 3NOPC 4I3AA 1JNUA 3MJQA 3FG8A 5G4ZA 1LSVA 4M4XA 5HWWA 5AVEA 1LT0A 2L1MA 1GSXA 2BASA 2A24B 3H9WA 3V5YA 1DP6A 2Z6CA 3E4PA 1OTIA 4GHIA 3HJIA 2WKRA 4R3AA 3H7WA 4E04A 1S4RA 4WL9A 1S1ZA 3G6OA 3LYXA 3T50A 1KOUA 2WKPA 3NHQA 2PD8A 5TBMB 5KIZA 4K08A 4LRXC 3MFXA 5AVFA 1D06A 3BY8A 2QHKA
chains in the Genus database with same CATH superfamily
4D4NA 4IBXA 2EX8A 2HJ9C 2HF6A 3EOIA 4YT4A 1L3PA 1YA7O 4DRIB 3CPTA 4DVZA 1VTMP 4GQHA 1MNEA 2O9CA 4ZAMA 3HLCA 2J7VA 4EHPA 3IBRA 4ZTKA 3PHYA 1FTSA 4QU3A 3C8GA 3SP1A 1F5MA 1VB6A 3OC2A 5E3AA 1YPRA 2AU5A 3DI5A 3Q7VB 2B95A 3RFBA 5A8BA 1RCPA 2OQMA 1KTMA 3FVYA 2HV1A 5HPIA 5BOHA 2Z2LB 2MWQA 1JWZA 4G7ZF 3HLZA 4JJGA 2G2WA 4LDKA 3X2QC 2ZM8A 3DTEA 1D0ZA 3GMWA 4GLQA 3D9YA 4DXWA 2L0WA 1VK5A 4FAPB 3MS6A 4EBKA 1Q2PA 1RCJA 2O9AA 1E85A 1MQVA 3GM3A 1LL5A 1XX2A 2O9BA 5J8XA 2OEVA 3PBOA 1FQGA 4CIHA 4Y2FA 4U5HA 3LEOA 4CQHA 3WS4A 2YLDA 3VM6A 1Y6DA 1EA8A 3CQZA 1STZA 3FYZA 4HBUA 5DVWA 4EWCA 3GDIA 4U3TA 4UA7A 4G0HA 3DTMA 3ATPA 4KUKA 2J9VA 3C4PA 5IHVA 3RIPA 3HVFA 2RSEB 5IS1A 2Q00A 4CJGA 3NI9A 3BRMA 2FH5A 2D01A 2BE5F 2Z15A 4NXBA 5CRFA 2ZQ7A 1SZIA 2GDCA 4WZ5A 4ID4A 4JEAA 4QY6A 3MQ0A 4U0TA 5FATA 4IWBA 4IUHA 4NXFA 3FWLA 3R7CA 3BRJA 1M57C 1Z09A 4P6ZM 5G4YA 1G6OA 3QP5A 4WLAA 1T6IA 1ZHWA 2JKRM 3F1OA 5CHUA 1IW7F 4CS8A 1JWVA 5HD5A 5HL6A 4B6IA 4PACA 3ABLC 4E6XA 3GWNA 3HLDA 4QY5A 2QY9A 3E4OA 1ZHZA 3OLOA 3RVZA 4CIPA 4XLNF 4F4BA 5EGYA 3V5XA 2JCHA 3PCVA 5BQHA 1YLWA 1TDLA 1K6SA 3UDFA 2JE5A 4BJ6A 4S2IA 5TJJA 2P9VB 3HNIA 3IF6B 2X71A 5KYYB 3G4PA 2H10A 2I15A 1VETA 2HUJA 4H6JA 1WYCA 3NJAA 5EVLA 5F68A 1L0GA 3GEEA 2WZFA 3IS2B 4JXWA 5EPHA 3UPNA 3S29A 3ZTMA 1XP4A 3UGOA 4XT2A 3OZHA 1YLTA 4NCQA 4FUWA 2KSFA 2EFXA 3N8SA 4UA6A 3IF6C 3R7WA 4DE3A 4RDAA 5KMWA 2TMVP 2XD5A 1B68A 4GNUA 2EIMC 3V3SA 4R6LA 3M1CB 3NYMA 5TGFA 4WABA 4ER9A 4EW7A 4KQOA 1SKFA 2W3GA 3S4XA 3RQGA 1CJFA 1HZOA 4IJGA 5F6AA 3NECA 1W5DA 3AGDA 4LDRA 1KVLA 2H5SA 4EBLA 3DJNB 4QPRA 1IELA 1S1YA 2QUPA 1HE1A 4X1LA 4E3IA 2GZAA 1YA9A 2R05A 2PYPA 4IARA 4G3VA 1TF1A 5L0IA 5KYUB 4S2JA 4NXGA 1F98A 2A24A 5L0HA 3EGXB 3ZDLA 2J9UA 2HP5A 3KX0X 4J32B 3IQ5A 2V2FF 4KI2A 3Q6MA 4LFUA 4MTGA 1FSWA 1M6TA 1MPLA 3FOPA 2G2UA 2EX2A 2VK3A 3JVUA 1DP9A 4Q7CA 1TEMA 1WGWA 5DTTA 1K4FA 2PAVP 4Y3IA 3QHYA 1WYBA 3MR0A 3ZFZA 4BJ5C 2DB4A 1AVOB 1ZU5A 1LLBA 1N4OA 4PHTA 3UMHA 4DBQA 3KYQA 3EGXC 2YKZA 2RL3A 2KX6A 2OLUA 1YM1A 2C04A 3AGEA 4RBNA 3K1HA 2J3TC 3CLOA 4GCZA 3DAFA 3ZVRA 2QMIA 1MC0A 3O39A 1FR6A 4JGOA 3ZHHA 4OQIA 3NMJA 2J7PD 2P7JA 1V54C 3UMDA 4HHDA 1D1BA 1KE0A 2ZC6B 4ESPA 4EEUA 2M4EA 1RKEB 3FKVA 3ULFA 1NU7D 1YSQA 1IOUA 4WUJA 4MVRA 3TULA 4ARZA 1PW8A 3UB9A 2W3HA 2VCAA 2P74A 1FFHA 1CQAA 1I4ZA 2PR5A 4BG0A 1OQCA 1MMAA 4CS9A 2XDMA 1YDIA 4JURI 3BEHA 4JVSA 1W63Q 1MMNA 2VASA 2DCFA 3DWKA 3E70C 3C7VA 3MQOA 2HV7A 1ONGA 4JW1A 4UAAA 1KE3A 4QJGA 3H82B 3ZQYA 3S7QA 3HBRA 2O9XA 4S2NA 4XXRA 3C62A 2PNOA 2A0UA 2HV6A 2K7SA 2QJ7A 1IZMA 4X0RA 4EWFA 1NLYA 3IHUA 3US6A 4HNBA 4EEPA 1K38A 2D02A 4XEVA 1K56A 1TS6A 1D1JA 3HNKA 4E6WA 1VOMA 1NJ4A 4OINF 3F1PA 1K0KA 2JKTM 1OCCC 3S27A 4KZ4A 2Q4FA 3UE6A 2XR0A 5EFWA 4O79A 1LSWA 1K57C 1U89A 5HD3A 3U0CA 2HZ8A 1JR8A 4KZ8A 2A68F 2XEPA 5EM0A 3UNWA 2R7UA 3G2YA 4ZBEA 3HUOA 2P6VA 2EX9A 4MVZA 4KENB 1WE4A 1J8MF 2CW0F 4XEKA 1ZHHB 5CIVA 3MXRA 3DZAA 2EWWA 1EKYA 1UGUA 1KDWA 5J3WA 4A5RA 3NC8A 3O3VA 2BG1A 1KNYA 3GODA 4OD5A 4GHIB 3BM6A 4J7TA 1FCNA 1JWPA 2OEXA 4WZ4A 5FQJA 5L2FA 1UFBA 1N9LA 3VSLA 1RGYA 4P87A 4C7OB 1S05A 1PWGA 1EI5A 2XL6A 2JD3A 3RW0A 3ZWIA 2Z6DA 1SMYF 1Z6FA 2HP9A 4U0XA 4GEHA 4P9FA 5FDHA 2QTVA 3C4OA 1CPQA 4K1OA 4E0IA 3N8LA 3I4UA 2M7UA 2K2NA 1SKOA 5A6JA 2M64A 3EH2A 2HMZA 5EVID 3OA1A 3TE8A 2PBYA 2AP3A 4BQMA 3WS0A 3PHF2 3B33A 1MWSA 1V9YA 5EOEA 5FQ9A 2VCBA 1LI0A 2E8JA 1GCEA 4YWQA 1MBLA 3QMKA 3X1OA 1OW6A 3JPUA 1FIKA 3SYNA 3UN7A 5TFQA 3IEEA 2Y2KA 1M2VA 5CECA 2CGEA 4ZLDA 2LK4A 3DW0A 5DF7A 4CJOA 4NK3A 4JTDB 4E17A 3UPOA 4P6ZS 2D4UA 3LNRA 2KW3C 5HV9A 2V0WA 2IXNA 2KC3A 2NG1A 3MSHA 4NQFA 5F5HA 3RYLA 2XLEA 2CMNA 4ZJ1A 5A90A 4C75A 1ORJA 2A2LA 1T01A 4DE2A 3DKAA 1W8QA 4HEFA 3N24A 3RXXA 5JP7A 1NLZA 4DN0A 1VLSA 4QDLA 5CI9A 5L0GA 1CEGA 3QNBA 4WMCD 3E2KA 3TQOA 5HWWA 2YVKA 3W4YA 4JXGA 3GANA 4OOLA 4QHCA 4NETA 1GSXA 3GM2A 2I8BA 4ZLCA 3V5MA 4FX5A 2HFIA 4I44A 4UDVA 2LB9A 4OONA 3KO6A 3P98A 3QP1A 3E4PA 5HFOA 3HTKC 3HJIA 2Y2QA 3H7WA 2GAQA 2J46A 1Y4CA 3AJMA 2ZXPA 1PWCA 3IWIA 4FTXA 4LGWA 3S7NA 1KOUA 1ZW2A 4OPZA 1OW7A 4X6TA 4MBFA 4AE4A 1BDJB 4C3EA 3CZDA 2A49A 5CERA 3MFXA 1HD8A 1UG7A 3P01A 4U5GA 2QHKA 3NDEA 4M63A 1AUEA 5CEDA 4HBTA 1KDSA 3DM5A 2C6WB 4EKWA 3KSHA 3DD7A 3NKDA 3GSGA 3KSFA 5FEGA 1S7ZA 4MVMA 2ASRA 2JKTI 5GLBA 1AWIA 4EERA 1JMWA 5HSWA 2X01A 4P9TA 3JSZA 4GB7A 2LCHA 2WGIA 5AC5A 3SEOA 1VMAA 1FNTc 1E86A 2Y2OA 3OPRA 4I1OB 4EBPA 4YL1A 3ZG5A 2WVOA 4M3KA 3LIFA 3K1IA 4OP5A 3C30A 3KMIA 2HPBA 4HJ3A 1IEMA 4E3KA 4DXCA 2IXOA 4IRUA 4P6BA 5DF9A 4IBRA 3O88A 4MN5A 4X1MA 3ZC4A 4PKYA 2ZC4B 2XRHA 2NUPB 5L0CA 4II7A 3UB6A 3V67A 1CGOA 4BEMJ 5T1DB 1TWHA 2ZQAA 3LI8A 3ZQ5A 1ZZPA 3SXZA 2A1DD 3T4QA 1FR0A 3O55A 2ZOIA 1OJ5A 5DKKA 1YT4A 2NSFA 2GJ3A 5A6BD 3IH8A 1TWCA 3OOVA 2AVXA 5FI6A 3HKKA 2ZMVA 4YINA 2NUPC 2IXMA 5I5LA 2YKFA 3NRHA 1FR1A 5GHYA 2GA0A 3LIBA 5L0FA 1I2WA 2JKGA 3QNCA 3EQLF 4CDYA 3PYPA 1ST6A 3SS3A 5HAPA 5L0JA 3VP0A 1RKCA 1G5ZA 2P0NA 2KLIA 5CGXA 1R5ID 3RH8B 1T18A 4YNRA 4JLFA 4LRZE 4GW9A 3CJMA 1SF8A 4CLCB 5GPGB 3LR5A 4Z9IA 4X56A 5FDSA 1TDGA 2ZD8A 3T6GB 4OIRF 3K7DA 3LICA 4KG5A 1T6QA 4Y17A 3O87A 1U60A 4HY8A 1OXKA 1W79A 2J0WA 4U5CE 2IWCA 3AOUA 1WA9A 4XQ1A 4KZ3A 2JX0A 2W0NA 5E2HA 4H8RA 4CLCC 4NC3A 1S4SA 3KSGA 3NOUC 3EFOA 1XZPA 3FXHA 3B9QA 3PBRA 3UR3C 1OPXA 4HE8D 1T5OA 1E83A 3AGTA 5E2FA 5A6KA 1K04A 4PFPA 5DKLA 5LBRA 1T1CA 3ZG8B 1T1BA 2HS5A 4BJ1A 1PZOA 3BJNA 4HJ4A 2NPUA 1Q0FA 5CHMA 2P61A 3BYDA 3HJCA 1ODVA 2CYDA 3AGFA 3CUEC 4X69A 4LRYC 1LI5A 1ONHA 4PM8A 2UWXA 3U2AA 3LO7A 4QI0A 1D1CA 1DOVA 3VYWA 2XLVA 4PJJA 4BLMA 1K54C 4C3QA 3B71A 3D72A 1SYQA 2JKFA 3HREA 3OCNA 1TQGA 3MF0A 4OOMA 1S67L 4OPRA 4DBRA 1EI7A 4RA7A 3ECSA 2HDUA 2ZLYA 2W3FA 1PIOA 4MTOA 3B47A 3JVVA 4LDQA 5HZHA 2DYSC 2HJ3A 4J7YA 4E3LA 2DGJA 3W4QA 4I3JA 3HLEA 3L7HA 5KZHA 4CS7A 1G8XA 1QMFA 3SXMA 4JBFA 3U4LP 1N1CA 1H9GA 1BTLA 4IB4A 4GS9B 3QVZA 3NOTC 1X0OA 1ZVZA 4FCFA 4JF5A 3EEHA 4E3MA 2WUQA 1CEFA 3AG4C 3S7OA 1HY5A 1LS4A 3ZCZA 1NRJA 4HJ6A 2J7PA 2XXAA 3SS4A 2YEVA 1ZKJA 1OW8A 2P08A 2G3VA 3WRZA 2YRFA 3ZGAB 2ZJ9A 3U5SA 1OTEA 2W3EA 2XM4A 4OKPA 2R7OA 4OQGA 2R9WA 2ZD9A 1CI9A 1LHYA 5CEBA 3BW6A 3V7OA 2BLSA 2L4RA 2R03A 1ZTUA 4RD9A 1V4AA 4MMNA 3GWLA 2ZQ9A 4FSFA 1ZHYA 4P6IC 4U5BE 2DNSA 4CLCD 4B4XA 5HWVA 1NFNA 4N06A 1YMXA 3VRCA 3MYFA 3HLGA 4B4ZA 1YMSA 3OPHA 4CJNA 3KYIA 4FESA 4YT8A 3ZNTA 1NLXA 4DRHB 2BC5A 2ZC3B 1XFQA 1O3UA 4CX9A 1DY6A 3MBZA 2H0YA 3IS2A 2B02A 2QJ5A 2W1TB 2Y2NA 3CWFA 4JXSA 1Z3IX 1JTGA 1D7EA 1E4DA 2IM8A 4YT2A 1N9BA 4U9EA 3M79A 4I39A 1XGJA 1YAXA 1GHIA 4LV3A 3JT1A 1ZYRF 1OTBA 4LPZA 3DE8A 4KNWA 4XPWA 4KUOA 2GWWA 1QLEC 5GL9A 3LIEA 3MZFA 5TR7A 4WM9A 3LS0A 1JAFA 1P97A 5DJUA 2R7XA 1IKIA 4O6NA 3EHNA 1OKKD 4GKUA 3UE3A 2M1CA 3UGPA 2R02A 1ZC2A 1YZAA 1I2SA 5DFXA 1K05A 1LIHA 2KGOA 1HLUP 4K7BA 5COMA 2WZZA 3OCLA 4KZ5A 2ZQCA 4ZRRA 2KDKA 4YK5A 4Y7PA 5AQ9A 3BQ8A 2PR6A 3M4BA 4JGRA 2C03A 3G35A 4BD1A 2Y2IA 3FZCA 1MZUA 2PBDP 2R7RA 4U5EE 1S0WA 2J9PA 1T9KA 1S66L 3CG5A 3LUQA 4EU0A 3MQQA 3Q7ZA 3E2LA 4JTAB 5F83A 3F1NA 3U3FA 3MZDA 2B0JA 1IYOA 4EBBA 4IAOA 4I5SA 2LQGA 1V74B 4JKTA 3ICYA 2V26A 3TW8A 3KH2A 4L9FA 1YLJA 1MWRA 1TR2A 4L6RA 3ITFA 1RJ9A 2LB5A 3MYIA 3MFDA 3VSKA 4JCZA 3HUMA 4DXBA 5GHZA 3B3XA 3ABMC 5D91A 3QZCA 2ZQDA 4I38A 5IU1A 5EVIA 1VYKA 4PKYG 5EK0A 1OR2A 3VE3A 5E2QA 1W8YA 4KZ7A 4P85A 1G4WR 5FQKA 3F1OB 5DQTA 3ASOC 3I5PA 4S2PA 1BLCA 5DF8A 5F69A 2ZXOA 4E3JA 3MXQA 4WZ5C 5FEFA 5F1GA 2WL8A 1WATA 3TG9A 2WAEA 2UUHA 1C02A 2HKVA 3UE0A 3NIAA 4O01A 3HLFA 2Y2GA 4KG2A 3UMKA 1LVKA 4OOYA 2Y55A 4Z9HA 1L0DA 1XJ6A 4EBNA 2V3CC 4Y13A 3GORA 3CAXA 5HSQA 4R4SA 3Q6NA 2JBFA 5CX7A 2PF4E 1VETB 1ES4A 3H82A 3IBJA 4BBVA 2PHYA 3SOIA 2VKSA 4H6JB 4OQHA 4WMCA 4KG6A 1K55C 3EZIA 2VLGA 2KYHA 2B18A 3VV4A 2R78A 1K25A 5B1AC 3RQEA 1K57A 3R7WB 4N6HA 3O5YA 5CTNA 3FC7A 3VP1A 3JYYA 3V3RA 3QTHA 4WYYA 3IHBA 4JGPA 4ZDXA 2D5RB 3AGUA 3LFVA 5JYOA 1W63M 3ZG7B 5FQMA 3KL4A 1J3WA 1N9NA 2WVQA 3N6IA 3C8CA 3MKEA 4YFMA 1OT9A 3G34A 5CGSA 1HMDA 4BBTA 4N1XA 1Q0DA 3T4RA 2NUTB 3IX8A 1NXYA 4X53A 1BR4A 4NTFA 2VA0A 3T1RA 3EG9A 1YKDA 3W2VA 4EV4A 1SCWA 1L7CA 4YN0B 3TOMA 5GHXA 3FG8A 2DI3A 1LSVA 5I94A 2GDNA 2ZMFA 5FSRA 5M19A 2I72A 3VFFA 2DRWA 1QMEA 3LEVA 5AVEA 1LT0A 5F5FA 2EXBA 2NUTC 5HARA 1IYSA 2A24B 4JPMA 2WYXA 2R7VA 3Q07A 1H8ZA 5DQZA 1MXOA 2WGVA 2Z6CA 3GEHA 2HZ5A 2VH3A 1ES3A 2J8WA 4Q0HA 4MVUA 2PFDA 4GHIA 4EUKB 1PFLA 2WKRA 3L8IA 3UMIA 4E04A 4C7OA 4WL9A 5EE8A 4DF6A 3G6OA 2R9XA 2Y2LA 2OJED 4G7OF 4PMAA 1E84A 2KQ9A 2XGNA 5E3CA 3DE9A 1E2XA 2K31A 1G68A 2ZM2A 4QB8A 2WKPA 1SHVA 4ETZA 2PD8A 5HL1A 3JZ0A 4QWOA 4GN2A 4K08A 4LRXC 3UPPA 4OPYA 2J3WA 2XSSA 2ZL1A 3BY8A 4CDAA 4O7DA 4ONSA 4R3BA 2J9BA 4E3OA 1BT5A 3PBTA 3C7UA 5BQIA 1ZG4A 2ZMAA 4HH2A 2R7WA 3L8JA 4S2MA 3LJBA 5BUOA 5KYNA 1UWPX 3J06A 1NYYA 2E8IA 4WEJA 4BEJA 1VQQA 1BYWA 1BZ4A 2JPUA 4ARZB 2A69F 3WS5A 5AGFA 3NDGA 3JRTA 4EQ1A 2ZXRA 3C2WA 2GX5A 1ERQA 4U5DE 3W4OA 1PRQA 3VOYA 1TKNA 4CSAC 2VGJA 5HWTA 2ZBBA 4UHUA 4K0DA 2J3TD 5A6BA 3FPVA 1FSYA 4ULVA 2XFTA 2XLNA 1QKRA 2UUIA 1NWZA 1VEUA 4PPRA 4R70A 4F3LB 4Y15A 2YL7A 2MJ6A 3LS1A 5AC4A 2B5RA 4AK9A 1GHPA 5DS4A 4JIOA 2QE9A 1GM5A 1IKGA 3BY9A 3E98A 4IHQA 5HAIA 4PM5A 1YSPA 4PJMA 1W7FA 2Y2HA 1TVFA 1JOGA 4KZ9A 4QI2A 1FCOA 1LI9A 4L9EA 1EW0A 3ZG0A 4CS9C 1TD5A 1FFTC 3NKEA 4U9DA 1DP8A 3OPLA 2YQYA 3NY4A 4BWIA 2RD9A 4YL0A 2QKPA 3QW0A 2XLDA 4LV0A 5C5KA 1I4YA 3U2LA 3A0VA 3FPWA 5GLCA 4S2NC 3TJ5A 3F1PB 2XLMA 2QLAA 3IT9A 4LV1A 2PP4A 1F1MA 5KYWA 4JZAA 4FOFA 1T1AA 3KYJA 3BECA 4GJ4A 2XLWA 1TS8A 2CNWD 1GSWA 5FI2A 1ORSC 4D4XA 1Y54A 4XPXA 4OH0A 4JEBA 1ESIA 1JTDA 1NBBA 1MKMA 5DS5A 1T19A 4N9LA 3UE1A 4JC7A 2DYRC 2ACGA 1OXBA 1P0ZA 1HTZA 1Q0GA 2IXPA 4HI4A 3ZDJA 4MVSA 3TK0A 3IXGA 2JN7A 4PM9A 4D2OA 2XK1A 3H2UA 4L9GA 3GVBA 4B88A 1XZQA 3B0PA 3FDQA 1J9MA 4G3WA 4N92A 2WGWA 3I5QA 2X51A 4LERA 1OTDA 2HDRA 1BBHA 2MYSA 5AQ7A 3A0SA 1RP5A 1QVXA 3WODF 5M18A 5IY5C 1PYYA 1MWUA 1YLYA 3GEIA 3A3DA 2W4MA 3EJNA 4GDNA 1ZU4A 4PFOA 2FFHA 1VB5A 3SXKA 4H4KC 5D92A 2WKIA 2WKHA 2Q0OA 3U9JA 3A11A 2J8YA 3F46A 1JVJA 4IAQA 4WBGA 3VE4A 1VLTA 2RCXA 5EUAA 2HJEA 3B42A 2YLGA 1ZHXA 1SZVA 4FH2A 4DJ9A 4PM7A 3S7PA 3S90A 2XL8A 3TOIA 4MCWA 3K33A 2Y79A 1M2VB 4DDYA 3NG1A 5A91A 3FAJA 4MN6A 5G18A 4MVQA 1YYJA 2Q9MA 1K6RA 2IWDA 3M6HA 1MMDA 3GM1A 1QZXA 4EETB 4WN5A 1E3UD 3CI6A 5B1BC 3WHNA 4KQRA 1Z5ZA 2DMWA 3QP6A 5HX9A 4CBEA 5COFA 2V8FA 4UQIM 3G30A 5HDSA 2EIKC 3ZNYA 4Y0TA 4R3JA 5JSLA 1W2WA 1GGQA 4G3KA 3EEAA 3U8PA 1JRAA 2PD7A 3WS2A 1KGEA 5B3SC 4CLCA 5E43A 1I5NA 3R2PA 3AG2C 3POVA 4XWJA 2EWVA 4NTBA 2EPKX 2VGKA 4AL1A 3ASNC 3PBNA 3C7JA 3H7WB 3T4TA 5L3VA 3A3EA 3P09A 3Q1FA 3FAPB 2Y3DA 1GS9A 1KE4A 2VZWA 1PI5A 1U0BB 3GECA 5KYXA 3LCEA 1HE9A 4IJJA 3UNGC 3DWWA 1EWZA 3EQVA 1M2OA 2XFSA 2L6HA 3ITBA 4F94A 3ZVWA 3FOOA 3KYEA 1ES5A 4AE4B 2R7SA 1I5QA 5T3WA 3ISGA 4S2KA 4PJNA 2V0UA 2J9WA 2V1AA 4OVDA 5FAOA 3N8RA 2OG2A 4ZJ3A 3EHMA 1Y28A 1A41A 3M2KA 4DOZA 5DLJA 4OIQF 5TBMA 1OKKA 4ETXA 4KC9A 4QD4A 1P9WA 2ZOHA 3JRMO 3LIAA 1D0XA 1MY8A 3LLKA 3O86A 1YLPA 2A3UA 4KBLA 4YWZA 3S84A 2IYLD 4ME4A 1LE2A 4X68A 1C03A 3CMZA 2WZGA 3KPHA 2JC7A 4DRTA 4OIOF 2IA2A 3BFCA 3V39A 2Y2PA 5A93A 1ERMA 3WS1A 4R1GA 1NY0A 1QSPA 1F2KA 3AQBA 256BA 3HCYA 3Q82A 1Z6AA 3Q7VA 4NXEA 5J4EA 1J8YF 4R0QA 2XS8A 3VOZA 2YL0A 3EGDB 1Q2QA 5HDCA 2EPMX 2HMQA 3G50A 4MNDA 3A3JA 4R38A 3O6XA 2HP6A 4BL2A 4DJ2A 1YAUO 2W3DA 1K40A 3HLBA 2PU2A 3TJZC 3Q7GA 3A3FA 4GS9A 3K1IC 4LLOB 3GRJA 2PU4A 4GD8A 2KK1A 2V1BA 2Y3BA 3W2WA 1Y4OA 1YQSA 1H5XA 3EGDC 2INWA 3SNHA 3DJUB 4MS2A 5EV0A 5FQIA 4O7GA 4B9OA 1LI7A 1NZOA 2Y4AA 4NG2A 2M7VA 1V55C 3UB8A 3PR6A 4HP9A 2R7TA 1QPUA 1KGGA 4G7HF 1DRMA 3K6BA 5FAQA 1BLHA 5FL3A 3IPMO 5HAQA 1U6HA 3EZHA 3UB7A 3W8IA 3K3CA 4Z9QA 4DVYP 3RFYA 4ZJ2A 1TS7A 2J45A 3TOLA 4MNRA 5AJGA 4B93A 5JVEA 5K5BA 3AG3C 1GA0A 4OLDA 1N9OA 2CC1A 5FAPA 3WWXA 3SS5A 5DTSA 4FWVA 3V5ZA 4MDZA 3IXDA 3NCKA 3ZTZA 2Y3HA 2W1TA 3AQCA 4L0LA 3LIDA 3ZYTA 2YZSA 4JF4A 2Q9BA 2OKUA 2EFUA 3LEQA 4NEED 3G32A 3FMSA 4OLGA 3S22A 5KSHA 2Y59A 4LENA 4BENA 3EFOB 2WVNA 1ES2A 3C63A 2WK0A 1T6UA 5L3QA 1G4US 1WWPA 2Q7RA 2J9OA 2VJWA 1PW1A 2ZC5B 1HMOA 1TWGA 3WG7C 2P04A 2VV8A 1ZW3A 3Q81A 3VMAA 3U9MA 1LL9A 4KZ6A 1RMVA 2YKHA 3T1QB 3MZEA 5DTKA 2IOQA 1FMVA 4PR9A 4CLCE 1ALQA 2KOIA 2XRNA 1H8MA 1OR3A 3DM9B 3JTLO 2XA7M 3UMEA 4E7ZA 4MTFA 4KZBA 3TJ6A 2HGVA 4RX2A 2P9VA 3IF6A 1CK3A 5KYYA 1XA1A 3WRTA 3CPTB 4O6MA 4HP4A 1CPRA 4MW3A 3EQUA 2OAP1 3I7JA 1DJBA 2PDRA 1O87A 1CGME 4XUXA 4W8PA 3M2JA 1LM3B 2ETSA 2IWBA 3C8GB 4Y5FA 1YLZA 4AFIA 2L7AA 2WZLA 1DJAA 2A0BA 1XFNA 3UDXA 3UDIA 3O10A 3T1XA 3ABKC 4G78A 3DTKA 3QW1A 5HPFA 1BLSA 1M56C 1LKXA 4YOFA 4WF0A 5F1FA 1EQ1A 3NOPC 1PWDA 5FASA 2V1ZA 2EIJC 1YZCA 3V50A 4I3AA 1JNUA 3S1YA 3N0TA 5G4ZA 3H2VA 4M4XA 1H6GA 2Z2MB 4JE9A 1NZUA 3MLGA 2L1MA 2XLHA 4OP8A 2XXAB 5DS6A 3DMDA 3GTCA 3G4ZA 3C38A 1DP6A 3BQAA 4EBJA 2Y91A 2UV0E 2QNLA 4LCMA 2XSEA 4I3MA 1OTIA 2W1RA 5KYUA 4BJ5A 1AEPA 5MC7A 1S4RA 1L0FA 2HSBA 3EGXA 1Z7Qc 3PMRA 1O7EA 4XUZA 5F82A 3L34A 4AX2A 3T50A 5FQQA 1C3BA 4JXVA 1EROA 3IWOA 1K4EA 1K55A 3B0VC 4MVOA 3NHQA 5KIZA 4YJWA 4I1MA 2NSGA 4UQIS 1G6AA 3QVYA 5AVFA 1D06A 2VGLM 4XLPF 1BZAA 1TFOB 1DOWA 4EUVA 4HEAJ 4Y0UA 1L3LA 1R4TA 3HNJA 1QQ3A 2VEAA 4JCHA 2LSEA 1LL8A 1IYQA 1FILA 3H65A 4PM6A 5EHHA 3IQ6A 2AWYA 1A0KA 4C3BA 1NYMA 4YL3A 3IHAA 5L8MA 1A7DA 3UB5P 1PNEA 4PJLA 1XWJA 4DJ3A 4MQ9F 3JYIA 2EXAA 3G4XA 3PDMP 1RKEA 4R23A 3TD7A 3K3DA 2X0CA 4XTKA 5L07A 3CEXA 3ZSUA 1F9IA 4OD4A 2NUTA 4OIPF 3NBLA 5E2EA 1GA9A 3M15A 2CNWA 2LD6A 2OSUA 4LV2A 4HESA 1BSGA 4P0MA 1PI4A 4CS8C 5DFYA 4N6CA 3PXPA 4BJTA 2LFFA 4W8KA 1OT6A 3IXHA 5J7EA 1VHMA 3AG1C 4HFKB 1ORYA 2X02A 1UWNX 5CI8A 4HIAA 5EVEA 1OJGA 3LY4A 3SH9A 1FAPB 1YLMA 1NRFA 3DBAA 5EECA 2V9AA 3IH9A 3C8GD 4JF6A 4KNVA 4NKPA 1VM1A 2J80A 4XT2B 5IT5A 4BJ6C 5CTMA 3T6BA 4CPKA 5FCLA 3F1NB 5M1AA 5K0IA 2PT7A 4BBUA 4S2OA 2HDSA 4RVAA 4MW8A 5HW3A 5JS5A 3RTYA 1RJ9B 2YL3A 2L6FA 1FOFA 3MBGA 2WB7A 1G5UA 2YWAA 1BUEA 5EVIB 1XJ2A 2EA9A 3A3IA 1LSXA 4E18A 3IQCA 5DVAA 4FD8A 3WAQA 5JRAA 4CSAA 1H3QA 1XXMA 3HLWA 3T9OA 4HOIA 2H7VC 1XKZA 2VC9A 3L1MA 5D3OA 1IYPA 2YHSA 2H28A 3T6JA 2B0HA 3MMHA 4BMWA 5EVIC 2PX3A 1WTYA 3A9CA 3DWZA 4MN7A 3T4SA 3OEOA 1SDEA 5BQGA 3T12B 2V8CA 3T1SA 3N7WA 1YVIA 4Q0IA 5A6AA 1Z23A 1E3UA 3IQAA 4BPMA 2Y69C 1CI8A 1LPEA 3E4QA 1SR2A 4X25A 1KVMA 4F3LA 1Q0MA 4EIYA 3HUNA 4EXOA 2FGYA 4KQDA 2LFDA 1L0EA 2Y2JA 2YL1A 2Y3GA 3U2MA 3W4PA 2KNHA 4U5FE 2JKRI 4JJFA 3R4KA 3B29A 2VV7A 1TFKB 1CF0A 2Q9CA 2XL4A 1NU9C 2PRFA 5F5YA 1PZPA 3S28A 3SZRA 4JTCB 2XS1A 4Q4ZF 2I9VA 3LY3A 1TWAA 3T4LA 2H7OA 3ZVTA 4AL0A 4XPYA 1M6KA 3MKFA 2CCYA 2EPOA 1S6RA 4E3NA 1ZHTA 5FZTA 3KYZA 4PAUA 1YJGA 4R4RA 3LAYA 3IWQA 4GD6A 3RQFA 4WGZA 5F28E 4N9KA 1Q0KA 2XH9A 3GQZA 3EG9B 2F22A 2W4BA 4KZAA 3IF5A 4XEFA 2OWHA 3FHDA 3RF3A 4BL3A 3LR0A 4HH3A 5L0DA 3D4FA 1GHMA 3Q7LA 1WASA 2IBFA 5CXWA 1XGIA 3HNLA 1A7VA 2AVKA 1BULA 4RYEA 1D0YA 2ZPAA 2XM0A 4E0HA 1RGZA 3SW1A 4LLEA 2LIGA 3UO9A 3RVYA 1XJ4A 2BTFP 4K0XA 2GFHA 2VB6A 2W45A 2XA7S 5AQBA 4IVKA 1E25A 4IGGA 2QWSA 3LGOA 5DJTA 5EM1A 1Z63A 5A92A 1XJ3A 1V9ZA 1P9RA 2R7QA 1PD1A 3P7NA 4OQ0A 3GR2A 2ZXWC 1FCMA 5CHJA 2OCCC 5JT4A 4FH4A 3BFDA 5COGA 4D60A 2OAQ1 2O99A 3NMIA 4LCLA 3NYLA 4Q5SF 3K2NA 1KGFA 1GQAA 4WEKA 3VAYA 2A6HF 1MKIA 4Y0OA 4O6YA 2ZL1B 3S0XA 3W8KA 1YYXA 2QPNA 3BWLA 2W27A 3SZTA 3LI9A 3ZQVA 3L0IA 3DXJF 4JKVA 3ZG9B 4X55A 4YT5A 3E0YA 2MHRA 5B3IA 4Q0JA 2EX6A 2P1AA 3IX4A 3BLSA 1JPJA 3KKBA 3N2ZB 3LR4A 1FMWA 1HW1A 3LNMB 3D3OA 3VOLA 1OCRC 1GSVA 2JHEA 1G28A 2XQZA 2Q3TA 5JYPA 4WGYA 1H0MA 4CDVA 3SXYA 1NZEA 3G31A 3A0RA 3RJUA 1M40A 4LLCA 2O0YA 4DE1A 3IXBA 3LUTB 3CSKA 4R32A 4K91A 4N1HA 3FKWA 4O0PA 4RQ9A 1VYIA 1VEUB 2AWCA 3QP2A 1CGNA 1BR2A 4IVIA 3IQTA 3EH1A 3EPVA 3GV9A 3RXWA 3VP2A 3JSEO 4GZBA 3NULA 4H54A 2G3KA 2Y39A 4UA9A 1NFOA 1H8YA 3B0UX 2CDQA 2EINC 2P7VA 3OWTA 1SKOB 2OOCA 2ZC7A 3KSIA 4MBHA 4KQQA 4DDSA 2PYRA 1OCOC 2OOLA 2L6GA 3C8ZA 3MX3A 1JPNA 4WJ0A 2J0XA 4IUKA 2ZM0A 5GLAA 1D1AA 1HVBA 2VGLS 2Q9AA 4JGQA 2QYBA 2WADA 1ESUA 2R9RB 2Q9NA 5GLDA 3PAEA 2A6EF 2NUPA 1AXBA 1BLPA 3QP8A 4A4AA 2R25A 5KYWB 2WKEA 3U3BA 4DMZA 4S2LA 3M6BA 4ANJA 5AQAA 1DJCA 5FI7A 2PX0A 3ZIBA 1MNDA 4WELA 4K0WA 2L9JA 3W8HA 3T4OA 1H9TA 1SDNA 3EWKA 5U47A 3U8VA 2BL2A 3VFHA 3LESA 5HDDA 5JLIA 3DAVA 2EPNA 2FAPB 2WKQA 3NMKA 1APCA 4IEDA 3FV7A 1ACFA 2OU6A 4I3IA 3NDBB 4MBKA 4EESA 2OV5A 3HJKA 2EPLX 2EILC 3C5AA 3LLIA 4MLLA 1C17M 2WGWB 3W2ZA 2FZ0A 2H0TA 3JCUQ 3K66A 3CITA 3T4JA 1K56D 3MFNA 3CHWP 3G2ZA 4J30B 5JUAA 4LACB 4HFFB 5T3TA 3IX3A 2OJQA 3NYJA 3PTEA 5E33A 3CUEA 3EGDA 2G7UA 1HW2A 1OMEA 5CGWA 3OPPA 2H8AA 4NTAA 2GNXA 1WN0A 1K54A 2PBEA 4Q8IA 2VV6A 4C3DA 4ULWA 3UY6A 1YARO 3C18A 1RXQA 2VCCA 4DE0A 4UEYA 2OLVA 3DTIA 3ITAA 5A69A 2HDQA 4N4WA 4GDBA 4MEZA 1L2SA 3RKOF 4EUZA 1WOLA 1PD0A 2XD1A 4OPQA 1OTAA 1TS0A 2VX8A 5EOOA 2ICWG 4HQAA 3TSGA 3LR3A 2E87A 1NSGB 4Z9JA 5TJ5E 2HJMA 2OWJA 5FA7A 3M4CA 5KSCA 1O5HA 4DRJB 3BEBA 2KJGA 3QP4A 3VP4A 2WAFA 4PK4A 3BLMA 4EQIA 2WZXA 4NY3A 1IFQA 3CZ6A 2Y8HA 1LS1A 4RX3A 3TRCA 3MXSA 3RH3A 3MJQA 3VF0A 3E9VA 2H7BA 2FFYA 3T4KA 4BJPA 1OCZC 2QZ6A 4GYTA 1BR1A 1XPBA 3HL9A 3L9KA 2W9YA 3N4IA 3JYHA 3ZG1A 2BASA 4GOGA 3H9WA 3V5YA 1PCXA 3SH7A 3OBFA 1A0BA 3LEZA 2LP4A 4JRZA 5KYXB 1LE4A 2XLOA 2FFFB 4DKIA 3S9OA 1MWTA 4R3AA 5E2GA 4Z1WA 3BFGA 1H7IA 3PAGA 1XA7A 4O8GA 4BD0A 5L09A 1S1ZA 1MMGA 1O07A 2XROA 2G62A 3BFFA 3LYXA 3SH8A 2YLIA 4A2NB 2HSQA 2Y2MA 5TBMB 5L10A 1PV3A 3BFEA 2L81A 1ZG6A 1NG1A 4C6YA 2ZQ8A 2XF3A 1KU2A 3F47A 2C5WB 2V20A 3VP3A 3PBSA 4E7SA 1A7EA 3PBQA 3DAGA
chains in the Genus database with same CATH topology
2VEAA 3KSHA 3PBTA 3KSFA 1LL8A 4HH2A 2HJ9C 2JKTI 1UWPX 2HF6A 3EOIA 4WEJA 4EERA 5L8MA 1BYWA 4ARZB 4DJ3A 2O9CA 3IBRA 4EQ1A 3C2WA 3PHYA 2GX5A 1F5MA 1VB6A 3OC2A 5HWTA 2ZBBA 3RFBA 2J3TD 3K3DA 5A8BA 3FPVA 1F9IA 1NWZA 2HV1A 4R70A 5HPIA 4F3LB 2MJ6A 3LIFA 3C30A 3BY9A 4HJ3A 3E98A 4IHQA 1YSPA 5DFYA 5DF9A 4GLQA 4L9EA 1EW0A 3PXPA 4MN5A 1TD5A 1OT6A 2L0WA 4PKYA 5J7EA 1VHMA 1DP8A 2O9AA 3UB6A 4II7A 3V67A 4BWIA 1UWNX 2QKPA 4HIAA 3LI8A 5C5KA 1OJGA 2O9BA 3A0VA 3ZQ5A 3FPWA 3DBAA 3PBOA 4Y2FA 2V9AA 3T4QA 4NKPA 2J80A 2ZOIA 3F1PB 4XT2B 4CQHA 5IT5A 1OJ5A 5DKKA 2GJ3A 3OOVA 3F1NB 2ZMVA 1STZA 2NUPC 2PT7A 4FOFA 5I5LA 2YKFA 1T1AA 4BBUA 4GJ4A 1TS8A 3GDIA 3LIBA 1GSWA 3RTYA 1T19A 1MKMA 3PYPA 4KUKA 2P0NA 2KLIA 1P0ZA 1XJ2A 3RH8B 2EA9A 1LSXA 5IS1A 1T18A 4HI4A 4YNRA 4LRZE 4GW9A 2JN7A 1H3QA 2FH5A 4CLCB 2D01A 4L9GA 3LR5A 4NXBA 4HOIA 4G3WA 2H28A 3MQ0A 4IUHA 4NXFA 3LICA 3MMHA 4BMWA 4P6ZM 5G4YA 1G6OA 4HY8A 1OTDA 4WLAA 2JKRM 3A0SA 3F1OA 4MN7A 3T4SA 5HD5A 5HL6A 1WA9A 2W0NA 4CLCC 4Q0IA 1S4SA 3KSGA 3NOUC 3E4OA 3E4QA 3OLOA 4F3LA 3PBRA 1OPXA 4EXOA 3U9JA 4KQDA 5DKLA 5LBRA 1T1CA 3V5XA 3VE4A 2JKRI 1T1BA 3BJNA 2HJEA 3B42A 4HJ4A 3R4KA 2VV7A 5TJJA 1ODVA 3CUEC 4LRYC 5F5YA 3U2AA 3S7PA 4MCWA 2Y79A 2I9VA 3D72A 4H6JA 3T4LA 3NJAA 3OCNA 4MN6A 5F68A 3IS2B 3MF0A 4OOMA 4XT2A 4EETB 4WN5A 1S67L 3R7WA 3CI6A 3KYZA 4PAUA 2W3FA 2DMWA 4R6LA 3B47A 3JVVA 5HZHA 4UQIM 4KQOA 2OWHA 5HDSA 2W3GA 3LR0A 4HH3A 4I3JA 4IJGA 5F6AA 4G3KA 3EEAA 2PD7A 3SW1A 4QPRA 1S1YA 4GS9B 4CLCA 3NOTC 1X0OA 2GZAA 1XJ4A 3EEHA 2EWVA 2XA7S 2PYPA 4G3VA 2QWSA 1TF1A 3PBNA 5DJTA 3S7OA 3H7WB 1XJ3A 4NXGA 1NRJA 4HJ6A 1F98A 3T4TA 1V9ZA 1P9RA 2A24A 3P7NA 2P08A 3KX0X 2VZWA 3GECA 4EW7A 3JVUA 3EQVA 2OAQ1 1DP9A 2O99A 1OTEA 2W3EA 4Y3IA 3K2NA 3MR0A 3BW6A 2V0UA 2L4RA 4WEKA 2V1AA 4PHTA 1ZTUA 3EGXC 3KYQA 3BWLA 1Y28A 2W27A 4MMNA 2KX6A 3LI9A 4FSFA 5TBMA 4ETXA 4CLCD 5HWVA 2J3TC 1P9WA 3E0YA 3CLOA 2ZOHA 4Q0JA 4GCZA 3LIAA 3LR4A 1MC0A 4YWZA 3D3OA 3VOLA 2JHEA 1GSVA 4ME4A 1G28A 4JGOA 1XFQA 2P7JA 3UMDA 4HHDA 3IS2A 2B02A 2QJ5A 2W1TB 3CWFA 4EEUA 2IA2A 3A0RA 1D7EA 3ULFA 1YSQA 1IOUA 2O0YA 4WUJA 4ARZA 4I39A 1YAXA 4O0PA 4RQ9A 3UB9A 1OTBA 2W3HA 4LPZA 4KUOA 3LIEA 3HCYA 5J4EA 2PR5A 1P97A 4NXEA 5DJUA 1W63Q 5HDCA 3UE3A 2M1CA 3KSIA 4R38A 5DFXA 3MQOA 2PYRA 2OOLA 4DJ2A 2W3DA 4IUKA 3H82B 3S7QA 3TJZC 2VGLS 4GS9A 3OCLA 4LLOB 4JGQA 2QYBA 4ZRRA 2KDKA 2V1BA 2K7SA 3BQ8A 2PR6A 3EGDC 2QJ7A 2INWA 4JGRA 1NLYA 4EEPA 4HNBA 1MZUA 4B9OA 2D02A 4DMZA 1TS6A 2M7VA 1S66L 3PR6A 3UB8A 4WELA 3LUQA 3F1PA 4EU0A 4HP9A 3MQQA 2JKTM 3T4OA 3F1NA 1DRMA 3EWKA 3UE6A 5EFWA 1LSWA 4I5SA 3ICYA 5HDDA 5FL3A 2WKQA 5HD3A 3TW8A 4L9FA 3UB7A 3K3CA 2LB5A 4I3IA 4EESA 3HJKA 1TS7A 4I38A 5IU1A 4PKYG 5AJGA 4B93A 1ZHHB 3W2ZA 5K5BA 3VE3A 1N9OA 2EWWA 1UGUA 5J3WA 3V5ZA 2FZ0A 4MDZA 3CITA 3T4JA 2W1TA 3F1OB 4L0LA 3LIDA 3ZYTA 4GHIB 4NEED 5F69A 3MXQA 5KSHA 1N9LA 2Z6DA 4O01A 2VJWA 3CUEA 2P04A 1XJ6A 2G7UA 2VV8A 2M7UA 3U9MA 2K2NA 2GNXA 2YKHA 3CAXA 5HSQA 5CX7A 4CLCE 2VV6A 2KOIA 3TE8A 2XRNA 3H82A 3IBJA 1H8MA 4BBVA 2PHYA 2XA7M 2VKSA 3UMEA 3B33A 1V9YA 4H6JB 4UEYA 2HGVA 2VLGA 3VV4A 2B18A 2R78A 4HP4A 3EQUA 3R7WB 2OAP1 2PDRA 3O5YA 3FC7A 4EUVA 4JGPA 1OTAA 1TS0A 2VX8A 3LFVA 4P6ZS 4Y5FA 1W63M 4HQAA 4AFIA 1N9NA 3LR3A 1XFNA 3C8CA 2V0WA 2OWJA 1OT9A 4BBTA 2CMNA 5HPFA 4YOFA 2A2LA 1IFQA 4WF0A 2VA0A 1YKDA 2Y8HA 3NOPC 3TRCA 1NLZA 4DN0A 4I3AA 1JNUA 3MJQA 3FG8A 5G4ZA 1LSVA 2ZMFA 4M4XA 3T4KA 4BJPA 5HWWA 5AVEA 4OOLA 1LT0A 2L1MA 2NUTC 1GSXA 2BASA 2A24B 3H9WA 3V5YA 3OBFA 3C38A 1DP6A 3BQAA 2LB9A 2Z6CA 3KO6A 4Q0HA 3E4PA 1OTIA 4GHIA 2W1RA 3HJIA 2WKRA 4R3AA 4Z1WA 5MC7A 3H7WA 4E04A 1S4RA 4WL9A 4O8GA 1S1ZA 3G6OA 2XROA 3LYXA 3S7NA 3T50A 1KOUA 2K31A 2WKPA 4ETZA 3NHQA 2PD8A 5TBMB 5KIZA 4K08A 4UQIS 4LRXC 3MFXA 5AVFA 2J3WA 1D06A 2VGLM 2XSSA 3P01A 3PBSA 3BY8A 2QHKA 3PBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VEA A;  1LL8 A;  4HH2 A;  1UWP X;  4EER A;  1BYW A;  4DJ3 A;  3IBR A;  4EQ1 A;  3C2W A;  3PHY A;  1VB6 A;  5HWT A;  2ZBB A;  3K3D A;  5A8B A;  1F9I A;  1NWZ A;  2HV1 A;  4R70 A;  4F3L B;  3LIF A;  3BY9 A;  4HJ3 A;  4L9E A;  1EW0 A;  4MN5 A;  1OT6 A;  2L0W A;  4PKY A;  5J7E A;  1DP8 A;  3UB6 A;  1UWN X;  2QKP A;  4HIA A;  3LI8 A;  1OJG A;  3A0V A;  3ZQ5 A;  2V9A A;  2J80 A;  2ZOI A;  3F1P B;  4XT2 B;  1OJ5 A;  5DKK A;  2GJ3 A;  3F1N B;  5I5L A;  2YKF A;  1T1A A;  4BBU A;  1TS8 A;  3GDI A;  3LIB A;  1GSW A;  3RTY A;  1T19 A;  3PYP A;  4KUK A;  2P0N A;  1P0Z A;  1XJ2 A;  3RH8 B;  2EA9 A;  1LSX A;  5IS1 A;  1T18 A;  4HI4 A;  4LRZ E;  4GW9 A;  2JN7 A;  2D01 A;  4L9G A;  4NXB A;  4HOI A;  2H28 A;  4NXF A;  3LIC A;  5G4Y A;  4HY8 A;  1OTD A;  4WLA A;  3A0S A;  3F1O A;  5HD5 A;  1WA9 A;  2W0N A;  1S4S A;  3NOU C;  3E4O A;  3E4Q A;  3OLO A;  4F3L A;  4EXO A;  3U9J A;  4KQD A;  5DKL A;  1T1C A;  3V5X A;  3VE4 A;  1T1B A;  4HJ4 A;  2VV7 A;  1ODV A;  4LRY C;  5F5Y A;  2I9V A;  3D72 A;  4H6J A;  3NJA A;  4MN6 A;  5F68 A;  3IS2 B;  4EET B;  4XT2 A;  4WN5 A;  1S67 L;  4R6L A;  5HZH A;  2OWH A;  5HDS A;  4HH3 A;  4I3J A;  5F6A A;  2PD7 A;  3SW1 A;  1S1Y A;  4GS9 B;  3NOT C;  1X0O A;  1XJ4 A;  3EEH A;  2PYP A;  2QWS A;  5DJT A;  3H7W B;  1XJ3 A;  4NXG A;  4HJ6 A;  1F98 A;  2A24 A;  1V9Z A;  3P7N A;  3KX0 X;  3GEC A;  4EW7 A;  1DP9 A;  1OTE A;  3MR0 A;  2V0U A;  2L4R A;  2V1A A;  3BWL A;  1Y28 A;  2W27 A;  2KX6 A;  3LI9 A;  5TBM A;  5HWV A;  3CLO A;  2ZOH A;  4GCZ A;  3LIA A;  4YWZ A;  3VOL A;  2JHE A;  1GSV A;  1G28 A;  4JGO A;  1XFQ A;  2P7J A;  3UMD A;  4HHD A;  3IS2 A;  2B02 A;  2QJ5 A;  3CWF A;  4EEU A;  3A0R A;  1D7E A;  3ULF A;  4WUJ A;  4I39 A;  4RQ9 A;  3UB9 A;  1OTB A;  4LPZ A;  4KUO A;  3LIE A;  5J4E A;  2PR5 A;  1P97 A;  4NXE A;  5DJU A;  5HDC A;  2M1C A;  4R38 A;  3MQO A;  2PYR A;  2OOL A;  4DJ2 A;  3H82 B;  4GS9 A;  4LLO B;  4JGQ A;  2KDK A;  2V1B A;  2K7S A;  2PR6 A;  2QJ7 A;  2INW A;  4JGR A;  4EEP A;  4HNB A;  1MZU A;  4B9O A;  2D02 A;  1TS6 A;  1S66 L;  3UB8 A;  3LUQ A;  3F1P A;  4HP9 A;  3MQQ A;  3F1N A;  1DRM A;  3EWK A;  3UE6 A;  5EFW A;  1LSW A;  4I5S A;  3ICY A;  5HDD A;  2WKQ A;  5HD3 A;  4L9F A;  3UB7 A;  3K3C A;  4I3I A;  4EES A;  3HJK A;  1TS7 A;  4I38 A;  5IU1 A;  4PKY G;  3VE3 A;  1N9O A;  1UGU A;  5J3W A;  3V5Z A;  3F1O B;  3LID A;  4GHI B;  5F69 A;  3MXQ A;  1N9L A;  2Z6D A;  1XJ6 A;  2VV8 A;  3U9M A;  2YKH A;  3CAX A;  5HSQ A;  2VV6 A;  3H82 A;  4BBV A;  2PHY A;  3UME A;  3B33 A;  1V9Y A;  4H6J B;  2VLG A;  2R78 A;  4HP4 A;  2PDR A;  3FC7 A;  4JGP A;  1OTA A;  1TS0 A;  4HQA A;  1N9N A;  1XFN A;  3C8C A;  2V0W A;  2OWJ A;  1OT9 A;  4BBT A;  2CMN A;  4WF0 A;  3NOP C;  4I3A A;  1JNU A;  3MJQ A;  3FG8 A;  5G4Z A;  1LSV A;  4M4X A;  5HWW A;  5AVE A;  1LT0 A;  2L1M A;  1GSX A;  2BAS A;  2A24 B;  3H9W A;  3V5Y A;  1DP6 A;  2Z6C A;  3E4P A;  1OTI A;  4GHI A;  3HJI A;  2WKR A;  4R3A A;  3H7W A;  4E04 A;  1S4R A;  4WL9 A;  1S1Z A;  3G6O A;  3LYX A;  3T50 A;  1KOU A;  2WKP A;  3NHQ A;  2PD8 A;  5TBM B;  5KIZ A;  4K08 A;  4LRX C;  3MFX A;  5AVF A;  1D06 A;  3BY8 A;  2QHK A; 
#chains in the Genus database with same CATH topology
 4D4N A;  4IBX A;  2EX8 A;  2HJ9 C;  2HF6 A;  3EOI A;  4YT4 A;  1L3P A;  1YA7 O;  4DRI B;  3CPT A;  4DVZ A;  1VTM P;  4GQH A;  1MNE A;  2O9C A;  4ZAM A;  3HLC A;  2J7V A;  4EHP A;  3IBR A;  4ZTK A;  3PHY A;  1FTS A;  4QU3 A;  3C8G A;  3SP1 A;  1F5M A;  1VB6 A;  3OC2 A;  5E3A A;  1YPR A;  2AU5 A;  3DI5 A;  3Q7V B;  2B95 A;  3RFB A;  5A8B A;  1RCP A;  2OQM A;  1KTM A;  3FVY A;  2HV1 A;  5HPI A;  5BOH A;  2Z2L B;  2MWQ A;  1JWZ A;  4G7Z F;  3HLZ A;  4JJG A;  2G2W A;  4LDK A;  3X2Q C;  2ZM8 A;  3DTE A;  1D0Z A;  3GMW A;  4GLQ A;  3D9Y A;  4DXW A;  2L0W A;  1VK5 A;  4FAP B;  3MS6 A;  4EBK A;  1Q2P A;  1RCJ A;  2O9A A;  1E85 A;  1MQV A;  3GM3 A;  1LL5 A;  1XX2 A;  2O9B A;  5J8X A;  2OEV A;  3PBO A;  1FQG A;  4CIH A;  4Y2F A;  4U5H A;  3LEO A;  4CQH A;  3WS4 A;  2YLD A;  3VM6 A;  1Y6D A;  1EA8 A;  3CQZ A;  1STZ A;  3FYZ A;  4HBU A;  5DVW A;  4EWC A;  3GDI A;  4U3T A;  4UA7 A;  4G0H A;  3DTM A;  3ATP A;  4KUK A;  2J9V A;  3C4P A;  5IHV A;  3RIP A;  3HVF A;  2RSE B;  5IS1 A;  2Q00 A;  4CJG A;  3NI9 A;  3BRM A;  2FH5 A;  2D01 A;  2BE5 F;  2Z15 A;  4NXB A;  5CRF A;  2ZQ7 A;  1SZI A;  2GDC A;  4WZ5 A;  4ID4 A;  4JEA A;  4QY6 A;  3MQ0 A;  4U0T A;  5FAT A;  4IWB A;  4IUH A;  4NXF A;  3FWL A;  3R7C A;  3BRJ A;  1M57 C;  1Z09 A;  4P6Z M;  5G4Y A;  1G6O A;  3QP5 A;  4WLA A;  1T6I A;  1ZHW A;  2JKR M;  3F1O A;  5CHU A;  1IW7 F;  4CS8 A;  1JWV A;  5HD5 A;  5HL6 A;  4B6I A;  4PAC A;  3ABL C;  4E6X A;  3GWN A;  3HLD A;  4QY5 A;  2QY9 A;  3E4O A;  1ZHZ A;  3OLO A;  3RVZ A;  4CIP A;  4XLN F;  4F4B A;  5EGY A;  3V5X A;  2JCH A;  3PCV A;  5BQH A;  1YLW A;  1TDL A;  1K6S A;  3UDF A;  2JE5 A;  4BJ6 A;  4S2I A;  5TJJ A;  2P9V B;  3HNI A;  3IF6 B;  2X71 A;  5KYY B;  3G4P A;  2H10 A;  2I15 A;  1VET A;  2HUJ A;  4H6J A;  1WYC A;  3NJA A;  5EVL A;  5F68 A;  1L0G A;  3GEE A;  2WZF A;  3IS2 B;  4JXW A;  5EPH A;  3UPN A;  3S29 A;  3ZTM A;  1XP4 A;  3UGO A;  4XT2 A;  3OZH A;  1YLT A;  4NCQ A;  4FUW A;  2KSF A;  2EFX A;  3N8S A;  4UA6 A;  3IF6 C;  3R7W A;  4DE3 A;  4RDA A;  5KMW A;  2TMV P;  2XD5 A;  1B68 A;  4GNU A;  2EIM C;  3V3S A;  4R6L A;  3M1C B;  3NYM A;  5TGF A;  4WAB A;  4ER9 A;  4EW7 A;  4KQO A;  1SKF A;  2W3G A;  3S4X A;  3RQG A;  1CJF A;  1HZO A;  4IJG A;  5F6A A;  3NEC A;  1W5D A;  3AGD A;  4LDR A;  1KVL A;  2H5S A;  4EBL A;  3DJN B;  4QPR A;  1IEL A;  1S1Y A;  2QUP A;  1HE1 A;  4X1L A;  4E3I A;  2GZA A;  1YA9 A;  2R05 A;  2PYP A;  4IAR A;  4G3V A;  1TF1 A;  5L0I A;  5KYU B;  4S2J A;  4NXG A;  1F98 A;  2A24 A;  5L0H A;  3EGX B;  3ZDL A;  2J9U A;  2HP5 A;  3KX0 X;  4J32 B;  3IQ5 A;  2V2F F;  4KI2 A;  3Q6M A;  4LFU A;  4MTG A;  1FSW A;  1M6T A;  1MPL A;  3FOP A;  2G2U A;  2EX2 A;  2VK3 A;  3JVU A;  1DP9 A;  4Q7C A;  1TEM A;  1WGW A;  5DTT A;  1K4F A;  2PAV P;  4Y3I A;  3QHY A;  1WYB A;  3MR0 A;  3ZFZ A;  4BJ5 C;  2DB4 A;  1AVO B;  1ZU5 A;  1LLB A;  1N4O A;  4PHT A;  3UMH A;  4DBQ A;  3KYQ A;  3EGX C;  2YKZ A;  2RL3 A;  2KX6 A;  2OLU A;  1YM1 A;  2C04 A;  3AGE A;  4RBN A;  3K1H A;  2J3T C;  3CLO A;  4GCZ A;  3DAF A;  3ZVR A;  2QMI A;  1MC0 A;  3O39 A;  1FR6 A;  4JGO A;  3ZHH A;  4OQI A;  3NMJ A;  2J7P D;  2P7J A;  1V54 C;  3UMD A;  4HHD A;  1D1B A;  1KE0 A;  2ZC6 B;  4ESP A;  4EEU A;  2M4E A;  1RKE B;  3FKV A;  3ULF A;  1NU7 D;  1YSQ A;  1IOU A;  4WUJ A;  4MVR A;  3TUL A;  4ARZ A;  1PW8 A;  3UB9 A;  2W3H A;  2VCA A;  2P74 A;  1FFH A;  1CQA A;  1I4Z A;  2PR5 A;  4BG0 A;  1OQC A;  1MMA A;  4CS9 A;  2XDM A;  1YDI A;  4JUR I;  3BEH A;  4JVS A;  1W63 Q;  1MMN A;  2VAS A;  2DCF A;  3DWK A;  3E70 C;  3C7V A;  3MQO A;  2HV7 A;  1ONG A;  4JW1 A;  4UAA A;  1KE3 A;  4QJG A;  3H82 B;  3ZQY A;  3S7Q A;  3HBR A;  2O9X A;  4S2N A;  4XXR A;  3C62 A;  2PNO A;  2A0U A;  2HV6 A;  2K7S A;  2QJ7 A;  1IZM A;  4X0R A;  4EWF A;  1NLY A;  3IHU A;  3US6 A;  4HNB A;  4EEP A;  1K38 A;  2D02 A;  4XEV A;  1K56 A;  1TS6 A;  1D1J A;  3HNK A;  4E6W A;  1VOM A;  1NJ4 A;  4OIN F;  3F1P A;  1K0K A;  2JKT M;  1OCC C;  3S27 A;  4KZ4 A;  2Q4F A;  3UE6 A;  2XR0 A;  5EFW A;  4O79 A;  1LSW A;  1K57 C;  1U89 A;  5HD3 A;  3U0C A;  2HZ8 A;  1JR8 A;  4KZ8 A;  2A68 F;  2XEP A;  5EM0 A;  3UNW A;  2R7U A;  3G2Y A;  4ZBE A;  3HUO A;  2P6V A;  2EX9 A;  4MVZ A;  4KEN B;  1WE4 A;  1J8M F;  2CW0 F;  4XEK A;  1ZHH B;  5CIV A;  3MXR A;  3DZA A;  2EWW A;  1EKY A;  1UGU A;  1KDW A;  5J3W A;  4A5R A;  3NC8 A;  3O3V A;  2BG1 A;  1KNY A;  3GOD A;  4OD5 A;  4GHI B;  3BM6 A;  4J7T A;  1FCN A;  1JWP A;  2OEX A;  4WZ4 A;  5FQJ A;  5L2F A;  1UFB A;  1N9L A;  3VSL A;  1RGY A;  4P87 A;  4C7O B;  1S05 A;  1PWG A;  1EI5 A;  2XL6 A;  2JD3 A;  3RW0 A;  3ZWI A;  2Z6D A;  1SMY F;  1Z6F A;  2HP9 A;  4U0X A;  4GEH A;  4P9F A;  5FDH A;  2QTV A;  3C4O A;  1CPQ A;  4K1O A;  4E0I A;  3N8L A;  3I4U A;  2M7U A;  2K2N A;  1SKO A;  5A6J A;  2M64 A;  3EH2 A;  2HMZ A;  5EVI D;  3OA1 A;  3TE8 A;  2PBY A;  2AP3 A;  4BQM A;  3WS0 A;  3PHF 2;  3B33 A;  1MWS A;  1V9Y A;  5EOE A;  5FQ9 A;  2VCB A;  1LI0 A;  2E8J A;  1GCE A;  4YWQ A;  1MBL A;  3QMK A;  3X1O A;  1OW6 A;  3JPU A;  1FIK A;  3SYN A;  3UN7 A;  5TFQ A;  3IEE A;  2Y2K A;  1M2V A;  5CEC A;  2CGE A;  4ZLD A;  2LK4 A;  3DW0 A;  5DF7 A;  4CJO A;  4NK3 A;  4JTD B;  4E17 A;  3UPO A;  4P6Z S;  2D4U A;  3LNR A;  2KW3 C;  5HV9 A;  2V0W A;  2IXN A;  2KC3 A;  2NG1 A;  3MSH A;  4NQF A;  5F5H A;  3RYL A;  2XLE A;  2CMN A;  4ZJ1 A;  5A90 A;  4C75 A;  1ORJ A;  2A2L A;  1T01 A;  4DE2 A;  3DKA A;  1W8Q A;  4HEF A;  3N24 A;  3RXX A;  5JP7 A;  1NLZ A;  4DN0 A;  1VLS A;  4QDL A;  5CI9 A;  5L0G A;  1CEG A;  3QNB A;  4WMC D;  3E2K A;  3TQO A;  5HWW A;  2YVK A;  3W4Y A;  4JXG A;  3GAN A;  4OOL A;  4QHC A;  4NET A;  1GSX A;  3GM2 A;  2I8B A;  4ZLC A;  3V5M A;  4FX5 A;  2HFI A;  4I44 A;  4UDV A;  2LB9 A;  4OON A;  3KO6 A;  3P98 A;  3QP1 A;  3E4P A;  5HFO A;  3HTK C;  3HJI A;  2Y2Q A;  3H7W A;  2GAQ A;  2J46 A;  1Y4C A;  3AJM A;  2ZXP A;  1PWC A;  3IWI A;  4FTX A;  4LGW A;  3S7N A;  1KOU A;  1ZW2 A;  4OPZ A;  1OW7 A;  4X6T A;  4MBF A;  4AE4 A;  1BDJ B;  4C3E A;  3CZD A;  2A49 A;  5CER A;  3MFX A;  1HD8 A;  1UG7 A;  3P01 A;  4U5G A;  2QHK A;  3NDE A;  4M63 A;  1AUE A;  5CED A;  4HBT A;  1KDS A;  3DM5 A;  2C6W B;  4EKW A;  3KSH A;  3DD7 A;  3NKD A;  3GSG A;  3KSF A;  5FEG A;  1S7Z A;  4MVM A;  2ASR A;  2JKT I;  5GLB A;  1AWI A;  4EER A;  1JMW A;  5HSW A;  2X01 A;  4P9T A;  3JSZ A;  4GB7 A;  2LCH A;  2WGI A;  5AC5 A;  3SEO A;  1VMA A;  1FNT c;  1E86 A;  2Y2O A;  3OPR A;  4I1O B;  4EBP A;  4YL1 A;  3ZG5 A;  2WVO A;  4M3K A;  3LIF A;  3K1I A;  4OP5 A;  3C30 A;  3KMI A;  2HPB A;  4HJ3 A;  1IEM A;  4E3K A;  4DXC A;  2IXO A;  4IRU A;  4P6B A;  5DF9 A;  4IBR A;  3O88 A;  4MN5 A;  4X1M A;  3ZC4 A;  4PKY A;  2ZC4 B;  2XRH A;  2NUP B;  5L0C A;  4II7 A;  3UB6 A;  3V67 A;  1CGO A;  4BEM J;  5T1D B;  1TWH A;  2ZQA A;  3LI8 A;  3ZQ5 A;  1ZZP A;  3SXZ A;  2A1D D;  3T4Q A;  1FR0 A;  3O55 A;  2ZOI A;  1OJ5 A;  5DKK A;  1YT4 A;  2NSF A;  2GJ3 A;  5A6B D;  3IH8 A;  1TWC A;  3OOV A;  2AVX A;  5FI6 A;  3HKK A;  2ZMV A;  4YIN A;  2NUP C;  2IXM A;  5I5L A;  2YKF A;  3NRH A;  1FR1 A;  5GHY A;  2GA0 A;  3LIB A;  5L0F A;  1I2W A;  2JKG A;  3QNC A;  3EQL F;  4CDY A;  3PYP A;  1ST6 A;  3SS3 A;  5HAP A;  5L0J A;  3VP0 A;  1RKC A;  1G5Z A;  2P0N A;  2KLI A;  5CGX A;  1R5I D;  3RH8 B;  1T18 A;  4YNR A;  4JLF A;  4LRZ E;  4GW9 A;  3CJM A;  1SF8 A;  4CLC B;  5GPG B;  3LR5 A;  4Z9I A;  4X56 A;  5FDS A;  1TDG A;  2ZD8 A;  3T6G B;  4OIR F;  3K7D A;  3LIC A;  4KG5 A;  1T6Q A;  4Y17 A;  3O87 A;  1U60 A;  4HY8 A;  1OXK A;  1W79 A;  2J0W A;  4U5C E;  2IWC A;  3AOU A;  1WA9 A;  4XQ1 A;  4KZ3 A;  2JX0 A;  2W0N A;  5E2H A;  4H8R A;  4CLC C;  4NC3 A;  1S4S A;  3KSG A;  3NOU C;  3EFO A;  1XZP A;  3FXH A;  3B9Q A;  3PBR A;  3UR3 C;  1OPX A;  4HE8 D;  1T5O A;  1E83 A;  3AGT A;  5E2F A;  5A6K A;  1K04 A;  4PFP A;  5DKL A;  5LBR A;  1T1C A;  3ZG8 B;  1T1B A;  2HS5 A;  4BJ1 A;  1PZO A;  3BJN A;  4HJ4 A;  2NPU A;  1Q0F A;  5CHM A;  2P61 A;  3BYD A;  3HJC A;  1ODV A;  2CYD A;  3AGF A;  3CUE C;  4X69 A;  4LRY C;  1LI5 A;  1ONH A;  4PM8 A;  2UWX A;  3U2A A;  3LO7 A;  4QI0 A;  1D1C A;  1DOV A;  3VYW A;  2XLV A;  4PJJ A;  4BLM A;  1K54 C;  4C3Q A;  3B71 A;  3D72 A;  1SYQ A;  2JKF A;  3HRE A;  3OCN A;  1TQG A;  3MF0 A;  4OOM A;  1S67 L;  4OPR A;  4DBR A;  1EI7 A;  4RA7 A;  3ECS A;  2HDU A;  2ZLY A;  2W3F A;  1PIO A;  4MTO A;  3B47 A;  3JVV A;  4LDQ A;  5HZH A;  2DYS C;  2HJ3 A;  4J7Y A;  4E3L A;  2DGJ A;  3W4Q A;  4I3J A;  3HLE A;  3L7H A;  5KZH A;  4CS7 A;  1G8X A;  1QMF A;  3SXM A;  4JBF A;  3U4L P;  1N1C A;  1H9G A;  1BTL A;  4IB4 A;  4GS9 B;  3QVZ A;  3NOT C;  1X0O A;  1ZVZ A;  4FCF A;  4JF5 A;  3EEH A;  4E3M A;  2WUQ A;  1CEF A;  3AG4 C;  3S7O A;  1HY5 A;  1LS4 A;  3ZCZ A;  1NRJ A;  4HJ6 A;  2J7P A;  2XXA A;  3SS4 A;  2YEV A;  1ZKJ A;  1OW8 A;  2P08 A;  2G3V A;  3WRZ A;  2YRF A;  3ZGA B;  2ZJ9 A;  3U5S A;  1OTE A;  2W3E A;  2XM4 A;  4OKP A;  2R7O A;  4OQG A;  2R9W A;  2ZD9 A;  1CI9 A;  1LHY A;  5CEB A;  3BW6 A;  3V7O A;  2BLS A;  2L4R A;  2R03 A;  1ZTU A;  4RD9 A;  1V4A A;  4MMN A;  3GWL A;  2ZQ9 A;  4FSF A;  1ZHY A;  4P6I C;  4U5B E;  2DNS A;  4CLC D;  4B4X A;  5HWV A;  1NFN A;  4N06 A;  1YMX A;  3VRC A;  3MYF A;  3HLG A;  4B4Z A;  1YMS A;  3OPH A;  4CJN A;  3KYI A;  4FES A;  4YT8 A;  3ZNT A;  1NLX A;  4DRH B;  2BC5 A;  2ZC3 B;  1XFQ A;  1O3U A;  4CX9 A;  1DY6 A;  3MBZ A;  2H0Y A;  3IS2 A;  2B02 A;  2QJ5 A;  2W1T B;  2Y2N A;  3CWF A;  4JXS A;  1Z3I X;  1JTG A;  1D7E A;  1E4D A;  2IM8 A;  4YT2 A;  1N9B A;  4U9E A;  3M79 A;  4I39 A;  1XGJ A;  1YAX A;  1GHI A;  4LV3 A;  3JT1 A;  1ZYR F;  1OTB A;  4LPZ A;  3DE8 A;  4KNW A;  4XPW A;  4KUO A;  2GWW A;  1QLE C;  5GL9 A;  3LIE A;  3MZF A;  5TR7 A;  4WM9 A;  3LS0 A;  1JAF A;  1P97 A;  5DJU A;  2R7X A;  1IKI A;  4O6N A;  3EHN A;  1OKK D;  4GKU A;  3UE3 A;  2M1C A;  3UGP A;  2R02 A;  1ZC2 A;  1YZA A;  1I2S A;  5DFX A;  1K05 A;  1LIH A;  2KGO A;  1HLU P;  4K7B A;  5COM A;  2WZZ A;  3OCL A;  4KZ5 A;  2ZQC A;  4ZRR A;  2KDK A;  4YK5 A;  4Y7P A;  5AQ9 A;  3BQ8 A;  2PR6 A;  3M4B A;  4JGR A;  2C03 A;  3G35 A;  4BD1 A;  2Y2I A;  3FZC A;  1MZU A;  2PBD P;  2R7R A;  4U5E E;  1S0W A;  2J9P A;  1T9K A;  1S66 L;  3CG5 A;  3LUQ A;  4EU0 A;  3MQQ A;  3Q7Z A;  3E2L A;  4JTA B;  5F83 A;  3F1N A;  3U3F A;  3MZD A;  2B0J A;  1IYO A;  4EBB A;  4IAO A;  4I5S A;  2LQG A;  1V74 B;  4JKT A;  3ICY A;  2V26 A;  3TW8 A;  3KH2 A;  4L9F A;  1YLJ A;  1MWR A;  1TR2 A;  4L6R A;  3ITF A;  1RJ9 A;  2LB5 A;  3MYI A;  3MFD A;  3VSK A;  4JCZ A;  3HUM A;  4DXB A;  5GHZ A;  3B3X A;  3ABM C;  5D91 A;  3QZC A;  2ZQD A;  4I38 A;  5IU1 A;  5EVI A;  1VYK A;  4PKY G;  5EK0 A;  1OR2 A;  3VE3 A;  5E2Q A;  1W8Y A;  4KZ7 A;  4P85 A;  1G4W R;  5FQK A;  3F1O B;  5DQT A;  3ASO C;  3I5P A;  4S2P A;  1BLC A;  5DF8 A;  5F69 A;  2ZXO A;  4E3J A;  3MXQ A;  4WZ5 C;  5FEF A;  5F1G A;  2WL8 A;  1WAT A;  3TG9 A;  2WAE A;  2UUH A;  1C02 A;  2HKV A;  3UE0 A;  3NIA A;  4O01 A;  3HLF A;  2Y2G A;  4KG2 A;  3UMK A;  1LVK A;  4OOY A;  2Y55 A;  4Z9H A;  1L0D A;  1XJ6 A;  4EBN A;  2V3C C;  4Y13 A;  3GOR A;  3CAX A;  5HSQ A;  4R4S A;  3Q6N A;  2JBF A;  5CX7 A;  2PF4 E;  1VET B;  1ES4 A;  3H82 A;  3IBJ A;  4BBV A;  2PHY A;  3SOI A;  2VKS A;  4H6J B;  4OQH A;  4WMC A;  4KG6 A;  1K55 C;  3EZI A;  2VLG A;  2KYH A;  2B18 A;  3VV4 A;  2R78 A;  1K25 A;  5B1A C;  3RQE A;  1K57 A;  3R7W B;  4N6H A;  3O5Y A;  5CTN A;  3FC7 A;  3VP1 A;  3JYY A;  3V3R A;  3QTH A;  4WYY A;  3IHB A;  4JGP A;  4ZDX A;  2D5R B;  3AGU A;  3LFV A;  5JYO A;  1W63 M;  3ZG7 B;  5FQM A;  3KL4 A;  1J3W A;  1N9N A;  2WVQ A;  3N6I A;  3C8C A;  3MKE A;  4YFM A;  1OT9 A;  3G34 A;  5CGS A;  1HMD A;  4BBT A;  4N1X A;  1Q0D A;  3T4R A;  2NUT B;  3IX8 A;  1NXY A;  4X53 A;  1BR4 A;  4NTF A;  2VA0 A;  3T1R A;  3EG9 A;  1YKD A;  3W2V A;  4EV4 A;  1SCW A;  1L7C A;  4YN0 B;  3TOM A;  5GHX A;  3FG8 A;  2DI3 A;  1LSV A;  5I94 A;  2GDN A;  2ZMF A;  5FSR A;  5M19 A;  2I72 A;  3VFF A;  2DRW A;  1QME A;  3LEV A;  5AVE A;  1LT0 A;  5F5F A;  2EXB A;  2NUT C;  5HAR A;  1IYS A;  2A24 B;  4JPM A;  2WYX A;  2R7V A;  3Q07 A;  1H8Z A;  5DQZ A;  1MXO A;  2WGV A;  2Z6C A;  3GEH A;  2HZ5 A;  2VH3 A;  1ES3 A;  2J8W A;  4Q0H A;  4MVU A;  2PFD A;  4GHI A;  4EUK B;  1PFL A;  2WKR A;  3L8I A;  3UMI A;  4E04 A;  4C7O A;  4WL9 A;  5EE8 A;  4DF6 A;  3G6O A;  2R9X A;  2Y2L A;  2OJE D;  4G7O F;  4PMA A;  1E84 A;  2KQ9 A;  2XGN A;  5E3C A;  3DE9 A;  1E2X A;  2K31 A;  1G68 A;  2ZM2 A;  4QB8 A;  2WKP A;  1SHV A;  4ETZ A;  2PD8 A;  5HL1 A;  3JZ0 A;  4QWO A;  4GN2 A;  4K08 A;  4LRX C;  3UPP A;  4OPY A;  2J3W A;  2XSS A;  2ZL1 A;  3BY8 A;  4CDA A;  4O7D A;  4ONS A;  4R3B A;  2J9B A;  4E3O A;  1BT5 A;  3PBT A;  3C7U A;  5BQI A;  1ZG4 A;  2ZMA A;  4HH2 A;  2R7W A;  3L8J A;  4S2M A;  3LJB A;  5BUO A;  5KYN A;  1UWP X;  3J06 A;  1NYY A;  2E8I A;  4WEJ A;  4BEJ A;  1VQQ A;  1BYW A;  1BZ4 A;  2JPU A;  4ARZ B;  2A69 F;  3WS5 A;  5AGF A;  3NDG A;  3JRT A;  4EQ1 A;  2ZXR A;  3C2W A;  2GX5 A;  1ERQ A;  4U5D E;  3W4O A;  1PRQ A;  3VOY A;  1TKN A;  4CSA C;  2VGJ A;  5HWT A;  2ZBB A;  4UHU A;  4K0D A;  2J3T D;  5A6B A;  3FPV A;  1FSY A;  4ULV A;  2XFT A;  2XLN A;  1QKR A;  2UUI A;  1NWZ A;  1VEU A;  4PPR A;  4R70 A;  4F3L B;  4Y15 A;  2YL7 A;  2MJ6 A;  3LS1 A;  5AC4 A;  2B5R A;  4AK9 A;  1GHP A;  5DS4 A;  4JIO A;  2QE9 A;  1GM5 A;  1IKG A;  3BY9 A;  3E98 A;  4IHQ A;  5HAI A;  4PM5 A;  1YSP A;  4PJM A;  1W7F A;  2Y2H A;  1TVF A;  1JOG A;  4KZ9 A;  4QI2 A;  1FCO A;  1LI9 A;  4L9E A;  1EW0 A;  3ZG0 A;  4CS9 C;  1TD5 A;  1FFT C;  3NKE A;  4U9D A;  1DP8 A;  3OPL A;  2YQY A;  3NY4 A;  4BWI A;  2RD9 A;  4YL0 A;  2QKP A;  3QW0 A;  2XLD A;  4LV0 A;  5C5K A;  1I4Y A;  3U2L A;  3A0V A;  3FPW A;  5GLC A;  4S2N C;  3TJ5 A;  3F1P B;  2XLM A;  2QLA A;  3IT9 A;  4LV1 A;  2PP4 A;  1F1M A;  5KYW A;  4JZA A;  4FOF A;  1T1A A;  3KYJ A;  3BEC A;  4GJ4 A;  2XLW A;  1TS8 A;  2CNW D;  1GSW A;  5FI2 A;  1ORS C;  4D4X A;  1Y54 A;  4XPX A;  4OH0 A;  4JEB A;  1ESI A;  1JTD A;  1NBB A;  1MKM A;  5DS5 A;  1T19 A;  4N9L A;  3UE1 A;  4JC7 A;  2DYR C;  2ACG A;  1OXB A;  1P0Z A;  1HTZ A;  1Q0G A;  2IXP A;  4HI4 A;  3ZDJ A;  4MVS A;  3TK0 A;  3IXG A;  2JN7 A;  4PM9 A;  4D2O A;  2XK1 A;  3H2U A;  4L9G A;  3GVB A;  4B88 A;  1XZQ A;  3B0P A;  3FDQ A;  1J9M A;  4G3W A;  4N92 A;  2WGW A;  3I5Q A;  2X51 A;  4LER A;  1OTD A;  2HDR A;  1BBH A;  2MYS A;  5AQ7 A;  3A0S A;  1RP5 A;  1QVX A;  3WOD F;  5M18 A;  5IY5 C;  1PYY A;  1MWU A;  1YLY A;  3GEI A;  3A3D A;  2W4M A;  3EJN A;  4GDN A;  1ZU4 A;  4PFO A;  2FFH A;  1VB5 A;  3SXK A;  4H4K C;  5D92 A;  2WKI A;  2WKH A;  2Q0O A;  3U9J A;  3A11 A;  2J8Y A;  3F46 A;  1JVJ A;  4IAQ A;  4WBG A;  3VE4 A;  1VLT A;  2RCX A;  5EUA A;  2HJE A;  3B42 A;  2YLG A;  1ZHX A;  1SZV A;  4FH2 A;  4DJ9 A;  4PM7 A;  3S7P A;  3S90 A;  2XL8 A;  3TOI A;  4MCW A;  3K33 A;  2Y79 A;  1M2V B;  4DDY A;  3NG1 A;  5A91 A;  3FAJ A;  4MN6 A;  5G18 A;  4MVQ A;  1YYJ A;  2Q9M A;  1K6R A;  2IWD A;  3M6H A;  1MMD A;  3GM1 A;  1QZX A;  4EET B;  4WN5 A;  1E3U D;  3CI6 A;  5B1B C;  3WHN A;  4KQR A;  1Z5Z A;  2DMW A;  3QP6 A;  5HX9 A;  4CBE A;  5COF A;  2V8F A;  4UQI M;  3G30 A;  5HDS A;  2EIK C;  3ZNY A;  4Y0T A;  4R3J A;  5JSL A;  1W2W A;  1GGQ A;  4G3K A;  3EEA A;  3U8P A;  1JRA A;  2PD7 A;  3WS2 A;  1KGE A;  5B3S C;  4CLC A;  5E43 A;  1I5N A;  3R2P A;  3AG2 C;  3POV A;  4XWJ A;  2EWV A;  4NTB A;  2EPK X;  2VGK A;  4AL1 A;  3ASN C;  3PBN A;  3C7J A;  3H7W B;  3T4T A;  5L3V A;  3A3E A;  3P09 A;  3Q1F A;  3FAP B;  2Y3D A;  1GS9 A;  1KE4 A;  2VZW A;  1PI5 A;  1U0B B;  3GEC A;  5KYX A;  3LCE A;  1HE9 A;  4IJJ A;  3UNG C;  3DWW A;  1EWZ A;  3EQV A;  1M2O A;  2XFS A;  2L6H A;  3ITB A;  4F94 A;  3ZVW A;  3FOO A;  3KYE A;  1ES5 A;  4AE4 B;  2R7S A;  1I5Q A;  5T3W A;  3ISG A;  4S2K A;  4PJN A;  2V0U A;  2J9W A;  2V1A A;  4OVD A;  5FAO A;  3N8R A;  2OG2 A;  4ZJ3 A;  3EHM A;  1Y28 A;  1A41 A;  3M2K A;  4DOZ A;  5DLJ A;  4OIQ F;  5TBM A;  1OKK A;  4ETX A;  4KC9 A;  4QD4 A;  1P9W A;  2ZOH A;  3JRM O;  3LIA A;  1D0X A;  1MY8 A;  3LLK A;  3O86 A;  1YLP A;  2A3U A;  4KBL A;  4YWZ A;  3S84 A;  2IYL D;  4ME4 A;  1LE2 A;  4X68 A;  1C03 A;  3CMZ A;  2WZG A;  3KPH A;  2JC7 A;  4DRT A;  4OIO F;  2IA2 A;  3BFC A;  3V39 A;  2Y2P A;  5A93 A;  1ERM A;  3WS1 A;  4R1G A;  1NY0 A;  1QSP A;  1F2K A;  3AQB A;  256B A;  3HCY A;  3Q82 A;  1Z6A A;  3Q7V A;  4NXE A;  5J4E A;  1J8Y F;  4R0Q A;  2XS8 A;  3VOZ A;  2YL0 A;  3EGD B;  1Q2Q A;  5HDC A;  2EPM X;  2HMQ A;  3G50 A;  4MND A;  3A3J A;  4R38 A;  3O6X A;  2HP6 A;  4BL2 A;  4DJ2 A;  1YAU O;  2W3D A;  1K40 A;  3HLB A;  2PU2 A;  3TJZ C;  3Q7G A;  3A3F A;  4GS9 A;  3K1I C;  4LLO B;  3GRJ A;  2PU4 A;  4GD8 A;  2KK1 A;  2V1B A;  2Y3B A;  3W2W A;  1Y4O A;  1YQS A;  1H5X A;  3EGD C;  2INW A;  3SNH A;  3DJU B;  4MS2 A;  5EV0 A;  5FQI A;  4O7G A;  4B9O A;  1LI7 A;  1NZO A;  2Y4A A;  4NG2 A;  2M7V A;  1V55 C;  3UB8 A;  3PR6 A;  4HP9 A;  2R7T A;  1QPU A;  1KGG A;  4G7H F;  1DRM A;  3K6B A;  5FAQ A;  1BLH A;  5FL3 A;  3IPM O;  5HAQ A;  1U6H A;  3EZH A;  3UB7 A;  3W8I A;  3K3C A;  4Z9Q A;  4DVY P;  3RFY A;  4ZJ2 A;  1TS7 A;  2J45 A;  3TOL A;  4MNR A;  5AJG A;  4B93 A;  5JVE A;  5K5B A;  3AG3 C;  1GA0 A;  4OLD A;  1N9O A;  2CC1 A;  5FAP A;  3WWX A;  3SS5 A;  5DTS A;  4FWV A;  3V5Z A;  4MDZ A;  3IXD A;  3NCK A;  3ZTZ A;  2Y3H A;  2W1T A;  3AQC A;  4L0L A;  3LID A;  3ZYT A;  2YZS A;  4JF4 A;  2Q9B A;  2OKU A;  2EFU A;  3LEQ A;  4NEE D;  3G32 A;  3FMS A;  4OLG A;  3S22 A;  5KSH A;  2Y59 A;  4LEN A;  4BEN A;  3EFO B;  2WVN A;  1ES2 A;  3C63 A;  2WK0 A;  1T6U A;  5L3Q A;  1G4U S;  1WWP A;  2Q7R A;  2J9O A;  2VJW A;  1PW1 A;  2ZC5 B;  1HMO A;  1TWG A;  3WG7 C;  2P04 A;  2VV8 A;  1ZW3 A;  3Q81 A;  3VMA A;  3U9M A;  1LL9 A;  4KZ6 A;  1RMV A;  2YKH A;  3T1Q B;  3MZE A;  5DTK A;  2IOQ A;  1FMV A;  4PR9 A;  4CLC E;  1ALQ A;  2KOI A;  2XRN A;  1H8M A;  1OR3 A;  3DM9 B;  3JTL O;  2XA7 M;  3UME A;  4E7Z A;  4MTF A;  4KZB A;  3TJ6 A;  2HGV A;  4RX2 A;  2P9V A;  3IF6 A;  1CK3 A;  5KYY A;  1XA1 A;  3WRT A;  3CPT B;  4O6M A;  4HP4 A;  1CPR A;  4MW3 A;  3EQU A;  2OAP 1;  3I7J A;  1DJB A;  2PDR A;  1O87 A;  1CGM E;  4XUX A;  4W8P A;  3M2J A;  1LM3 B;  2ETS A;  2IWB A;  3C8G B;  4Y5F A;  1YLZ A;  4AFI A;  2L7A A;  2WZL A;  1DJA A;  2A0B A;  1XFN A;  3UDX A;  3UDI A;  3O10 A;  3T1X A;  3ABK C;  4G78 A;  3DTK A;  3QW1 A;  5HPF A;  1BLS A;  1M56 C;  1LKX A;  4YOF A;  4WF0 A;  5F1F A;  1EQ1 A;  3NOP C;  1PWD A;  5FAS A;  2V1Z A;  2EIJ C;  1YZC A;  3V50 A;  4I3A A;  1JNU A;  3S1Y A;  3N0T A;  5G4Z A;  3H2V A;  4M4X A;  1H6G A;  2Z2M B;  4JE9 A;  1NZU A;  3MLG A;  2L1M A;  2XLH A;  4OP8 A;  2XXA B;  5DS6 A;  3DMD A;  3GTC A;  3G4Z A;  3C38 A;  1DP6 A;  3BQA A;  4EBJ A;  2Y91 A;  2UV0 E;  2QNL A;  4LCM A;  2XSE A;  4I3M A;  1OTI A;  2W1R A;  5KYU A;  4BJ5 A;  1AEP A;  5MC7 A;  1S4R A;  1L0F A;  2HSB A;  3EGX A;  1Z7Q c;  3PMR A;  1O7E A;  4XUZ A;  5F82 A;  3L34 A;  4AX2 A;  3T50 A;  5FQQ A;  1C3B A;  4JXV A;  1ERO A;  3IWO A;  1K4E A;  1K55 A;  3B0V C;  4MVO A;  3NHQ A;  5KIZ A;  4YJW A;  4I1M A;  2NSG A;  4UQI S;  1G6A A;  3QVY A;  5AVF A;  1D06 A;  2VGL M;  4XLP F;  1BZA A;  1TFO B;  1DOW A;  4EUV A;  4HEA J;  4Y0U A;  1L3L A;  1R4T A;  3HNJ A;  1QQ3 A;  2VEA A;  4JCH A;  2LSE A;  1LL8 A;  1IYQ A;  1FIL A;  3H65 A;  4PM6 A;  5EHH A;  3IQ6 A;  2AWY A;  1A0K A;  4C3B A;  1NYM A;  4YL3 A;  3IHA A;  5L8M A;  1A7D A;  3UB5 P;  1PNE A;  4PJL A;  1XWJ A;  4DJ3 A;  4MQ9 F;  3JYI A;  2EXA A;  3G4X A;  3PDM P;  1RKE A;  4R23 A;  3TD7 A;  3K3D A;  2X0C A;  4XTK A;  5L07 A;  3CEX A;  3ZSU A;  1F9I A;  4OD4 A;  2NUT A;  4OIP F;  3NBL A;  5E2E A;  1GA9 A;  3M15 A;  2CNW A;  2LD6 A;  2OSU A;  4LV2 A;  4HES A;  1BSG A;  4P0M A;  1PI4 A;  4CS8 C;  5DFY A;  4N6C A;  3PXP A;  4BJT A;  2LFF A;  4W8K A;  1OT6 A;  3IXH A;  5J7E A;  1VHM A;  3AG1 C;  4HFK B;  1ORY A;  2X02 A;  1UWN X;  5CI8 A;  4HIA A;  5EVE A;  1OJG A;  3LY4 A;  3SH9 A;  1FAP B;  1YLM A;  1NRF A;  3DBA A;  5EEC A;  2V9A A;  3IH9 A;  3C8G D;  4JF6 A;  4KNV A;  4NKP A;  1VM1 A;  2J80 A;  4XT2 B;  5IT5 A;  4BJ6 C;  5CTM A;  3T6B A;  4CPK A;  5FCL A;  3F1N B;  5M1A A;  5K0I A;  2PT7 A;  4BBU A;  4S2O A;  2HDS A;  4RVA A;  4MW8 A;  5HW3 A;  5JS5 A;  3RTY A;  1RJ9 B;  2YL3 A;  2L6F A;  1FOF A;  3MBG A;  2WB7 A;  1G5U A;  2YWA A;  1BUE A;  5EVI B;  1XJ2 A;  2EA9 A;  3A3I A;  1LSX A;  4E18 A;  3IQC A;  5DVA A;  4FD8 A;  3WAQ A;  5JRA A;  4CSA A;  1H3Q A;  1XXM A;  3HLW A;  3T9O A;  4HOI A;  2H7V C;  1XKZ A;  2VC9 A;  3L1M A;  5D3O A;  1IYP A;  2YHS A;  2H28 A;  3T6J A;  2B0H A;  3MMH A;  4BMW A;  5EVI C;  2PX3 A;  1WTY A;  3A9C A;  3DWZ A;  4MN7 A;  3T4S A;  3OEO A;  1SDE A;  5BQG A;  3T12 B;  2V8C A;  3T1S A;  3N7W A;  1YVI A;  4Q0I A;  5A6A A;  1Z23 A;  1E3U A;  3IQA A;  4BPM A;  2Y69 C;  1CI8 A;  1LPE A;  3E4Q A;  1SR2 A;  4X25 A;  1KVM A;  4F3L A;  1Q0M A;  4EIY A;  3HUN A;  4EXO A;  2FGY A;  4KQD A;  2LFD A;  1L0E A;  2Y2J A;  2YL1 A;  2Y3G A;  3U2M A;  3W4P A;  2KNH A;  4U5F E;  2JKR I;  4JJF A;  3R4K A;  3B29 A;  2VV7 A;  1TFK B;  1CF0 A;  2Q9C A;  2XL4 A;  1NU9 C;  2PRF A;  5F5Y A;  1PZP A;  3S28 A;  3SZR A;  4JTC B;  2XS1 A;  4Q4Z F;  2I9V A;  3LY3 A;  1TWA A;  3T4L A;  2H7O A;  3ZVT A;  4AL0 A;  4XPY A;  1M6K A;  3MKF A;  2CCY A;  2EPO A;  1S6R A;  4E3N A;  1ZHT A;  5FZT A;  3KYZ A;  4PAU A;  1YJG A;  4R4R A;  3LAY A;  3IWQ A;  4GD6 A;  3RQF A;  4WGZ A;  5F28 E;  4N9K A;  1Q0K A;  2XH9 A;  3GQZ A;  3EG9 B;  2F22 A;  2W4B A;  4KZA A;  3IF5 A;  4XEF A;  2OWH A;  3FHD A;  3RF3 A;  4BL3 A;  3LR0 A;  4HH3 A;  5L0D A;  3D4F A;  1GHM A;  3Q7L A;  1WAS A;  2IBF A;  5CXW A;  1XGI A;  3HNL A;  1A7V A;  2AVK A;  1BUL A;  4RYE A;  1D0Y A;  2ZPA A;  2XM0 A;  4E0H A;  1RGZ A;  3SW1 A;  4LLE A;  2LIG A;  3UO9 A;  3RVY A;  1XJ4 A;  2BTF P;  4K0X A;  2GFH A;  2VB6 A;  2W45 A;  2XA7 S;  5AQB A;  4IVK A;  1E25 A;  4IGG A;  2QWS A;  3LGO A;  5DJT A;  5EM1 A;  1Z63 A;  5A92 A;  1XJ3 A;  1V9Z A;  1P9R A;  2R7Q A;  1PD1 A;  3P7N A;  4OQ0 A;  3GR2 A;  2ZXW C;  1FCM A;  5CHJ A;  2OCC C;  5JT4 A;  4FH4 A;  3BFD A;  5COG A;  4D60 A;  2OAQ 1;  2O99 A;  3NMI A;  4LCL A;  3NYL A;  4Q5S F;  3K2N A;  1KGF A;  1GQA A;  4WEK A;  3VAY A;  2A6H F;  1MKI A;  4Y0O A;  4O6Y A;  2ZL1 B;  3S0X A;  3W8K A;  1YYX A;  2QPN A;  3BWL A;  2W27 A;  3SZT A;  3LI9 A;  3ZQV A;  3L0I A;  3DXJ F;  4JKV A;  3ZG9 B;  4X55 A;  4YT5 A;  3E0Y A;  2MHR A;  5B3I A;  4Q0J A;  2EX6 A;  2P1A A;  3IX4 A;  3BLS A;  1JPJ A;  3KKB A;  3N2Z B;  3LR4 A;  1FMW A;  1HW1 A;  3LNM B;  3D3O A;  3VOL A;  1OCR C;  1GSV A;  2JHE A;  1G28 A;  2XQZ A;  2Q3T A;  5JYP A;  4WGY A;  1H0M A;  4CDV A;  3SXY A;  1NZE A;  3G31 A;  3A0R A;  3RJU A;  1M40 A;  4LLC A;  2O0Y A;  4DE1 A;  3IXB A;  3LUT B;  3CSK A;  4R32 A;  4K91 A;  4N1H A;  3FKW A;  4O0P A;  4RQ9 A;  1VYI A;  1VEU B;  2AWC A;  3QP2 A;  1CGN A;  1BR2 A;  4IVI A;  3IQT A;  3EH1 A;  3EPV A;  3GV9 A;  3RXW A;  3VP2 A;  3JSE O;  4GZB A;  3NUL A;  4H54 A;  2G3K A;  2Y39 A;  4UA9 A;  1NFO A;  1H8Y A;  3B0U X;  2CDQ A;  2EIN C;  2P7V A;  3OWT A;  1SKO B;  2OOC A;  2ZC7 A;  3KSI A;  4MBH A;  4KQQ A;  4DDS A;  2PYR A;  1OCO C;  2OOL A;  2L6G A;  3C8Z A;  3MX3 A;  1JPN A;  4WJ0 A;  2J0X A;  4IUK A;  2ZM0 A;  5GLA A;  1D1A A;  1HVB A;  2VGL S;  2Q9A A;  4JGQ A;  2QYB A;  2WAD A;  1ESU A;  2R9R B;  2Q9N A;  5GLD A;  3PAE A;  2A6E F;  2NUP A;  1AXB A;  1BLP A;  3QP8 A;  4A4A A;  2R25 A;  5KYW B;  2WKE A;  3U3B A;  4DMZ A;  4S2L A;  3M6B A;  4ANJ A;  5AQA A;  1DJC A;  5FI7 A;  2PX0 A;  3ZIB A;  1MND A;  4WEL A;  4K0W A;  2L9J A;  3W8H A;  3T4O A;  1H9T A;  1SDN A;  3EWK A;  5U47 A;  3U8V A;  2BL2 A;  3VFH A;  3LES A;  5HDD A;  5JLI A;  3DAV A;  2EPN A;  2FAP B;  2WKQ A;  3NMK A;  1APC A;  4IED A;  3FV7 A;  1ACF A;  2OU6 A;  4I3I A;  3NDB B;  4MBK A;  4EES A;  2OV5 A;  3HJK A;  2EPL X;  2EIL C;  3C5A A;  3LLI A;  4MLL A;  1C17 M;  2WGW B;  3W2Z A;  2FZ0 A;  2H0T A;  3JCU Q;  3K66 A;  3CIT A;  3T4J A;  1K56 D;  3MFN A;  3CHW P;  3G2Z A;  4J30 B;  5JUA A;  4LAC B;  4HFF B;  5T3T A;  3IX3 A;  2OJQ A;  3NYJ A;  3PTE A;  5E33 A;  3CUE A;  3EGD A;  2G7U A;  1HW2 A;  1OME A;  5CGW A;  3OPP A;  2H8A A;  4NTA A;  2GNX A;  1WN0 A;  1K54 A;  2PBE A;  4Q8I A;  2VV6 A;  4C3D A;  4ULW A;  3UY6 A;  1YAR O;  3C18 A;  1RXQ A;  2VCC A;  4DE0 A;  4UEY A;  2OLV A;  3DTI A;  3ITA A;  5A69 A;  2HDQ A;  4N4W A;  4GDB A;  4MEZ A;  1L2S A;  3RKO F;  4EUZ A;  1WOL A;  1PD0 A;  2XD1 A;  4OPQ A;  1OTA A;  1TS0 A;  2VX8 A;  5EOO A;  2ICW G;  4HQA A;  3TSG A;  3LR3 A;  2E87 A;  1NSG B;  4Z9J A;  5TJ5 E;  2HJM A;  2OWJ A;  5FA7 A;  3M4C A;  5KSC A;  1O5H A;  4DRJ B;  3BEB A;  2KJG A;  3QP4 A;  3VP4 A;  2WAF A;  4PK4 A;  3BLM A;  4EQI A;  2WZX A;  4NY3 A;  1IFQ A;  3CZ6 A;  2Y8H A;  1LS1 A;  4RX3 A;  3TRC A;  3MXS A;  3RH3 A;  3MJQ A;  3VF0 A;  3E9V A;  2H7B A;  2FFY A;  3T4K A;  4BJP A;  1OCZ C;  2QZ6 A;  4GYT A;  1BR1 A;  1XPB A;  3HL9 A;  3L9K A;  2W9Y A;  3N4I A;  3JYH A;  3ZG1 A;  2BAS A;  4GOG A;  3H9W A;  3V5Y A;  1PCX A;  3SH7 A;  3OBF A;  1A0B A;  3LEZ A;  2LP4 A;  4JRZ A;  5KYX B;  1LE4 A;  2XLO A;  2FFF B;  4DKI A;  3S9O A;  1MWT A;  4R3A A;  5E2G A;  4Z1W A;  3BFG A;  1H7I A;  3PAG A;  1XA7 A;  4O8G A;  4BD0 A;  5L09 A;  1S1Z A;  1MMG A;  1O07 A;  2XRO A;  2G62 A;  3BFF A;  3LYX A;  3SH8 A;  2YLI A;  4A2N B;  2HSQ A;  2Y2M A;  5TBM B;  5L10 A;  1PV3 A;  3BFE A;  2L81 A;  1ZG6 A;  1NG1 A;  4C6Y A;  2ZQ8 A;  2XF3 A;  1KU2 A;  3F47 A;  2C5W B;  2V20 A;  3VP3 A;  3PBS A;  4E7S A;  1A7E A;  3PBQ A;  3DAG A; 
#chains in the Genus database with same CATH homology
 2VEA A;  3KSH A;  3PBT A;  3KSF A;  1LL8 A;  4HH2 A;  2HJ9 C;  2JKT I;  1UWP X;  2HF6 A;  3EOI A;  4WEJ A;  4EER A;  5L8M A;  1BYW A;  4ARZ B;  4DJ3 A;  2O9C A;  3IBR A;  4EQ1 A;  3C2W A;  3PHY A;  2GX5 A;  1F5M A;  1VB6 A;  3OC2 A;  5HWT A;  2ZBB A;  3RFB A;  2J3T D;  3K3D A;  5A8B A;  3FPV A;  1F9I A;  1NWZ A;  2HV1 A;  4R70 A;  5HPI A;  4F3L B;  2MJ6 A;  3LIF A;  3C30 A;  3BY9 A;  4HJ3 A;  3E98 A;  4IHQ A;  1YSP A;  5DFY A;  5DF9 A;  4GLQ A;  4L9E A;  1EW0 A;  3PXP A;  4MN5 A;  1TD5 A;  1OT6 A;  2L0W A;  4PKY A;  5J7E A;  1VHM A;  1DP8 A;  2O9A A;  3UB6 A;  4II7 A;  3V67 A;  4BWI A;  1UWN X;  2QKP A;  4HIA A;  3LI8 A;  5C5K A;  1OJG A;  2O9B A;  3A0V A;  3ZQ5 A;  3FPW A;  3DBA A;  3PBO A;  4Y2F A;  2V9A A;  3T4Q A;  4NKP A;  2J80 A;  2ZOI A;  3F1P B;  4XT2 B;  4CQH A;  5IT5 A;  1OJ5 A;  5DKK A;  2GJ3 A;  3OOV A;  3F1N B;  2ZMV A;  1STZ A;  2NUP C;  2PT7 A;  4FOF A;  5I5L A;  2YKF A;  1T1A A;  4BBU A;  4GJ4 A;  1TS8 A;  3GDI A;  3LIB A;  1GSW A;  3RTY A;  1T19 A;  1MKM A;  3PYP A;  4KUK A;  2P0N A;  2KLI A;  1P0Z A;  1XJ2 A;  3RH8 B;  2EA9 A;  1LSX A;  5IS1 A;  1T18 A;  4HI4 A;  4YNR A;  4LRZ E;  4GW9 A;  2JN7 A;  1H3Q A;  2FH5 A;  4CLC B;  2D01 A;  4L9G A;  3LR5 A;  4NXB A;  4HOI A;  4G3W A;  2H28 A;  3MQ0 A;  4IUH A;  4NXF A;  3LIC A;  3MMH A;  4BMW A;  4P6Z M;  5G4Y A;  1G6O A;  4HY8 A;  1OTD A;  4WLA A;  2JKR M;  3A0S A;  3F1O A;  4MN7 A;  3T4S A;  5HD5 A;  5HL6 A;  1WA9 A;  2W0N A;  4CLC C;  4Q0I A;  1S4S A;  3KSG A;  3NOU C;  3E4O A;  3E4Q A;  3OLO A;  4F3L A;  3PBR A;  1OPX A;  4EXO A;  3U9J A;  4KQD A;  5DKL A;  5LBR A;  1T1C A;  3V5X A;  3VE4 A;  2JKR I;  1T1B A;  3BJN A;  2HJE A;  3B42 A;  4HJ4 A;  3R4K A;  2VV7 A;  5TJJ A;  1ODV A;  3CUE C;  4LRY C;  5F5Y A;  3U2A A;  3S7P A;  4MCW A;  2Y79 A;  2I9V A;  3D72 A;  4H6J A;  3T4L A;  3NJA A;  3OCN A;  4MN6 A;  5F68 A;  3IS2 B;  3MF0 A;  4OOM A;  4XT2 A;  4EET B;  4WN5 A;  1S67 L;  3R7W A;  3CI6 A;  3KYZ A;  4PAU A;  2W3F A;  2DMW A;  4R6L A;  3B47 A;  3JVV A;  5HZH A;  4UQI M;  4KQO A;  2OWH A;  5HDS A;  2W3G A;  3LR0 A;  4HH3 A;  4I3J A;  4IJG A;  5F6A A;  4G3K A;  3EEA A;  2PD7 A;  3SW1 A;  4QPR A;  1S1Y A;  4GS9 B;  4CLC A;  3NOT C;  1X0O A;  2GZA A;  1XJ4 A;  3EEH A;  2EWV A;  2XA7 S;  2PYP A;  4G3V A;  2QWS A;  1TF1 A;  3PBN A;  5DJT A;  3S7O A;  3H7W B;  1XJ3 A;  4NXG A;  1NRJ A;  4HJ6 A;  1F98 A;  3T4T A;  1V9Z A;  1P9R A;  2A24 A;  3P7N A;  2P08 A;  3KX0 X;  2VZW A;  3GEC A;  4EW7 A;  3JVU A;  3EQV A;  2OAQ 1;  1DP9 A;  2O99 A;  1OTE A;  2W3E A;  4Y3I A;  3K2N A;  3MR0 A;  3BW6 A;  2V0U A;  2L4R A;  4WEK A;  2V1A A;  4PHT A;  1ZTU A;  3EGX C;  3KYQ A;  3BWL A;  1Y28 A;  2W27 A;  4MMN A;  2KX6 A;  3LI9 A;  4FSF A;  5TBM A;  4ETX A;  4CLC D;  5HWV A;  2J3T C;  1P9W A;  3E0Y A;  3CLO A;  2ZOH A;  4Q0J A;  4GCZ A;  3LIA A;  3LR4 A;  1MC0 A;  4YWZ A;  3D3O A;  3VOL A;  2JHE A;  1GSV A;  4ME4 A;  1G28 A;  4JGO A;  1XFQ A;  2P7J A;  3UMD A;  4HHD A;  3IS2 A;  2B02 A;  2QJ5 A;  2W1T B;  3CWF A;  4EEU A;  2IA2 A;  3A0R A;  1D7E A;  3ULF A;  1YSQ A;  1IOU A;  2O0Y A;  4WUJ A;  4ARZ A;  4I39 A;  1YAX A;  4O0P A;  4RQ9 A;  3UB9 A;  1OTB A;  2W3H A;  4LPZ A;  4KUO A;  3LIE A;  3HCY A;  5J4E A;  2PR5 A;  1P97 A;  4NXE A;  5DJU A;  1W63 Q;  5HDC A;  3UE3 A;  2M1C A;  3KSI A;  4R38 A;  5DFX A;  3MQO A;  2PYR A;  2OOL A;  4DJ2 A;  2W3D A;  4IUK A;  3H82 B;  3S7Q A;  3TJZ C;  2VGL S;  4GS9 A;  3OCL A;  4LLO B;  4JGQ A;  2QYB A;  4ZRR A;  2KDK A;  2V1B A;  2K7S A;  3BQ8 A;  2PR6 A;  3EGD C;  2QJ7 A;  2INW A;  4JGR A;  1NLY A;  4EEP A;  4HNB A;  1MZU A;  4B9O A;  2D02 A;  4DMZ A;  1TS6 A;  2M7V A;  1S66 L;  3PR6 A;  3UB8 A;  4WEL A;  3LUQ A;  3F1P A;  4EU0 A;  4HP9 A;  3MQQ A;  2JKT M;  3T4O A;  3F1N A;  1DRM A;  3EWK A;  3UE6 A;  5EFW A;  1LSW A;  4I5S A;  3ICY A;  5HDD A;  5FL3 A;  2WKQ A;  5HD3 A;  3TW8 A;  4L9F A;  3UB7 A;  3K3C A;  2LB5 A;  4I3I A;  4EES A;  3HJK A;  1TS7 A;  4I38 A;  5IU1 A;  4PKY G;  5AJG A;  4B93 A;  1ZHH B;  3W2Z A;  5K5B A;  3VE3 A;  1N9O A;  2EWW A;  1UGU A;  5J3W A;  3V5Z A;  2FZ0 A;  4MDZ A;  3CIT A;  3T4J A;  2W1T A;  3F1O B;  4L0L A;  3LID A;  3ZYT A;  4GHI B;  4NEE D;  5F69 A;  3MXQ A;  5KSH A;  1N9L A;  2Z6D A;  4O01 A;  2VJW A;  3CUE A;  2P04 A;  1XJ6 A;  2G7U A;  2VV8 A;  2M7U A;  3U9M A;  2K2N A;  2GNX A;  2YKH A;  3CAX A;  5HSQ A;  5CX7 A;  4CLC E;  2VV6 A;  2KOI A;  3TE8 A;  2XRN A;  3H82 A;  3IBJ A;  1H8M A;  4BBV A;  2PHY A;  2XA7 M;  2VKS A;  3UME A;  3B33 A;  1V9Y A;  4H6J B;  4UEY A;  2HGV A;  2VLG A;  3VV4 A;  2B18 A;  2R78 A;  4HP4 A;  3EQU A;  3R7W B;  2OAP 1;  2PDR A;  3O5Y A;  3FC7 A;  4EUV A;  4JGP A;  1OTA A;  1TS0 A;  2VX8 A;  3LFV A;  4P6Z S;  4Y5F A;  1W63 M;  4HQA A;  4AFI A;  1N9N A;  3LR3 A;  1XFN A;  3C8C A;  2V0W A;  2OWJ A;  1OT9 A;  4BBT A;  2CMN A;  5HPF A;  4YOF A;  2A2L A;  1IFQ A;  4WF0 A;  2VA0 A;  1YKD A;  2Y8H A;  3NOP C;  3TRC A;  1NLZ A;  4DN0 A;  4I3A A;  1JNU A;  3MJQ A;  3FG8 A;  5G4Z A;  1LSV A;  2ZMF A;  4M4X A;  3T4K A;  4BJP A;  5HWW A;  5AVE A;  4OOL A;  1LT0 A;  2L1M A;  2NUT C;  1GSX A;  2BAS A;  2A24 B;  3H9W A;  3V5Y A;  3OBF A;  3C38 A;  1DP6 A;  3BQA A;  2LB9 A;  2Z6C A;  3KO6 A;  4Q0H A;  3E4P A;  1OTI A;  4GHI A;  2W1R A;  3HJI A;  2WKR A;  4R3A A;  4Z1W A;  5MC7 A;  3H7W A;  4E04 A;  1S4R A;  4WL9 A;  4O8G A;  1S1Z A;  3G6O A;  2XRO A;  3LYX A;  3S7N A;  3T50 A;  1KOU A;  2K31 A;  2WKP A;  4ETZ A;  3NHQ A;  2PD8 A;  5TBM B;  5KIZ A;  4K08 A;  4UQI S;  4LRX C;  3MFX A;  5AVF A;  2J3W A;  1D06 A;  2VGL M;  2XSS A;  3P01 A;  3PBS A;  3BY8 A;  2QHK A;  3PBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...