3CAXA

Crystal structure of uncharacterized protein pf0695
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
355
structure length
355
Chain Sequence
LPEGHPLKTLYQENKEIMKDAEMLNLYAKTLATTKDERMREEILGVLEEIVSSLRMVGFTHYNREEMLIFPYIERRGLTVIATVLWTKHDEIRAMIKQLAELLRKREEMPWEEFVEKFKAKAGEVAFALSDMVFRENNIFYPTLKALLSEGEWKAIKMQEDEIGYYKVKPPEWDPGEDVKPLHPWEINPELNVEQLLTLPKEVQQALRGQPLEFDKTQLKREEDIDLGTGYLNIEELKAIFEALPVDVTFIDKDDRVRFFSPGERIFTRTPSVLGRPVQLCHPPKSVYVVNKILKAFKEGRKKEATFWLRLREKYVYIKYVPLFNEKGEYIGTLEMTMDIAPYKKIEGEKRLLDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein PF0695.
rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein PF0695
total genus 119
structure length 355
sequence length 355
ec nomenclature
pdb deposition date 2008-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
A PF13596 PAS_10 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3caxA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3caxA02
5G4YA 4EXOA 3U9MA 4HJ6A 2PYRA 4MN5A 1LT0A 3F1PA 4HQAA 4WL9A 2R78A 2PDRA 3LIAA 1UWNX 3LUQA 3MQOA 4M4XA 5AVEA 5IU1A 2PYPA 1DP8A 3CLOA 3UMEA 4E04A 2W27A 5HZHA 4NXFA 3A0RA 4DJ2A 3H7WA 3MXQA 1S67L 4XT2B 1P0ZA 1NWZA 3G6OA 3UB8A 4HP9A 4LRXC 5DKLA 2HV1A 4H6JA 4YWZA 2YKHA 5J3WA 3C2WA 3CWFA 3E4QA 1VB6A 3LIDA 4HHDA 2QKPA 4XT2A 2OOLA 4EERA 1XFQA 5F68A 1DP6A 4F3LB 4WLAA 3V5YA 4HY8A 4NXGA 3BY8A 3U9JA 5I5LA 1TS7A 4LPZA 4MN6A 5J4EA 3NOTC 4PKYA 5HDSA 1D06A 1GSXA 3NJAA 4R3AA 4L9GA 3F1NB 4HH3A 4I38A 4WUJA 3F1PB 3ZQ5A 1TS8A 3VE3A 4HOIA 4HP4A 1EW0A 5HD3A 2WKPA 2A24A 3LICA 3SW1A 1OTDA 3MJQA 1XJ2A 1G28A 1OTEA 3GECA 3VE4A 3K3CA 2D02A 4KUOA 4KUKA 1OTAA 2PD7A 3LIEA 5DKKA 1GSVA 4HIAA 3P7NA 2D01A 3D72A 1LSXA 2JHEA 5HD5A 3V5ZA 4EETB 1DRMA 1LL8A 4H6JB 4L9FA 4BBUA 4PKYG 4HJ4A 4R38A 4EW7A 3MR0A 3RH8B 2M1CA 2INWA 2QJ5A 1T1AA 2VV8A 5HWVA 3EWKA 3BY9A 2V0WA 3IS2B 4GHIA 5HDDA 5IS1A 1T1CA 1S4SA 1OJGA 1JNUA 1OTBA 3LI8A 3IBRA 4WN5A 1S4RA 4JGOA 3H7WB 4EQ1A 1OT6A 3OLOA 1UWPX 4NXBA 2VLGA 2Z6CA 3FC7A 3NOPC 2PR5A 2WKQA 2V9AA 5HWWA 3NHQA 2OWHA 4K08A 5HDCA 3E4OA 3LIBA 5J7EA 4HH2A 4LRYC 4I3AA 3F1OA 5TBMB 1OJ5A 1P97A 1N9LA 2CMNA 2V1BA 2VV6A 3UB6A 1V9YA 2L0WA 5A8BA 5HSQA 2Z6DA 4JGPA 1T18A 4HJ3A 3UE6A 2BASA 4GW9A 4I3JA 3C8CA 5AVFA 2QJ7A 1BYWA 1OT9A 2QHKA 2L1MA 2V0UA 3GDIA 4GS9A 4F3LA 4GCZA 3BWLA 2L4RA 2H28A 4DJ3A 1S1YA 2A24B 2W0NA 1F9IA 1LSVA 2B02A 3B33A 1WA9A 5EFWA 2V1AA 1S66L 1X0OA 3E4PA 3ULFA 2OWJA 2KDKA 4RQ9A 4L9EA 1ODVA 3HJIA 1F98A 3MFXA 3CAXA 4EEPA 1TS6A 3LIFA 5DJUA 1XJ3A 3UB9A 3UMDA 2ZBBA 1T19A 4JGQA 2KX6A 1Y28A 2JN7A 4HI4A 5F69A 4KQDA 1S1ZA 5G4ZA 3K3DA 3UB7A 2J80A 2K7SA 2PD8A 1T1BA 1XJ4A 4JGRA 1MZUA 5DJTA 1V9ZA 2ZOIA 3PHYA 3H9WA 2EA9A 2VV7A 4GS9B 4I39A 4EESA 3MQQA 3KX0X 3IS2A 2ZOHA 2PR6A 4HNBA 2GJ3A 3F1NA 4B9OA 4BBVA 3RTYA 4BBTA 1D7EA 1DP9A 4EEUA 3EEHA 5F5YA 1N9OA 3PYPA 3NOUC 5KIZA 3F1OB 3HJKA 4I5SA 5TBMA 3H82B 1OTIA 3FG8A 3T50A 1N9NA 4LRZE 5HWTA 4R70A 3A0SA 2PHYA 2P0NA 2P7JA 3H82A 1GSWA 3LYXA 2QWSA 2VEAA 4LLOB 2WKRA 2YKFA 4WF0A 1LSWA 3LI9A 1KOUA 3V5XA 3VOLA 4R6LA 3A0VA 2I9VA 1TS0A 5F6AA 1XJ6A 4I3IA 1UGUA 4NXEA 3ICYA 4GHIB 1XFNA
chains in the Genus database with same CATH superfamily
2VCCA 3T4JA 4MN5A 1ZU4A 1ZYRF 4RBNA 4GDBA 3U3BA 4PM6A 2J3TC 4JW1A 3IQCA 4B93A 1PW8A 2YL3A 1LE4A 2Y8HA 4KQRA 4KG2A 4UHUA 1U6HA 1BUEA 5HL1A 1EROA 4S2JA 3BFDA 4NG2A 2WVNA 1R5ID 2ZJ9A 4YL0A 3HNJA 1WYBA 4NC3A 1FFTC 3NOTC 3VSKA 4BJPA 4DDYA 4JF5A 3GMWA 4HP4A 4YL1A 1ZHTA 4CLCA 3EGXA 2J7PD 3GM1A 4JTCB 3UNWA 1CPQA 3MYFA 3ZDJA 1JPJA 3EHNA 4KUKA 1RKCA 4HIAA 2XLWA 1M6TA 2Q9NA 5AQAA 2IWCA 3HVFA 5FAQA 3R2PA 4EW7A 4BL2A 1K6RA 1YPRA 3EWKA 5F28E 3ITAA 4EBJA 1OR2A 2H8AA 3B71A 2HJ9C 2O9AA 3LI8A 3IBRA 3UMIA 1MKIA 1W79A 3QMKA 3NULA 1J8YF 1ORSC 2ZL1A 5AQ7A 3SXKA 5J8XA 4JKVA 4U5BE 3L0IA 2VA0A 5HDCA 2VKSA 4ANJA 4HH2A 4I3AA 4LCMA 5TBMB 5HV9A 3UB6A 1T18A 2DGJA 3UE6A 3I4UA 4YJWA 4OQIA 4QDLA 2HDQA 2A24B 3PMRA 5AC5A 1LSVA 4QD4A 3C7JA 1E4DA 1JWPA 3HNLA 3WS5A 1LVKA 1WYCA 3PBNA 1CJFA 4RQ9A 5DLJA 4D4XA 3JVUA 4YFMA 1SF8A 3FV7A 5EVIB 1SDNA 2UV0E 4UAAA 2ZBBA 4JGQA 3DWWA 4R3BA 2I72A 4JCHA 2IBFA 1MWUA 1XJ4A 2XROA 2Z15A 3B3XA 3Q6MA 3Q82A 2B0JA 3PHYA 3ZSUA 2VV7A 1V54C 3D9YA 4OQ0A 5HAIA 4B9OA 1VQQA 2Y2KA 1T01A 2A6HF 5EV0A 4EEUA 5F5YA 2A68F 4CX9A 3LR4A 3HJKA 2G3VA 1K4EA 2E87A 2J3TD 4GD6A 4DF6A 5A6KA 2PHYA 2P0NA 3H82A 5E3AA 2NUPC 5FQMA 1OCOC 5JT4A 1QMFA 2H7BA 5DTSA 3ZG0A 4MBHA 1ONGA 2AWCA 1Z5ZA 3UDXA 5CX7A 4RDAA 4E7ZA 1TS0A 4FSFA 3VMAA 1ZHZA 2J0WA 3NDGA 3S7NA 3C5AA 4Q7CA 3VP3A 5DF8A 5HPIA 4MVZA 3JCUQ 2VX8A 5FA7A 1LPEA 1NWZA 2WZGA 3SS3A 3G6OA 3UB8A 4DRHB 3A3FA 2YKHA 4PFOA 2P74A 4EV4A 3KYJA 3GVBA 3IHBA 4BG0A 1XFQA 4DMZA 1MMNA 3N8SA 4YN0B 3M15A 5J4EA 5HDSA 4XEKA 4DJ9A 4MBFA 2MHRA 4EIYA 2PX0A 1YZAA 3VYWA 3MJQA 2XK1A 3DTEA 2YL1A 4BJ5C 4QY6A 2W1RA 3DXJF 2NUPA 3P7NA 3L7HA 2W4MA 4XPWA 4HJ4A 2CCYA 3RH8B 3OCLA 4WZ4A 3EJNA 1ES4A 2V0WA 1JNUA 3IH9A 1RKEB 1TEMA 2Y3BA 3H7WB 3LLKA 4F94A 5J7EA 1YLYA 1HE9A 4ONSA 2DB4A 4KC9A 1N9LA 1L2SA 1O3UA 1WE4A 4LACB 3LS1A 5AVFA 5BUOA 2R7SA 2VGJA 3EG9B 4QJGA 4GCZA 2PX3A 2AVKA 2WKHA 3CQZA 4XEVA 4E3KA 2BC5A 3MF0A 3I5PA 1I5QA 2AU5A 4K1OA 1UFBA 2LIGA 4JIOA 3H2UA 4ULVA 3LIFA 1A7DA 5DJUA 4G78A 5HAPA 4U3TA 4IBRA 5GLAA 4G7OF 4HI4A 3QP1A 1S1ZA 5EECA 4GDNA 1S05A 4MVOA 3ABMC 4JGRA 2I8BA 2ZOIA 4E0IA 4C6YA 4QI0A 3N8RA 2A3UA 1OCZC 1VYKA 2P61A 2ZOHA 4ZAMA 1ERQA 2HP9A 4BBVA 3TD7A 1Q0DA 2M4EA 3AG3C 3RXXA 3V3RA 4Z9QA 5A69A 3UPOA 4FX5A 1HVBA 1PD0A 5KIZA 1VLSA 3NMIA 4ETZA 5IHVA 3NBLA 3ABLC 1N9NA 2QWSA 4LDRA 1S7ZA 1IOUA 2JKRI 4OD4A 4KQQA 4H54A 3NY4A 1K57A 2WB7A 4GHIB 3OPHA 3U9MA 1ZZPA 1TDGA 2P9VA 4Y5FA 3LO7A 1MMGA 3ZG8B 5FQJA 3JVVA 4U5CE 1FILA 2EX2A 3R4KA 4KZBA 5HFOA 3VFFA 5DKLA 1BR4A 1RJ9A 4MDZA 2QE9A 3IHAA 4S2KA 1Z6AA 3LS0A 5K0IA 4E3NA 2CW0F 2JKGA 2ZM0A 2OEXA 1E3UD 3VV4A 1HY5A 5A6AA 4MLLA 4DXBA 4L6RA 1G6AA 4CLCD 2R7RA 4NTAA 3UPPA 2A0UA 3B47A 3BM6A 3N2ZB 2XD5A 2D5RB 3G34A 4N4WA 5FI2A 1RJ9B 3EHMA 4JVSA 2QY9A 3MS6A 1NZEA 4WJ0A 2F22A 2INWA 3PCVA 2FAPB 1FCNA 1NXYA 2A49A 2XD1A 4WN5A 1XZPA 3VRCA 5DTTA 3S90A 2WKQA 2V9AA 1MKMA 1H6GA 4MEZA 5L0IA 2EFUA 3NECA 4U5EE 2J45A 3WHNA 1G5UA 2WAFA 3LY4A 3LR3A 4GW9A 4II7A 2W3HA 2BG1A 2V0UA 4BD1A 1JOGA 4CDVA 1P9RA 2EX8A 2PAVP 2OOCA 5COFA 3ATPA 4KI2A 3QP4A 1QQ3A 3MKFA 3ULFA 4E3LA 3EFOB 2OJED 3AQCA 2CDQA 3DAVA 1NRJA 2IXMA 2P1AA 1TS6A 2EPKX 4XPYA 3CJMA 3UMDA 2H7VC 2QZ6A 3PTEA 2Y2IA 3ZVRA 2D4UA 4ZTKA 1JWVA 1GS9A 3K66A 4CQHA 1MMDA 4MNDA 1Q0MA 4MBKA 2YRFA 4X53A 1Z63A 3C4OA 1T6QA 4B4ZA 1NFNA 2K31A 3EQUA 5FI7A 5KMWA 1NFOA 3KSGA 2V1ZA 4UDVA 4H4KC 3LYXA 2Z2MB 3MSHA 2V8FA 4LERA 2XXAB 3BFFA 2XS8A 2YLIA 4JF6A 1KE3A 1CF0A 2CYDA 5EVIC 4EUZA 2Q9BA 3IPMO 1J3WA 3EQVA 3GODA 2YEVA 1XGJA 3VP0A 4WABA 3IWIA 1VOMA 2WADA 1BULA 5AVEA 5F5FA 3NI9A 2XLVA 2W27A 5E2EA 3IX3A 1GGQA 3S84A 4N1HA 4GYTA 1Q2QA 4OINF 2XL4A 2YLDA 2AWYA 1YM1A 2J9VA 3IF6C 4UQIS 3C2WA 4XT2A 3GEEA 3M1CB 4HHDA 3TJ5A 4PM8A 1IELA 3BY8A 4ESPA 3C62A 4JTDB 4MN6A 4GNUA 3CUEC 2ACGA 3BECA 1MXOA 4CLCE 2GWWA 4X1LA 4XUZA 1T5OA 3ZIBA 2MWQA 4NK3A 1BTLA 3IXHA 4FUWA 2X01A 3IXBA 5HD5A 4U9EA 4RX2A 4ME4A 2XL8A 3MXSA 4BLMA 3VM6A 3TJZC 1ES3A 1NYYA 5AC4A 4GHIA 4KG5A 1S4SA 3I7JA 5HSWA 3U2LA 3CI6A 2QPNA 2VLGA 2KOIA 3SXMA 3HLEA 1ES2A 4JTAB 3UDFA 3RVYA 4LRYC 3WS1A 4Y7PA 1V9YA 5T3TA 4LCLA 2IXPA 3DWKA 5CERA 2W3DA 3T4KA 4K0DA 4G0HA 3G32A 3NRHA 3V3SA 4DJ3A 4U5GA 3ZFZA 2W4BA 1F9IA 3S1YA 1KGEA 2B02A 5EFWA 3NYMA 3E4PA 4DE2A 4HFKB 2OWJA 2KDKA 4I3MA 3MXRA 1JVJA 4WEKA 2OLUA 4LV1A 1P9WA 3EFOA 4Y13A 3A11A 2PU2A 4JJGA 4MTFA 2XQZA 3A3IA 2RL3A 4KQDA 1TR2A 5BQGA 5L3VA 2H7OA 3GV9A 2XRNA 1WATA 1K04A 4ARZB 1OXKA 3DI5A 4R3JA 3RTYA 4Q8IA 2E8IA 4AX2A 3O88A 2LCHA 1KDWA 4WBGA 3Q7LA 1FR6A 3HCYA 1MBLA 3RFBA 2L81A 3AG2C 3RQEA 4K7BA 2WK0A 2LB5A 1GHIA 1K57C 1BZAA 1MC0A 3M4BA 1UGUA 1YAXA 2Y2NA 1CGME 4O0PA 5FATA 4E6WA 3A3EA 3QP8A 1CPRA 3SS4A 4CDYA 1SHVA 3NKEA 4DDSA 5A92A 1UWNX 3C63A 3MZEA 1KU2A 3UE3A 3WAQA 3IXDA 4XXRA 3TSGA 5JYOA 3EH1A 3EGDC 1PV3A 3OBFA 2G3KA 4HP9A 4LRXC 1K56A 4H6JA 1O5HA 3ZG1A 3VP4A 3RIPA 1ERMA 2JKTM 1DY6A 1WGWA 4X68A 1SDEA 2WGVA 1FSYA 4K0WA 3DJNB 3UB9A 1NLXA 4R3AA 3CMZA 2B95A 2R05A 5D92A 3U8VA 3VE3A 3WRZA 2EILC 3A3JA 4P9FA 4OP5A 3ZTZA 4O01A 3SH8A 1C02A 1YA9A 3VE4A 3TE8A 1TQGA 4H6JB 2JBFA 1OR3A 2QLAA 5HWVA 4BWIA 3PAGA 4KQOA 1U0BB 4ZBEA 2UWXA 2VGLM 3WODF 1RMVA 3BYDA 2HJ3A 1Z6FA 2LFFA 4OIOF 2Z6CA 1K4FA 3B0PA 1XPBA 2Y2LA 1K0KA 2ICWG 1ZW3A 2R03A 3LIBA 3MKEA 4W8PA 4HFFB 2R7TA 3S4XA 1VLTA 2M7VA 1IFQA 2HJMA 3KSFA 2HPBA 3GORA 5E2HA 1OW7A 4JPMA 3B9QA 2ZC3B 4ZJ1A 3GSGA 4GEHA 2B0HA 1ST6A 2O0YA 3DTIA 3E98A 4X1MA 1RKEA 4QPRA 4YOFA 3KSHA 1KVMA 2WL8A 2Y2PA 4U9DA 2H0TA 5TJJA 3MFNA 2Q4FA 3G50A 1Y28A 2A6EF 5F69A 4Y3IA 4S2LA 3S27A 5EVIA 5JS5A 1XGIA 2CGEA 2HZ5A 4IUHA 4K91A 1L0GA 1F5MA 2HDUA 1JRAA 3LGOA 3KX0X 2ZM2A 4N1XA 3DW0A 3F47A 3TG9A 2J9OA 1BZ4A 3F1OB 1G8XA 3PBSA 1OW6A 3CITA 1KE4A 3LJBA 3NDBB 1AXBA 1KGFA 4BJ6C 4WF0A 1EA8A 2V26A 1W63M 1G4WR 1LI7A 5M18A 3CPTB 4NEED 2ZXOA 1MMAA 3LESA 3PDMP 3LEVA 3T9OA 5KSCA 1Q0KA 4R1GA 2R7QA 4E04A 2J0XA 4LDKA 4XT2B 4IUKA 3JYYA 3U0CA 2HV1A 4N6HA 3EGDB 2IYLD 4P85A 4EERA 2IOQA 4S2PA 5DFYA 4WLAA 3FAJA 3U9JA 3O86A 3RQFA 4MN7A 1O7EA 5E33A 2P9VB 3FWLA 1LI5A 4PACA 2E8JA 2EX6A 4OQGA 2KSFA 3FAPB 3QVYA 5DKKA 5FL3A 1LSXA 4OD5A 3E0YA 4JCZA 4L9FA 2H10A 4PKYG 4DRJB 3HTKC 3SNHA 1LHYA 1OPXA 2QMIA 1GA9A 4J7YA 1HE1A 1YMXA 4ZLDA 2ZMVA 4I1OB 1I2SA 1G68A 4CS9A 5AGFA 1VEUB 1YMSA 5GHZA 3T4RA 2VGLS 3BQAA 2Y39A 1H8MA 1EKYA 4HJ3A 5CTNA 3C8CA 1M57C 1VK5A 4WGYA 3RVZA 1Y4CA 2DI3A 3OPPA 1ZG6A 2HUJA 4O79A 3G4PA 1W5DA 3EG9A 2V1AA 2Y2JA 2OG2A 2VC9A 3RH3A 3ZNYA 2FFHA 1GA0A 4MVRA 4C3EA 1ODVA 3QZCA 4DXWA 1XJ3A 4OPQA 3W2ZA 2G2UA 2HZ8A 3IH8A 2L6GA 4BEMJ 3PBRA 4Z9HA 2J80A 2R02A 3NKDA 4EUKB 4Q4ZF 3FOPA 2XDMA 2WZZA 1Z09A 2PBDP 3G4XA 5COMA 4PM7A 4I5SA 3IX8A 3L8JA 3T50A 5EPHA 2JPUA 2HP6A 3DBAA 5CEBA 3V50A 2QYBA 2VEAA 2DMWA 5MC7A 3LNRA 2KYHA 3IEEA 5A6JA 4R6LA 2Q3TA 5F6AA 5FEGA 1JTGA 4I3IA 1ZHXA 3W2WA 5EGYA 1K54C 4EXOA 1VMAA 2PYRA 1LT0A 1YQSA 3AGTA 1T9KA 5D91A 5KYUB 1PI5A 4DJ2A 2EPOA 4AFIA 1EI7A 3T4TA 5KYWB 4YT5A 1K56D 3CWFA 1L0EA 1A7EA 2HSQA 2R9RB 3VOZA 4YINA 1XXMA 4HH3A 1NLZA 1HMOA 4WUJA 1OCRC 2HJEA 4JXSA 5JSLA 2NG1A 2KK1A 4MNRA 3FPWA 3FVYA 3M79A 3JRMO 2MJ6A 1OKKD 2YWAA 1N1CA 3ASNC 2HFIA 3DAGA 3V5ZA 5KYWA 2WKIA 2EXAA 2V2FF 3ZQYA 1L3PA 5CECA 2Y2QA 3HLGA 1PFLA 1PCXA 1WOLA 5GHXA 1CGOA 1UWPX 3N7WA 3UPNA 1U89A 3VF0A 1H9TA 5DFXA 1C17M 1ZU5A 4FTXA 2OAQ1 3C38A 4EWFA 4DRIB 4BL3A 1N9BA 1VHMA 2CNWD 3UGOA 1FAPB 3NYLA 5L8MA 1LS1A 1ESIA 1YYJA 1D1BA 1QSPA 2Q0OA 2DYSC 3P01A 3HLBA 4EEPA 1PI4A 5EHHA 1D1AA 4GLQA 2ZQAA 2LSEA 2JN7A 2VCAA 1AWIA 4OOLA 1CI8A 1NJ4A 3UB7A 4CBEA 1D1CA 2ZQDA 4D2OA 1LLBA 3S28A 3S7QA 3X1OA 2Q9CA 4I39A 2ZMFA 1S0WA 2EX9A 4M63A 4GJ4A 1BLPA 1OTIA 4NETA 1MQVA 4FESA 3AJMA 4JJFA 5KYYB 3E70C 2WKRA 3BQ8A 3IWOA 3C7UA 4OVDA 3MX3A 1LI9A 1BSGA 3QP2A 4JLFA 1IYOA 4R0QA 3KYEA 2IA2A 5CHJA 2PDRA 3DM9B 2W45A 3CLOA 3UY6A 5HZHA 3K33A 4JEBA 3H7WA 2BE5F 1PNEA 2R7UA 2DNSA 3BFGA 3ITBA 4D60A 4JBFA 4DVZA 2NUTB 5CI9A 3KO6A 1XA1A 3RXWA 3DWZA 2JX0A 1SKFA 3GWNA 2R9WA 1TS7A 5L09A 2HV6A 1RCPA 4OKPA 3ZCZA 2M7UA 1BDJB 3BW6A 1C3BA 4HEFA 4M3KA 3VP2A 2L9JA 4CLCB 5DS6A 2WUQA 2JHEA 2KLIA 1DRMA 5E2FA 4G3KA 2XXAA 5JRAA 4MW8A 2PNOA 2J9PA 4LGWA 4C3QA 2J9UA 5A6BA 1LL5A 3DM5A 3BLMA 2KW3C 3QVZA 4N92A 3WRTA 3RKOF 4KZ3A 3L1MA 3NOPC 1YKDA 4EQIA 3U2MA 3LAYA 3NHQA 1W7FA 3OC2A 4PM9A 2HDRA 3KPHA 2V1BA 4PMAA 5JYPA 3G31A 2LQGA 4YT4A 1M40A 1BYWA 2L1MA 1EWZA 1D1JA 4RD9A 4GS9A 1ZC2A 3BWLA 2IWDA 2ZLYA 3M6HA 1S1YA 3O87A 4DXCA 2W0NA 4Z9JA 3FOOA 3EGXB 4G7HF 2PRFA 5HX9A 2TMVP 5DS5A 3K2NA 1TFKB 3AOUA 3IHUA 4KZ6A 2L7AA 5KYUA 4PFPA 3DD7A 4EKWA 2GX5A 1XWJA 3U3FA 1H8YA 4O8GA 4IBXA 1KE0A 4EU0A 2PT7A 3UR3C 4GS9B 3NMJA 4BBTA 3S29A 1YZCA 2LK4A 3G2ZA 2W3EA 4MVUA 3TJ6A 3TOLA 3GEHA 4DOZA 4JKTA 5CHUA 3FG8A 1HD8A 4XEFA 2YLGA 4P6ZM 2LD6A 3HKKA 2V20A 4QWOA 1MWSA 3GTCA 3LY3A 1PWDA 4CPKA 4XQ1A 5KZHA 4E0HA 5CI8A 4ZJ3A 3DKAA 3HJIA 1C03A 1XFNA 3ZVTA 1I4ZA 1K54A 4HJ6A 5FEFA 3GEIA 3F1PA 3FZCA 4A2NB 1DJBA 1TDLA 3EZHA 2RCXA 3LUQA 3T4QA 4CIHA 5IU1A 1JPNA 3UMEA 4O6MA 4JXWA 2MYSA 5D3OA 1YLJA 4EBLA 2VJWA 1QLEC 1BLCA 1JMWA 1FMWA 1SZIA 3SYNA 1H5XA 1SCWA 3ZDLA 5J3WA 1FQGA 2GA0A 3J06A 3LIDA 2ZC4B 2OOLA 4GN2A 5FCLA 5L10A 3N6IA 4LPZA 1D06A 2ZC6B 3NJAA 3R7WB 2OV5A 4DBQA 4P9TA 4HOIA 1G6OA 3GM3A 1BR1A 2K2NA 4HESA 3FYZA 2Y2HA 1OTAA 2LB9A 2J7VA 1GSVA 3C8ZA 4PJNA 2D01A 1KGGA 2WGWB 3D72A 4X56A 4CJGA 1OKKA 3AGDA 1NRFA 2XS1A 3HNKA 5DTKA 3C8GB 1VETB 3MR0A 1OQCA 4JZAA 1Z7Qc 2R9XA 4UA6A 4KNWA 3SEOA 2HMQA 3OA1A 3BY9A 4HEAJ 1VTMP 4LV3A 2M64A 1W63Q 3NYJA 4PR9A 4FD8A 1S4RA 1DOWA 2XRHA 2J46A 2XM4A 4EQ1A 4IAOA 3K1IA 1H0MA 3IXGA 2KC3A 3L34A 4QY5A 1AEPA 2YKZA 4IGGA 4LDQA 3M2KA 2PFDA 3R7CA 3OWTA 1SKOB 3SXYA 2WGWA 5TFQA 3VSLA 3LEOA 1L0DA 2BASA 3NG1A 4YK5A 1ONHA 2XLNA 2LFDA 3C18A 4F3LA 4Y2FA 3ISGA 3UN7A 1A7VA 2CNWA 2XFTA 1WA9A 4NTBA 5G18A 5AJGA 1ZW2A 3O39A 4CLCC 4F4BA 2H0YA 4WMCD 3UO9A 2W3GA 4A4AA 2KX6A 3S0XA 5GL9A 3JSZA 2W3FA 4IJJA 4NQFA 1YLTA 2RD9A 5I94A 1IKIA 3Q7ZA 1YJGA 1QMEA 3A9CA 3IS2A 2PR6A 5GHYA 1D7EA 1RP5A 3PBTA 4OIPF 1E3UA 5DVWA 2OLVA 4J7TA 2DYRC 2YL0A 1Q0FA 2ZMAA 5A93A 3T6JA 4C7OB 2XA7M 4MVMA 4BJ5A 4LRZE 2C04A 2A2LA 4R70A 2P7JA 5HWTA 1Y6DA 3G35A 1OCCC 3MZFA 5EVID 2HF6A 4OQHA 4Q0JA 2WVQA 3UGPA 4BD0A 2KQ9A 2ZD8A 2R7VA 2HSBA 4WL9A 2R78A 4BENA 1RGYA 1YARO 4C7OA 3E2KA 4WM9A 2ZD9A 3OCNA 1BR2A 3PXPA 1BBHA 2O9XA 3JPUA 5GPGB 2GDCA 4OLDA 4JRZA 1LE2A 1IEMA 2W9YA 2IXOA 4HY8A 3MQ0A 5B1BC 4LV0A 2C6WB 3AG1C 3MBGA 3HJCA 2CC1A 1FCOA 4EHPA 4S2NA 4XLPF 3JRTA 1EQ1A 1H9GA 1HTZA 2GZAA 1A0BA 2ZQ8A 3T6GB 3ZWIA 1FTSA 3RW0A 5A6BD 1D0XA 5IS1A 1T1CA 3SXZA 2VGKA 1NBBA 1H7IA 4JGOA 3KYQA 5GLBA 5IT5A 3C4PA 4HBTA 2OJQA 2KGOA 1K40A 1HZOA 3EGDA 5E2QA 3IF6A 1ORJA 5EUAA 2UUIA 3EOIA 1VB5A 1SKOA 5BQIA 1NLYA 5KYYA 3MLGA 1Q2PA 4OOYA 4KBLA 1OXBA 5L0GA 3GANA 3DE8A 4KZ9A 1XP4A 4Z1WA 3FXHA 1ZTUA 3WWXA 4C75A 1O87A 4L9EA 4UQIM 3N0TA 4PAUA 3TK0A 2VH3A 3S7PA 3FKVA 4MVQA 4JC7A 2V3CC 1T19A 3IQAA 1OW8A 3ZYTA 3K3DA 1MWRA 2J8YA 4RVAA 3CSKA 2Q7RA 4IAQA 1VETA 3LLIA 2IWBA 4OIQF 3H9WA 3BRMA 1OMEA 1AUEA 3KKBA 3O55A 2YL7A 3AGUA 1J9MA 3MZDA 3ZG5A 4OH0A 3M6BA 1FFHA 3M4CA 5FQIA 1FSWA 4JE9A 1JTDA 3A0VA 5AQBA 1NU9C 3L8IA 2J8WA 1Z23A 2EPLX 1Z3IX 1KDSA 4OOMA 3S7OA 2VZWA 1DOVA 1YA7O 4EBKA 3LIAA 4X25A 3AQBA 2Y2OA 2Q9AA 5EVEA 5FQ9A 3V39A 1W2WA 3IQ6A 4KENB 4E17A 4YL3A 3HLWA 3RYLA 2QKPA 5F68A 1DP6A 1S6RA 3VP1A 3K6BA 2HMZA 1ORYA 2ZXRA 3TOIA 3FPVA 3ZQ5A 3ZG7B 1YSQA 1E86A 1TS8A 3BLSA 3HL9A 2GNXA 1XX2A 3BFCA 3TW8A 3T6BA 2NUPB 4QHCA 1G28A 1GHPA 1SMYF 1TD5A 3HUOA 3RF3A 4Y17A 3C8GA 4AL1A 4EETB 3LUTB 5COGA 2ZC5B 2JCHA 1LL8A 3NMKA 1ZVZA 2Y91A 1K05A 4OP8A 3K7DA 2UUHA 1T1AA 4Y0TA 4YT8A 3IBJA 3IS2B 1OJGA 2XLEA 1VYIA 1SZVA 1JAFA 1OT6A 2HP5A 3K1IC 2OWHA 1CGNA 3E4OA 4BJ1A 5BOHA 2JKTI 3SZTA 3F1OA 2G2WA 1O07A 1CQAA 3Q7GA 3VOYA 1OT9A 1RGZA 1ZKJA 4B6IA 3CEXA 3IQTA 3GDIA 1L3LA 2DCFA 5DS4A 4E6XA 4KZ8A 4S2IA 2OSUA 1CEFA 3BRJA 3OPRA 2VK3A 1FCMA 1M2VB 5EM1A 2X71A 2I15A 2AP3A 1K38A 3EPVA 4MTGA 4J32B 5DQTA 1LM3B 3KYZA 2RSEB 5KYXB 4DRTA 4CIPA 1R4TA 4WMCA 4BPMA 5HARA 4U0XA 5B1AC 4JXGA 1MZUA 5DJTA 4NKPA 1WN0A 3CHWP 1AVOB 5FASA 1I5NA 5L0HA 2QTVA 1Y54A 5FDSA 4EESA 5CGSA 1H3QA 5TBMA 2R7XA 1D0YA 5JUAA 3UMKA 2NPUA 3NDEA 2H5SA 3OZHA 1MY8A 3GQZA 3SZRA 4D4NA 1H8ZA 1YLZA 2HDSA 5T1DB 4U0TA 1MPLA 1D0ZA 1U60A 3W4PA 3ASOC 4WELA 4WZ5C 1K25A 2G62A 1TKNA 1WASA 4FH2A 5G4YA 2HGVA 3OEOA 1YSPA 5TGFA 3O10A 5FI6A 4AE4A 5CTMA 3I5QA 2EIJC 5M19A 5HL6A 3Q81A 1P0ZA 2WZXA 2X51A 4BEJA 2ZQCA 1L0FA 4PK4A 5TJ5E 4P0MA 4FOFA 2BTFP 4MS2A 2NUTA 3CPTA 1LI0A 1W8QA 1KVLA 256BA 3DE9A 2WKEA 2WAEA 4S2OA 4CS7A 3F1PB 1G5ZA 4N9KA 4DE1A 3UDIA 5FQQA 2V8CA 3KL4A 2KNHA 3ZVWA 4A5RA 4ZDXA 2PU4A 4KUOA 3LIEA 1ACFA 5F83A 3E9VA 3JSEO 5E2GA 2L6FA 5F5HA 4GKUA 3T4LA 4O7GA 2R25A 5HDDA 2Y2GA 3MMHA 3R7WA 2PBEA 1A0KA 1ZHYA 2Y3DA 1TF1A 3BJNA 1IYQA 1P97A 1IKGA 5HSQA 4CS8A 2OCCC 2OEVA 4EBPA 1TVFA 1V55C 3HUMA 2P6VA 4IRUA 2H28A 3TULA 4ETXA 2JKRM 2Y59A 5DVAA 1TFOB 1IW7F 1X0OA 1PYYA 2W1TB 5KSHA 4X6TA 1BT5A 4N06A 3O3VA 4IVIA 3PHF2 1FOFA 2C5WB 2XM0A 3CZ6A 4JEAA 4IEDA 4C3DA 4IVKA 3W4QA 2PD8A 2A1DD 4WGZA 2J9WA 5BQHA 4QI2A 1HW1A 4IARA 3MQQA 4FCFA 3DMDA 4HNBA 4P6ZS 4G3WA 2LP4A 2WZFA 2AVXA 4UA7A 3FKWA 1CK3A 4C3BA 1N9OA 3H2VA 4DBRA 3KSIA 2ZQ7A 4O6NA 1L7CA 2C03A 2EWVA 4S2NC 2GFHA 4LENA 4LLEA 5CIVA 2YKFA 3FHDA 1PRQA 2Q00A 2ZXWC 3W8HA 1NU7D 1XJ6A 3K3CA 3WS4A 2ZXPA 2P08A 2YZSA 3HBRA 1FMVA 4Q0HA 4HQAA 2FFFB 1RCJA 2XLOA 2YHSA 2JC7A 4P6BA 3LEZA 3V5MA 1NYMA 3V67A 2XSSA 2WGIA 3EEAA 5U47A 3WG7C 4E3MA 3ZQVA 5M1AA 3ABKC 2A69F 1K55A 1JWZA 4PJMA 4XPXA 2GAQA 3S22A 3U8PA 4ID4A 2XLHA 4PKYA 5F1FA 4MMNA 4QU3A 2FH5A 3ZC4A 3T12B 3US6A 1VEUA 2A24A 4CDAA 3SW1A 2O9BA 4XTKA 1OTEA 2PBYA 5A90A 2FGYA 3ZTMA 4MCWA 5CGXA 3C8GD 4IJGA 4QB8A 1NSGB 4WEJA 3HLCA 3C7VA 1W8YA 3DJUB 4BBUA 4CJNA 4R38A 5AQ9A 3PBOA 3ZHHA 2QJ5A 2FZ0A 2ASRA 1CEGA 1K6SA 4E18A 4U5FE 1OTBA 4S2MA 4JURI 3Q1FA 3SH7A 5CEDA 3GR2A 4IB4A 5E3CA 1ESUA 3Q7VB 1B68A 3FMSA 1YLMA 1LS4A 1OJ5A 1Y4OA 4RYEA 4FH4A 2L6HA 4BJ6A 2GDNA 5F82A 4I3JA 2NUTC 3ZNTA 5TR7A 3X2QC 5EK0A 3GWLA 4PJLA 4IHQA 3NIAA 2A0BA 4LLCA 4YT2A 3B33A 3BEBA 4PJJA 1S66L 5E43A 1XKZA 4DE0A 3CAXA 4X0RA 3QHYA 1F1MA 1PW1A 3PR6A 1G4US 4CJOA 3MFDA 4I44A 1V9ZA 3IX4A 2OAP1 2EA9A 3T1SA 3GRJA 2OU6A 3F1NA 4EBNA 4N6CA 5JVEA 4G7ZF 3ZGAB 3IQ5A 5L0JA 3H82B 3Q07A 3Q6NA 2J9BA 2VB6A 5JLIA 4BQMA 3DZAA 2EWWA 3ITFA 3O5YA 1BLSA 4NTFA 1LSWA 3LI9A 4OLGA 2ETSA 3TOMA 1T6UA 4XUXA 2ZM8A 2DRWA 1XZQA 4ULWA 1BLHA 3CUEA 1PZOA 1M56C 4BMWA 3LR0A 4OPZA 3EGXC 1T6IA 5FAOA 1LKXA 1E25A 2NSGA 3MQOA 4M4XA 4ZJ2A 3C30A 2XLMA 3OOVA 4NXFA 1TWGA 5EOOA 3MYIA 5FAPA 5GLDA 3KH2A 3D3OA 4OONA 4P87A 1TWAA 3GM2A 4CS8C 3G30A 1FR0A 3JTLO 4F3LB 3JZ0A 1QZXA 1YVIA 3QNBA 1KTMA 4E3IA 2VASA 1JR8A 4I38A 2W1TA 3KYIA 1HMDA 1EW0A 1QKRA 2ZPAA 3FDQA 2WYXA 2ZL1B 5HD3A 1XJ2A 4I1MA 1PZPA 2Y79A 3HNIA 1M2VA 3WS0A 2ZQ9A 3LEQA 2IXNA 2PF4E 4MVSA 3PAEA 4CSAA 2XA7S 5HAQA 1HLUP 3T1QB 4RA7A 5CRFA 4UEYA 4XWJA 3HLDA 5KYNA 1V74B 2JKFA 3FC7A 5HWWA 4JF4A 1PWCA 1E2XA 3LR5A 3OPLA 1ES5A 4BJTA 2BLSA 1QPUA 2CMNA 4X55A 3W4OA 2L0WA 1NY0A 4KZ5A 5A8BA 4DVYP 1YYXA 5DF7A 5FDHA 3NCKA 1FNTc 3T4SA 2Y3HA 4Y0OA 2NSFA 2Y4AA 3UNGC 4DE3A 4XLNF 4ZLCA 3B0VC 3MFXA 5CGWA 4L0LA 4P6IC 5EOEA 3S9OA 1A41A 4AE4B 4PHTA 1GQAA 2K7SA 1FR1A 2R7OA 4R32A 1XA7A 5FZTA 2Y2MA 1DP9A 1I2WA 3EEHA 3PYPA 5T3WA 5LBRA 4PM5A 4R4RA 5A91A 4B88A 1MNEA 3V7OA 3Q7VA 3RFYA 5B3SC 3A0SA 3T1XA 4KNVA 1YLPA 1GSWA 3W2VA 4ZRRA 3V5XA 1N4OA 3JT1A 4KZ4A 4U5DE 1CI9A 2FFYA 1SYQA 3EQLF 1PD1A 4GOGA 3ZG9B 3JYIA 4GB7A 1ZG4A 2PYPA 4X69A 4FAPB 1FIKA 2PP4A 3A0RA 2Q9MA 3HLFA 3IF6B 3N8LA 4MW3A 4YWZA 4OIRF 2BL2A 4Y0UA 4AK9A 5L3QA 1VB6A 1M6KA 1J8MF 4YWQA 1TWCA 4W8KA 5IY5C 1NZUA 2X02A 5I5LA 1GSXA 2YQYA 3HLZA 3F1NB 2XL6A 2J7PA 4MTOA 3GECA 4RX3A 5L0CA 2D02A 4B4XA 2P04A 2HS5A 3TQOA 4G3VA 3W8KA 3LCEA 3P09A 4Z9IA 3EH2A 1V4AA 2M1CA 4OPRA 2VV8A 1WWPA 2HKVA 1ZHWA 3OLOA 2OKUA 3AGEA 4K08A 5JP7A 3U4LP 3CG5A 2XR0A 2VV6A 1MNDA 4JGPA 3AG4C 3UMHA 1GM5A 3N4IA 4Y15A 3G2YA 2P7VA 2XSEA 2QHKA 1EI5A 3POVA 3DAFA 1E83A 1GHMA 3E2LA 2EIMC 2JE5A 3W4YA 2VCBA 3G4ZA 4NY3A 3SOIA 4H8RA 1F98A 3N24A 4MQ9F 4DKIA 2R7WA 4K0XA 5EM0A 3A3DA 1IYPA 3SS5A 2Z2LB 2YVKA 2OQMA 1PWGA 2G7UA 5K5BA 1SR2A 3LNMB 4E7SA 1STZA 3HUNA 4O6YA 2GJ3A 3QP5A 4KZAA 4HE8D 3B42A 2EIKC 3PBQA 2B18A 3IT9A 2EPNA 1QVXA 4J30B 2JD3A 2X0CA 4EUVA 1DJAA 3DTMA 3CZDA 2O9CA 3MBZA 1M2OA 1GCEA 3VAYA 4LFUA 3QTHA 4LLOB 4UA9A 4PPRA 3ECSA 1YAUO 1KOUA 2I9VA 4NXEA 5EE8A 2IM8A 3U5SA 2EFXA 5FSRA 4KZ7A 2HV7A 1E84A 3M2JA 1DJCA 4EBBA 2QNLA 1APCA 3EZIA 4U5HA 1DP8A 4Q0IA 4E3JA 1WTYA 5KYXA 3MXQA 1S67L 3W8IA 1LIHA 2XLDA 1YDIA 3WS2A 1F2KA 1K55C 3HREA 3LFVA 3E4QA 3P98A 2EXBA 4OPYA 3JYHA 3V5YA 4NXGA 3T4OA 4ARZA 4IWBA 2XF3A 3B0UX 1IZMA 1RXQA 4CS9C 4L9GA 2XH9A 5EVLA 3K1HA 2WKPA 3LICA 1OTDA 5B3IA 5F1GA 5L07A 2EPMX 4JXVA 2PD7A 2QUPA 1NG1A 4GZBA 3TRCA 4AL0A 4KG6A 4GD8A 4DN0A 3O6XA 4CSAC 4EWCA 5HPFA 4WYYA 1NZOA 4Q5SF 3B29A 1UG7A 3F46A 1KNYA 3DTKA 5HW3A 2WVOA 4R4SA 3UE0A 4O7DA 1IYSA 2Y69C 4NCQA 4N9LA 4E3OA 1ZHHB 3U2AA 4NXBA 1Q0GA 3L9KA 4ER9A 2PR5A 1YT4A 3IF5A 2XGNA 4LV2A 4YNRA 3QW0A 2Z6DA 5C5KA 1I4YA 2QJ7A 2B5RA 3KMIA 2L4RA 3QNCA 5CXWA 3BFEA 1ALQA 3UE1A 2O99A 5CHMA 2Y55A 1TWHA 4HBUA 2ZC7A 4R23A 3SH9A 2WZLA 1YLWA 2J3WA 3VFHA 2XFSA 5G4ZA 3NC8A 3SP1A 1T1BA 5L0DA 4FWVA 5GLCA 3T1RA 1VM1A 3QP6A 5L0FA 3RQGA 1PIOA 3NOUC 3IWQA 3H65A 2KJGA 2Y3GA 2EINC 3RJUA 1MWTA 1E85A 4GQHA 5FQKA 3UB5P 5L2FA 5DF9A 3QW1A 5DQZA 1LL9A 3BEHA 3VOLA 3D4FA 3AGFA 2XEPA 4WZ5A 1HW2A 3ICYA
chains in the Genus database with same CATH topology
2P08A 4O0PA 3T4JA 4Q0HA 4HJ6A 4MN5A 3F1PA 4HQAA 1UWNX 2J3TC 3LUQA 3T4QA 5IU1A 3V67A 3UMEA 2XSSA 3UE3A 4B93A 3EEAA 2Y8HA 2VJWA 3EGDC 3OBFA 4HP9A 4LRXC 5J3WA 4H6JA 3LIDA 2OOLA 2JKTM 4LPZA 3NOTC 4PKYA 3UB9A 1D06A 4R3AA 3NJAA 3R7WB 4BJPA 4MMNA 2FH5A 3VE3A 4HOIA 4HP4A 2A24A 1G6OA 3SW1A 2O9BA 4CLCA 4O01A 1OTEA 2K2NA 3VE4A 4KUKA 1OTAA 3TE8A 2LB9A 1GSVA 4HIAA 2D01A 3D72A 4MCWA 4IJGA 4WEJA 4H6JB 4BBUA 4R38A 3PBOA 4EW7A 3MR0A 4BWIA 2QJ5A 2FZ0A 5HWVA 3EWKA 4KQOA 3BY9A 2VGLM 2HJ9C 1OTBA 2O9AA 1W63Q 3IBRA 3LI8A 1S4RA 4EQ1A 2Z6CA 2VA0A 5HDCA 2VKSA 3LIBA 4HH2A 4I3AA 2M7VA 1IFQA 5TBMB 1OJ5A 3KSFA 3UB6A 1T18A 3UE6A 2BASA 4I3JA 2NUTC 4F3LA 4Y2FA 2A24B 4IHQA 2O0YA 3E98A 1LSVA 3B33A 1WA9A 1S66L 3PBNA 4QPRA 4RQ9A 5AJGA 4YOFA 4CLCC 3KSHA 3JVUA 3CAXA 5TJJA 2W3GA 2ZBBA 4JGQA 3PR6A 2KX6A 1Y28A 5F69A 4Y3IA 2W3FA 1XJ4A 2XROA 4IUHA 1V9ZA 2OAP1 3PHYA 2EA9A 2VV7A 1F5MA 3KX0X 3IS2A 2PR6A 3F1NA 4B9OA 1D7EA 3PBTA 4EEUA 5F5YA 3LR4A 3F1OB 3HJKA 3PBSA 3CITA 3H82B 2J3TD 4LRZE 2XA7M 4R70A 5HWTA 2PHYA 2EWWA 2A2LA 2P0NA 2P7JA 3H82A 3O5YA 2NUPC 4WF0A 1LSWA 3LI9A 1W63M 2HF6A 4Q0JA 5CX7A 1TS0A 4FSFA 3CUEA 4NEED 3S7NA 4BMWA 3LR0A 3EGXC 4WL9A 2R78A 3MQOA 4M4XA 5HPIA 4E04A 3C30A 3OOVA 4NXFA 2VX8A 3OCNA 4XT2B 3D3OA 3PXPA 1NWZA 4IUKA 3G6OA 3UB8A 2HV1A 2YKHA 4EERA 1XFQA 5DFYA 4F3LB 4WLAA 4DMZA 4HY8A 3U9JA 3MQ0A 5J4EA 5HDSA 4MN7A 4I38A 2W1TA 1EW0A 5HD3A 3MJQA 1XJ2A 2Y79A 2W1RA 5DKKA 2GZAA 3P7NA 5FL3A 1LSXA 3E0YA 4L9FA 2XA7S 4PKYG 4HJ4A 3RH8B 3OCLA 1OPXA 2V0WA 5IS1A 1T1CA 1JNUA 4UEYA 4JGOA 3H7WB 2ZMVA 3KYQA 5IT5A 3FC7A 5HWWA 2VGLS 3LR5A 5J7EA 3BQAA 1N9LA 1H8MA 2CMNA 2L0WA 5A8BA 3EOIA 4HJ3A 3C8CA 5AVFA 1NLYA 4GCZA 3T4SA 2V1AA 4Z1WA 1ZTUA 3MF0A 4L9EA 1ODVA 3MFXA 4UQIM 4PAUA 3LIFA 5DJUA 1XJ3A 3S7PA 3W2ZA 4L0LA 1T19A 4HI4A 3ZYTA 3PBRA 1S1ZA 4PHTA 3K3DA 2J80A 2K7SA 4JGRA 2ZOIA 3H9WA 2ZOHA 4BBVA 1DP9A 3EEHA 3PYPA 5LBRA 5KIZA 4I5SA 3T50A 4ETZA 3DBAA 1N9NA 3A0SA 1GSWA 2QYBA 2QWSA 2VEAA 2DMWA 4ZRRA 5MC7A 1IOUA 2JKRI 3V5XA 4R6LA 3A0VA 5F6AA 4I3IA 4GHIB 4EXOA 4OOMA 3U9MA 2PYRA 1LT0A 3S7OA 4Y5FA 2VZWA 3LIAA 3JVVA 2PYPA 3A0RA 4DJ2A 4AFIA 3R4KA 5DKLA 3T4TA 4YWZA 4MDZA 3CWFA 1VB6A 2QKPA 5F68A 1DP6A 5I5LA 1GSXA 3F1NB 3FPVA 1NLZA 4HH3A 4WUJA 3ZQ5A 1YSQA 1TS8A 2HJEA 3VV4A 2GNXA 3TW8A 1G28A 1TD5A 4CLCD 3GECA 3B47A 3FPWA 2D02A 2P04A 4EETB 2MJ6A 3V5ZA 4G3VA 1LL8A 2M1CA 2INWA 1T1AA 2VV8A 3IBJA 3IS2B 1OJGA 4WN5A 1OT6A 3OLOA 1UWPX 2WKQA 2V9AA 4K08A 2OWHA 1MKMA 3E4OA 2JKTI 5DFXA 3F1OA 2OAQ1 2VV6A 4JGPA 3LR3A 1UGUA 4GW9A 3C38A 4II7A 2W3HA 1OT9A 2QHKA 1VHMA 2V0UA 3GDIA 1P9RA 5L8MA 3ULFA 3HJIA 3P01A 1F98A 3KYZA 4EEPA 1NRJA 1TS6A 3UMDA 4GLQA 2JN7A 4OOLA 3UB7A 4CQHA 2G7UA 3S7QA 1MZUA 5DJTA 4NKPA 5K5BA 1STZA 4I39A 4EESA 2GJ3A 2ZMFA 1H3QA 3B42A 3PBQA 2K31A 5TBMA 2B18A 4GJ4A 1OTIA 3EQUA 4EUVA 3KSGA 2O9CA 3LYXA 4LLOB 2WKRA 3BQ8A 1KOUA 2I9VA 4NXEA 4WELA 5G4YA 3EQVA 2HGVA 2IA2A 1YSPA 2PDRA 5AVEA 1DP8A 3CLOA 4Q0IA 2W27A 5HZHA 5HL6A 3H7WA 3MXQA 1S67L 1P0ZA 3KO6A 4UQIS 3C2WA 3LFVA 3E4QA 4XT2A 4FOFA 4HHDA 3V5YA 4NXGA 3BY8A 3T4OA 4ARZA 1TS7A 4MN6A 3CUEC 4L9GA 3F1PB 1XFNA 2M7UA 4CLCE 3BW6A 2WKPA 3LICA 1OTDA 4KUOA 2PD7A 3LIEA 4CLCB 5HD5A 2JHEA 2KLIA 1DRMA 3TRCA 4G3KA 4DN0A 4ME4A 5HPFA 3T4LA 3TJZC 5HDDA 4GHIA 3MMHA 1S4SA 3R7WA 1ZHHB 3U2AA 3CI6A 4NXBA 2VLGA 3NOPC 1TF1A 1YKDA 2KOIA 2PR5A 3BJNA 3NHQA 3OC2A 4LRYC 1P97A 2V1BA 1V9YA 5HSQA 4YNRA 2Z6DA 5C5KA 2W3DA 2QJ7A 1BYWA 3T4KA 2L1MA 4GS9A 3BWLA 2L4RA 2H28A 4DJ3A 1S1YA 2W0NA 4ETXA 2JKRM 1F9IA 2O99A 2B02A 5EFWA 1X0OA 3K2NA 2W1TB 5KSHA 3E4PA 2OWJA 2KDKA 4WEKA 2J3WA 1P9WA 2GX5A 5G4ZA 4KQDA 4O8GA 2PD8A 1T1BA 4EU0A 2PT7A 2XRNA 4GS9B 4ARZB 3MQQA 4BBTA 4HNBA 4P6ZS 4G3WA 3RTYA 2W3EA 1N9OA 3NOUC 3FG8A 3KSIA 2EWVA 4P6ZM 5DF9A 2YKFA 3HCYA 3RFBA 3VOLA 2LB5A 1XJ6A 3K3CA 1YAXA 1MC0A 3ICYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4Y A;  4EXO A;  3U9M A;  4HJ6 A;  2PYR A;  4MN5 A;  1LT0 A;  3F1P A;  4HQA A;  4WL9 A;  2R78 A;  2PDR A;  3LIA A;  1UWN X;  3LUQ A;  3MQO A;  4M4X A;  5AVE A;  5IU1 A;  2PYP A;  1DP8 A;  3CLO A;  3UME A;  4E04 A;  2W27 A;  5HZH A;  4NXF A;  3A0R A;  4DJ2 A;  3H7W A;  3MXQ A;  1S67 L;  4XT2 B;  1P0Z A;  1NWZ A;  3G6O A;  3UB8 A;  4HP9 A;  4LRX C;  5DKL A;  2HV1 A;  4H6J A;  4YWZ A;  2YKH A;  5J3W A;  3C2W A;  3CWF A;  3E4Q A;  1VB6 A;  3LID A;  4HHD A;  2QKP A;  4XT2 A;  2OOL A;  4EER A;  1XFQ A;  5F68 A;  1DP6 A;  4F3L B;  4WLA A;  3V5Y A;  4HY8 A;  4NXG A;  3BY8 A;  3U9J A;  5I5L A;  1TS7 A;  4LPZ A;  4MN6 A;  5J4E A;  3NOT C;  4PKY A;  5HDS A;  1D06 A;  1GSX A;  3NJA A;  4R3A A;  4L9G A;  3F1N B;  4HH3 A;  4I38 A;  4WUJ A;  3F1P B;  3ZQ5 A;  1TS8 A;  3VE3 A;  4HOI A;  4HP4 A;  1EW0 A;  5HD3 A;  2WKP A;  2A24 A;  3LIC A;  3SW1 A;  1OTD A;  3MJQ A;  1XJ2 A;  1G28 A;  1OTE A;  3GEC A;  3VE4 A;  3K3C A;  2D02 A;  4KUO A;  4KUK A;  1OTA A;  2PD7 A;  3LIE A;  5DKK A;  1GSV A;  4HIA A;  3P7N A;  2D01 A;  3D72 A;  1LSX A;  2JHE A;  5HD5 A;  3V5Z A;  4EET B;  1DRM A;  1LL8 A;  4H6J B;  4L9F A;  4BBU A;  4PKY G;  4HJ4 A;  4R38 A;  4EW7 A;  3MR0 A;  3RH8 B;  2M1C A;  2INW A;  2QJ5 A;  1T1A A;  2VV8 A;  5HWV A;  3EWK A;  3BY9 A;  2V0W A;  3IS2 B;  4GHI A;  5HDD A;  5IS1 A;  1T1C A;  1S4S A;  1OJG A;  1JNU A;  1OTB A;  3LI8 A;  3IBR A;  4WN5 A;  1S4R A;  4JGO A;  3H7W B;  4EQ1 A;  1OT6 A;  3OLO A;  1UWP X;  4NXB A;  2VLG A;  2Z6C A;  3FC7 A;  3NOP C;  2PR5 A;  2WKQ A;  2V9A A;  5HWW A;  3NHQ A;  2OWH A;  4K08 A;  5HDC A;  3E4O A;  3LIB A;  5J7E A;  4HH2 A;  4LRY C;  4I3A A;  3F1O A;  5TBM B;  1OJ5 A;  1P97 A;  1N9L A;  2CMN A;  2V1B A;  2VV6 A;  3UB6 A;  1V9Y A;  2L0W A;  5A8B A;  5HSQ A;  2Z6D A;  4JGP A;  1T18 A;  4HJ3 A;  3UE6 A;  2BAS A;  4GW9 A;  4I3J A;  3C8C A;  5AVF A;  2QJ7 A;  1BYW A;  1OT9 A;  2QHK A;  2L1M A;  2V0U A;  3GDI A;  4GS9 A;  4F3L A;  4GCZ A;  3BWL A;  2L4R A;  2H28 A;  4DJ3 A;  1S1Y A;  2A24 B;  2W0N A;  1F9I A;  1LSV A;  2B02 A;  3B33 A;  1WA9 A;  5EFW A;  2V1A A;  1S66 L;  1X0O A;  3E4P A;  3ULF A;  2OWJ A;  2KDK A;  4RQ9 A;  4L9E A;  1ODV A;  3HJI A;  1F98 A;  3MFX A;  3CAX A;  4EEP A;  1TS6 A;  3LIF A;  5DJU A;  1XJ3 A;  3UB9 A;  3UMD A;  2ZBB A;  1T19 A;  4JGQ A;  2KX6 A;  1Y28 A;  2JN7 A;  4HI4 A;  5F69 A;  4KQD A;  1S1Z A;  5G4Z A;  3K3D A;  3UB7 A;  2J80 A;  2K7S A;  2PD8 A;  1T1B A;  1XJ4 A;  4JGR A;  1MZU A;  5DJT A;  1V9Z A;  2ZOI A;  3PHY A;  3H9W A;  2EA9 A;  2VV7 A;  4GS9 B;  4I39 A;  4EES A;  3MQQ A;  3KX0 X;  3IS2 A;  2ZOH A;  2PR6 A;  4HNB A;  2GJ3 A;  3F1N A;  4B9O A;  4BBV A;  3RTY A;  4BBT A;  1D7E A;  1DP9 A;  4EEU A;  3EEH A;  5F5Y A;  1N9O A;  3PYP A;  3NOU C;  5KIZ A;  3F1O B;  3HJK A;  4I5S A;  5TBM A;  3H82 B;  1OTI A;  3FG8 A;  3T50 A;  1N9N A;  4LRZ E;  5HWT A;  4R70 A;  3A0S A;  2PHY A;  2P0N A;  2P7J A;  3H82 A;  1GSW A;  3LYX A;  2QWS A;  2VEA A;  4LLO B;  2WKR A;  2YKF A;  4WF0 A;  1LSW A;  3LI9 A;  1KOU A;  3V5X A;  3VOL A;  4R6L A;  3A0V A;  2I9V A;  1TS0 A;  5F6A A;  1XJ6 A;  4I3I A;  1UGU A;  4NXE A;  3ICY A;  4GHI B;  1XFN A; 
#chains in the Genus database with same CATH topology
 2VCC A;  3T4J A;  4MN5 A;  1ZU4 A;  1ZYR F;  4RBN A;  4GDB A;  3U3B A;  4PM6 A;  2J3T C;  4JW1 A;  3IQC A;  4B93 A;  1PW8 A;  2YL3 A;  1LE4 A;  2Y8H A;  4KQR A;  4KG2 A;  4UHU A;  1U6H A;  1BUE A;  5HL1 A;  1ERO A;  4S2J A;  3BFD A;  4NG2 A;  2WVN A;  1R5I D;  2ZJ9 A;  4YL0 A;  3HNJ A;  1WYB A;  4NC3 A;  1FFT C;  3NOT C;  3VSK A;  4BJP A;  4DDY A;  4JF5 A;  3GMW A;  4HP4 A;  4YL1 A;  1ZHT A;  4CLC A;  3EGX A;  2J7P D;  3GM1 A;  4JTC B;  3UNW A;  1CPQ A;  3MYF A;  3ZDJ A;  1JPJ A;  3EHN A;  4KUK A;  1RKC A;  4HIA A;  2XLW A;  1M6T A;  2Q9N A;  5AQA A;  2IWC A;  3HVF A;  5FAQ A;  3R2P A;  4EW7 A;  4BL2 A;  1K6R A;  1YPR A;  3EWK A;  5F28 E;  3ITA A;  4EBJ A;  1OR2 A;  2H8A A;  3B71 A;  2HJ9 C;  2O9A A;  3LI8 A;  3IBR A;  3UMI A;  1MKI A;  1W79 A;  3QMK A;  3NUL A;  1J8Y F;  1ORS C;  2ZL1 A;  5AQ7 A;  3SXK A;  5J8X A;  4JKV A;  4U5B E;  3L0I A;  2VA0 A;  5HDC A;  2VKS A;  4ANJ A;  4HH2 A;  4I3A A;  4LCM A;  5TBM B;  5HV9 A;  3UB6 A;  1T18 A;  2DGJ A;  3UE6 A;  3I4U A;  4YJW A;  4OQI A;  4QDL A;  2HDQ A;  2A24 B;  3PMR A;  5AC5 A;  1LSV A;  4QD4 A;  3C7J A;  1E4D A;  1JWP A;  3HNL A;  3WS5 A;  1LVK A;  1WYC A;  3PBN A;  1CJF A;  4RQ9 A;  5DLJ A;  4D4X A;  3JVU A;  4YFM A;  1SF8 A;  3FV7 A;  5EVI B;  1SDN A;  2UV0 E;  4UAA A;  2ZBB A;  4JGQ A;  3DWW A;  4R3B A;  2I72 A;  4JCH A;  2IBF A;  1MWU A;  1XJ4 A;  2XRO A;  2Z15 A;  3B3X A;  3Q6M A;  3Q82 A;  2B0J A;  3PHY A;  3ZSU A;  2VV7 A;  1V54 C;  3D9Y A;  4OQ0 A;  5HAI A;  4B9O A;  1VQQ A;  2Y2K A;  1T01 A;  2A6H F;  5EV0 A;  4EEU A;  5F5Y A;  2A68 F;  4CX9 A;  3LR4 A;  3HJK A;  2G3V A;  1K4E A;  2E87 A;  2J3T D;  4GD6 A;  4DF6 A;  5A6K A;  2PHY A;  2P0N A;  3H82 A;  5E3A A;  2NUP C;  5FQM A;  1OCO C;  5JT4 A;  1QMF A;  2H7B A;  5DTS A;  3ZG0 A;  4MBH A;  1ONG A;  2AWC A;  1Z5Z A;  3UDX A;  5CX7 A;  4RDA A;  4E7Z A;  1TS0 A;  4FSF A;  3VMA A;  1ZHZ A;  2J0W A;  3NDG A;  3S7N A;  3C5A A;  4Q7C A;  3VP3 A;  5DF8 A;  5HPI A;  4MVZ A;  3JCU Q;  2VX8 A;  5FA7 A;  1LPE A;  1NWZ A;  2WZG A;  3SS3 A;  3G6O A;  3UB8 A;  4DRH B;  3A3F A;  2YKH A;  4PFO A;  2P74 A;  4EV4 A;  3KYJ A;  3GVB A;  3IHB A;  4BG0 A;  1XFQ A;  4DMZ A;  1MMN A;  3N8S A;  4YN0 B;  3M15 A;  5J4E A;  5HDS A;  4XEK A;  4DJ9 A;  4MBF A;  2MHR A;  4EIY A;  2PX0 A;  1YZA A;  3VYW A;  3MJQ A;  2XK1 A;  3DTE A;  2YL1 A;  4BJ5 C;  4QY6 A;  2W1R A;  3DXJ F;  2NUP A;  3P7N A;  3L7H A;  2W4M A;  4XPW A;  4HJ4 A;  2CCY A;  3RH8 B;  3OCL A;  4WZ4 A;  3EJN A;  1ES4 A;  2V0W A;  1JNU A;  3IH9 A;  1RKE B;  1TEM A;  2Y3B A;  3H7W B;  3LLK A;  4F94 A;  5J7E A;  1YLY A;  1HE9 A;  4ONS A;  2DB4 A;  4KC9 A;  1N9L A;  1L2S A;  1O3U A;  1WE4 A;  4LAC B;  3LS1 A;  5AVF A;  5BUO A;  2R7S A;  2VGJ A;  3EG9 B;  4QJG A;  4GCZ A;  2PX3 A;  2AVK A;  2WKH A;  3CQZ A;  4XEV A;  4E3K A;  2BC5 A;  3MF0 A;  3I5P A;  1I5Q A;  2AU5 A;  4K1O A;  1UFB A;  2LIG A;  4JIO A;  3H2U A;  4ULV A;  3LIF A;  1A7D A;  5DJU A;  4G78 A;  5HAP A;  4U3T A;  4IBR A;  5GLA A;  4G7O F;  4HI4 A;  3QP1 A;  1S1Z A;  5EEC A;  4GDN A;  1S05 A;  4MVO A;  3ABM C;  4JGR A;  2I8B A;  2ZOI A;  4E0I A;  4C6Y A;  4QI0 A;  3N8R A;  2A3U A;  1OCZ C;  1VYK A;  2P61 A;  2ZOH A;  4ZAM A;  1ERQ A;  2HP9 A;  4BBV A;  3TD7 A;  1Q0D A;  2M4E A;  3AG3 C;  3RXX A;  3V3R A;  4Z9Q A;  5A69 A;  3UPO A;  4FX5 A;  1HVB A;  1PD0 A;  5KIZ A;  1VLS A;  3NMI A;  4ETZ A;  5IHV A;  3NBL A;  3ABL C;  1N9N A;  2QWS A;  4LDR A;  1S7Z A;  1IOU A;  2JKR I;  4OD4 A;  4KQQ A;  4H54 A;  3NY4 A;  1K57 A;  2WB7 A;  4GHI B;  3OPH A;  3U9M A;  1ZZP A;  1TDG A;  2P9V A;  4Y5F A;  3LO7 A;  1MMG A;  3ZG8 B;  5FQJ A;  3JVV A;  4U5C E;  1FIL A;  2EX2 A;  3R4K A;  4KZB A;  5HFO A;  3VFF A;  5DKL A;  1BR4 A;  1RJ9 A;  4MDZ A;  2QE9 A;  3IHA A;  4S2K A;  1Z6A A;  3LS0 A;  5K0I A;  4E3N A;  2CW0 F;  2JKG A;  2ZM0 A;  2OEX A;  1E3U D;  3VV4 A;  1HY5 A;  5A6A A;  4MLL A;  4DXB A;  4L6R A;  1G6A A;  4CLC D;  2R7R A;  4NTA A;  3UPP A;  2A0U A;  3B47 A;  3BM6 A;  3N2Z B;  2XD5 A;  2D5R B;  3G34 A;  4N4W A;  5FI2 A;  1RJ9 B;  3EHM A;  4JVS A;  2QY9 A;  3MS6 A;  1NZE A;  4WJ0 A;  2F22 A;  2INW A;  3PCV A;  2FAP B;  1FCN A;  1NXY A;  2A49 A;  2XD1 A;  4WN5 A;  1XZP A;  3VRC A;  5DTT A;  3S90 A;  2WKQ A;  2V9A A;  1MKM A;  1H6G A;  4MEZ A;  5L0I A;  2EFU A;  3NEC A;  4U5E E;  2J45 A;  3WHN A;  1G5U A;  2WAF A;  3LY4 A;  3LR3 A;  4GW9 A;  4II7 A;  2W3H A;  2BG1 A;  2V0U A;  4BD1 A;  1JOG A;  4CDV A;  1P9R A;  2EX8 A;  2PAV P;  2OOC A;  5COF A;  3ATP A;  4KI2 A;  3QP4 A;  1QQ3 A;  3MKF A;  3ULF A;  4E3L A;  3EFO B;  2OJE D;  3AQC A;  2CDQ A;  3DAV A;  1NRJ A;  2IXM A;  2P1A A;  1TS6 A;  2EPK X;  4XPY A;  3CJM A;  3UMD A;  2H7V C;  2QZ6 A;  3PTE A;  2Y2I A;  3ZVR A;  2D4U A;  4ZTK A;  1JWV A;  1GS9 A;  3K66 A;  4CQH A;  1MMD A;  4MND A;  1Q0M A;  4MBK A;  2YRF A;  4X53 A;  1Z63 A;  3C4O A;  1T6Q A;  4B4Z A;  1NFN A;  2K31 A;  3EQU A;  5FI7 A;  5KMW A;  1NFO A;  3KSG A;  2V1Z A;  4UDV A;  4H4K C;  3LYX A;  2Z2M B;  3MSH A;  2V8F A;  4LER A;  2XXA B;  3BFF A;  2XS8 A;  2YLI A;  4JF6 A;  1KE3 A;  1CF0 A;  2CYD A;  5EVI C;  4EUZ A;  2Q9B A;  3IPM O;  1J3W A;  3EQV A;  3GOD A;  2YEV A;  1XGJ A;  3VP0 A;  4WAB A;  3IWI A;  1VOM A;  2WAD A;  1BUL A;  5AVE A;  5F5F A;  3NI9 A;  2XLV A;  2W27 A;  5E2E A;  3IX3 A;  1GGQ A;  3S84 A;  4N1H A;  4GYT A;  1Q2Q A;  4OIN F;  2XL4 A;  2YLD A;  2AWY A;  1YM1 A;  2J9V A;  3IF6 C;  4UQI S;  3C2W A;  4XT2 A;  3GEE A;  3M1C B;  4HHD A;  3TJ5 A;  4PM8 A;  1IEL A;  3BY8 A;  4ESP A;  3C62 A;  4JTD B;  4MN6 A;  4GNU A;  3CUE C;  2ACG A;  3BEC A;  1MXO A;  4CLC E;  2GWW A;  4X1L A;  4XUZ A;  1T5O A;  3ZIB A;  2MWQ A;  4NK3 A;  1BTL A;  3IXH A;  4FUW A;  2X01 A;  3IXB A;  5HD5 A;  4U9E A;  4RX2 A;  4ME4 A;  2XL8 A;  3MXS A;  4BLM A;  3VM6 A;  3TJZ C;  1ES3 A;  1NYY A;  5AC4 A;  4GHI A;  4KG5 A;  1S4S A;  3I7J A;  5HSW A;  3U2L A;  3CI6 A;  2QPN A;  2VLG A;  2KOI A;  3SXM A;  3HLE A;  1ES2 A;  4JTA B;  3UDF A;  3RVY A;  4LRY C;  3WS1 A;  4Y7P A;  1V9Y A;  5T3T A;  4LCL A;  2IXP A;  3DWK A;  5CER A;  2W3D A;  3T4K A;  4K0D A;  4G0H A;  3G32 A;  3NRH A;  3V3S A;  4DJ3 A;  4U5G A;  3ZFZ A;  2W4B A;  1F9I A;  3S1Y A;  1KGE A;  2B02 A;  5EFW A;  3NYM A;  3E4P A;  4DE2 A;  4HFK B;  2OWJ A;  2KDK A;  4I3M A;  3MXR A;  1JVJ A;  4WEK A;  2OLU A;  4LV1 A;  1P9W A;  3EFO A;  4Y13 A;  3A11 A;  2PU2 A;  4JJG A;  4MTF A;  2XQZ A;  3A3I A;  2RL3 A;  4KQD A;  1TR2 A;  5BQG A;  5L3V A;  2H7O A;  3GV9 A;  2XRN A;  1WAT A;  1K04 A;  4ARZ B;  1OXK A;  3DI5 A;  4R3J A;  3RTY A;  4Q8I A;  2E8I A;  4AX2 A;  3O88 A;  2LCH A;  1KDW A;  4WBG A;  3Q7L A;  1FR6 A;  3HCY A;  1MBL A;  3RFB A;  2L81 A;  3AG2 C;  3RQE A;  4K7B A;  2WK0 A;  2LB5 A;  1GHI A;  1K57 C;  1BZA A;  1MC0 A;  3M4B A;  1UGU A;  1YAX A;  2Y2N A;  1CGM E;  4O0P A;  5FAT A;  4E6W A;  3A3E A;  3QP8 A;  1CPR A;  3SS4 A;  4CDY A;  1SHV A;  3NKE A;  4DDS A;  5A92 A;  1UWN X;  3C63 A;  3MZE A;  1KU2 A;  3UE3 A;  3WAQ A;  3IXD A;  4XXR A;  3TSG A;  5JYO A;  3EH1 A;  3EGD C;  1PV3 A;  3OBF A;  2G3K A;  4HP9 A;  4LRX C;  1K56 A;  4H6J A;  1O5H A;  3ZG1 A;  3VP4 A;  3RIP A;  1ERM A;  2JKT M;  1DY6 A;  1WGW A;  4X68 A;  1SDE A;  2WGV A;  1FSY A;  4K0W A;  3DJN B;  3UB9 A;  1NLX A;  4R3A A;  3CMZ A;  2B95 A;  2R05 A;  5D92 A;  3U8V A;  3VE3 A;  3WRZ A;  2EIL C;  3A3J A;  4P9F A;  4OP5 A;  3ZTZ A;  4O01 A;  3SH8 A;  1C02 A;  1YA9 A;  3VE4 A;  3TE8 A;  1TQG A;  4H6J B;  2JBF A;  1OR3 A;  2QLA A;  5HWV A;  4BWI A;  3PAG A;  4KQO A;  1U0B B;  4ZBE A;  2UWX A;  2VGL M;  3WOD F;  1RMV A;  3BYD A;  2HJ3 A;  1Z6F A;  2LFF A;  4OIO F;  2Z6C A;  1K4F A;  3B0P A;  1XPB A;  2Y2L A;  1K0K A;  2ICW G;  1ZW3 A;  2R03 A;  3LIB A;  3MKE A;  4W8P A;  4HFF B;  2R7T A;  3S4X A;  1VLT A;  2M7V A;  1IFQ A;  2HJM A;  3KSF A;  2HPB A;  3GOR A;  5E2H A;  1OW7 A;  4JPM A;  3B9Q A;  2ZC3 B;  4ZJ1 A;  3GSG A;  4GEH A;  2B0H A;  1ST6 A;  2O0Y A;  3DTI A;  3E98 A;  4X1M A;  1RKE A;  4QPR A;  4YOF A;  3KSH A;  1KVM A;  2WL8 A;  2Y2P A;  4U9D A;  2H0T A;  5TJJ A;  3MFN A;  2Q4F A;  3G50 A;  1Y28 A;  2A6E F;  5F69 A;  4Y3I A;  4S2L A;  3S27 A;  5EVI A;  5JS5 A;  1XGI A;  2CGE A;  2HZ5 A;  4IUH A;  4K91 A;  1L0G A;  1F5M A;  2HDU A;  1JRA A;  3LGO A;  3KX0 X;  2ZM2 A;  4N1X A;  3DW0 A;  3F47 A;  3TG9 A;  2J9O A;  1BZ4 A;  3F1O B;  1G8X A;  3PBS A;  1OW6 A;  3CIT A;  1KE4 A;  3LJB A;  3NDB B;  1AXB A;  1KGF A;  4BJ6 C;  4WF0 A;  1EA8 A;  2V26 A;  1W63 M;  1G4W R;  1LI7 A;  5M18 A;  3CPT B;  4NEE D;  2ZXO A;  1MMA A;  3LES A;  3PDM P;  3LEV A;  3T9O A;  5KSC A;  1Q0K A;  4R1G A;  2R7Q A;  4E04 A;  2J0X A;  4LDK A;  4XT2 B;  4IUK A;  3JYY A;  3U0C A;  2HV1 A;  4N6H A;  3EGD B;  2IYL D;  4P85 A;  4EER A;  2IOQ A;  4S2P A;  5DFY A;  4WLA A;  3FAJ A;  3U9J A;  3O86 A;  3RQF A;  4MN7 A;  1O7E A;  5E33 A;  2P9V B;  3FWL A;  1LI5 A;  4PAC A;  2E8J A;  2EX6 A;  4OQG A;  2KSF A;  3FAP B;  3QVY A;  5DKK A;  5FL3 A;  1LSX A;  4OD5 A;  3E0Y A;  4JCZ A;  4L9F A;  2H10 A;  4PKY G;  4DRJ B;  3HTK C;  3SNH A;  1LHY A;  1OPX A;  2QMI A;  1GA9 A;  4J7Y A;  1HE1 A;  1YMX A;  4ZLD A;  2ZMV A;  4I1O B;  1I2S A;  1G68 A;  4CS9 A;  5AGF A;  1VEU B;  1YMS A;  5GHZ A;  3T4R A;  2VGL S;  3BQA A;  2Y39 A;  1H8M A;  1EKY A;  4HJ3 A;  5CTN A;  3C8C A;  1M57 C;  1VK5 A;  4WGY A;  3RVZ A;  1Y4C A;  2DI3 A;  3OPP A;  1ZG6 A;  2HUJ A;  4O79 A;  3G4P A;  1W5D A;  3EG9 A;  2V1A A;  2Y2J A;  2OG2 A;  2VC9 A;  3RH3 A;  3ZNY A;  2FFH A;  1GA0 A;  4MVR A;  4C3E A;  1ODV A;  3QZC A;  4DXW A;  1XJ3 A;  4OPQ A;  3W2Z A;  2G2U A;  2HZ8 A;  3IH8 A;  2L6G A;  4BEM J;  3PBR A;  4Z9H A;  2J80 A;  2R02 A;  3NKD A;  4EUK B;  4Q4Z F;  3FOP A;  2XDM A;  2WZZ A;  1Z09 A;  2PBD P;  3G4X A;  5COM A;  4PM7 A;  4I5S A;  3IX8 A;  3L8J A;  3T50 A;  5EPH A;  2JPU A;  2HP6 A;  3DBA A;  5CEB A;  3V50 A;  2QYB A;  2VEA A;  2DMW A;  5MC7 A;  3LNR A;  2KYH A;  3IEE A;  5A6J A;  4R6L A;  2Q3T A;  5F6A A;  5FEG A;  1JTG A;  4I3I A;  1ZHX A;  3W2W A;  5EGY A;  1K54 C;  4EXO A;  1VMA A;  2PYR A;  1LT0 A;  1YQS A;  3AGT A;  1T9K A;  5D91 A;  5KYU B;  1PI5 A;  4DJ2 A;  2EPO A;  4AFI A;  1EI7 A;  3T4T A;  5KYW B;  4YT5 A;  1K56 D;  3CWF A;  1L0E A;  1A7E A;  2HSQ A;  2R9R B;  3VOZ A;  4YIN A;  1XXM A;  4HH3 A;  1NLZ A;  1HMO A;  4WUJ A;  1OCR C;  2HJE A;  4JXS A;  5JSL A;  2NG1 A;  2KK1 A;  4MNR A;  3FPW A;  3FVY A;  3M79 A;  3JRM O;  2MJ6 A;  1OKK D;  2YWA A;  1N1C A;  3ASN C;  2HFI A;  3DAG A;  3V5Z A;  5KYW A;  2WKI A;  2EXA A;  2V2F F;  3ZQY A;  1L3P A;  5CEC A;  2Y2Q A;  3HLG A;  1PFL A;  1PCX A;  1WOL A;  5GHX A;  1CGO A;  1UWP X;  3N7W A;  3UPN A;  1U89 A;  3VF0 A;  1H9T A;  5DFX A;  1C17 M;  1ZU5 A;  4FTX A;  2OAQ 1;  3C38 A;  4EWF A;  4DRI B;  4BL3 A;  1N9B A;  1VHM A;  2CNW D;  3UGO A;  1FAP B;  3NYL A;  5L8M A;  1LS1 A;  1ESI A;  1YYJ A;  1D1B A;  1QSP A;  2Q0O A;  2DYS C;  3P01 A;  3HLB A;  4EEP A;  1PI4 A;  5EHH A;  1D1A A;  4GLQ A;  2ZQA A;  2LSE A;  2JN7 A;  2VCA A;  1AWI A;  4OOL A;  1CI8 A;  1NJ4 A;  3UB7 A;  4CBE A;  1D1C A;  2ZQD A;  4D2O A;  1LLB A;  3S28 A;  3S7Q A;  3X1O A;  2Q9C A;  4I39 A;  2ZMF A;  1S0W A;  2EX9 A;  4M63 A;  4GJ4 A;  1BLP A;  1OTI A;  4NET A;  1MQV A;  4FES A;  3AJM A;  4JJF A;  5KYY B;  3E70 C;  2WKR A;  3BQ8 A;  3IWO A;  3C7U A;  4OVD A;  3MX3 A;  1LI9 A;  1BSG A;  3QP2 A;  4JLF A;  1IYO A;  4R0Q A;  3KYE A;  2IA2 A;  5CHJ A;  2PDR A;  3DM9 B;  2W45 A;  3CLO A;  3UY6 A;  5HZH A;  3K33 A;  4JEB A;  3H7W A;  2BE5 F;  1PNE A;  2R7U A;  2DNS A;  3BFG A;  3ITB A;  4D60 A;  4JBF A;  4DVZ A;  2NUT B;  5CI9 A;  3KO6 A;  1XA1 A;  3RXW A;  3DWZ A;  2JX0 A;  1SKF A;  3GWN A;  2R9W A;  1TS7 A;  5L09 A;  2HV6 A;  1RCP A;  4OKP A;  3ZCZ A;  2M7U A;  1BDJ B;  3BW6 A;  1C3B A;  4HEF A;  4M3K A;  3VP2 A;  2L9J A;  4CLC B;  5DS6 A;  2WUQ A;  2JHE A;  2KLI A;  1DRM A;  5E2F A;  4G3K A;  2XXA A;  5JRA A;  4MW8 A;  2PNO A;  2J9P A;  4LGW A;  4C3Q A;  2J9U A;  5A6B A;  1LL5 A;  3DM5 A;  3BLM A;  2KW3 C;  3QVZ A;  4N92 A;  3WRT A;  3RKO F;  4KZ3 A;  3L1M A;  3NOP C;  1YKD A;  4EQI A;  3U2M A;  3LAY A;  3NHQ A;  1W7F A;  3OC2 A;  4PM9 A;  2HDR A;  3KPH A;  2V1B A;  4PMA A;  5JYP A;  3G31 A;  2LQG A;  4YT4 A;  1M40 A;  1BYW A;  2L1M A;  1EWZ A;  1D1J A;  4RD9 A;  4GS9 A;  1ZC2 A;  3BWL A;  2IWD A;  2ZLY A;  3M6H A;  1S1Y A;  3O87 A;  4DXC A;  2W0N A;  4Z9J A;  3FOO A;  3EGX B;  4G7H F;  2PRF A;  5HX9 A;  2TMV P;  5DS5 A;  3K2N A;  1TFK B;  3AOU A;  3IHU A;  4KZ6 A;  2L7A A;  5KYU A;  4PFP A;  3DD7 A;  4EKW A;  2GX5 A;  1XWJ A;  3U3F A;  1H8Y A;  4O8G A;  4IBX A;  1KE0 A;  4EU0 A;  2PT7 A;  3UR3 C;  4GS9 B;  3NMJ A;  4BBT A;  3S29 A;  1YZC A;  2LK4 A;  3G2Z A;  2W3E A;  4MVU A;  3TJ6 A;  3TOL A;  3GEH A;  4DOZ A;  4JKT A;  5CHU A;  3FG8 A;  1HD8 A;  4XEF A;  2YLG A;  4P6Z M;  2LD6 A;  3HKK A;  2V20 A;  4QWO A;  1MWS A;  3GTC A;  3LY3 A;  1PWD A;  4CPK A;  4XQ1 A;  5KZH A;  4E0H A;  5CI8 A;  4ZJ3 A;  3DKA A;  3HJI A;  1C03 A;  1XFN A;  3ZVT A;  1I4Z A;  1K54 A;  4HJ6 A;  5FEF A;  3GEI A;  3F1P A;  3FZC A;  4A2N B;  1DJB A;  1TDL A;  3EZH A;  2RCX A;  3LUQ A;  3T4Q A;  4CIH A;  5IU1 A;  1JPN A;  3UME A;  4O6M A;  4JXW A;  2MYS A;  5D3O A;  1YLJ A;  4EBL A;  2VJW A;  1QLE C;  1BLC A;  1JMW A;  1FMW A;  1SZI A;  3SYN A;  1H5X A;  1SCW A;  3ZDL A;  5J3W A;  1FQG A;  2GA0 A;  3J06 A;  3LID A;  2ZC4 B;  2OOL A;  4GN2 A;  5FCL A;  5L10 A;  3N6I A;  4LPZ A;  1D06 A;  2ZC6 B;  3NJA A;  3R7W B;  2OV5 A;  4DBQ A;  4P9T A;  4HOI A;  1G6O A;  3GM3 A;  1BR1 A;  2K2N A;  4HES A;  3FYZ A;  2Y2H A;  1OTA A;  2LB9 A;  2J7V A;  1GSV A;  3C8Z A;  4PJN A;  2D01 A;  1KGG A;  2WGW B;  3D72 A;  4X56 A;  4CJG A;  1OKK A;  3AGD A;  1NRF A;  2XS1 A;  3HNK A;  5DTK A;  3C8G B;  1VET B;  3MR0 A;  1OQC A;  4JZA A;  1Z7Q c;  2R9X A;  4UA6 A;  4KNW A;  3SEO A;  2HMQ A;  3OA1 A;  3BY9 A;  4HEA J;  1VTM P;  4LV3 A;  2M64 A;  1W63 Q;  3NYJ A;  4PR9 A;  4FD8 A;  1S4R A;  1DOW A;  2XRH A;  2J46 A;  2XM4 A;  4EQ1 A;  4IAO A;  3K1I A;  1H0M A;  3IXG A;  2KC3 A;  3L34 A;  4QY5 A;  1AEP A;  2YKZ A;  4IGG A;  4LDQ A;  3M2K A;  2PFD A;  3R7C A;  3OWT A;  1SKO B;  3SXY A;  2WGW A;  5TFQ A;  3VSL A;  3LEO A;  1L0D A;  2BAS A;  3NG1 A;  4YK5 A;  1ONH A;  2XLN A;  2LFD A;  3C18 A;  4F3L A;  4Y2F A;  3ISG A;  3UN7 A;  1A7V A;  2CNW A;  2XFT A;  1WA9 A;  4NTB A;  5G18 A;  5AJG A;  1ZW2 A;  3O39 A;  4CLC C;  4F4B A;  2H0Y A;  4WMC D;  3UO9 A;  2W3G A;  4A4A A;  2KX6 A;  3S0X A;  5GL9 A;  3JSZ A;  2W3F A;  4IJJ A;  4NQF A;  1YLT A;  2RD9 A;  5I94 A;  1IKI A;  3Q7Z A;  1YJG A;  1QME A;  3A9C A;  3IS2 A;  2PR6 A;  5GHY A;  1D7E A;  1RP5 A;  3PBT A;  4OIP F;  1E3U A;  5DVW A;  2OLV A;  4J7T A;  2DYR C;  2YL0 A;  1Q0F A;  2ZMA A;  5A93 A;  3T6J A;  4C7O B;  2XA7 M;  4MVM A;  4BJ5 A;  4LRZ E;  2C04 A;  2A2L A;  4R70 A;  2P7J A;  5HWT A;  1Y6D A;  3G35 A;  1OCC C;  3MZF A;  5EVI D;  2HF6 A;  4OQH A;  4Q0J A;  2WVQ A;  3UGP A;  4BD0 A;  2KQ9 A;  2ZD8 A;  2R7V A;  2HSB A;  4WL9 A;  2R78 A;  4BEN A;  1RGY A;  1YAR O;  4C7O A;  3E2K A;  4WM9 A;  2ZD9 A;  3OCN A;  1BR2 A;  3PXP A;  1BBH A;  2O9X A;  3JPU A;  5GPG B;  2GDC A;  4OLD A;  4JRZ A;  1LE2 A;  1IEM A;  2W9Y A;  2IXO A;  4HY8 A;  3MQ0 A;  5B1B C;  4LV0 A;  2C6W B;  3AG1 C;  3MBG A;  3HJC A;  2CC1 A;  1FCO A;  4EHP A;  4S2N A;  4XLP F;  3JRT A;  1EQ1 A;  1H9G A;  1HTZ A;  2GZA A;  1A0B A;  2ZQ8 A;  3T6G B;  3ZWI A;  1FTS A;  3RW0 A;  5A6B D;  1D0X A;  5IS1 A;  1T1C A;  3SXZ A;  2VGK A;  1NBB A;  1H7I A;  4JGO A;  3KYQ A;  5GLB A;  5IT5 A;  3C4P A;  4HBT A;  2OJQ A;  2KGO A;  1K40 A;  1HZO A;  3EGD A;  5E2Q A;  3IF6 A;  1ORJ A;  5EUA A;  2UUI A;  3EOI A;  1VB5 A;  1SKO A;  5BQI A;  1NLY A;  5KYY A;  3MLG A;  1Q2P A;  4OOY A;  4KBL A;  1OXB A;  5L0G A;  3GAN A;  3DE8 A;  4KZ9 A;  1XP4 A;  4Z1W A;  3FXH A;  1ZTU A;  3WWX A;  4C75 A;  1O87 A;  4L9E A;  4UQI M;  3N0T A;  4PAU A;  3TK0 A;  2VH3 A;  3S7P A;  3FKV A;  4MVQ A;  4JC7 A;  2V3C C;  1T19 A;  3IQA A;  1OW8 A;  3ZYT A;  3K3D A;  1MWR A;  2J8Y A;  4RVA A;  3CSK A;  2Q7R A;  4IAQ A;  1VET A;  3LLI A;  2IWB A;  4OIQ F;  3H9W A;  3BRM A;  1OME A;  1AUE A;  3KKB A;  3O55 A;  2YL7 A;  3AGU A;  1J9M A;  3MZD A;  3ZG5 A;  4OH0 A;  3M6B A;  1FFH A;  3M4C A;  5FQI A;  1FSW A;  4JE9 A;  1JTD A;  3A0V A;  5AQB A;  1NU9 C;  3L8I A;  2J8W A;  1Z23 A;  2EPL X;  1Z3I X;  1KDS A;  4OOM A;  3S7O A;  2VZW A;  1DOV A;  1YA7 O;  4EBK A;  3LIA A;  4X25 A;  3AQB A;  2Y2O A;  2Q9A A;  5EVE A;  5FQ9 A;  3V39 A;  1W2W A;  3IQ6 A;  4KEN B;  4E17 A;  4YL3 A;  3HLW A;  3RYL A;  2QKP A;  5F68 A;  1DP6 A;  1S6R A;  3VP1 A;  3K6B A;  2HMZ A;  1ORY A;  2ZXR A;  3TOI A;  3FPV A;  3ZQ5 A;  3ZG7 B;  1YSQ A;  1E86 A;  1TS8 A;  3BLS A;  3HL9 A;  2GNX A;  1XX2 A;  3BFC A;  3TW8 A;  3T6B A;  2NUP B;  4QHC A;  1G28 A;  1GHP A;  1SMY F;  1TD5 A;  3HUO A;  3RF3 A;  4Y17 A;  3C8G A;  4AL1 A;  4EET B;  3LUT B;  5COG A;  2ZC5 B;  2JCH A;  1LL8 A;  3NMK A;  1ZVZ A;  2Y91 A;  1K05 A;  4OP8 A;  3K7D A;  2UUH A;  1T1A A;  4Y0T A;  4YT8 A;  3IBJ A;  3IS2 B;  1OJG A;  2XLE A;  1VYI A;  1SZV A;  1JAF A;  1OT6 A;  2HP5 A;  3K1I C;  2OWH A;  1CGN A;  3E4O A;  4BJ1 A;  5BOH A;  2JKT I;  3SZT A;  3F1O A;  2G2W A;  1O07 A;  1CQA A;  3Q7G A;  3VOY A;  1OT9 A;  1RGZ A;  1ZKJ A;  4B6I A;  3CEX A;  3IQT A;  3GDI A;  1L3L A;  2DCF A;  5DS4 A;  4E6X A;  4KZ8 A;  4S2I A;  2OSU A;  1CEF A;  3BRJ A;  3OPR A;  2VK3 A;  1FCM A;  1M2V B;  5EM1 A;  2X71 A;  2I15 A;  2AP3 A;  1K38 A;  3EPV A;  4MTG A;  4J32 B;  5DQT A;  1LM3 B;  3KYZ A;  2RSE B;  5KYX B;  4DRT A;  4CIP A;  1R4T A;  4WMC A;  4BPM A;  5HAR A;  4U0X A;  5B1A C;  4JXG A;  1MZU A;  5DJT A;  4NKP A;  1WN0 A;  3CHW P;  1AVO B;  5FAS A;  1I5N A;  5L0H A;  2QTV A;  1Y54 A;  5FDS A;  4EES A;  5CGS A;  1H3Q A;  5TBM A;  2R7X A;  1D0Y A;  5JUA A;  3UMK A;  2NPU A;  3NDE A;  2H5S A;  3OZH A;  1MY8 A;  3GQZ A;  3SZR A;  4D4N A;  1H8Z A;  1YLZ A;  2HDS A;  5T1D B;  4U0T A;  1MPL A;  1D0Z A;  1U60 A;  3W4P A;  3ASO C;  4WEL A;  4WZ5 C;  1K25 A;  2G62 A;  1TKN A;  1WAS A;  4FH2 A;  5G4Y A;  2HGV A;  3OEO A;  1YSP A;  5TGF A;  3O10 A;  5FI6 A;  4AE4 A;  5CTM A;  3I5Q A;  2EIJ C;  5M19 A;  5HL6 A;  3Q81 A;  1P0Z A;  2WZX A;  2X51 A;  4BEJ A;  2ZQC A;  1L0F A;  4PK4 A;  5TJ5 E;  4P0M A;  4FOF A;  2BTF P;  4MS2 A;  2NUT A;  3CPT A;  1LI0 A;  1W8Q A;  1KVL A;  256B A;  3DE9 A;  2WKE A;  2WAE A;  4S2O A;  4CS7 A;  3F1P B;  1G5Z A;  4N9K A;  4DE1 A;  3UDI A;  5FQQ A;  2V8C A;  3KL4 A;  2KNH A;  3ZVW A;  4A5R A;  4ZDX A;  2PU4 A;  4KUO A;  3LIE A;  1ACF A;  5F83 A;  3E9V A;  3JSE O;  5E2G A;  2L6F A;  5F5H A;  4GKU A;  3T4L A;  4O7G A;  2R25 A;  5HDD A;  2Y2G A;  3MMH A;  3R7W A;  2PBE A;  1A0K A;  1ZHY A;  2Y3D A;  1TF1 A;  3BJN A;  1IYQ A;  1P97 A;  1IKG A;  5HSQ A;  4CS8 A;  2OCC C;  2OEV A;  4EBP A;  1TVF A;  1V55 C;  3HUM A;  2P6V A;  4IRU A;  2H28 A;  3TUL A;  4ETX A;  2JKR M;  2Y59 A;  5DVA A;  1TFO B;  1IW7 F;  1X0O A;  1PYY A;  2W1T B;  5KSH A;  4X6T A;  1BT5 A;  4N06 A;  3O3V A;  4IVI A;  3PHF 2;  1FOF A;  2C5W B;  2XM0 A;  3CZ6 A;  4JEA A;  4IED A;  4C3D A;  4IVK A;  3W4Q A;  2PD8 A;  2A1D D;  4WGZ A;  2J9W A;  5BQH A;  4QI2 A;  1HW1 A;  4IAR A;  3MQQ A;  4FCF A;  3DMD A;  4HNB A;  4P6Z S;  4G3W A;  2LP4 A;  2WZF A;  2AVX A;  4UA7 A;  3FKW A;  1CK3 A;  4C3B A;  1N9O A;  3H2V A;  4DBR A;  3KSI A;  2ZQ7 A;  4O6N A;  1L7C A;  2C03 A;  2EWV A;  4S2N C;  2GFH A;  4LEN A;  4LLE A;  5CIV A;  2YKF A;  3FHD A;  1PRQ A;  2Q00 A;  2ZXW C;  3W8H A;  1NU7 D;  1XJ6 A;  3K3C A;  3WS4 A;  2ZXP A;  2P08 A;  2YZS A;  3HBR A;  1FMV A;  4Q0H A;  4HQA A;  2FFF B;  1RCJ A;  2XLO A;  2YHS A;  2JC7 A;  4P6B A;  3LEZ A;  3V5M A;  1NYM A;  3V67 A;  2XSS A;  2WGI A;  3EEA A;  5U47 A;  3WG7 C;  4E3M A;  3ZQV A;  5M1A A;  3ABK C;  2A69 F;  1K55 A;  1JWZ A;  4PJM A;  4XPX A;  2GAQ A;  3S22 A;  3U8P A;  4ID4 A;  2XLH A;  4PKY A;  5F1F A;  4MMN A;  4QU3 A;  2FH5 A;  3ZC4 A;  3T12 B;  3US6 A;  1VEU A;  2A24 A;  4CDA A;  3SW1 A;  2O9B A;  4XTK A;  1OTE A;  2PBY A;  5A90 A;  2FGY A;  3ZTM A;  4MCW A;  5CGX A;  3C8G D;  4IJG A;  4QB8 A;  1NSG B;  4WEJ A;  3HLC A;  3C7V A;  1W8Y A;  3DJU B;  4BBU A;  4CJN A;  4R38 A;  5AQ9 A;  3PBO A;  3ZHH A;  2QJ5 A;  2FZ0 A;  2ASR A;  1CEG A;  1K6S A;  4E18 A;  4U5F E;  1OTB A;  4S2M A;  4JUR I;  3Q1F A;  3SH7 A;  5CED A;  3GR2 A;  4IB4 A;  5E3C A;  1ESU A;  3Q7V B;  1B68 A;  3FMS A;  1YLM A;  1LS4 A;  1OJ5 A;  1Y4O A;  4RYE A;  4FH4 A;  2L6H A;  4BJ6 A;  2GDN A;  5F82 A;  4I3J A;  2NUT C;  3ZNT A;  5TR7 A;  3X2Q C;  5EK0 A;  3GWL A;  4PJL A;  4IHQ A;  3NIA A;  2A0B A;  4LLC A;  4YT2 A;  3B33 A;  3BEB A;  4PJJ A;  1S66 L;  5E43 A;  1XKZ A;  4DE0 A;  3CAX A;  4X0R A;  3QHY A;  1F1M A;  1PW1 A;  3PR6 A;  1G4U S;  4CJO A;  3MFD A;  4I44 A;  1V9Z A;  3IX4 A;  2OAP 1;  2EA9 A;  3T1S A;  3GRJ A;  2OU6 A;  3F1N A;  4EBN A;  4N6C A;  5JVE A;  4G7Z F;  3ZGA B;  3IQ5 A;  5L0J A;  3H82 B;  3Q07 A;  3Q6N A;  2J9B A;  2VB6 A;  5JLI A;  4BQM A;  3DZA A;  2EWW A;  3ITF A;  3O5Y A;  1BLS A;  4NTF A;  1LSW A;  3LI9 A;  4OLG A;  2ETS A;  3TOM A;  1T6U A;  4XUX A;  2ZM8 A;  2DRW A;  1XZQ A;  4ULW A;  1BLH A;  3CUE A;  1PZO A;  1M56 C;  4BMW A;  3LR0 A;  4OPZ A;  3EGX C;  1T6I A;  5FAO A;  1LKX A;  1E25 A;  2NSG A;  3MQO A;  4M4X A;  4ZJ2 A;  3C30 A;  2XLM A;  3OOV A;  4NXF A;  1TWG A;  5EOO A;  3MYI A;  5FAP A;  5GLD A;  3KH2 A;  3D3O A;  4OON A;  4P87 A;  1TWA A;  3GM2 A;  4CS8 C;  3G30 A;  1FR0 A;  3JTL O;  4F3L B;  3JZ0 A;  1QZX A;  1YVI A;  3QNB A;  1KTM A;  4E3I A;  2VAS A;  1JR8 A;  4I38 A;  2W1T A;  3KYI A;  1HMD A;  1EW0 A;  1QKR A;  2ZPA A;  3FDQ A;  2WYX A;  2ZL1 B;  5HD3 A;  1XJ2 A;  4I1M A;  1PZP A;  2Y79 A;  3HNI A;  1M2V A;  3WS0 A;  2ZQ9 A;  3LEQ A;  2IXN A;  2PF4 E;  4MVS A;  3PAE A;  4CSA A;  2XA7 S;  5HAQ A;  1HLU P;  3T1Q B;  4RA7 A;  5CRF A;  4UEY A;  4XWJ A;  3HLD A;  5KYN A;  1V74 B;  2JKF A;  3FC7 A;  5HWW A;  4JF4 A;  1PWC A;  1E2X A;  3LR5 A;  3OPL A;  1ES5 A;  4BJT A;  2BLS A;  1QPU A;  2CMN A;  4X55 A;  3W4O A;  2L0W A;  1NY0 A;  4KZ5 A;  5A8B A;  4DVY P;  1YYX A;  5DF7 A;  5FDH A;  3NCK A;  1FNT c;  3T4S A;  2Y3H A;  4Y0O A;  2NSF A;  2Y4A A;  3UNG C;  4DE3 A;  4XLN F;  4ZLC A;  3B0V C;  3MFX A;  5CGW A;  4L0L A;  4P6I C;  5EOE A;  3S9O A;  1A41 A;  4AE4 B;  4PHT A;  1GQA A;  2K7S A;  1FR1 A;  2R7O A;  4R32 A;  1XA7 A;  5FZT A;  2Y2M A;  1DP9 A;  1I2W A;  3EEH A;  3PYP A;  5T3W A;  5LBR A;  4PM5 A;  4R4R A;  5A91 A;  4B88 A;  1MNE A;  3V7O A;  3Q7V A;  3RFY A;  5B3S C;  3A0S A;  3T1X A;  4KNV A;  1YLP A;  1GSW A;  3W2V A;  4ZRR A;  3V5X A;  1N4O A;  3JT1 A;  4KZ4 A;  4U5D E;  1CI9 A;  2FFY A;  1SYQ A;  3EQL F;  1PD1 A;  4GOG A;  3ZG9 B;  3JYI A;  4GB7 A;  1ZG4 A;  2PYP A;  4X69 A;  4FAP B;  1FIK A;  2PP4 A;  3A0R A;  2Q9M A;  3HLF A;  3IF6 B;  3N8L A;  4MW3 A;  4YWZ A;  4OIR F;  2BL2 A;  4Y0U A;  4AK9 A;  5L3Q A;  1VB6 A;  1M6K A;  1J8M F;  4YWQ A;  1TWC A;  4W8K A;  5IY5 C;  1NZU A;  2X02 A;  5I5L A;  1GSX A;  2YQY A;  3HLZ A;  3F1N B;  2XL6 A;  2J7P A;  4MTO A;  3GEC A;  4RX3 A;  5L0C A;  2D02 A;  4B4X A;  2P04 A;  2HS5 A;  3TQO A;  4G3V A;  3W8K A;  3LCE A;  3P09 A;  4Z9I A;  3EH2 A;  1V4A A;  2M1C A;  4OPR A;  2VV8 A;  1WWP A;  2HKV A;  1ZHW A;  3OLO A;  2OKU A;  3AGE A;  4K08 A;  5JP7 A;  3U4L P;  3CG5 A;  2XR0 A;  2VV6 A;  1MND A;  4JGP A;  3AG4 C;  3UMH A;  1GM5 A;  3N4I A;  4Y15 A;  3G2Y A;  2P7V A;  2XSE A;  2QHK A;  1EI5 A;  3POV A;  3DAF A;  1E83 A;  1GHM A;  3E2L A;  2EIM C;  2JE5 A;  3W4Y A;  2VCB A;  3G4Z A;  4NY3 A;  3SOI A;  4H8R A;  1F98 A;  3N24 A;  4MQ9 F;  4DKI A;  2R7W A;  4K0X A;  5EM0 A;  3A3D A;  1IYP A;  3SS5 A;  2Z2L B;  2YVK A;  2OQM A;  1PWG A;  2G7U A;  5K5B A;  1SR2 A;  3LNM B;  4E7S A;  1STZ A;  3HUN A;  4O6Y A;  2GJ3 A;  3QP5 A;  4KZA A;  4HE8 D;  3B42 A;  2EIK C;  3PBQ A;  2B18 A;  3IT9 A;  2EPN A;  1QVX A;  4J30 B;  2JD3 A;  2X0C A;  4EUV A;  1DJA A;  3DTM A;  3CZD A;  2O9C A;  3MBZ A;  1M2O A;  1GCE A;  3VAY A;  4LFU A;  3QTH A;  4LLO B;  4UA9 A;  4PPR A;  3ECS A;  1YAU O;  1KOU A;  2I9V A;  4NXE A;  5EE8 A;  2IM8 A;  3U5S A;  2EFX A;  5FSR A;  4KZ7 A;  2HV7 A;  1E84 A;  3M2J A;  1DJC A;  4EBB A;  2QNL A;  1APC A;  3EZI A;  4U5H A;  1DP8 A;  4Q0I A;  4E3J A;  1WTY A;  5KYX A;  3MXQ A;  1S67 L;  3W8I A;  1LIH A;  2XLD A;  1YDI A;  3WS2 A;  1F2K A;  1K55 C;  3HRE A;  3LFV A;  3E4Q A;  3P98 A;  2EXB A;  4OPY A;  3JYH A;  3V5Y A;  4NXG A;  3T4O A;  4ARZ A;  4IWB A;  2XF3 A;  3B0U X;  1IZM A;  1RXQ A;  4CS9 C;  4L9G A;  2XH9 A;  5EVL A;  3K1H A;  2WKP A;  3LIC A;  1OTD A;  5B3I A;  5F1G A;  5L07 A;  2EPM X;  4JXV A;  2PD7 A;  2QUP A;  1NG1 A;  4GZB A;  3TRC A;  4AL0 A;  4KG6 A;  4GD8 A;  4DN0 A;  3O6X A;  4CSA C;  4EWC A;  5HPF A;  4WYY A;  1NZO A;  4Q5S F;  3B29 A;  1UG7 A;  3F46 A;  1KNY A;  3DTK A;  5HW3 A;  2WVO A;  4R4S A;  3UE0 A;  4O7D A;  1IYS A;  2Y69 C;  4NCQ A;  4N9L A;  4E3O A;  1ZHH B;  3U2A A;  4NXB A;  1Q0G A;  3L9K A;  4ER9 A;  2PR5 A;  1YT4 A;  3IF5 A;  2XGN A;  4LV2 A;  4YNR A;  3QW0 A;  2Z6D A;  5C5K A;  1I4Y A;  2QJ7 A;  2B5R A;  3KMI A;  2L4R A;  3QNC A;  5CXW A;  3BFE A;  1ALQ A;  3UE1 A;  2O99 A;  5CHM A;  2Y55 A;  1TWH A;  4HBU A;  2ZC7 A;  4R23 A;  3SH9 A;  2WZL A;  1YLW A;  2J3W A;  3VFH A;  2XFS A;  5G4Z A;  3NC8 A;  3SP1 A;  1T1B A;  5L0D A;  4FWV A;  5GLC A;  3T1R A;  1VM1 A;  3QP6 A;  5L0F A;  3RQG A;  1PIO A;  3NOU C;  3IWQ A;  3H65 A;  2KJG A;  2Y3G A;  2EIN C;  3RJU A;  1MWT A;  1E85 A;  4GQH A;  5FQK A;  3UB5 P;  5L2F A;  5DF9 A;  3QW1 A;  5DQZ A;  1LL9 A;  3BEH A;  3VOL A;  3D4F A;  3AGF A;  2XEP A;  4WZ5 A;  1HW2 A;  3ICY A; 
#chains in the Genus database with same CATH homology
 2P08 A;  4O0P A;  3T4J A;  4Q0H A;  4HJ6 A;  4MN5 A;  3F1P A;  4HQA A;  1UWN X;  2J3T C;  3LUQ A;  3T4Q A;  5IU1 A;  3V67 A;  3UME A;  2XSS A;  3UE3 A;  4B93 A;  3EEA A;  2Y8H A;  2VJW A;  3EGD C;  3OBF A;  4HP9 A;  4LRX C;  5J3W A;  4H6J A;  3LID A;  2OOL A;  2JKT M;  4LPZ A;  3NOT C;  4PKY A;  3UB9 A;  1D06 A;  4R3A A;  3NJA A;  3R7W B;  4BJP A;  4MMN A;  2FH5 A;  3VE3 A;  4HOI A;  4HP4 A;  2A24 A;  1G6O A;  3SW1 A;  2O9B A;  4CLC A;  4O01 A;  1OTE A;  2K2N A;  3VE4 A;  4KUK A;  1OTA A;  3TE8 A;  2LB9 A;  1GSV A;  4HIA A;  2D01 A;  3D72 A;  4MCW A;  4IJG A;  4WEJ A;  4H6J B;  4BBU A;  4R38 A;  3PBO A;  4EW7 A;  3MR0 A;  4BWI A;  2QJ5 A;  2FZ0 A;  5HWV A;  3EWK A;  4KQO A;  3BY9 A;  2VGL M;  2HJ9 C;  1OTB A;  2O9A A;  1W63 Q;  3IBR A;  3LI8 A;  1S4R A;  4EQ1 A;  2Z6C A;  2VA0 A;  5HDC A;  2VKS A;  3LIB A;  4HH2 A;  4I3A A;  2M7V A;  1IFQ A;  5TBM B;  1OJ5 A;  3KSF A;  3UB6 A;  1T18 A;  3UE6 A;  2BAS A;  4I3J A;  2NUT C;  4F3L A;  4Y2F A;  2A24 B;  4IHQ A;  2O0Y A;  3E98 A;  1LSV A;  3B33 A;  1WA9 A;  1S66 L;  3PBN A;  4QPR A;  4RQ9 A;  5AJG A;  4YOF A;  4CLC C;  3KSH A;  3JVU A;  3CAX A;  5TJJ A;  2W3G A;  2ZBB A;  4JGQ A;  3PR6 A;  2KX6 A;  1Y28 A;  5F69 A;  4Y3I A;  2W3F A;  1XJ4 A;  2XRO A;  4IUH A;  1V9Z A;  2OAP 1;  3PHY A;  2EA9 A;  2VV7 A;  1F5M A;  3KX0 X;  3IS2 A;  2PR6 A;  3F1N A;  4B9O A;  1D7E A;  3PBT A;  4EEU A;  5F5Y A;  3LR4 A;  3F1O B;  3HJK A;  3PBS A;  3CIT A;  3H82 B;  2J3T D;  4LRZ E;  2XA7 M;  4R70 A;  5HWT A;  2PHY A;  2EWW A;  2A2L A;  2P0N A;  2P7J A;  3H82 A;  3O5Y A;  2NUP C;  4WF0 A;  1LSW A;  3LI9 A;  1W63 M;  2HF6 A;  4Q0J A;  5CX7 A;  1TS0 A;  4FSF A;  3CUE A;  4NEE D;  3S7N A;  4BMW A;  3LR0 A;  3EGX C;  4WL9 A;  2R78 A;  3MQO A;  4M4X A;  5HPI A;  4E04 A;  3C30 A;  3OOV A;  4NXF A;  2VX8 A;  3OCN A;  4XT2 B;  3D3O A;  3PXP A;  1NWZ A;  4IUK A;  3G6O A;  3UB8 A;  2HV1 A;  2YKH A;  4EER A;  1XFQ A;  5DFY A;  4F3L B;  4WLA A;  4DMZ A;  4HY8 A;  3U9J A;  3MQ0 A;  5J4E A;  5HDS A;  4MN7 A;  4I38 A;  2W1T A;  1EW0 A;  5HD3 A;  3MJQ A;  1XJ2 A;  2Y79 A;  2W1R A;  5DKK A;  2GZA A;  3P7N A;  5FL3 A;  1LSX A;  3E0Y A;  4L9F A;  2XA7 S;  4PKY G;  4HJ4 A;  3RH8 B;  3OCL A;  1OPX A;  2V0W A;  5IS1 A;  1T1C A;  1JNU A;  4UEY A;  4JGO A;  3H7W B;  2ZMV A;  3KYQ A;  5IT5 A;  3FC7 A;  5HWW A;  2VGL S;  3LR5 A;  5J7E A;  3BQA A;  1N9L A;  1H8M A;  2CMN A;  2L0W A;  5A8B A;  3EOI A;  4HJ3 A;  3C8C A;  5AVF A;  1NLY A;  4GCZ A;  3T4S A;  2V1A A;  4Z1W A;  1ZTU A;  3MF0 A;  4L9E A;  1ODV A;  3MFX A;  4UQI M;  4PAU A;  3LIF A;  5DJU A;  1XJ3 A;  3S7P A;  3W2Z A;  4L0L A;  1T19 A;  4HI4 A;  3ZYT A;  3PBR A;  1S1Z A;  4PHT A;  3K3D A;  2J80 A;  2K7S A;  4JGR A;  2ZOI A;  3H9W A;  2ZOH A;  4BBV A;  1DP9 A;  3EEH A;  3PYP A;  5LBR A;  5KIZ A;  4I5S A;  3T50 A;  4ETZ A;  3DBA A;  1N9N A;  3A0S A;  1GSW A;  2QYB A;  2QWS A;  2VEA A;  2DMW A;  4ZRR A;  5MC7 A;  1IOU A;  2JKR I;  3V5X A;  4R6L A;  3A0V A;  5F6A A;  4I3I A;  4GHI B;  4EXO A;  4OOM A;  3U9M A;  2PYR A;  1LT0 A;  3S7O A;  4Y5F A;  2VZW A;  3LIA A;  3JVV A;  2PYP A;  3A0R A;  4DJ2 A;  4AFI A;  3R4K A;  5DKL A;  3T4T A;  4YWZ A;  4MDZ A;  3CWF A;  1VB6 A;  2QKP A;  5F68 A;  1DP6 A;  5I5L A;  1GSX A;  3F1N B;  3FPV A;  1NLZ A;  4HH3 A;  4WUJ A;  3ZQ5 A;  1YSQ A;  1TS8 A;  2HJE A;  3VV4 A;  2GNX A;  3TW8 A;  1G28 A;  1TD5 A;  4CLC D;  3GEC A;  3B47 A;  3FPW A;  2D02 A;  2P04 A;  4EET B;  2MJ6 A;  3V5Z A;  4G3V A;  1LL8 A;  2M1C A;  2INW A;  1T1A A;  2VV8 A;  3IBJ A;  3IS2 B;  1OJG A;  4WN5 A;  1OT6 A;  3OLO A;  1UWP X;  2WKQ A;  2V9A A;  4K08 A;  2OWH A;  1MKM A;  3E4O A;  2JKT I;  5DFX A;  3F1O A;  2OAQ 1;  2VV6 A;  4JGP A;  3LR3 A;  1UGU A;  4GW9 A;  3C38 A;  4II7 A;  2W3H A;  1OT9 A;  2QHK A;  1VHM A;  2V0U A;  3GDI A;  1P9R A;  5L8M A;  3ULF A;  3HJI A;  3P01 A;  1F98 A;  3KYZ A;  4EEP A;  1NRJ A;  1TS6 A;  3UMD A;  4GLQ A;  2JN7 A;  4OOL A;  3UB7 A;  4CQH A;  2G7U A;  3S7Q A;  1MZU A;  5DJT A;  4NKP A;  5K5B A;  1STZ A;  4I39 A;  4EES A;  2GJ3 A;  2ZMF A;  1H3Q A;  3B42 A;  3PBQ A;  2K31 A;  5TBM A;  2B18 A;  4GJ4 A;  1OTI A;  3EQU A;  4EUV A;  3KSG A;  2O9C A;  3LYX A;  4LLO B;  2WKR A;  3BQ8 A;  1KOU A;  2I9V A;  4NXE A;  4WEL A;  5G4Y A;  3EQV A;  2HGV A;  2IA2 A;  1YSP A;  2PDR A;  5AVE A;  1DP8 A;  3CLO A;  4Q0I A;  2W27 A;  5HZH A;  5HL6 A;  3H7W A;  3MXQ A;  1S67 L;  1P0Z A;  3KO6 A;  4UQI S;  3C2W A;  3LFV A;  3E4Q A;  4XT2 A;  4FOF A;  4HHD A;  3V5Y A;  4NXG A;  3BY8 A;  3T4O A;  4ARZ A;  1TS7 A;  4MN6 A;  3CUE C;  4L9G A;  3F1P B;  1XFN A;  2M7U A;  4CLC E;  3BW6 A;  2WKP A;  3LIC A;  1OTD A;  4KUO A;  2PD7 A;  3LIE A;  4CLC B;  5HD5 A;  2JHE A;  2KLI A;  1DRM A;  3TRC A;  4G3K A;  4DN0 A;  4ME4 A;  5HPF A;  3T4L A;  3TJZ C;  5HDD A;  4GHI A;  3MMH A;  1S4S A;  3R7W A;  1ZHH B;  3U2A A;  3CI6 A;  4NXB A;  2VLG A;  3NOP C;  1TF1 A;  1YKD A;  2KOI A;  2PR5 A;  3BJN A;  3NHQ A;  3OC2 A;  4LRY C;  1P97 A;  2V1B A;  1V9Y A;  5HSQ A;  4YNR A;  2Z6D A;  5C5K A;  2W3D A;  2QJ7 A;  1BYW A;  3T4K A;  2L1M A;  4GS9 A;  3BWL A;  2L4R A;  2H28 A;  4DJ3 A;  1S1Y A;  2W0N A;  4ETX A;  2JKR M;  1F9I A;  2O99 A;  2B02 A;  5EFW A;  1X0O A;  3K2N A;  2W1T B;  5KSH A;  3E4P A;  2OWJ A;  2KDK A;  4WEK A;  2J3W A;  1P9W A;  2GX5 A;  5G4Z A;  4KQD A;  4O8G A;  2PD8 A;  1T1B A;  4EU0 A;  2PT7 A;  2XRN A;  4GS9 B;  4ARZ B;  3MQQ A;  4BBT A;  4HNB A;  4P6Z S;  4G3W A;  3RTY A;  2W3E A;  1N9O A;  3NOU C;  3FG8 A;  3KSI A;  2EWV A;  4P6Z M;  5DF9 A;  2YKF A;  3HCY A;  3RFB A;  3VOL A;  2LB5 A;  1XJ6 A;  3K3C A;  1YAX A;  1MC0 A;  3ICY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...