2IM8A

X-ray crystal structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of hypothetical protein yPPE. Northeast Structural Genomics Consortium target SR213.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yppE
total genus 46
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2im8A00
2HUJA 2IM8A 2HFIA 2ETSA
chains in the Genus database with same CATH superfamily
3FVYA 4XQ1A 2DI3A 2NUPB 1ST6A 3UR3C 3U3BA 4KI2A 3W4YA 4J7YA 3PHF2 3LUTB 2H7BA 2Y69C 3H65A 3JRMO 1E85A 2X51A 1V4AA 4JCHA 2HZ8A 4OD5A 3C18A 4AX2A 1D0ZA 4MTOA 3FHDA 2A6EF 1WASA 4UDVA 3GM1A 1TWCA 1A7VA 2LIGA 1FMVA 4HFKB 4JKVA 2O9XA 3S29A 4YWQA 2HMZA 2WL8A 3JSZA 1J8MF 3ASOC 4PJLA 4N4WA 3C62A 2GAQA 3DM9B 4C3DA 1OCOC 1NZEA 5JT4A 1TWGA 3IQ5A 3MBGA 1MMDA 1Q0GA 1TFOB 3CZ6A 2YVKA 3FAJA 4MQ9F 5BQIA 1Q0KA 5IY5C 1A0BA 4JEBA 2IXOA 3HNLA 2ZD9A 1Z23A 3U9MA 1RXQA 256BA 2D4UA 4I1OB 3ZWIA 4EIYA 2VCAA 5F5HA 2QE9A 1VK5A 1WTYA 3JCUQ 3DAGA 3G4ZA 4BJTA 2XLVA 3SXZA 3S9OA 4ULVA 1E2XA 3N2ZB 3SYNA 2VASA 1T01A 4JC7A 1HMOA 2L9JA 1AVOB 3AQBA 4YL3A 4EWCA 2KSFA 2G3VA 3TJ5A 4ONSA 3NG1A 4JTCB 4QI0A 1ZW3A 4DRJB 3GODA 2LP4A 4U5GA 4RBNA 2PFDA 3NYMA 2G62A 1M2VA 5HSWA 3ZDLA 5D91A 5COMA 3ZIBA 4XLPF 2J7PD 4EUKB 5E3CA 2VB6A 1S7ZA 2E87A 2L81A 4A2NB 4C7OB 4XPYA 3EGXB 2VC9A 4JURI 5CI8A 1KU2A 1CGNA 1YA9A 2YLDA 5AC4A 3C63A 3AG2C 5DS5A 3C7JA 1JOGA 1OR2A 3GM2A 3X2QC 3S0XA 1ZU5A 2R7OA 2DYSC 3B71A 4J7TA 4RDAA 2B0HA 1YYJA 2ZPAA 3QVYA 4X0RA 3O55A 4IARA 5T3WA 2R7XA 3L8IA 3NYJA 5L3QA 5DQZA 2CCYA 4PACA 4QDLA 1D1CA 3T4RA 1DOWA 4JRZA 3WG7C 4DVZA 1HW2A 3QW1A 3C8GA 1W2WA 1ZHXA 2DGJA 2XM0A 4U9EA 4DXWA 4Q5SF 3AGUA 2XLEA 2IXNA 1Q0MA 2XL6A 1VYKA 5DS4A 1EA8A 1VYIA 1L7CA 2J9VA 2Y3BA 5A6BD 5L0HA 3RQEA 3QW0A 1IZMA 4CSAC 3GEHA 3TJ6A 1OCRC 3MX3A 2OEXA 4C3EA 2L7AA 1EQ1A 4YL1A 3ZTZA 2J45A 2PX3A 2XLMA 3HLZA 4U5HA 1UFBA 3JSEO 2HJMA 2L6GA 3FMSA 2GFHA 5TJ5E 1QLEC 2AWCA 2BE5F 2V3CC 4G0HA 3FDQA 4NCQA 2P7VA 5DQTA 2Z15A 2QNLA 3NYLA 1SR2A 1V55C 3GEEA 4CS8C 4G7OF 4ZLCA 3RVYA 1MMNA 1TR2A 1QSPA 1R5ID 5KYUA 3SP1A 5B1BC 1LM3B 2HMQA 2XL4A 4LACB 1Z3IX 2A69F 3E9VA 4O6MA 3EGXA 5DVWA 3V5ZA 4MW8A 2IYLD 1VTMP 4CS9A 1G4WR 1HE1A 3KYJA 4O6NA 3B0UX 2J8WA 1TFKB 1WOLA 3GWNA 2R7SA 3W8IA 1BR1A 4NTBA 3DJNB 4GYTA 1RKEA 3T6BA 3WHNA 3MLGA 4AE4B 5A6KA 2QLAA 3F46A 2JPUA 3IQTA 3RFYA 1GM5A 5JP7A 1C03A 3SXYA 4CS7A 1G8XA 3H2UA 4IJJA 3JYHA 3SXKA 1VLSA 5KYYB 4NTAA 3UGPA 1Z5ZA 2LCHA 4DRIB 1Q0FA 3IQCA 3ZG1A 2ZXRA 3QTHA 3AQCA 3ZSUA 3LLIA 2JD3A 3DXJF 3L34A 5E33A 2YLGA 3EHNA 2KQ9A 3K33A 1NBBA 4P9TA 2HSBA 3DE9A 3ZVRA 1S05A 2XLOA 3LNRA 1K05A 4XWJA 5GPGB 1TWHA 3KL4A 4MVSA 5L3VA 3JTLO 3QVZA 2KW3C 2WVNA 3L1MA 3SNHA 2EIJC 2ZXWC 3X1OA 4P9FA 1ZHWA 2R7TA 1U6HA 3LEVA 3LESA 2NUTA 2QUPA 3A11A 3EG9A 4CS9C 4HEAJ 2LD6A 4Z9JA 2AU5A 3JRTA 4W8PA 3WAQA 4EHPA 1HMDA 4J30B 3U2LA 3K1HA 3B0VC 3GEIA 5KYXB 4H54A 2XXAA 1FNTc 4HE8D 5KYUB 1PCXA 2OU6A 3GORA 2WVQA 2R02A 2CNWA 5F5FA 2R7QA 1LVKA 4U5DE 1ZHYA 2XLWA 3AG3C 1MMGA 4JVSA 4ZLDA 1D1AA 1HY5A 3AG1C 3LEOA 3TK0A 2LQGA 4I3MA 2R7VA 2CW0F 1EI7A 2UUHA 3TD7A 2M64A 5KYWB 2KYHA 3W2VA 2G3KA 4CJOA 4D4XA 1YA7O 3DMDA 1GQAA 4EBKA 1BZ4A 4CIPA 5A6JA 2YZSA 4J32B 4BJ1A 4U5BE 3T6GB 2EPKX 2W45A 3I5PA 2XSEA 2C04A 4MNDA 5COFA 2HV7A 2IXMA 2IOQA 3JT1A 5CI9A 4E7SA 4IAOA 4GQHA 2VCBA 4E0IA 3UMIA 3ASNC 4KNVA 3ZQVA 2A0BA 3HJCA 4WJ0A 1K04A 2YL0A 3US6A 4YK5A 3V5YA 5L0IA 2XRHA 4O6YA 3C8GB 3L8JA 4KBLA 1LS1A 4Q4ZF 1H9GA 4PJJA 1OXKA 1DOVA 1GS9A 3CQZA 2Y3DA 1E84A 5L0JA 2R9RB 4WABA 4N6CA 3FAPB 2OQMA 3OEOA 2H7VC 5DS6A 2V26A 2R7UA 3AGTA 3T9OA 3ITFA 3OWTA 2UUIA 4O7GA 1B68A 3NMKA 1LE4A 1SZIA 3R7CA 2OOCA 2PX0A 2YLIA 1CPQA 4KNWA 4N06A 1M6TA 4JEAA 3CSKA 5B1AC 3RW0A 3T6JA 4U5EE 1LI7A 1OR3A 4LLEA 3VAYA 3ATPA 3B29A 1YVIA 1M2VB 1U89A 2WB7A 1FTSA 2CGEA 3G4XA 3HNKA 3IEEA 3AJMA 3Q6NA 1ZW2A 4Q7CA 1NFNA 1ORYA 1A7EA 1RJ9A 3EPVA 3RQFA 4D4NA 1YAUO 3M1CB 1OW7A 1LS4A 1FMWA 3EFOB 2YL7A 3MFNA 2Y39A 4U5CE 3VRCA 3UNGC 2NUPA 3DI5A 3UMKA 2OKUA 2KC3A 2MYSA 4K0DA 2EILC 1YLMA 2IBFA 3EGDA 1I4ZA 3NRHA 2NSGA 2OEVA 3DKAA 2J7PA 2QY9A 3EFOA 4MTFA 2P61A 1IW7F 2GWWA 3RH3A 3RKOF 4IGGA 4CBEA 1U0BB 1FR0A 1MNEA 3QZCA 4BJ5A 2H7OA 3O39A 2LK4A 5L0GA 2FFHA 4MVZA 5B3IA 5EHHA 2DYRC 2HFIA 2WZFA 3U9JA 5JLIA 2EPNA 3ABMC 2FAPB 4MVUA 5BQGA 4O79A 3U5SA 1O87A 2J9WA 5E3AA 5JS5A 1R4TA 4DOZA 3S27A 4FAPB 3RVZA 2PBEA 2W4MA 2RSEB 1VMAA 4DVYP 3UGOA 1PV3A 3NKDA 3M79A 4MW3A 1OCCC 1ORSC 5A6BA 4CDVA 3PDMP 4MTGA 4YN0B 3OA1A 4XEKA 3RF3A 5K0IA 1WGWA 3UMHA 3M4CA 2WZLA 3S28A 2R25A 1MNDA 1PD0A 4XPXA 3K7DA 3ZC4A 3H2VA 1YJGA 1A41A 4G7ZF 2A6HF 1T6UA 3BEHA 4NTFA 3J06A 1XZPA 4PFPA 4XEVA 3TOLA 2D5RB 1LPEA 1H6GA 1T9KA 2ASRA 4CDYA 3VM6A 2EIMC 3EG9B 2A68F 3GM3A 3JYYA 4BG0A 4CSAA 1AEPA 4E17A 1SF8A 3NMJA 1BR4A 3L0IA 1J8YF 2HJ3A 4A4AA 4YT8A 4XEFA 1XWJA 2QTVA 4MVQA 4BEMJ 1YZCA 1TKNA 2OJQA 2YWAA 2W4BA 4R32A 3K66A 1YYXA 1FAPB 1RKCA 2KGOA 2CDQA 3ABKC 1VLTA 2EPMX 3AG4C 5BQHA 1CGME 4N6HA 3U8PA 3R2PA 3I5QA 1OW6A 1RKEB 2H8AA 1QZXA 4WGYA 1JAFA 4Z9IA 2R7WA 1M57C 3W2WA 4YT4A 5KYNA 1O5HA 1JPNA 2LFDA 4IRUA 4MS2A 4JTAB 2ICWG 2YQYA 2Q3TA 4PJMA 3VYWA 1V74B 4CJGA 3U0CA 1D0XA 2ETSA 2Q9CA 1OQCA 5KYWA 2EPLX 4K1OA 2MHRA 3S84A 1T6IA 3RQGA 4CX9A 1OXBA 3HNIA 1ZYRF 4OIPF 3EJNA 2XS8A 1KTMA 3K1IA 4I1MA 2TMVP 1WATA 3F47A 3KMIA 2ZXPA 4I44A 1LIHA 1GGQA 1T5OA 2XLDA 3DWWA 1RCPA 2GA0A 2PP4A 3IHUA 2J9BA 4FWVA 3RYLA 5F28E 4OIQF 2HSQA 2J46A 4JJGA 3GANA 1NU7D 3EZHA 4JZAA 2WZGA 5T1DB 2R7RA 1RMVA 4YT5A 1ZZPA 2L6FA 3Q7LA 5L0CA 2Y3HA 3PMRA 4DBRA 3LAYA 2OG2A 3FOOA 5AC5A 1WN0A 2XLHA 1OW8A 1ZVZA 2KJGA 4OD4A 3TQOA 1JPJA 2L6HA 2XM4A 3DE8A 3EHMA 5FZTA 4U5FE 4BJ5C 1BBHA 4MVRA 3BRJA 1D0YA 4BJ6C 4JJFA 2EPOA 4YT2A 4IWBA 2Q9BA 2F22A 2IM8A 3GWLA 5B3SC 2A0UA 4JW1A 4K7BA 2J9UA 4LERA 4KC9A 4RD9A 2AWYA 3NKEA 2LSEA 3SZRA 4ULWA 1JMWA 1OCZC 5COGA 2YRFA 1A7DA 5CIVA 3EGDB 4JE9A 3FOPA 1QPUA 4JTDB 5AGFA 5D92A 5JUAA 5KYXA 4NC3A 2YL3A 3U8VA 4C3BA 5T3TA 4U9DA 1E86A 4B6IA 2W9YA 4PFOA 4L6RA 1FFHA 4LDQA 1XZQA 3DZAA 2P0NA 1NG1A 4LLCA 4AL1A 1SMYF 2XS1A 3CEXA 3U2MA 3HTKC 3AOUA 2HUJA 3NMIA 4E0HA 2R03A 1N1CA 3O6XA 2LFFA 1AUEA 2HS5A 1I4YA 5A6AA 4AL0A 1JR8A 3KPHA 1QQ3A 3G50A 3M4BA 4CIHA 3EZIA 5EGYA 1M2OA 2HV6A 4H4KC 1APCA 4BEJA 2YHSA 4PK4A 1SYQA 2A1DD 4Z9HA 4CDAA 3ECSA 4DRHB 3NDBB 3HKKA 4XPWA 1TWAA 4G78A 5KYYA 1C17M 1LE2A 3KYIA 1L3PA 1NLXA 1EKYA 2Q00A 2B0JA 3VF0A 1CGOA 3LS1A 3M15A 4LDKA 2OJED 1H7IA 1JRAA 3KKBA 3LNMB 4GEHA 2X0CA 4G7HF 5EK0A 1HE9A 1UG7A 4FESA 5JSLA 1ORJA 4OIRF 1Y6DA 1Q0DA 4BPMA 4PR9A 1BDJB 2P6VA 1KNYA 2PNOA 3QMKA 4ANJA 3IPMO 1VB5A 1Z6AA 1BR2A 3HNJA 1D1BA 1OKKD 4ER9A 4MVMA 2CNWD 1K40A 1G4US 2DB4A 3C8GD 4AK9A 4XTKA 1CPRA 1NFOA 3I4UA 2BL2A 4HFFB 4F4BA 2PF4E 1MQVA 2EINC 2I15A 1T6QA 3DJUB 4YL0A 1QKRA 3EH2A 3KH2A 1YDIA 4PJNA 4C7OA 5HV9A 1I5NA 2Q9AA 4M63A 5DLJA 1C02A 3LJBA 2KNHA 3TULA 4P6IC 4IAQA 3U3FA 2ZXOA 3DM5A 2BC5A 4EBJA 2KK1A 3TOMA 2MWQA 3ABLC 1Z7Qc 4LDRA 2P1AA 4JCZA 3O10A 3N24A 4JIOA 3Q6MA 4DJ9A 2NPUA 3E70C 1H9TA 1F1MA 4E7ZA 4BJ6A 5L0DA 4EBBA 5JRAA 2YKZA 3ZQYA 1LKXA 2HKVA 2J0XA 4OIOF 1V54C 1ZHZA 2AP3A 4AE4A 5JVEA 2M4EA 1OKKA 1FFTC 2IXPA 3LLKA 4NQFA 5FCLA 1PD1A 3DD7A 2C03A 1E83A 1ZU4A 3PCVA 3SXMA 2I8BA 3K1IC 3WODF 2YL1A 2JX0A 3MYFA 1Y4CA 2Q7RA 3N0TA 4MVOA 4NY3A 3B9QA 1Z63A 2XL8A 3B0PA 5BUOA 1WWPA 4DBQA 2AVKA 3A9CA 3EQLF 2Y3GA 3Q7GA 1TQGA 4WGZA 2NUTB 1VOMA 2VCCA 3W8HA 3EH1A 4OINF 3C8ZA 2OCCC 2R05A 2J0WA 1LI5A 4E18A 1MMAA 3MYIA 4QI2A 2NG1A 1O3UA 3V7OA 2FGYA 3LS0A 1QVXA 3K6BA 2YEVA 5E2QA 2XXAB 5L0FA 2NSFA 2RD9A 5A69A 1M56C 4YJWA 1ZHTA 3RIPA 1NU9C 2WVOA 3IQ6A 3SEOA 3ZTMA 4CS8A 1HW1A 3JZ0A 4EKWA 2Q4FA 2GDCA 3POVA 2CYDA 4IB4A 4W8KA 3CAXA 1RJ9B 4XLNF 3DAFA 1YARO 3V5XA 4FX5A 1G5ZA 3FXHA 1NSGB 1YZAA 2VH3A 3S90A 2EIKC
chains in the Genus database with same CATH topology
2HUJA 2IM8A 2HFIA 2ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUJ A;  2IM8 A;  2HFI A;  2ETS A; 
#chains in the Genus database with same CATH topology
 3FVY A;  4XQ1 A;  2DI3 A;  2NUP B;  1ST6 A;  3UR3 C;  3U3B A;  4KI2 A;  3W4Y A;  4J7Y A;  3PHF 2;  3LUT B;  2H7B A;  2Y69 C;  3H65 A;  3JRM O;  1E85 A;  2X51 A;  1V4A A;  4JCH A;  2HZ8 A;  4OD5 A;  3C18 A;  4AX2 A;  1D0Z A;  4MTO A;  3FHD A;  2A6E F;  1WAS A;  4UDV A;  3GM1 A;  1TWC A;  1A7V A;  2LIG A;  1FMV A;  4HFK B;  4JKV A;  2O9X A;  3S29 A;  4YWQ A;  2HMZ A;  2WL8 A;  3JSZ A;  1J8M F;  3ASO C;  4PJL A;  4N4W A;  3C62 A;  2GAQ A;  3DM9 B;  4C3D A;  1OCO C;  1NZE A;  5JT4 A;  1TWG A;  3IQ5 A;  3MBG A;  1MMD A;  1Q0G A;  1TFO B;  3CZ6 A;  2YVK A;  3FAJ A;  4MQ9 F;  5BQI A;  1Q0K A;  5IY5 C;  1A0B A;  4JEB A;  2IXO A;  3HNL A;  2ZD9 A;  1Z23 A;  3U9M A;  1RXQ A;  256B A;  2D4U A;  4I1O B;  3ZWI A;  4EIY A;  2VCA A;  5F5H A;  2QE9 A;  1VK5 A;  1WTY A;  3JCU Q;  3DAG A;  3G4Z A;  4BJT A;  2XLV A;  3SXZ A;  3S9O A;  4ULV A;  1E2X A;  3N2Z B;  3SYN A;  2VAS A;  1T01 A;  4JC7 A;  1HMO A;  2L9J A;  1AVO B;  3AQB A;  4YL3 A;  4EWC A;  2KSF A;  2G3V A;  3TJ5 A;  4ONS A;  3NG1 A;  4JTC B;  4QI0 A;  1ZW3 A;  4DRJ B;  3GOD A;  2LP4 A;  4U5G A;  4RBN A;  2PFD A;  3NYM A;  2G62 A;  1M2V A;  5HSW A;  3ZDL A;  5D91 A;  5COM A;  3ZIB A;  4XLP F;  2J7P D;  4EUK B;  5E3C A;  2VB6 A;  1S7Z A;  2E87 A;  2L81 A;  4A2N B;  4C7O B;  4XPY A;  3EGX B;  2VC9 A;  4JUR I;  5CI8 A;  1KU2 A;  1CGN A;  1YA9 A;  2YLD A;  5AC4 A;  3C63 A;  3AG2 C;  5DS5 A;  3C7J A;  1JOG A;  1OR2 A;  3GM2 A;  3X2Q C;  3S0X A;  1ZU5 A;  2R7O A;  2DYS C;  3B71 A;  4J7T A;  4RDA A;  2B0H A;  1YYJ A;  2ZPA A;  3QVY A;  4X0R A;  3O55 A;  4IAR A;  5T3W A;  2R7X A;  3L8I A;  3NYJ A;  5L3Q A;  5DQZ A;  2CCY A;  4PAC A;  4QDL A;  1D1C A;  3T4R A;  1DOW A;  4JRZ A;  3WG7 C;  4DVZ A;  1HW2 A;  3QW1 A;  3C8G A;  1W2W A;  1ZHX A;  2DGJ A;  2XM0 A;  4U9E A;  4DXW A;  4Q5S F;  3AGU A;  2XLE A;  2IXN A;  1Q0M A;  2XL6 A;  1VYK A;  5DS4 A;  1EA8 A;  1VYI A;  1L7C A;  2J9V A;  2Y3B A;  5A6B D;  5L0H A;  3RQE A;  3QW0 A;  1IZM A;  4CSA C;  3GEH A;  3TJ6 A;  1OCR C;  3MX3 A;  2OEX A;  4C3E A;  2L7A A;  1EQ1 A;  4YL1 A;  3ZTZ A;  2J45 A;  2PX3 A;  2XLM A;  3HLZ A;  4U5H A;  1UFB A;  3JSE O;  2HJM A;  2L6G A;  3FMS A;  2GFH A;  5TJ5 E;  1QLE C;  2AWC A;  2BE5 F;  2V3C C;  4G0H A;  3FDQ A;  4NCQ A;  2P7V A;  5DQT A;  2Z15 A;  2QNL A;  3NYL A;  1SR2 A;  1V55 C;  3GEE A;  4CS8 C;  4G7O F;  4ZLC A;  3RVY A;  1MMN A;  1TR2 A;  1QSP A;  1R5I D;  5KYU A;  3SP1 A;  5B1B C;  1LM3 B;  2HMQ A;  2XL4 A;  4LAC B;  1Z3I X;  2A69 F;  3E9V A;  4O6M A;  3EGX A;  5DVW A;  3V5Z A;  4MW8 A;  2IYL D;  1VTM P;  4CS9 A;  1G4W R;  1HE1 A;  3KYJ A;  4O6N A;  3B0U X;  2J8W A;  1TFK B;  1WOL A;  3GWN A;  2R7S A;  3W8I A;  1BR1 A;  4NTB A;  3DJN B;  4GYT A;  1RKE A;  3T6B A;  3WHN A;  3MLG A;  4AE4 B;  5A6K A;  2QLA A;  3F46 A;  2JPU A;  3IQT A;  3RFY A;  1GM5 A;  5JP7 A;  1C03 A;  3SXY A;  4CS7 A;  1G8X A;  3H2U A;  4IJJ A;  3JYH A;  3SXK A;  1VLS A;  5KYY B;  4NTA A;  3UGP A;  1Z5Z A;  2LCH A;  4DRI B;  1Q0F A;  3IQC A;  3ZG1 A;  2ZXR A;  3QTH A;  3AQC A;  3ZSU A;  3LLI A;  2JD3 A;  3DXJ F;  3L34 A;  5E33 A;  2YLG A;  3EHN A;  2KQ9 A;  3K33 A;  1NBB A;  4P9T A;  2HSB A;  3DE9 A;  3ZVR A;  1S05 A;  2XLO A;  3LNR A;  1K05 A;  4XWJ A;  5GPG B;  1TWH A;  3KL4 A;  4MVS A;  5L3V A;  3JTL O;  3QVZ A;  2KW3 C;  2WVN A;  3L1M A;  3SNH A;  2EIJ C;  2ZXW C;  3X1O A;  4P9F A;  1ZHW A;  2R7T A;  1U6H A;  3LEV A;  3LES A;  2NUT A;  2QUP A;  3A11 A;  3EG9 A;  4CS9 C;  4HEA J;  2LD6 A;  4Z9J A;  2AU5 A;  3JRT A;  4W8P A;  3WAQ A;  4EHP A;  1HMD A;  4J30 B;  3U2L A;  3K1H A;  3B0V C;  3GEI A;  5KYX B;  4H54 A;  2XXA A;  1FNT c;  4HE8 D;  5KYU B;  1PCX A;  2OU6 A;  3GOR A;  2WVQ A;  2R02 A;  2CNW A;  5F5F A;  2R7Q A;  1LVK A;  4U5D E;  1ZHY A;  2XLW A;  3AG3 C;  1MMG A;  4JVS A;  4ZLD A;  1D1A A;  1HY5 A;  3AG1 C;  3LEO A;  3TK0 A;  2LQG A;  4I3M A;  2R7V A;  2CW0 F;  1EI7 A;  2UUH A;  3TD7 A;  2M64 A;  5KYW B;  2KYH A;  3W2V A;  2G3K A;  4CJO A;  4D4X A;  1YA7 O;  3DMD A;  1GQA A;  4EBK A;  1BZ4 A;  4CIP A;  5A6J A;  2YZS A;  4J32 B;  4BJ1 A;  4U5B E;  3T6G B;  2EPK X;  2W45 A;  3I5P A;  2XSE A;  2C04 A;  4MND A;  5COF A;  2HV7 A;  2IXM A;  2IOQ A;  3JT1 A;  5CI9 A;  4E7S A;  4IAO A;  4GQH A;  2VCB A;  4E0I A;  3UMI A;  3ASN C;  4KNV A;  3ZQV A;  2A0B A;  3HJC A;  4WJ0 A;  1K04 A;  2YL0 A;  3US6 A;  4YK5 A;  3V5Y A;  5L0I A;  2XRH A;  4O6Y A;  3C8G B;  3L8J A;  4KBL A;  1LS1 A;  4Q4Z F;  1H9G A;  4PJJ A;  1OXK A;  1DOV A;  1GS9 A;  3CQZ A;  2Y3D A;  1E84 A;  5L0J A;  2R9R B;  4WAB A;  4N6C A;  3FAP B;  2OQM A;  3OEO A;  2H7V C;  5DS6 A;  2V26 A;  2R7U A;  3AGT A;  3T9O A;  3ITF A;  3OWT A;  2UUI A;  4O7G A;  1B68 A;  3NMK A;  1LE4 A;  1SZI A;  3R7C A;  2OOC A;  2PX0 A;  2YLI A;  1CPQ A;  4KNW A;  4N06 A;  1M6T A;  4JEA A;  3CSK A;  5B1A C;  3RW0 A;  3T6J A;  4U5E E;  1LI7 A;  1OR3 A;  4LLE A;  3VAY A;  3ATP A;  3B29 A;  1YVI A;  1M2V B;  1U89 A;  2WB7 A;  1FTS A;  2CGE A;  3G4X A;  3HNK A;  3IEE A;  3AJM A;  3Q6N A;  1ZW2 A;  4Q7C A;  1NFN A;  1ORY A;  1A7E A;  1RJ9 A;  3EPV A;  3RQF A;  4D4N A;  1YAU O;  3M1C B;  1OW7 A;  1LS4 A;  1FMW A;  3EFO B;  2YL7 A;  3MFN A;  2Y39 A;  4U5C E;  3VRC A;  3UNG C;  2NUP A;  3DI5 A;  3UMK A;  2OKU A;  2KC3 A;  2MYS A;  4K0D A;  2EIL C;  1YLM A;  2IBF A;  3EGD A;  1I4Z A;  3NRH A;  2NSG A;  2OEV A;  3DKA A;  2J7P A;  2QY9 A;  3EFO A;  4MTF A;  2P61 A;  1IW7 F;  2GWW A;  3RH3 A;  3RKO F;  4IGG A;  4CBE A;  1U0B B;  1FR0 A;  1MNE A;  3QZC A;  4BJ5 A;  2H7O A;  3O39 A;  2LK4 A;  5L0G A;  2FFH A;  4MVZ A;  5B3I A;  5EHH A;  2DYR C;  2HFI A;  2WZF A;  3U9J A;  5JLI A;  2EPN A;  3ABM C;  2FAP B;  4MVU A;  5BQG A;  4O79 A;  3U5S A;  1O87 A;  2J9W A;  5E3A A;  5JS5 A;  1R4T A;  4DOZ A;  3S27 A;  4FAP B;  3RVZ A;  2PBE A;  2W4M A;  2RSE B;  1VMA A;  4DVY P;  3UGO A;  1PV3 A;  3NKD A;  3M79 A;  4MW3 A;  1OCC C;  1ORS C;  5A6B A;  4CDV A;  3PDM P;  4MTG A;  4YN0 B;  3OA1 A;  4XEK A;  3RF3 A;  5K0I A;  1WGW A;  3UMH A;  3M4C A;  2WZL A;  3S28 A;  2R25 A;  1MND A;  1PD0 A;  4XPX A;  3K7D A;  3ZC4 A;  3H2V A;  1YJG A;  1A41 A;  4G7Z F;  2A6H F;  1T6U A;  3BEH A;  4NTF A;  3J06 A;  1XZP A;  4PFP A;  4XEV A;  3TOL A;  2D5R B;  1LPE A;  1H6G A;  1T9K A;  2ASR A;  4CDY A;  3VM6 A;  2EIM C;  3EG9 B;  2A68 F;  3GM3 A;  3JYY A;  4BG0 A;  4CSA A;  1AEP A;  4E17 A;  1SF8 A;  3NMJ A;  1BR4 A;  3L0I A;  1J8Y F;  2HJ3 A;  4A4A A;  4YT8 A;  4XEF A;  1XWJ A;  2QTV A;  4MVQ A;  4BEM J;  1YZC A;  1TKN A;  2OJQ A;  2YWA A;  2W4B A;  4R32 A;  3K66 A;  1YYX A;  1FAP B;  1RKC A;  2KGO A;  2CDQ A;  3ABK C;  1VLT A;  2EPM X;  3AG4 C;  5BQH A;  1CGM E;  4N6H A;  3U8P A;  3R2P A;  3I5Q A;  1OW6 A;  1RKE B;  2H8A A;  1QZX A;  4WGY A;  1JAF A;  4Z9I A;  2R7W A;  1M57 C;  3W2W A;  4YT4 A;  5KYN A;  1O5H A;  1JPN A;  2LFD A;  4IRU A;  4MS2 A;  4JTA B;  2ICW G;  2YQY A;  2Q3T A;  4PJM A;  3VYW A;  1V74 B;  4CJG A;  3U0C A;  1D0X A;  2ETS A;  2Q9C A;  1OQC A;  5KYW A;  2EPL X;  4K1O A;  2MHR A;  3S84 A;  1T6I A;  3RQG A;  4CX9 A;  1OXB A;  3HNI A;  1ZYR F;  4OIP F;  3EJN A;  2XS8 A;  1KTM A;  3K1I A;  4I1M A;  2TMV P;  1WAT A;  3F47 A;  3KMI A;  2ZXP A;  4I44 A;  1LIH A;  1GGQ A;  1T5O A;  2XLD A;  3DWW A;  1RCP A;  2GA0 A;  2PP4 A;  3IHU A;  2J9B A;  4FWV A;  3RYL A;  5F28 E;  4OIQ F;  2HSQ A;  2J46 A;  4JJG A;  3GAN A;  1NU7 D;  3EZH A;  4JZA A;  2WZG A;  5T1D B;  2R7R A;  1RMV A;  4YT5 A;  1ZZP A;  2L6F A;  3Q7L A;  5L0C A;  2Y3H A;  3PMR A;  4DBR A;  3LAY A;  2OG2 A;  3FOO A;  5AC5 A;  1WN0 A;  2XLH A;  1OW8 A;  1ZVZ A;  2KJG A;  4OD4 A;  3TQO A;  1JPJ A;  2L6H A;  2XM4 A;  3DE8 A;  3EHM A;  5FZT A;  4U5F E;  4BJ5 C;  1BBH A;  4MVR A;  3BRJ A;  1D0Y A;  4BJ6 C;  4JJF A;  2EPO A;  4YT2 A;  4IWB A;  2Q9B A;  2F22 A;  2IM8 A;  3GWL A;  5B3S C;  2A0U A;  4JW1 A;  4K7B A;  2J9U A;  4LER A;  4KC9 A;  4RD9 A;  2AWY A;  3NKE A;  2LSE A;  3SZR A;  4ULW A;  1JMW A;  1OCZ C;  5COG A;  2YRF A;  1A7D A;  5CIV A;  3EGD B;  4JE9 A;  3FOP A;  1QPU A;  4JTD B;  5AGF A;  5D92 A;  5JUA A;  5KYX A;  4NC3 A;  2YL3 A;  3U8V A;  4C3B A;  5T3T A;  4U9D A;  1E86 A;  4B6I A;  2W9Y A;  4PFO A;  4L6R A;  1FFH A;  4LDQ A;  1XZQ A;  3DZA A;  2P0N A;  1NG1 A;  4LLC A;  4AL1 A;  1SMY F;  2XS1 A;  3CEX A;  3U2M A;  3HTK C;  3AOU A;  2HUJ A;  3NMI A;  4E0H A;  2R03 A;  1N1C A;  3O6X A;  2LFF A;  1AUE A;  2HS5 A;  1I4Y A;  5A6A A;  4AL0 A;  1JR8 A;  3KPH A;  1QQ3 A;  3G50 A;  3M4B A;  4CIH A;  3EZI A;  5EGY A;  1M2O A;  2HV6 A;  4H4K C;  1APC A;  4BEJ A;  2YHS A;  4PK4 A;  1SYQ A;  2A1D D;  4Z9H A;  4CDA A;  3ECS A;  4DRH B;  3NDB B;  3HKK A;  4XPW A;  1TWA A;  4G78 A;  5KYY A;  1C17 M;  1LE2 A;  3KYI A;  1L3P A;  1NLX A;  1EKY A;  2Q00 A;  2B0J A;  3VF0 A;  1CGO A;  3LS1 A;  3M15 A;  4LDK A;  2OJE D;  1H7I A;  1JRA A;  3KKB A;  3LNM B;  4GEH A;  2X0C A;  4G7H F;  5EK0 A;  1HE9 A;  1UG7 A;  4FES A;  5JSL A;  1ORJ A;  4OIR F;  1Y6D A;  1Q0D A;  4BPM A;  4PR9 A;  1BDJ B;  2P6V A;  1KNY A;  2PNO A;  3QMK A;  4ANJ A;  3IPM O;  1VB5 A;  1Z6A A;  1BR2 A;  3HNJ A;  1D1B A;  1OKK D;  4ER9 A;  4MVM A;  2CNW D;  1K40 A;  1G4U S;  2DB4 A;  3C8G D;  4AK9 A;  4XTK A;  1CPR A;  1NFO A;  3I4U A;  2BL2 A;  4HFF B;  4F4B A;  2PF4 E;  1MQV A;  2EIN C;  2I15 A;  1T6Q A;  3DJU B;  4YL0 A;  1QKR A;  3EH2 A;  3KH2 A;  1YDI A;  4PJN A;  4C7O A;  5HV9 A;  1I5N A;  2Q9A A;  4M63 A;  5DLJ A;  1C02 A;  3LJB A;  2KNH A;  3TUL A;  4P6I C;  4IAQ A;  3U3F A;  2ZXO A;  3DM5 A;  2BC5 A;  4EBJ A;  2KK1 A;  3TOM A;  2MWQ A;  3ABL C;  1Z7Q c;  4LDR A;  2P1A A;  4JCZ A;  3O10 A;  3N24 A;  4JIO A;  3Q6M A;  4DJ9 A;  2NPU A;  3E70 C;  1H9T A;  1F1M A;  4E7Z A;  4BJ6 A;  5L0D A;  4EBB A;  5JRA A;  2YKZ A;  3ZQY A;  1LKX A;  2HKV A;  2J0X A;  4OIO F;  1V54 C;  1ZHZ A;  2AP3 A;  4AE4 A;  5JVE A;  2M4E A;  1OKK A;  1FFT C;  2IXP A;  3LLK A;  4NQF A;  5FCL A;  1PD1 A;  3DD7 A;  2C03 A;  1E83 A;  1ZU4 A;  3PCV A;  3SXM A;  2I8B A;  3K1I C;  3WOD F;  2YL1 A;  2JX0 A;  3MYF A;  1Y4C A;  2Q7R A;  3N0T A;  4MVO A;  4NY3 A;  3B9Q A;  1Z63 A;  2XL8 A;  3B0P A;  5BUO A;  1WWP A;  4DBQ A;  2AVK A;  3A9C A;  3EQL F;  2Y3G A;  3Q7G A;  1TQG A;  4WGZ A;  2NUT B;  1VOM A;  2VCC A;  3W8H A;  3EH1 A;  4OIN F;  3C8Z A;  2OCC C;  2R05 A;  2J0W A;  1LI5 A;  4E18 A;  1MMA A;  3MYI A;  4QI2 A;  2NG1 A;  1O3U A;  3V7O A;  2FGY A;  3LS0 A;  1QVX A;  3K6B A;  2YEV A;  5E2Q A;  2XXA B;  5L0F A;  2NSF A;  2RD9 A;  5A69 A;  1M56 C;  4YJW A;  1ZHT A;  3RIP A;  1NU9 C;  2WVO A;  3IQ6 A;  3SEO A;  3ZTM A;  4CS8 A;  1HW1 A;  3JZ0 A;  4EKW A;  2Q4F A;  2GDC A;  3POV A;  2CYD A;  4IB4 A;  4W8K A;  3CAX A;  1RJ9 B;  4XLN F;  3DAF A;  1YAR O;  3V5X A;  4FX5 A;  1G5Z A;  3FXH A;  1NSG B;  1YZA A;  2VH3 A;  3S90 A;  2EIK C; 
#chains in the Genus database with same CATH homology
 2HUJ A;  2IM8 A;  2HFI A;  2ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...