2IM8A

X-ray crystal structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
b'MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yppE
publication title X-Ray structure of hypothetical protein yPPE. Northeast Structural Genomics Consortium target SR213.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 46
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2im8A00
2IM8A 2ETSA 2HUJA 2HFIA
chains in the Genus database with same CATH superfamily
4KNWA 2MHRA 1OW6A 4E18A 2CGEA 4MVSA 1ZW2A 3DJUB 1YJGA 3ZC4A 4DRHB 1G4US 2XLWA 2YVKA 5T3WA 4C7OA 1NU9C 5GPGB 2J46A 4NTFA 2LD6A 4K1OA 4PACA 4MVMA 1JOGA 2GA0A 4MQ9F 3S27A 4AL0A 3F46A 2YQYA 4GYTA 1ZHTA 4JW1A 4CS9C 3UMHA 3GEHA 1WATA 3LEOA 1GM5A 2G62A 1SYQA 2I15A 4H4KC 1BR2A 4A4AA 5L0DA 2XXAB 4E17A 1APCA 2ZXPA 4N6CA 2YHSA 1JRAA 4MS2A 1YVIA 2J0WA 4U5GA 5D91A 2A0UA 3ZQYA 2R7RA 2XLMA 1Y4CA 1YYJA 1YDIA 2P6VA 3NYJA 4IWBA 4JZAA 1U89A 2HSQA 4JTDB 4U9DA 5TJ5E 3J06A 2EIMC 4EBJA 2Y3HA 2DI3A 1VYKA 3AQBA 3FOOA 1EKYA 2Y3BA 1B68A 4LLEA 4P6IC 3CZ6A 3T6GB 3AQCA 2XM0A 4ER9A 5L0JA 1UFBA 3ZWIA 2NUTA 2A6HF 3NMJA 5B3IA 2LQGA 3VM6A 1YYXA 3ASNC 1FAPB 2HZ8A 4EBKA 3C7JA 2NG1A 4ULWA 1HMDA 4MTOA 4DOZA 4QI2A 3GODA 2XLEA 3HNKA 3AJMA 2CNWD 2YL3A 2OQMA 5L0IA 1QSPA 3L0IA 4KBLA 2QNLA 3EGDB 3HTKC 2JX0A 3I5QA 1SZIA 2I8BA 3DJNB 4JIOA 2NSGA 4XQ1A 1HY5A 4MTGA 2R7VA 1ZYRF 1H9GA 1RKEB 3B71A 3MYFA 1D1CA 4OIRF 3SYNA 2MWQA 1Z23A 1O5HA 2A1DD 3DKAA 4MVUA 1QZXA 2Q4FA 4YL3A 4DVYP 4YJWA 1G8XA 3RVYA 2E87A 1OR2A 3NG1A 3CEXA 5DVWA 3TK0A 1JMWA 3AGTA 1DOWA 1D0XA 3CSKA 4U5DE 2XL6A 4YN0B 3LLIA 4MNDA 2C04A 1KU2A 3ZQVA 3U2MA 5DQTA 4CS8C 3T4RA 1TFOB 3WODF 3BEHA 4BJ5A 2RD9A 1KTMA 2QY9A 2W45A 5DS5A 2ASRA 1TWCA 4XLPF 1I4YA 3MYIA 1D1AA 5JVEA 1Q0DA 2J45A 2WVNA 1WOLA 3DAFA 2Q9AA 1OW8A 5JSLA 3FVYA 2P0NA 4CIHA 3EFOB 2B0JA 2J9BA 4MVZA 4YT2A 4JCHA 2LFFA 3R7CA 3PMRA 4YK5A 1ZVZA 3A11A 4XPXA 5B1BC 3Q6NA 1GQAA 2A69F 5KYYA 4Q5SF 1QQ3A 4O6MA 2O9XA 4IARA 3DD7A 2XS8A 5F5HA 4AL1A 3I4UA 2UUIA 3VYWA 4WGYA 2R9RB 4O6YA 4XLNF 4Q7CA 5COFA 4XTKA 1NG1A 4B6IA 4AE4B 2D4UA 2XXAA 4QI0A 2HV6A 4ZLCA 1SMYF 2C03A 1ZHYA 4WJ0A 5AGFA 4GEHA 2M64A 2Q3TA 2R25A 3E9VA 3L8IA 1HW1A 4JC7A 3RKOF 3LESA 2Y69C 1FNTc 4E0HA 2R02A 3LUTB 3U8PA 2YLIA 1QPUA 1ORJA 4XEVA 1E86A 2R03A 5A6BD 2A68F 1VOMA 1M56C 3AG2C 4MVQA 3JRTA 4A2NB 2VASA 5A6AA 3ZDLA 3ABMC 3FHDA 3EH2A 2IXOA 2OOCA 1D0YA 1OXKA 1E83A 2L7AA 1RJ9B 4LDQA 4KI2A 4N6HA 3AG1C 2R7UA 2P1AA 2YL0A 4QDLA 3T6BA 1IZMA 4CJGA 1PV3A 2KW3C 1GGQA 1T5OA 2Z15A 3KH2A 1E85A 2R7WA 1MMGA 3C18A 3O10A 3H2VA 2TMVP 1H6GA 1AUEA 1C02A 3EGDA 4G7OF 5L3QA 3DMDA 2HJ3A 4YT8A 2W4MA 3C8GD 4BJ5C 1FR0A 3W2VA 3TJ6A 4EIYA 2OCCC 3PCVA 5KYWA 1NBBA 3B9QA 1TR2A 2Q9CA 4R32A 2D5RB 2ICWG 2P61A 3POVA 3IQ5A 3EZHA 2OG2A 4PFPA 1MMAA 3B0PA 4NY3A 5F28E 3U8VA 3RH3A 4PJLA 4NTBA 1GS9A 3GANA 4Z9IA 2HMQA 4JJGA 4ULVA 1MNDA 3GWLA 2VCCA 2B0HA 2DYSC 3QTHA 2KYHA 4RD9A 3DM5A 1YZCA 3GEEA 1T01A 3I5PA 1CGOA 1OKKD 2VC9A 2EPMX 4LDRA 5A6KA 2BL2A 4JEBA 3VF0A 3EFOA 3F47A 4PFOA 1C17M 3TD7A 4Q4ZF 1PD1A 2FFHA 2LFDA 3EGXB 2HSBA 2X0CA 2X51A 3T6JA 3L1MA 5AC4A 3PDMP 1V4AA 3V7OA 2CW0F 1G4WR 2LSEA 3AGUA 4H54A 4K0DA 1LI7A 1T6QA 3RYLA 5HV9A 3OWTA 4FWVA 2PBEA 1BR4A 4U5CE 1OCZC 1T9KA 5JUAA 4OIQF 5L0CA 1NLXA 1D0ZA 1JR8A 1O3UA 3KL4A 3ZSUA 4OIPF 2ETSA 5EK0A 4D4XA 2A6EF 3JCUQ 4JURI 1E2XA 2LIGA 2NSFA 2WZFA 3ZTZA 4RDAA 4G7ZF 4WABA 1LPEA 5E3AA 3SXZA 3IHUA 3ZTMA 2AWCA 2L6GA 3M4CA 3DI5A 4HE8D 1F1MA 4JVSA 1J8MF 1XZPA 4JRZA 4U9EA 3U9JA 4CDAA 4CIPA 4LERA 3C62A 1S05A 1XWJA 4HFFB 1ST6A 3Q6MA 2JPUA 3NRHA 4Z9JA 4BEMJ 4ONSA 1LS4A 1SR2A 1OCRC 4HEAJ 2QUPA 5AC5A 4DXWA 2L81A 3ABLC 4P9FA 1HW2A 3W2WA 4ZLDA 1RJ9A 4N4WA 4PK4A 2WZGA 1LE4A 2HFIA 4PJJA 1RCPA 4L6RA 1PD0A 3JZ0A 1A7VA 3MBGA 4JKVA 4JTAB 4UDVA 3C8GB 1Z5ZA 4W8KA 3RIPA 1OW7A 2KK1A 1ZHZA 2Q00A 3M79A 5DQZA 5E33A 1E84A 3RQGA 2AVKA 1RMVA 4PJMA 3EH1A 1K04A 5JT4A 2H7VC 2PX3A 1CGNA 2GDCA 3LNMB 4I44A 4NCQA 3K1IA 2NUPB 2ZXWC 3JSZA 2WB7A 4CDVA 3K6BA 3ZG1A 5CIVA 3NKDA 2QTVA 5DS4A 3MX3A 3A9CA 2G3KA 2YL1A 4MVOA 4YWQA 2L9JA 2Q9BA 4YT4A 5JLIA 1H7IA 2OEXA 4NQFA 2QLAA 3G4XA 5JRAA 4DBRA 3GEIA 1YA9A 4OD5A 5FCLA 1LM3B 1FMWA 2IXMA 5K0IA 3DM9B 4LACB 1TFKB 3KPHA 4C3BA 3VRCA 3HNJA 3GWNA 2CDQA 2HS5A 3RQEA 3JT1A 3NMIA 1H9TA 2J7PA 5KYUB 2BC5A 4CJOA 3OEOA 3RF3A 3H2UA 3T9OA 1T6UA 3U2LA 2J9VA 3E70C 2OEVA 4EBBA 2G3VA 2J9UA 2AP3A 2XSEA 3LLKA 3N24A 1M57C 3TOMA 4BJ6A 2HKVA 2HMZA 1OQCA 4J7YA 1KNYA 5COGA 4AK9A 4I1OB 3JTLO 1K05A 4MVRA 5L0HA 4MTFA 3RQFA 1NZEA 2W9YA 3AG4C 3MFNA 2EILC 2UUHA 5T1DB 3K7DA 1PCXA 1M2OA 3HJCA 4LLCA 1D1BA 3S29A 5DS6A 3AG3C 1NU7D 1R5ID 4O7GA 2VH3A 4EKWA 3Q7LA 3UGPA 3MLGA 4XPYA 3NYLA 2YKZA 3O39A 2LP4A 1NSGB 2KC3A 2YRFA 1Z6AA 3DAGA 3FAPB 1VB5A 5E2QA 5A6BA 4WGZA 2PX0A 2ZXRA 1WN0A 2L6FA 2CYDA 2Y39A 3UGOA 1O87A 2EIKC 2EPKX 3W8HA 3UR3C 1HE1A 5JS5A 3VAYA 1BR1A 3FXHA 256BA 2NUTB 2EINC 1VLTA 1WGWA 4M63A 3KMIA 5BUOA 1CPQA 5DLJA 1BZ4A 4DRIB 1RKEA 2AU5A 2YEVA 2DB4A 2AWYA 2IXPA 3SZRA 1YAUO 3DE9A 1FTSA 2W4BA 1MQVA 1Z63A 4J32B 1AEPA 1WTYA 1TWAA 2YWAA 4IRUA 2KNHA 3N0TA 5B1AC 1A41A 1S7ZA 3IEEA 1ZHXA 2R7QA 1I4ZA 3QW1A 3US6A 4G7HF 3RVZA 4ANJA 3LAYA 1CGME 3BRJA 1TQGA 4IGGA 3SEOA 2PNOA 2LCHA 4GQHA 1IW7F 4JEAA 3ITFA 4CS7A 3N2ZB 4EUKB 4XWJA 2EPNA 1LKXA 2KGOA 1ZZPA 1K40A 3RW0A 4JCZA 3Q7GA 2WVOA 2KQ9A 2XLHA 1VLSA 3SP1A 4CDYA 2FGYA 2PF4E 2Y3GA 4G0HA 4P9TA 3GM1A 1DOVA 2XLOA 2R7TA 1OKKA 3L34A 3X1OA 3LS1A 3M4BA 4N06A 3SXKA 2XS1A 3FDQA 1A7DA 4JE9A 2H8AA 1NFOA 1XZQA 3RFYA 3NDBB 3UMKA 2EPOA 4U5BE 2F22A 2R7SA 5KYUA 3WAQA 1ZHWA 2M4EA 5JP7A 2ZD9A 4AE4A 4FESA 1V74B 3S0XA 2ZPAA 4C3EA 2H7OA 1M2VB 5KYYB 1QVXA 1EQ1A 4MW3A 5L0GA 4CSAA 1Y6DA 1Z7Qc 3U5SA 3U9MA 1U0BB 4CX9A 1BBHA 2ZXOA 1BDJB 2EIJC 4BEJA 1ZW3A 1OXBA 1R4TA 4BPMA 3R2PA 4DVZA 3U0CA 2V3CC 4BJ1A 4RBNA 1L7CA 2DGJA 4EWCA 1V55C 1OR3A 1LS1A 2HUJA 3S84A 2XRHA 3HNIA 1YA7O 4KNVA 3IQTA 4DJ9A 3DWWA 4AX2A 3CQZA 3WG7C 2R7XA 1CPRA 3DZAA 5CI9A 3GORA 2CNWA 2WL8A 1ZU4A 3V5YA 3ATPA 2GWWA 3WHNA 3AOUA 1Q0MA 4E0IA 1Q0FA 4DRJB 3JSEO 1Q0GA 1NFNA 2XM4A 2XLVA 3G4ZA 4W8PA 2NPUA 3TQOA 5BQIA 3LNRA 4PR9A 3C8ZA 1V54C 2HJMA 1ORYA 1UG7A 2JD3A 2RSEB 4IAOA 2KJGA 2GAQA 1J8YF 4BJTA 1ZU5A 1LIHA 3NYMA 3EZIA 1YARO 3EG9B 5L0FA 2J0XA 1WASA 1HE9A 2OJQA 2VCAA 3JYYA 3SXYA 2PFDA 3QVYA 3B0UX 3LS0A 2YL7A 4XEKA 4C3DA 3K1HA 1Q0KA 3PHF2 1JAFA 3UMIA 4I3MA 5KYWB 1JPJA 4I1MA 5KYXB 3KYJA 2Y3DA 3ZVRA 5HSWA 2VCBA 1G5ZA 3QVZA 3QMKA 5E3CA 4U5EE 1VMAA 2R05A 2IXNA 4JJFA 4EHPA 5BQHA 3CAXA 2WVQA 4NC3A 3SNHA 3JYHA 2GFHA 1M6TA 4O6NA 4FX5A 1FFHA 3W4YA 2QE9A 2A0BA 2XLDA 4KC9A 4IAQA 3EGXA 4YT5A 3KKBA 1JPNA 3TOLA 4C7OB 4CSAC 3KYIA 3OA1A 2LK4A 4OD4A 3V5ZA 5EGYA 2R7OA 4X0RA 1TKNA 3SXMA 3JRMO 1U6HA 2XL4A 2J9WA 4J7TA 3S90A 3ZIBA 3IPMO 3O6XA 4IJJA 2J7PD 2IBFA 3EHNA 4JTCB 1YZAA 4FAPB 1VTMP 3LJBA 1M2VA 2BE5F 1RKCA 2VB6A 1QKRA 2OJED 3ECSA 3U3FA 3M15A 4YL1A 1I5NA 1FFTC 3S9OA 3W8IA 2DYRC 2MYSA 2IOQA 1LVKA 4CS9A 2CCYA 1ORSC 1TWHA 5FZTA 2YLDA 5T3TA 3B29A 3L8JA 5COMA 3S28A 4U5HA 2YLGA 4J30B 3FAJA 3LEVA 3UNGC 4CBEA 3V5XA 1TWGA 5KYNA 2J8WA 4XPWA 3HKKA 4OIOF 3O55A 4Z9HA 1LI5A 2WZLA 5CI8A 4YL0A 2HV7A 1LE2A 1FMVA 3GM3A 3K1IC 3HLZA 5A6JA 3FMSA 4MW8A 4O79A 1YLMA 1W2WA 3GM2A 1VK5A 1SF8A 4E7SA 3IQCA 5B3SC 3HNLA 1RXQA 4OINF 4IB4A 1HMOA 3C8GA 3EJNA 3EQLF 3G50A 3QZCA 4LDKA 1MMDA 4HFKB 3IQ6A 3EHMA 5IY5C 3ASOC 3U3BA 4XEFA 3QW0A 1A0BA 4E7ZA 2H7BA 3NMKA 4BG0A 4G78A 5A69A 5F5FA 3X2QC 1EI7A 2NUPA 3EG9A 1QLEC 1Z3IX 1WWPA 2FAPB 1MNEA 1T6IA 2IYLD 2XL8A 3ABKC 3H65A 3NKEA 2EPLX 4K7BA 2OU6A 2V26A 2YZSA 3DXJF 5BQGA 4DBQA 1OCCC 3C63A 4F4BA 3B0VC 3M1CB 5L3VA 1MMNA 1L3PA 3FOPA 3K33A 2PP4A 4PJNA 2L6HA 1AVOB 2KSFA 2P7VA 5KYXA 3TJ5A 1N1CA 3EPVA 3K66A 2IM8A 4BJ6C 2Q7RA 4D4NA 3TULA 2OKUA 1A7EA 1C03A 1OCOC 5EHHA 1EA8A 1VYIA 4U5FE 5D92A 4NTAA 3DE8A 4CS8A
chains in the Genus database with same CATH topology
2IM8A 2ETSA 2HUJA 2HFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IM8 A;  2ETS A;  2HUJ A;  2HFI A; 
#chains in the Genus database with same CATH topology
 4KNW A;  2MHR A;  1OW6 A;  4E18 A;  2CGE A;  4MVS A;  1ZW2 A;  3DJU B;  1YJG A;  3ZC4 A;  4DRH B;  1G4U S;  2XLW A;  2YVK A;  5T3W A;  4C7O A;  1NU9 C;  5GPG B;  2J46 A;  4NTF A;  2LD6 A;  4K1O A;  4PAC A;  4MVM A;  1JOG A;  2GA0 A;  4MQ9 F;  3S27 A;  4AL0 A;  3F46 A;  2YQY A;  4GYT A;  1ZHT A;  4JW1 A;  4CS9 C;  3UMH A;  3GEH A;  1WAT A;  3LEO A;  1GM5 A;  2G62 A;  1SYQ A;  2I15 A;  4H4K C;  1BR2 A;  4A4A A;  5L0D A;  2XXA B;  4E17 A;  1APC A;  2ZXP A;  4N6C A;  2YHS A;  1JRA A;  4MS2 A;  1YVI A;  2J0W A;  4U5G A;  5D91 A;  2A0U A;  3ZQY A;  2R7R A;  2XLM A;  1Y4C A;  1YYJ A;  1YDI A;  2P6V A;  3NYJ A;  4IWB A;  4JZA A;  1U89 A;  2HSQ A;  4JTD B;  4U9D A;  5TJ5 E;  3J06 A;  2EIM C;  4EBJ A;  2Y3H A;  2DI3 A;  1VYK A;  3AQB A;  3FOO A;  1EKY A;  2Y3B A;  1B68 A;  4LLE A;  4P6I C;  3CZ6 A;  3T6G B;  3AQC A;  2XM0 A;  4ER9 A;  5L0J A;  1UFB A;  3ZWI A;  2NUT A;  2A6H F;  3NMJ A;  5B3I A;  2LQG A;  3VM6 A;  1YYX A;  3ASN C;  1FAP B;  2HZ8 A;  4EBK A;  3C7J A;  2NG1 A;  4ULW A;  1HMD A;  4MTO A;  4DOZ A;  4QI2 A;  3GOD A;  2XLE A;  3HNK A;  3AJM A;  2CNW D;  2YL3 A;  2OQM A;  5L0I A;  1QSP A;  3L0I A;  4KBL A;  2QNL A;  3EGD B;  3HTK C;  2JX0 A;  3I5Q A;  1SZI A;  2I8B A;  3DJN B;  4JIO A;  2NSG A;  4XQ1 A;  1HY5 A;  4MTG A;  2R7V A;  1ZYR F;  1H9G A;  1RKE B;  3B71 A;  3MYF A;  1D1C A;  4OIR F;  3SYN A;  2MWQ A;  1Z23 A;  1O5H A;  2A1D D;  3DKA A;  4MVU A;  1QZX A;  2Q4F A;  4YL3 A;  4DVY P;  4YJW A;  1G8X A;  3RVY A;  2E87 A;  1OR2 A;  3NG1 A;  3CEX A;  5DVW A;  3TK0 A;  1JMW A;  3AGT A;  1DOW A;  1D0X A;  3CSK A;  4U5D E;  2XL6 A;  4YN0 B;  3LLI A;  4MND A;  2C04 A;  1KU2 A;  3ZQV A;  3U2M A;  5DQT A;  4CS8 C;  3T4R A;  1TFO B;  3WOD F;  3BEH A;  4BJ5 A;  2RD9 A;  1KTM A;  2QY9 A;  2W45 A;  5DS5 A;  2ASR A;  1TWC A;  4XLP F;  1I4Y A;  3MYI A;  1D1A A;  5JVE A;  1Q0D A;  2J45 A;  2WVN A;  1WOL A;  3DAF A;  2Q9A A;  1OW8 A;  5JSL A;  3FVY A;  2P0N A;  4CIH A;  3EFO B;  2B0J A;  2J9B A;  4MVZ A;  4YT2 A;  4JCH A;  2LFF A;  3R7C A;  3PMR A;  4YK5 A;  1ZVZ A;  3A11 A;  4XPX A;  5B1B C;  3Q6N A;  1GQA A;  2A69 F;  5KYY A;  4Q5S F;  1QQ3 A;  4O6M A;  2O9X A;  4IAR A;  3DD7 A;  2XS8 A;  5F5H A;  4AL1 A;  3I4U A;  2UUI A;  3VYW A;  4WGY A;  2R9R B;  4O6Y A;  4XLN F;  4Q7C A;  5COF A;  4XTK A;  1NG1 A;  4B6I A;  4AE4 B;  2D4U A;  2XXA A;  4QI0 A;  2HV6 A;  4ZLC A;  1SMY F;  2C03 A;  1ZHY A;  4WJ0 A;  5AGF A;  4GEH A;  2M64 A;  2Q3T A;  2R25 A;  3E9V A;  3L8I A;  1HW1 A;  4JC7 A;  3RKO F;  3LES A;  2Y69 C;  1FNT c;  4E0H A;  2R02 A;  3LUT B;  3U8P A;  2YLI A;  1QPU A;  1ORJ A;  4XEV A;  1E86 A;  2R03 A;  5A6B D;  2A68 F;  1VOM A;  1M56 C;  3AG2 C;  4MVQ A;  3JRT A;  4A2N B;  2VAS A;  5A6A A;  3ZDL A;  3ABM C;  3FHD A;  3EH2 A;  2IXO A;  2OOC A;  1D0Y A;  1OXK A;  1E83 A;  2L7A A;  1RJ9 B;  4LDQ A;  4KI2 A;  4N6H A;  3AG1 C;  2R7U A;  2P1A A;  2YL0 A;  4QDL A;  3T6B A;  1IZM A;  4CJG A;  1PV3 A;  2KW3 C;  1GGQ A;  1T5O A;  2Z15 A;  3KH2 A;  1E85 A;  2R7W A;  1MMG A;  3C18 A;  3O10 A;  3H2V A;  2TMV P;  1H6G A;  1AUE A;  1C02 A;  3EGD A;  4G7O F;  5L3Q A;  3DMD A;  2HJ3 A;  4YT8 A;  2W4M A;  3C8G D;  4BJ5 C;  1FR0 A;  3W2V A;  3TJ6 A;  4EIY A;  2OCC C;  3PCV A;  5KYW A;  1NBB A;  3B9Q A;  1TR2 A;  2Q9C A;  4R32 A;  2D5R B;  2ICW G;  2P61 A;  3POV A;  3IQ5 A;  3EZH A;  2OG2 A;  4PFP A;  1MMA A;  3B0P A;  4NY3 A;  5F28 E;  3U8V A;  3RH3 A;  4PJL A;  4NTB A;  1GS9 A;  3GAN A;  4Z9I A;  2HMQ A;  4JJG A;  4ULV A;  1MND A;  3GWL A;  2VCC A;  2B0H A;  2DYS C;  3QTH A;  2KYH A;  4RD9 A;  3DM5 A;  1YZC A;  3GEE A;  1T01 A;  3I5P A;  1CGO A;  1OKK D;  2VC9 A;  2EPM X;  4LDR A;  5A6K A;  2BL2 A;  4JEB A;  3VF0 A;  3EFO A;  3F47 A;  4PFO A;  1C17 M;  3TD7 A;  4Q4Z F;  1PD1 A;  2FFH A;  2LFD A;  3EGX B;  2HSB A;  2X0C A;  2X51 A;  3T6J A;  3L1M A;  5AC4 A;  3PDM P;  1V4A A;  3V7O A;  2CW0 F;  1G4W R;  2LSE A;  3AGU A;  4H54 A;  4K0D A;  1LI7 A;  1T6Q A;  3RYL A;  5HV9 A;  3OWT A;  4FWV A;  2PBE A;  1BR4 A;  4U5C E;  1OCZ C;  1T9K A;  5JUA A;  4OIQ F;  5L0C A;  1NLX A;  1D0Z A;  1JR8 A;  1O3U A;  3KL4 A;  3ZSU A;  4OIP F;  2ETS A;  5EK0 A;  4D4X A;  2A6E F;  3JCU Q;  4JUR I;  1E2X A;  2LIG A;  2NSF A;  2WZF A;  3ZTZ A;  4RDA A;  4G7Z F;  4WAB A;  1LPE A;  5E3A A;  3SXZ A;  3IHU A;  3ZTM A;  2AWC A;  2L6G A;  3M4C A;  3DI5 A;  4HE8 D;  1F1M A;  4JVS A;  1J8M F;  1XZP A;  4JRZ A;  4U9E A;  3U9J A;  4CDA A;  4CIP A;  4LER A;  3C62 A;  1S05 A;  1XWJ A;  4HFF B;  1ST6 A;  3Q6M A;  2JPU A;  3NRH A;  4Z9J A;  4BEM J;  4ONS A;  1LS4 A;  1SR2 A;  1OCR C;  4HEA J;  2QUP A;  5AC5 A;  4DXW A;  2L81 A;  3ABL C;  4P9F A;  1HW2 A;  3W2W A;  4ZLD A;  1RJ9 A;  4N4W A;  4PK4 A;  2WZG A;  1LE4 A;  2HFI A;  4PJJ A;  1RCP A;  4L6R A;  1PD0 A;  3JZ0 A;  1A7V A;  3MBG A;  4JKV A;  4JTA B;  4UDV A;  3C8G B;  1Z5Z A;  4W8K A;  3RIP A;  1OW7 A;  2KK1 A;  1ZHZ A;  2Q00 A;  3M79 A;  5DQZ A;  5E33 A;  1E84 A;  3RQG A;  2AVK A;  1RMV A;  4PJM A;  3EH1 A;  1K04 A;  5JT4 A;  2H7V C;  2PX3 A;  1CGN A;  2GDC A;  3LNM B;  4I44 A;  4NCQ A;  3K1I A;  2NUP B;  2ZXW C;  3JSZ A;  2WB7 A;  4CDV A;  3K6B A;  3ZG1 A;  5CIV A;  3NKD A;  2QTV A;  5DS4 A;  3MX3 A;  3A9C A;  2G3K A;  2YL1 A;  4MVO A;  4YWQ A;  2L9J A;  2Q9B A;  4YT4 A;  5JLI A;  1H7I A;  2OEX A;  4NQF A;  2QLA A;  3G4X A;  5JRA A;  4DBR A;  3GEI A;  1YA9 A;  4OD5 A;  5FCL A;  1LM3 B;  1FMW A;  2IXM A;  5K0I A;  3DM9 B;  4LAC B;  1TFK B;  3KPH A;  4C3B A;  3VRC A;  3HNJ A;  3GWN A;  2CDQ A;  2HS5 A;  3RQE A;  3JT1 A;  3NMI A;  1H9T A;  2J7P A;  5KYU B;  2BC5 A;  4CJO A;  3OEO A;  3RF3 A;  3H2U A;  3T9O A;  1T6U A;  3U2L A;  2J9V A;  3E70 C;  2OEV A;  4EBB A;  2G3V A;  2J9U A;  2AP3 A;  2XSE A;  3LLK A;  3N24 A;  1M57 C;  3TOM A;  4BJ6 A;  2HKV A;  2HMZ A;  1OQC A;  4J7Y A;  1KNY A;  5COG A;  4AK9 A;  4I1O B;  3JTL O;  1K05 A;  4MVR A;  5L0H A;  4MTF A;  3RQF A;  1NZE A;  2W9Y A;  3AG4 C;  3MFN A;  2EIL C;  2UUH A;  5T1D B;  3K7D A;  1PCX A;  1M2O A;  3HJC A;  4LLC A;  1D1B A;  3S29 A;  5DS6 A;  3AG3 C;  1NU7 D;  1R5I D;  4O7G A;  2VH3 A;  4EKW A;  3Q7L A;  3UGP A;  3MLG A;  4XPY A;  3NYL A;  2YKZ A;  3O39 A;  2LP4 A;  1NSG B;  2KC3 A;  2YRF A;  1Z6A A;  3DAG A;  3FAP B;  1VB5 A;  5E2Q A;  5A6B A;  4WGZ A;  2PX0 A;  2ZXR A;  1WN0 A;  2L6F A;  2CYD A;  2Y39 A;  3UGO A;  1O87 A;  2EIK C;  2EPK X;  3W8H A;  3UR3 C;  1HE1 A;  5JS5 A;  3VAY A;  1BR1 A;  3FXH A;  256B A;  2NUT B;  2EIN C;  1VLT A;  1WGW A;  4M63 A;  3KMI A;  5BUO A;  1CPQ A;  5DLJ A;  1BZ4 A;  4DRI B;  1RKE A;  2AU5 A;  2YEV A;  2DB4 A;  2AWY A;  2IXP A;  3SZR A;  1YAU O;  3DE9 A;  1FTS A;  2W4B A;  1MQV A;  1Z63 A;  4J32 B;  1AEP A;  1WTY A;  1TWA A;  2YWA A;  4IRU A;  2KNH A;  3N0T A;  5B1A C;  1A41 A;  1S7Z A;  3IEE A;  1ZHX A;  2R7Q A;  1I4Z A;  3QW1 A;  3US6 A;  4G7H F;  3RVZ A;  4ANJ A;  3LAY A;  1CGM E;  3BRJ A;  1TQG A;  4IGG A;  3SEO A;  2PNO A;  2LCH A;  4GQH A;  1IW7 F;  4JEA A;  3ITF A;  4CS7 A;  3N2Z B;  4EUK B;  4XWJ A;  2EPN A;  1LKX A;  2KGO A;  1ZZP A;  1K40 A;  3RW0 A;  4JCZ A;  3Q7G A;  2WVO A;  2KQ9 A;  2XLH A;  1VLS A;  3SP1 A;  4CDY A;  2FGY A;  2PF4 E;  2Y3G A;  4G0H A;  4P9T A;  3GM1 A;  1DOV A;  2XLO A;  2R7T A;  1OKK A;  3L34 A;  3X1O A;  3LS1 A;  3M4B A;  4N06 A;  3SXK A;  2XS1 A;  3FDQ A;  1A7D A;  4JE9 A;  2H8A A;  1NFO A;  1XZQ A;  3RFY A;  3NDB B;  3UMK A;  2EPO A;  4U5B E;  2F22 A;  2R7S A;  5KYU A;  3WAQ A;  1ZHW A;  2M4E A;  5JP7 A;  2ZD9 A;  4AE4 A;  4FES A;  1V74 B;  3S0X A;  2ZPA A;  4C3E A;  2H7O A;  1M2V B;  5KYY B;  1QVX A;  1EQ1 A;  4MW3 A;  5L0G A;  4CSA A;  1Y6D A;  1Z7Q c;  3U5S A;  3U9M A;  1U0B B;  4CX9 A;  1BBH A;  2ZXO A;  1BDJ B;  2EIJ C;  4BEJ A;  1ZW3 A;  1OXB A;  1R4T A;  4BPM A;  3R2P A;  4DVZ A;  3U0C A;  2V3C C;  4BJ1 A;  4RBN A;  1L7C A;  2DGJ A;  4EWC A;  1V55 C;  1OR3 A;  1LS1 A;  2HUJ A;  3S84 A;  2XRH A;  3HNI A;  1YA7 O;  4KNV A;  3IQT A;  4DJ9 A;  3DWW A;  4AX2 A;  3CQZ A;  3WG7 C;  2R7X A;  1CPR A;  3DZA A;  5CI9 A;  3GOR A;  2CNW A;  2WL8 A;  1ZU4 A;  3V5Y A;  3ATP A;  2GWW A;  3WHN A;  3AOU A;  1Q0M A;  4E0I A;  1Q0F A;  4DRJ B;  3JSE O;  1Q0G A;  1NFN A;  2XM4 A;  2XLV A;  3G4Z A;  4W8P A;  2NPU A;  3TQO A;  5BQI A;  3LNR A;  4PR9 A;  3C8Z A;  1V54 C;  2HJM A;  1ORY A;  1UG7 A;  2JD3 A;  2RSE B;  4IAO A;  2KJG A;  2GAQ A;  1J8Y F;  4BJT A;  1ZU5 A;  1LIH A;  3NYM A;  3EZI A;  1YAR O;  3EG9 B;  5L0F A;  2J0X A;  1WAS A;  1HE9 A;  2OJQ A;  2VCA A;  3JYY A;  3SXY A;  2PFD A;  3QVY A;  3B0U X;  3LS0 A;  2YL7 A;  4XEK A;  4C3D A;  3K1H A;  1Q0K A;  3PHF 2;  1JAF A;  3UMI A;  4I3M A;  5KYW B;  1JPJ A;  4I1M A;  5KYX B;  3KYJ A;  2Y3D A;  3ZVR A;  5HSW A;  2VCB A;  1G5Z A;  3QVZ A;  3QMK A;  5E3C A;  4U5E E;  1VMA A;  2R05 A;  2IXN A;  4JJF A;  4EHP A;  5BQH A;  3CAX A;  2WVQ A;  4NC3 A;  3SNH A;  3JYH A;  2GFH A;  1M6T A;  4O6N A;  4FX5 A;  1FFH A;  3W4Y A;  2QE9 A;  2A0B A;  2XLD A;  4KC9 A;  4IAQ A;  3EGX A;  4YT5 A;  3KKB A;  1JPN A;  3TOL A;  4C7O B;  4CSA C;  3KYI A;  3OA1 A;  2LK4 A;  4OD4 A;  3V5Z A;  5EGY A;  2R7O A;  4X0R A;  1TKN A;  3SXM A;  3JRM O;  1U6H A;  2XL4 A;  2J9W A;  4J7T A;  3S90 A;  3ZIB A;  3IPM O;  3O6X A;  4IJJ A;  2J7P D;  2IBF A;  3EHN A;  4JTC B;  1YZA A;  4FAP B;  1VTM P;  3LJB A;  1M2V A;  2BE5 F;  1RKC A;  2VB6 A;  1QKR A;  2OJE D;  3ECS A;  3U3F A;  3M15 A;  4YL1 A;  1I5N A;  1FFT C;  3S9O A;  3W8I A;  2DYR C;  2MYS A;  2IOQ A;  1LVK A;  4CS9 A;  2CCY A;  1ORS C;  1TWH A;  5FZT A;  2YLD A;  5T3T A;  3B29 A;  3L8J A;  5COM A;  3S28 A;  4U5H A;  2YLG A;  4J30 B;  3FAJ A;  3LEV A;  3UNG C;  4CBE A;  3V5X A;  1TWG A;  5KYN A;  2J8W A;  4XPW A;  3HKK A;  4OIO F;  3O55 A;  4Z9H A;  1LI5 A;  2WZL A;  5CI8 A;  4YL0 A;  2HV7 A;  1LE2 A;  1FMV A;  3GM3 A;  3K1I C;  3HLZ A;  5A6J A;  3FMS A;  4MW8 A;  4O79 A;  1YLM A;  1W2W A;  3GM2 A;  1VK5 A;  1SF8 A;  4E7S A;  3IQC A;  5B3S C;  3HNL A;  1RXQ A;  4OIN F;  4IB4 A;  1HMO A;  3C8G A;  3EJN A;  3EQL F;  3G50 A;  3QZC A;  4LDK A;  1MMD A;  4HFK B;  3IQ6 A;  3EHM A;  5IY5 C;  3ASO C;  3U3B A;  4XEF A;  3QW0 A;  1A0B A;  4E7Z A;  2H7B A;  3NMK A;  4BG0 A;  4G78 A;  5A69 A;  5F5F A;  3X2Q C;  1EI7 A;  2NUP A;  3EG9 A;  1QLE C;  1Z3I X;  1WWP A;  2FAP B;  1MNE A;  1T6I A;  2IYL D;  2XL8 A;  3ABK C;  3H65 A;  3NKE A;  2EPL X;  4K7B A;  2OU6 A;  2V26 A;  2YZS A;  3DXJ F;  5BQG A;  4DBQ A;  1OCC C;  3C63 A;  4F4B A;  3B0V C;  3M1C B;  5L3V A;  1MMN A;  1L3P A;  3FOP A;  3K33 A;  2PP4 A;  4PJN A;  2L6H A;  1AVO B;  2KSF A;  2P7V A;  5KYX A;  3TJ5 A;  1N1C A;  3EPV A;  3K66 A;  2IM8 A;  4BJ6 C;  2Q7R A;  4D4N A;  3TUL A;  2OKU A;  1A7E A;  1C03 A;  1OCO C;  5EHH A;  1EA8 A;  1VYI A;  4U5F E;  5D92 A;  4NTA A;  3DE8 A;  4CS8 A; 
#chains in the Genus database with same CATH homology
 2IM8 A;  2ETS A;  2HUJ A;  2HFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...