2IM8A

X-ray crystal structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yppE
publication title X-Ray structure of hypothetical protein yPPE. Northeast Structural Genomics Consortium target SR213.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 46
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2im8A00
2HUJA 2HFIA 2ETSA 2IM8A
chains in the Genus database with same CATH superfamily
2F22A 1JR8A 1OCOC 4O7GA 4I3MA 4HE8D 3DKAA 1LE4A 3GEEA 3HNJA 4WABA 2NPUA 2I15A 2WB7A 1GS9A 2QY9A 4E0IA 3B29A 3G50A 4HFKB 1T01A 1VLSA 2DB4A 2EPLX 2X0CA 4U5BE 1ZHTA 2PP4A 4AL0A 4MTOA 3WODF 3EGXA 3ZIBA 4NTBA 1JPJA 5A6JA 1VK5A 2YHSA 3ASNC 3ZQVA 1D0YA 4YL1A 4E0HA 4EBJA 2R7XA 2W4MA 2YEVA 3QVZA 1EI7A 4DVZA 3ZQYA 3VAYA 2Y69C 3Q6NA 3U9MA 2WVNA 3ZC4A 3GM2A 5KYYB 4UDVA 3B0VC 3K1IC 2OU6A 5JLIA 5DQZA 2FFHA 5BUOA 3SYNA 3EGXB 1G4WR 2L6HA 4X0RA 5L0IA 3DAFA 2PFDA 4CX9A 3MYIA 5L0DA 1MMNA 5L0HA 4ULVA 4NTAA 1YA9A 2R25A 1SF8A 2VCAA 3PDMP 3LESA 1V4AA 3RVZA 1EQ1A 4KBLA 3F47A 1HMDA 3RKOF 3LS1A 1HE1A 5BQGA 4E18A 3GORA 3U3FA 5AC4A 3H2UA 1I5NA 3T9OA 5CI9A 4Z9IA 1FFTC 1OCCC 5EHHA 3O39A 1FR0A 1NSGB 4G7ZF 1ZZPA 3DAGA 1T6IA 3CAXA 2A69F 2HJMA 2IBFA 2GDCA 4JW1A 4ONSA 4AE4A 2EPMX 4J30B 5COMA 5L0FA 4M63A 3VF0A 4PJLA 2XLOA 3RYLA 3UNGC 4NC3A 5D91A 4XEVA 3LEOA 2VC9A 3U8PA 3HTKC 4MW8A 4OD4A 1ORYA 1W2WA 2LQGA 3KH2A 1H9TA 3U8VA 4J7TA 4JTAB 2Q7RA 1ZW3A 2H7BA 2I8BA 2IXOA 4EIYA 3GWNA 4JJGA 4IWBA 2KQ9A 3GEIA 4MQ9F 5A69A 1TWAA 3DM9B 4MVRA 4MVMA 4MVQA 2EIKC 4YN0B 1FMWA 4OINF 2H8AA 2EIMC 3ECSA 4I44A 2B0JA 3F46A 4KNWA 2EPOA 2XXAA 4AK9A 1OQCA 2GFHA 4DJ9A 2HS5A 2Z15A 4LLEA 3GANA 4ANJA 1K40A 3T6GB 2J9VA 4AX2A 1CPQA 4BJ6C 3RQFA 2RSEB 2BL2A 4XWJA 5DLJA 1V54C 1KU2A 3NDBB 1A0BA 2L9JA 3JSEO 3C8ZA 3K66A 3CZ6A 1EKYA 3LNRA 2QTVA 2XXAB 2AWYA 4GYTA 1JMWA 4BEMJ 1U6HA 2CW0F 2WVOA 3C7JA 1CPRA 1YAUO 3I5QA 2YRFA 1KNYA 5A6BA 4XLPF 2DYSC 3C8GA 2Y3HA 4JTCB 3G4ZA 1JAFA 2CDQA 2Q3TA 1VB5A 3VYWA 3S90A 3HNIA 3DI5A 3UR3C 1FTSA 3N24A 2NSGA 2YL7A 2MWQA 3M4CA 5F28E 2A6HF 3U9JA 4B6IA 5L0CA 3W4YA 4MNDA 1ST6A 4ZLCA 3K7DA 3DJUB 1OCZC 4JEAA 2R7TA 5EGYA 5KYUA 3EFOA 5JRAA 4G78A 3SNHA 5L0JA 2YLIA 3C8GB 2R7RA 3AG1C 1MQVA 2W9YA 3DXJF 2LFDA 2DI3A 1MNEA 1YLMA 3AGUA 4GEHA 2L6GA 1M2VA 2BC5A 2HUJA 2KW3C 4MS2A 4PFPA 2Q9BA 5JUAA 1QSPA 3S84A 2CNWD 3L34A 2R03A 1Y6DA 1RKEA 4RDAA 4CIPA 5KYUB 1K04A 3ZSUA 2VASA 3W2VA 1ZHZA 3IPMO 3O55A 3H65A 1WATA 3T6BA 2LIGA 4JEBA 4BEJA 3GODA 3EZIA 1M2VB 1T6QA 3R7CA 4JRZA 4XEFA 1YZAA 2QLAA 2KC3A 3NKEA 4A4AA 3FDQA 1YA7O 1RKEB 4JZAA 1Q0FA 2NSFA 2P7VA 3FHDA 2PBEA 1G5ZA 2OJQA 3PHF2 3L0IA 2R9RB 3FXHA 1RMVA 1ZHXA 1TR2A 2XL8A 4XPXA 4DXWA 4QI2A 1WASA 2IXPA 3ABMC 3KMIA 1MMDA 2HV6A 2QUPA 3NYJA 1SZIA 2W45A 3Q7GA 1Z7Qc 4CDAA 4ER9A 4PR9A 1Q0GA 1BDJB 3EGDA 5F5FA 2XS1A 5L0GA 5E33A 1TWCA 4LDRA 4BG0A 3H2VA 5B3IA 2YWAA 1RKCA 2EPKX 2J0XA 1J8YF 4JCZA 4PJNA 4E17A 5KYYA 1E84A 2G3VA 1U89A 2O9XA 4FX5A 4WJ0A 3U0CA 3QW0A 2HMZA 1LKXA 2ASRA 3TK0A 1LI7A 3UMKA 3IEEA 1T9KA 5L3VA 2RD9A 1H9GA 1S7ZA 1IZMA 2HV7A 3EGDB 4IB4A 5BQIA 3M1CB 3V5ZA 4U5DE 2EILC 4FWVA 3MFNA 5TJ5E 2V3CC 4IGGA 3LS0A 5A6AA 3NRHA 2ICWG 4LDQA 4KI2A 2C04A 2A1DD 2J9BA 4JKVA 1YYJA 3CQZA 3X1OA 3K6BA 3LLIA 5E3AA 3WHNA 3U2LA 2YL3A 3IQ5A 1WWPA 3KKBA 1T6UA 1R5ID 5JVEA 1LS1A 1H6GA 4WGYA 1AEPA 1MNDA 3IQCA 3EH2A 1D1CA 1EA8A 1QVXA 5L3QA 4A2NB 2Y3DA 3NYLA 3O6XA 4OIQF 4U5EE 2E87A 2FGYA 3C18A 2OEXA 2TMVP 2OQMA 4OD5A 5B1BC 4EBBA 2D4UA 2OEVA 3C62A 5KYWB 1VOMA 4CSAC 4OIPF 2HSQA 3LEVA 2P1AA 4XEKA 2A6EF 3RH3A 4J7YA 1NLXA 1TKNA 5FCLA 3AG2C 1GM5A 4K0DA 1E83A 3TQOA 4CSAA 3FOOA 4ZLDA 3DE8A 4NY3A 3S9OA 4N6HA 3ZVRA 2HZ8A 4CIHA 4MVSA 4XPWA 4YT5A 5IY5C 4Q5SF 3MX3A 4MVOA 2VB6A 3LNMB 4CJOA 2XM4A 3UMIA 1XZQA 1XZPA 2Q9CA 3AG4C 3HNKA 1OR3A 4NQFA 1BZ4A 2LD6A 1JRAA 2NUPA 3DM5A 1OCRC 1F1MA 2IOQA 1A41A 2C03A 2X51A 3L8IA 2R7OA 1Q0KA 3EG9A 4PK4A 1WOLA 2ETSA 5JP7A 2AVKA 1JOGA 1XWJA 4BPMA 1K05A 2J46A 5DS6A 2KNHA 2CNWA 2WL8A 3GM3A 4C3DA 5K0IA 4EWCA 1L7CA 1LM3B 2XM0A 1C03A 4PFOA 3PCVA 3TJ5A 2NUPB 2XL4A 1R4TA 2P0NA 3HJCA 1I4YA 4IARA 3J06A 3SZRA 1RJ9B 3A11A 1SMYF 3EG9B 4O79A 1NG1A 1AUEA 2HJ3A 3HKKA 1NFNA 3ZTZA 1ZHWA 1GQAA 3Q7LA 1L3PA 1WN0A 3ZWIA 1A7EA 4I1MA 1LE2A 5E2QA 4DVYP 4D4NA 1M57C 1TFOB 1LIHA 1YARO 3AOUA 4I1OB 3RFYA 4DBQA 3L1MA 3QZCA 2ZXWC 2AP3A 2ZXOA 3K1HA 3W8HA 3N2ZB 1A7DA 2LK4A 2XL6A 3X2QC 3QW1A 4YT2A 1O3UA 2HKVA 3AJMA 1M2OA 1D0XA 1C02A 4MW3A 1DOVA 5B1AC 5COFA 5DS5A 2LCHA 1B68A 4K1OA 4LDKA 4PJMA 5EK0A 2IXMA 4XLNF 1NU7D 3T4RA 3RQEA 1O87A 3ITFA 4XQ1A 3EZHA 2PX0A 3E9VA 3G4XA 2J45A 1YDIA 2GAQA 2UUIA 5A6KA 1E85A 3FAPB 4CS7A 1OKKD 3S0XA 4F4BA 2JX0A 1M56C 1PCXA 4FESA 4YT4A 2YZSA 4Z9HA 2AWCA 2KK1A 3FAJA 4DRIB 1TWHA 3QMKA 4YL3A 4O6MA 1QQ3A 1CGME 2YL1A 4GQHA 4N06A 4U5HA 3DMDA 3HLZA 2OG2A 3I5PA 2R7QA 3GM1A 1LPEA 2D5RB 2J8WA 2M4EA 2PNOA 3OEOA 4CS8C 3B0PA 4E7SA 1Z6AA 2J7PD 4H54A 4BJTA 3W8IA 3ATPA 2L7AA 1G4US 1OW8A 2XSEA 3JTLO 1Y4CA 2VCBA 3ABLC 2AU5A 3NYMA 3UGOA 4KNVA 5JSLA 4EHPA 4CS8A 3TULA 2J9WA 3KL4A 2KSFA 3HNLA 2XS8A 2ZD9A 5D92A 1NZEA 2JPUA 1PV3A 2YKZA 4U5CE 1O5HA 2A68F 1UFBA 4JJFA 1CGOA 1TWGA 2W4BA 2XLWA 3BEHA 4N6CA 5E3CA 3MYFA 1PD0A 3TJ6A 2P6VA 3FMSA 5JT4A 4BJ5C 4CBEA 3ZTMA 1KTMA 2HSBA 4IJJA 3OA1A 3NKDA 2YLDA 4JE9A 4O6NA 1LI5A 1PD1A 4JIOA 3GWLA 3WG7C 4AL1A 4U5FE 2WVQA 1Z63A 3WAQA 1VYIA 4D4XA 1APCA 2EIJC 2M64A 2Q9AA 2BE5F 1D1AA 2L81A 1MMGA 3R2PA 4C7OA 1QLEC 4BJ5A 4YJWA 2DYRC 2ZXRA 1ORSC 2V26A 2LFFA 4W8PA 4C7OB 5B3SC 5KYXB 1ZVZA 1YJGA 1ORJA 2LP4A 3DD7A 5FZTA 5KYWA 3VRCA 3CSKA 3ZG1A 2CCYA 3SXMA 4P9TA 4U9EA 1J8MF 1H7IA 1OW6A 3DWWA 3DZAA 3NMIA 3E70C 4Q7CA 4EKWA 1DOWA 3DJNB 5GPGB 2VCCA 3IHUA 1G8XA 1BBHA 1SR2A 3QTHA 4W8KA 5CI8A 4WGZA 4MTFA 1WGWA 3TOLA 5DVWA 1VMAA 1Q0DA 2J9UA 1YVIA 2YLGA 1OW7A 3EJNA 2R7UA 3B0UX 2UUHA 2HFIA 5CIVA 4YK5A 1E2XA 2OKUA 3UGPA 2G62A 2QE9A 2G3KA 3S27A 2VH3A 2OOCA 3POVA 3GEHA 2R02A 1UG7A 2A0UA 2WZGA 3ABKC 3JZ0A 2R7VA 3KYIA 1RCPA 2A0BA 3K1IA 2OJED 4MVZA 1V74B 3VM6A 3ZDLA 4CDVA 2EPNA 3U3BA 1T5OA 4BJ1A 1HW1A 1HE9A 1M6TA 2Y3GA 1D0ZA 1CGNA 2P61A 2YL0A 4L6RA 4DBRA 4YT8A 1OR2A 3JYHA 4EBKA 256BA 1ZHYA 3V7OA 4DOZA 1U0BB 2ZPAA 1Z23A 3ASOC 3EH1A 3FOPA 4LERA 1TQGA 3S29A 5DQTA 4U5GA 1WTYA 2GWWA 3A9CA 2KJGA 1GGQA 2Q4FA 2Y39A 1MMAA 3BRJA 4MVUA 2XLEA 4QDLA 5T1DB 4JVSA 4LLCA 5HSWA 1RJ9A 4U9DA 3RIPA 5F5HA 4DRHB 2R7SA 3JT1A 2FAPB 3EQLF 3SP1A 2CGEA 4KC9A 3M15A 5KYNA 4IAQA 1FMVA 1ZU5A 3AQBA 4G7HF 1OKKA 3LUTB 4AE4B 4JCHA 4P9FA 1S05A 3EHNA 4ULWA 4JC7A 3JSZA 2IXNA 4C3EA 3W2WA 3LLKA 3IQ6A 1C17M 2XLHA 4O6YA 2YVKA 4OIOF 4CDYA 3LJBA 3SEOA 1BR1A 2DGJA 2LSEA 1FAPB 1N1CA 2EINC 2L6FA 2Q00A 1YYXA 3O10A 3TD7A 1VTMP 4PACA 2NG1A 1ZW2A 3N0TA 1IW7F 4YWQA 3PMRA 5BQHA 5KYXA 1RXQA 2XLVA 4Q4ZF 2QNLA 1BR4A 2J7PA 2R05A 1FFHA 5COGA 5HV9A 4YL0A 4RBNA 4G7OF 2WZFA 3B9QA 1ZU4A 2IM8A 3I4UA 3Q6MA 4RD9A 5JS5A 2B0HA 3LAYA 1OXKA 2CYDA 1D1BA 1HMOA 1YZCA 3JRTA 3MLGA 3RQGA 4NCQA 2MYSA 4XTKA 4G0HA 3US6A 4BJ6A 4CS9C 3JCUQ 3K33A 3U2MA 3SXKA 2IYLD 4K7BA 1SYQA 2YQYA 3RW0A 3EHMA 2ZXPA 4NTFA 2PF4E 2WZLA 4IRUA 5DS4A 1Q0MA 3NG1A 4CS9A 2XRHA 3V5XA 3SXZA 4P6IC 4JURI 3JRMO 1VLTA 1V55C 3FVYA 3C63A 2NUTA 1AVOB 3NMKA 2PX3A 2Y3BA 4FAPB 1VYKA 5T3WA 1QKRA 4E7ZA 2KGOA 3AG3C 3SXYA 4JTDB 4MTGA 4OIRF 3EPVA 1LVKA 4C3BA 3KYJA 3KPHA 1HY5A 3T6JA 4EUKB 1HW2A 4IAOA 4HFFB 3RF3A 1NU9C 1I4ZA 2J0WA 3CEXA 3TOMA 1TFKB 4H4KC 4CJGA 1QPUA 3QVYA 2H7OA 4R32A 3V5YA 5AGFA 2NUTB 2KYHA 2GA0A 4DRJB 3EFOB 1NFOA 2XLMA 5T3TA 2XLDA 3DE9A 3U5SA 1A7VA 4QI0A 4HEAJ 3IQTA 2HMQA 3OWTA 4Z9JA 4PJJA 1E86A 3M4BA 3MBGA 3NMJA 1JPNA 4XPYA 1Z3IX 2JD3A 3AQCA 5AC5A 5A6BD 1BR2A 2MHRA 3M79A 3C8GD 2H7VC 3JYYA 3L8JA 3RVYA 1FNTc 1LS4A 3S28A 2R7WA 3UMHA 1NBBA 3AGTA 4LACB 4N4WA 2OCCC 1ZYRF 3B71A 4J32B 1Z5ZA 1QZXA 1OXBA
chains in the Genus database with same CATH topology
2HUJA 2HFIA 2ETSA 2IM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUJ A;  2HFI A;  2ETS A;  2IM8 A; 
#chains in the Genus database with same CATH topology
 2F22 A;  1JR8 A;  1OCO C;  4O7G A;  4I3M A;  4HE8 D;  3DKA A;  1LE4 A;  3GEE A;  3HNJ A;  4WAB A;  2NPU A;  2I15 A;  2WB7 A;  1GS9 A;  2QY9 A;  4E0I A;  3B29 A;  3G50 A;  4HFK B;  1T01 A;  1VLS A;  2DB4 A;  2EPL X;  2X0C A;  4U5B E;  1ZHT A;  2PP4 A;  4AL0 A;  4MTO A;  3WOD F;  3EGX A;  3ZIB A;  4NTB A;  1JPJ A;  5A6J A;  1VK5 A;  2YHS A;  3ASN C;  3ZQV A;  1D0Y A;  4YL1 A;  4E0H A;  4EBJ A;  2R7X A;  2W4M A;  2YEV A;  3QVZ A;  1EI7 A;  4DVZ A;  3ZQY A;  3VAY A;  2Y69 C;  3Q6N A;  3U9M A;  2WVN A;  3ZC4 A;  3GM2 A;  5KYY B;  4UDV A;  3B0V C;  3K1I C;  2OU6 A;  5JLI A;  5DQZ A;  2FFH A;  5BUO A;  3SYN A;  3EGX B;  1G4W R;  2L6H A;  4X0R A;  5L0I A;  3DAF A;  2PFD A;  4CX9 A;  3MYI A;  5L0D A;  1MMN A;  5L0H A;  4ULV A;  4NTA A;  1YA9 A;  2R25 A;  1SF8 A;  2VCA A;  3PDM P;  3LES A;  1V4A A;  3RVZ A;  1EQ1 A;  4KBL A;  3F47 A;  1HMD A;  3RKO F;  3LS1 A;  1HE1 A;  5BQG A;  4E18 A;  3GOR A;  3U3F A;  5AC4 A;  3H2U A;  1I5N A;  3T9O A;  5CI9 A;  4Z9I A;  1FFT C;  1OCC C;  5EHH A;  3O39 A;  1FR0 A;  1NSG B;  4G7Z F;  1ZZP A;  3DAG A;  1T6I A;  3CAX A;  2A69 F;  2HJM A;  2IBF A;  2GDC A;  4JW1 A;  4ONS A;  4AE4 A;  2EPM X;  4J30 B;  5COM A;  5L0F A;  4M63 A;  3VF0 A;  4PJL A;  2XLO A;  3RYL A;  3UNG C;  4NC3 A;  5D91 A;  4XEV A;  3LEO A;  2VC9 A;  3U8P A;  3HTK C;  4MW8 A;  4OD4 A;  1ORY A;  1W2W A;  2LQG A;  3KH2 A;  1H9T A;  3U8V A;  4J7T A;  4JTA B;  2Q7R A;  1ZW3 A;  2H7B A;  2I8B A;  2IXO A;  4EIY A;  3GWN A;  4JJG A;  4IWB A;  2KQ9 A;  3GEI A;  4MQ9 F;  5A69 A;  1TWA A;  3DM9 B;  4MVR A;  4MVM A;  4MVQ A;  2EIK C;  4YN0 B;  1FMW A;  4OIN F;  2H8A A;  2EIM C;  3ECS A;  4I44 A;  2B0J A;  3F46 A;  4KNW A;  2EPO A;  2XXA A;  4AK9 A;  1OQC A;  2GFH A;  4DJ9 A;  2HS5 A;  2Z15 A;  4LLE A;  3GAN A;  4ANJ A;  1K40 A;  3T6G B;  2J9V A;  4AX2 A;  1CPQ A;  4BJ6 C;  3RQF A;  2RSE B;  2BL2 A;  4XWJ A;  5DLJ A;  1V54 C;  1KU2 A;  3NDB B;  1A0B A;  2L9J A;  3JSE O;  3C8Z A;  3K66 A;  3CZ6 A;  1EKY A;  3LNR A;  2QTV A;  2XXA B;  2AWY A;  4GYT A;  1JMW A;  4BEM J;  1U6H A;  2CW0 F;  2WVO A;  3C7J A;  1CPR A;  1YAU O;  3I5Q A;  2YRF A;  1KNY A;  5A6B A;  4XLP F;  2DYS C;  3C8G A;  2Y3H A;  4JTC B;  3G4Z A;  1JAF A;  2CDQ A;  2Q3T A;  1VB5 A;  3VYW A;  3S90 A;  3HNI A;  3DI5 A;  3UR3 C;  1FTS A;  3N24 A;  2NSG A;  2YL7 A;  2MWQ A;  3M4C A;  5F28 E;  2A6H F;  3U9J A;  4B6I A;  5L0C A;  3W4Y A;  4MND A;  1ST6 A;  4ZLC A;  3K7D A;  3DJU B;  1OCZ C;  4JEA A;  2R7T A;  5EGY A;  5KYU A;  3EFO A;  5JRA A;  4G78 A;  3SNH A;  5L0J A;  2YLI A;  3C8G B;  2R7R A;  3AG1 C;  1MQV A;  2W9Y A;  3DXJ F;  2LFD A;  2DI3 A;  1MNE A;  1YLM A;  3AGU A;  4GEH A;  2L6G A;  1M2V A;  2BC5 A;  2HUJ A;  2KW3 C;  4MS2 A;  4PFP A;  2Q9B A;  5JUA A;  1QSP A;  3S84 A;  2CNW D;  3L34 A;  2R03 A;  1Y6D A;  1RKE A;  4RDA A;  4CIP A;  5KYU B;  1K04 A;  3ZSU A;  2VAS A;  3W2V A;  1ZHZ A;  3IPM O;  3O55 A;  3H65 A;  1WAT A;  3T6B A;  2LIG A;  4JEB A;  4BEJ A;  3GOD A;  3EZI A;  1M2V B;  1T6Q A;  3R7C A;  4JRZ A;  4XEF A;  1YZA A;  2QLA A;  2KC3 A;  3NKE A;  4A4A A;  3FDQ A;  1YA7 O;  1RKE B;  4JZA A;  1Q0F A;  2NSF A;  2P7V A;  3FHD A;  2PBE A;  1G5Z A;  2OJQ A;  3PHF 2;  3L0I A;  2R9R B;  3FXH A;  1RMV A;  1ZHX A;  1TR2 A;  2XL8 A;  4XPX A;  4DXW A;  4QI2 A;  1WAS A;  2IXP A;  3ABM C;  3KMI A;  1MMD A;  2HV6 A;  2QUP A;  3NYJ A;  1SZI A;  2W45 A;  3Q7G A;  1Z7Q c;  4CDA A;  4ER9 A;  4PR9 A;  1Q0G A;  1BDJ B;  3EGD A;  5F5F A;  2XS1 A;  5L0G A;  5E33 A;  1TWC A;  4LDR A;  4BG0 A;  3H2V A;  5B3I A;  2YWA A;  1RKC A;  2EPK X;  2J0X A;  1J8Y F;  4JCZ A;  4PJN A;  4E17 A;  5KYY A;  1E84 A;  2G3V A;  1U89 A;  2O9X A;  4FX5 A;  4WJ0 A;  3U0C A;  3QW0 A;  2HMZ A;  1LKX A;  2ASR A;  3TK0 A;  1LI7 A;  3UMK A;  3IEE A;  1T9K A;  5L3V A;  2RD9 A;  1H9G A;  1S7Z A;  1IZM A;  2HV7 A;  3EGD B;  4IB4 A;  5BQI A;  3M1C B;  3V5Z A;  4U5D E;  2EIL C;  4FWV A;  3MFN A;  5TJ5 E;  2V3C C;  4IGG A;  3LS0 A;  5A6A A;  3NRH A;  2ICW G;  4LDQ A;  4KI2 A;  2C04 A;  2A1D D;  2J9B A;  4JKV A;  1YYJ A;  3CQZ A;  3X1O A;  3K6B A;  3LLI A;  5E3A A;  3WHN A;  3U2L A;  2YL3 A;  3IQ5 A;  1WWP A;  3KKB A;  1T6U A;  1R5I D;  5JVE A;  1LS1 A;  1H6G A;  4WGY A;  1AEP A;  1MND A;  3IQC A;  3EH2 A;  1D1C A;  1EA8 A;  1QVX A;  5L3Q A;  4A2N B;  2Y3D A;  3NYL A;  3O6X A;  4OIQ F;  4U5E E;  2E87 A;  2FGY A;  3C18 A;  2OEX A;  2TMV P;  2OQM A;  4OD5 A;  5B1B C;  4EBB A;  2D4U A;  2OEV A;  3C62 A;  5KYW B;  1VOM A;  4CSA C;  4OIP F;  2HSQ A;  3LEV A;  2P1A A;  4XEK A;  2A6E F;  3RH3 A;  4J7Y A;  1NLX A;  1TKN A;  5FCL A;  3AG2 C;  1GM5 A;  4K0D A;  1E83 A;  3TQO A;  4CSA A;  3FOO A;  4ZLD A;  3DE8 A;  4NY3 A;  3S9O A;  4N6H A;  3ZVR A;  2HZ8 A;  4CIH A;  4MVS A;  4XPW A;  4YT5 A;  5IY5 C;  4Q5S F;  3MX3 A;  4MVO A;  2VB6 A;  3LNM B;  4CJO A;  2XM4 A;  3UMI A;  1XZQ A;  1XZP A;  2Q9C A;  3AG4 C;  3HNK A;  1OR3 A;  4NQF A;  1BZ4 A;  2LD6 A;  1JRA A;  2NUP A;  3DM5 A;  1OCR C;  1F1M A;  2IOQ A;  1A41 A;  2C03 A;  2X51 A;  3L8I A;  2R7O A;  1Q0K A;  3EG9 A;  4PK4 A;  1WOL A;  2ETS A;  5JP7 A;  2AVK A;  1JOG A;  1XWJ A;  4BPM A;  1K05 A;  2J46 A;  5DS6 A;  2KNH A;  2CNW A;  2WL8 A;  3GM3 A;  4C3D A;  5K0I A;  4EWC A;  1L7C A;  1LM3 B;  2XM0 A;  1C03 A;  4PFO A;  3PCV A;  3TJ5 A;  2NUP B;  2XL4 A;  1R4T A;  2P0N A;  3HJC A;  1I4Y A;  4IAR A;  3J06 A;  3SZR A;  1RJ9 B;  3A11 A;  1SMY F;  3EG9 B;  4O79 A;  1NG1 A;  1AUE A;  2HJ3 A;  3HKK A;  1NFN A;  3ZTZ A;  1ZHW A;  1GQA A;  3Q7L A;  1L3P A;  1WN0 A;  3ZWI A;  1A7E A;  4I1M A;  1LE2 A;  5E2Q A;  4DVY P;  4D4N A;  1M57 C;  1TFO B;  1LIH A;  1YAR O;  3AOU A;  4I1O B;  3RFY A;  4DBQ A;  3L1M A;  3QZC A;  2ZXW C;  2AP3 A;  2ZXO A;  3K1H A;  3W8H A;  3N2Z B;  1A7D A;  2LK4 A;  2XL6 A;  3X2Q C;  3QW1 A;  4YT2 A;  1O3U A;  2HKV A;  3AJM A;  1M2O A;  1D0X A;  1C02 A;  4MW3 A;  1DOV A;  5B1A C;  5COF A;  5DS5 A;  2LCH A;  1B68 A;  4K1O A;  4LDK A;  4PJM A;  5EK0 A;  2IXM A;  4XLN F;  1NU7 D;  3T4R A;  3RQE A;  1O87 A;  3ITF A;  4XQ1 A;  3EZH A;  2PX0 A;  3E9V A;  3G4X A;  2J45 A;  1YDI A;  2GAQ A;  2UUI A;  5A6K A;  1E85 A;  3FAP B;  4CS7 A;  1OKK D;  3S0X A;  4F4B A;  2JX0 A;  1M56 C;  1PCX A;  4FES A;  4YT4 A;  2YZS A;  4Z9H A;  2AWC A;  2KK1 A;  3FAJ A;  4DRI B;  1TWH A;  3QMK A;  4YL3 A;  4O6M A;  1QQ3 A;  1CGM E;  2YL1 A;  4GQH A;  4N06 A;  4U5H A;  3DMD A;  3HLZ A;  2OG2 A;  3I5P A;  2R7Q A;  3GM1 A;  1LPE A;  2D5R B;  2J8W A;  2M4E A;  2PNO A;  3OEO A;  4CS8 C;  3B0P A;  4E7S A;  1Z6A A;  2J7P D;  4H54 A;  4BJT A;  3W8I A;  3ATP A;  2L7A A;  1G4U S;  1OW8 A;  2XSE A;  3JTL O;  1Y4C A;  2VCB A;  3ABL C;  2AU5 A;  3NYM A;  3UGO A;  4KNV A;  5JSL A;  4EHP A;  4CS8 A;  3TUL A;  2J9W A;  3KL4 A;  2KSF A;  3HNL A;  2XS8 A;  2ZD9 A;  5D92 A;  1NZE A;  2JPU A;  1PV3 A;  2YKZ A;  4U5C E;  1O5H A;  2A68 F;  1UFB A;  4JJF A;  1CGO A;  1TWG A;  2W4B A;  2XLW A;  3BEH A;  4N6C A;  5E3C A;  3MYF A;  1PD0 A;  3TJ6 A;  2P6V A;  3FMS A;  5JT4 A;  4BJ5 C;  4CBE A;  3ZTM A;  1KTM A;  2HSB A;  4IJJ A;  3OA1 A;  3NKD A;  2YLD A;  4JE9 A;  4O6N A;  1LI5 A;  1PD1 A;  4JIO A;  3GWL A;  3WG7 C;  4AL1 A;  4U5F E;  2WVQ A;  1Z63 A;  3WAQ A;  1VYI A;  4D4X A;  1APC A;  2EIJ C;  2M64 A;  2Q9A A;  2BE5 F;  1D1A A;  2L81 A;  1MMG A;  3R2P A;  4C7O A;  1QLE C;  4BJ5 A;  4YJW A;  2DYR C;  2ZXR A;  1ORS C;  2V26 A;  2LFF A;  4W8P A;  4C7O B;  5B3S C;  5KYX B;  1ZVZ A;  1YJG A;  1ORJ A;  2LP4 A;  3DD7 A;  5FZT A;  5KYW A;  3VRC A;  3CSK A;  3ZG1 A;  2CCY A;  3SXM A;  4P9T A;  4U9E A;  1J8M F;  1H7I A;  1OW6 A;  3DWW A;  3DZA A;  3NMI A;  3E70 C;  4Q7C A;  4EKW A;  1DOW A;  3DJN B;  5GPG B;  2VCC A;  3IHU A;  1G8X A;  1BBH A;  1SR2 A;  3QTH A;  4W8K A;  5CI8 A;  4WGZ A;  4MTF A;  1WGW A;  3TOL A;  5DVW A;  1VMA A;  1Q0D A;  2J9U A;  1YVI A;  2YLG A;  1OW7 A;  3EJN A;  2R7U A;  3B0U X;  2UUH A;  2HFI A;  5CIV A;  4YK5 A;  1E2X A;  2OKU A;  3UGP A;  2G62 A;  2QE9 A;  2G3K A;  3S27 A;  2VH3 A;  2OOC A;  3POV A;  3GEH A;  2R02 A;  1UG7 A;  2A0U A;  2WZG A;  3ABK C;  3JZ0 A;  2R7V A;  3KYI A;  1RCP A;  2A0B A;  3K1I A;  2OJE D;  4MVZ A;  1V74 B;  3VM6 A;  3ZDL A;  4CDV A;  2EPN A;  3U3B A;  1T5O A;  4BJ1 A;  1HW1 A;  1HE9 A;  1M6T A;  2Y3G A;  1D0Z A;  1CGN A;  2P61 A;  2YL0 A;  4L6R A;  4DBR A;  4YT8 A;  1OR2 A;  3JYH A;  4EBK A;  256B A;  1ZHY A;  3V7O A;  4DOZ A;  1U0B B;  2ZPA A;  1Z23 A;  3ASO C;  3EH1 A;  3FOP A;  4LER A;  1TQG A;  3S29 A;  5DQT A;  4U5G A;  1WTY A;  2GWW A;  3A9C A;  2KJG A;  1GGQ A;  2Q4F A;  2Y39 A;  1MMA A;  3BRJ A;  4MVU A;  2XLE A;  4QDL A;  5T1D B;  4JVS A;  4LLC A;  5HSW A;  1RJ9 A;  4U9D A;  3RIP A;  5F5H A;  4DRH B;  2R7S A;  3JT1 A;  2FAP B;  3EQL F;  3SP1 A;  2CGE A;  4KC9 A;  3M15 A;  5KYN A;  4IAQ A;  1FMV A;  1ZU5 A;  3AQB A;  4G7H F;  1OKK A;  3LUT B;  4AE4 B;  4JCH A;  4P9F A;  1S05 A;  3EHN A;  4ULW A;  4JC7 A;  3JSZ A;  2IXN A;  4C3E A;  3W2W A;  3LLK A;  3IQ6 A;  1C17 M;  2XLH A;  4O6Y A;  2YVK A;  4OIO F;  4CDY A;  3LJB A;  3SEO A;  1BR1 A;  2DGJ A;  2LSE A;  1FAP B;  1N1C A;  2EIN C;  2L6F A;  2Q00 A;  1YYX A;  3O10 A;  3TD7 A;  1VTM P;  4PAC A;  2NG1 A;  1ZW2 A;  3N0T A;  1IW7 F;  4YWQ A;  3PMR A;  5BQH A;  5KYX A;  1RXQ A;  2XLV A;  4Q4Z F;  2QNL A;  1BR4 A;  2J7P A;  2R05 A;  1FFH A;  5COG A;  5HV9 A;  4YL0 A;  4RBN A;  4G7O F;  2WZF A;  3B9Q A;  1ZU4 A;  2IM8 A;  3I4U A;  3Q6M A;  4RD9 A;  5JS5 A;  2B0H A;  3LAY A;  1OXK A;  2CYD A;  1D1B A;  1HMO A;  1YZC A;  3JRT A;  3MLG A;  3RQG A;  4NCQ A;  2MYS A;  4XTK A;  4G0H A;  3US6 A;  4BJ6 A;  4CS9 C;  3JCU Q;  3K33 A;  3U2M A;  3SXK A;  2IYL D;  4K7B A;  1SYQ A;  2YQY A;  3RW0 A;  3EHM A;  2ZXP A;  4NTF A;  2PF4 E;  2WZL A;  4IRU A;  5DS4 A;  1Q0M A;  3NG1 A;  4CS9 A;  2XRH A;  3V5X A;  3SXZ A;  4P6I C;  4JUR I;  3JRM O;  1VLT A;  1V55 C;  3FVY A;  3C63 A;  2NUT A;  1AVO B;  3NMK A;  2PX3 A;  2Y3B A;  4FAP B;  1VYK A;  5T3W A;  1QKR A;  4E7Z A;  2KGO A;  3AG3 C;  3SXY A;  4JTD B;  4MTG A;  4OIR F;  3EPV A;  1LVK A;  4C3B A;  3KYJ A;  3KPH A;  1HY5 A;  3T6J A;  4EUK B;  1HW2 A;  4IAO A;  4HFF B;  3RF3 A;  1NU9 C;  1I4Z A;  2J0W A;  3CEX A;  3TOM A;  1TFK B;  4H4K C;  4CJG A;  1QPU A;  3QVY A;  2H7O A;  4R32 A;  3V5Y A;  5AGF A;  2NUT B;  2KYH A;  2GA0 A;  4DRJ B;  3EFO B;  1NFO A;  2XLM A;  5T3T A;  2XLD A;  3DE9 A;  3U5S A;  1A7V A;  4QI0 A;  4HEA J;  3IQT A;  2HMQ A;  3OWT A;  4Z9J A;  4PJJ A;  1E86 A;  3M4B A;  3MBG A;  3NMJ A;  1JPN A;  4XPY A;  1Z3I X;  2JD3 A;  3AQC A;  5AC5 A;  5A6B D;  1BR2 A;  2MHR A;  3M79 A;  3C8G D;  2H7V C;  3JYY A;  3L8J A;  3RVY A;  1FNT c;  1LS4 A;  3S28 A;  2R7W A;  3UMH A;  1NBB A;  3AGT A;  4LAC B;  4N4W A;  2OCC C;  1ZYR F;  3B71 A;  4J32 B;  1Z5Z A;  1QZX A;  1OXB A; 
#chains in the Genus database with same CATH homology
 2HUJ A;  2HFI A;  2ETS A;  2IM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...