2IM8A

X-ray crystal structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yppE
publication title X-Ray structure of hypothetical protein yPPE. Northeast Structural Genomics Consortium target SR213.
rcsb
source organism Bacillus subtilis
total genus 46
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2im8A00
2IM8A 2HFIA 2HUJA 2ETSA
chains in the Genus database with same CATH superfamily
2LSEA 2YLGA 3ASNC 4OD4A 3LUTB 3AJMA 1A0BA 2YL1A 1DOWA 3Q6NA 3HJCA 2R9RB 3Q7LA 2IXNA 1LS4A 2EPLX 3WG7C 2AWCA 1ZHXA 2HV7A 2R03A 3FOPA 4GQHA 4JTAB 3H2UA 1MMDA 4XLPF 1YYXA 2XL6A 3IHUA 1LM3B 1AEPA 3TQOA 1LPEA 3GORA 2EIMC 3T6GB 3W8HA 3EG9A 3VRCA 3IPMO 4DRJB 5EK0A 4MVQA 1JMWA 3ABKC 3EPVA 3HNIA 2KNHA 3LESA 4C3DA 4E0HA 1HE1A 2QTVA 4LDQA 1D0ZA 1WTYA 3BRJA 4JE9A 1Y6DA 2H7OA 5K0IA 2R02A 2UUHA 1NBBA 4CSAC 4CIHA 4XWJA 4JCZA 2EPKX 3R2PA 3EZHA 3H2VA 1XWJA 3FAPB 2DI3A 1JPJA 2OCCC 3AQBA 3FHDA 1UG7A 2J9UA 2KGOA 4G78A 3S90A 3ABMC 2I8BA 1OCZC 2LCHA 2YEVA 3SXZA 5JRAA 4H4KC 5JS5A 1YJGA 3F46A 2V3CC 1ZVZA 1GGQA 2EIJC 2L81A 1QLEC 2XLWA 2YLDA 3S27A 3NRHA 3V7OA 5A6BD 1ZU4A 2BL2A 3C7JA 4JCHA 1T01A 4YJWA 1MNEA 2KSFA 1RKEB 1M2VA 4XEFA 1H9TA 2EPOA 3EGDB 4JKVA 4MQ9F 2R7RA 3TULA 3JSEO 3AG1C 3DWWA 4YL1A 3ZG1A 3PHF2 4N4WA 1EA8A 3DJNB 4HFFB 1D0XA 3JRMO 2P61A 3K33A 4NCQA 4D4XA 4G7HF 5CIVA 4DOZA 2G3VA 2EPNA 1TQGA 3CAXA 2NUTA 3WAQA 1PV3A 5EHHA 1T6UA 1VYKA 2A0UA 3U5SA 2IBFA 3ZWIA 2OEVA 3U0CA 1MMAA 1C03A 1HE9A 1T9KA 2HJ3A 4Q4ZF 1AVOB 1FMWA 3MFNA 3L0IA 3NYLA 4AK9A 3EFOB 3NKEA 4JJFA 1E85A 4J32B 3EG9B 4G0HA 3U2LA 3ITFA 3DJUB 3IEEA 4U5CE 3ZSUA 3MLGA 4CS8A 2IXPA 5D92A 4N6HA 1YZCA 1HMDA 1NU7D 4H54A 5DVWA 4CJOA 3V5YA 2XL8A 4CIPA 3FDQA 5F5FA 4JTCB 3HNJA 4CS7A 2H7BA 3LNRA 1D1AA 4BG0A 3PMRA 4PJJA 2P7VA 1LS1A 2Q9CA 1PCXA 2CDQA 4L6RA 3W8IA 4F4BA 1NZEA 3FAJA 3KH2A 3SXKA 4IGGA 1T6IA 1TKNA 3OWTA 1Z3IX 1KU2A 4MS2A 4YT5A 1VLTA 2TMVP 4FWVA 5JP7A 1NFNA 2GFHA 5JT4A 1SZIA 1ZHTA 2IOQA 3CZ6A 2ZD9A 1BR2A 2XSEA 4YN0B 3EH2A 2PNOA 1NSGB 2R7UA 2PFDA 2HMQA 1WATA 2W4MA 3QW1A 3TJ6A 4YT8A 2R7QA 2J0WA 2IYLD 3U2MA 3AG4C 1ZHWA 4DJ9A 1S7ZA 2B0HA 1LVKA 1HY5A 4C3EA 3ZQYA 4E7ZA 5L0IA 2Y39A 3SZRA 5HV9A 5JVEA 5AC5A 4CS9C 1WN0A 2HKVA 3KYJA 4JW1A 3DMDA 4ANJA 4CSAA 1EI7A 4NQFA 3PDMP 1I4YA 5T1DB 5L0FA 3EQLF 2R7TA 4KNWA 3SP1A 5F28E 3EHMA 4N6CA 1VOMA 1YA7O 1FMVA 3L8IA 2ZXOA 3K1IC 2W45A 3C8GD 3EGXA 4RDAA 1A7DA 5L0DA 4NTBA 1Q0FA 3ZIBA 1M2OA 3CEXA 3AQCA 4GYTA 2UUIA 1RKCA 2WZLA 4EHPA 1BDJB 3RW0A 4U5GA 2XLMA 5KYUB 5T3WA 2F22A 2WL8A 1OCRC 2LIGA 3LEOA 4JZAA 5COGA 2CYDA 4K1OA 5F5HA 2FFHA 2A6HF 1FAPB 3VM6A 1CGNA 1K40A 1MMGA 1RKEA 3EGDA 2J7PA 2YWAA 5EGYA 4BEMJ 1T5OA 1YDIA 2LFFA 3VAYA 3ZVRA 5BQHA 2HMZA 2R7VA 1BR4A 1V54C 1FFTC 2JPUA 2VB6A 4P6IC 4AL0A 2EINC 5E2QA 2MHRA 2CNWD 1L3PA 1K04A 4E7SA 4ULWA 3RQFA 2A1DD 3MX3A 4CDVA 1CGME 3NDBB 3T6JA 1OR3A 3R7CA 3IQ6A 4NY3A 2ZXWC 2H8AA 2Q9BA 2XLEA 3G4XA 3UR3C 3EH1A 4JIOA 1G4US 1GM5A 1IW7F 2YKZA 1LKXA 3EFOA 3FOOA 4NC3A 3MYFA 1M6TA 3G4ZA 3SXMA 3RFYA 3LEVA 3UNGC 5B3IA 1E84A 4U5HA 5COFA 3WODF 1ZU5A 2GAQA 3FXHA 3EGXB 4O6MA 4IAOA 1ZW2A 4J30B 1YA9A 3N2ZB 2YL0A 4O79A 1OW7A 3MBGA 1RXQA 1YVIA 5TJ5E 3MYIA 3N0TA 3NMIA 2V26A 2A6EF 2OKUA 2J9BA 3NYJA 3UMHA 2WZGA 1FFHA 2YL3A 5DS6A 1Z7Qc 2XLOA 1GS9A 1PD0A 4IAQA 3RQEA 4MW3A 3ASOC 4ONSA 4KNVA 4YT4A 2L9JA 3DE8A 3JYYA 4YK5A 3U9JA 1NU9C 2R7OA 3JT1A 2OU6A 2YLIA 1OKKA 5IY5C 2Y3BA 4LDKA 1JPNA 3I5PA 3LAYA 2QUPA 1T6QA 4IARA 4YWQA 3M4BA 2R7SA 3BEHA 2Q9AA 4MTFA 3X1OA 3K1IA 4AE4A 4B6IA 1Z5ZA 4JC7A 4C7OA 2J46A 4A4AA 5A6AA 2BC5A 5CI9A 2ICWG 4EBBA 4BJ6C 1CPQA 2A69F 4P9TA 4Q5SF 2HJMA 3POVA 3TOMA 3GWLA 4UDVA 1WASA 2Q00A 1IZMA 2CCYA 3K7DA 1A7EA 3IQTA 5DS4A 3GM2A 2YVKA 3DKAA 3NYMA 1QZXA 5A6JA 2HSQA 1L7CA 3JTLO 4PACA 4R32A 5KYUA 4O6NA 1VB5A 1I4ZA 4U9EA 3FMSA 1E83A 2QLAA 4BJ5A 2OQMA 1ZYRF 4OIPF 3AGUA 2HS5A 4I3MA 4IRUA 1Q0DA 2CGEA 3NG1A 2XRHA 2PBEA 3I5QA 4CDAA 3Q7GA 2J9VA 1S05A 4JVSA 1JRAA 2EPMX 4WGYA 4X0RA 4XQ1A 2XL4A 2KW3C 1G4WR 3GM1A 1EKYA 2WZFA 1SF8A 3V5ZA 3JZ0A 4RD9A 3S28A 3LNMB 1ZW3A 4MW8A 1H9GA 3GWNA 2WB7A 3S0XA 1W2WA 3LLKA 2M4EA 1ZZPA 2JX0A 4FESA 3E70C 3UGPA 3SXYA 4XTKA 4QI2A 2J45A 1PD1A 1OXKA 1LE4A 3LJBA 5L0CA 5E33A 1ORYA 2HSBA 3KYIA 4YT2A 5DS5A 4PR9A 3I4UA 2RSEB 4JURI 3SYNA 3HNKA 3B0UX 3DM9B 1WWPA 4AL1A 1E86A 3B29A 3V5XA 4ZLCA 3M1CB 1DOVA 2BE5F 4MVRA 4AE4B 4C7OB 3O10A 5E3CA 2YRFA 3GODA 4RBNA 3WHNA 1VTMP 2Y69C 4CDYA 2HZ8A 1J8MF 2W4BA 5DLJA 1JAFA 2GWWA 2AU5A 1OCCC 2MYSA 2YZSA 2ETSA 4K0DA 3O55A 3GANA 4LDRA 1TWCA 3DXJF 3IQ5A 3K6BA 4MVMA 3S84A 4C3BA 1FNTc 2OOCA 3CSKA 2J9WA 4CJGA 3ECSA 3KMIA 3U9MA 1FR0A 1QPUA 4I1OB 1A41A 5D91A 3RF3A 4FAPB 4PFOA 2CW0F 1V55C 4PFPA 3ZQVA 1E2XA 1ORSC 2NSFA 1ORJA 1V74B 3A11A 1CGOA 4XLNF 3RH3A 1VYIA 5L0HA 2D4UA 3HKKA 4U5BE 4DBRA 1Q0MA 4YL0A 3B0VC 2J0XA 2X0CA 2LFDA 2AWYA 1B68A 1LIHA 3L34A 4BJ6A 2VCBA 3B71A 1C02A 2Z15A 3GEHA 2YL7A 1F1MA 3QVZA 4IJJA 1N1CA 1VK5A 2OJED 4P9FA 2NPUA 4BJ1A 4M63A 3RQGA 3C8GB 4XPXA 3S9OA 2XS1A 2D5RB 1M57C 3NMKA 5KYNA 4Z9IA 2XLDA 1GQAA 5JSLA 5KYWB 3TD7A 4N06A 3DM5A 3M15A 1KTMA 1OR2A 2PP4A 4MNDA 3M4CA 4CS8C 4Z9HA 1JR8A 2DYSC 2G3KA 1JOGA 1NG1A 2VCCA 2DGJA 5A6BA 1TWGA 5COMA 2PX3A 1HW1A 5T3TA 1R4TA 1O87A 1TFOB 5FCLA 2KC3A 3DD7A 1XZQA 5KYYA 3RVZA 2MWQA 3CQZA 4DRIB 4MVSA 2L7AA 3U8VA 3KKBA 4DXWA 1D0YA 4QDLA 3EJNA 3EHNA 3JSZA 1BZ4A 1Z23A 2OG2A 3GM3A 3US6A 1I5NA 1H7IA 3O39A 4QI0A 5A6KA 1TFKB 1Z63A 2IXMA 4PJLA 2FAPB 4DVYP 3C63A 4O6YA 5BUOA 2W9YA 3KPHA 3OEOA 5E3AA 2RD9A 5L3QA 2R25A 2ZXPA 4XEVA 3TK0A 2PF4E 3G50A 5B3SC 256BA 2IXOA 3S29A 2J7PD 2HUJA 3O6XA 1OW8A 3X2QC 2DYRC 2NUPB 1TWAA 2YQYA 4JRZA 4MTGA 5B1AC 5L0JA 1WGWA 1D1BA 1QKRA 4CS9A 2AP3A 3ABLC 2Y3GA 2VASA 1H6GA 1O3UA 2A68F 2QNLA 3AG2C 4MVOA 4MVUA 2XM0A 4JEAA 4U9DA 2KQ9A 4XPYA 2E87A 2DB4A 3DE9A 3L1MA 1EQ1A 1HW2A 3B9QA 1ZHYA 1Q0KA 2Q3TA 4HFKB 1AUEA 3DI5A 3QW0A 4Q7CA 5KYXA 2KYHA 2FGYA 4E18A 4OIQF 3J06A 4WABA 1OQCA 4D4NA 4CX9A 3C62A 2VH3A 4E0IA 1G8XA 2ZPAA 2KK1A 3Q6MA 3GEIA 5BQIA 1OW6A 3HNLA 1LI7A 3DZAA 4IWBA 1V4AA 3TOLA 5GPGB 3JRTA 2LQGA 4K7BA 3VF0A 2KJGA 3M79A 3LLIA 1VMAA 3W4YA 1U6HA 4EUKB 2VCAA 5KYYB 3ZTMA 4I1MA 5JUAA 2HV6A 4JTDB 2C04A 3AGTA 3RIPA 2I15A 3DAFA 3HLZA 3AOUA 1O5HA 1SMYF 3EZIA 3QVYA 4E17A 2NSGA 3UMKA 2AVKA 2G62A 1HMOA 4OIOF 3ATPA 2LK4A 1M56C 1MNDA 4MVZA 4EBJA 2P0NA 2O9XA 5L3VA 3QTHA 4EKWA 4FX5A 3AG3C 4WGZA 4LLCA 3T9OA 2R7WA 3RKOF 1TR2A 2A0BA 3LS1A 2R7XA 4YL3A 1OKKD 1MMNA 2PX0A 2OJQA 2P6VA 4OIRF 1D1CA 2H7VC 3C8GA 3JYHA 4KI2A 4W8KA 1U0BB 2WVOA 2LP4A 4ZLDA 5AGFA 4Z9JA 3ZDLA 2L6HA 5KYWA 1RJ9A 2WVNA 1J8YF 1FTSA 1ZHZA 2XLHA 4GEHA 2XXAA 4O7GA 4KBLA 5JLIA 3W2WA 3K66A 4HE8D 2JD3A 4IB4A 5A69A 2ASRA 2ZXRA 4A2NB 5KYXB 3T4RA 1MQVA 4DBQA 4AX2A 4U5DE 2HFIA 4ER9A 3C8ZA 5HSWA 3N24A 3K1HA 1Q0GA 3E9VA 3L8JA 2M64A 3RYLA 4J7TA 1APCA 4PJMA 3UGOA 1OXBA 3W2VA 4NTFA 1Y4CA 2Q4FA 1KNYA 4PK4A 4W8PA 4BEJA 2L6FA 1QVXA 3PCVA 4JJGA 4BPMA 3FVYA 1M2VB 2B0JA 4XPWA 2XS8A 4XEKA 1Z6AA 2CNWA 3F47A 5BQGA 4MTOA 3C18A 1BR1A 3LS0A 2X51A 1SYQA 1YZAA 2XM4A 4OINF 3ZC4A 4ULVA 2WVQA 3GEEA 3TJ5A 5DQZA 4G7ZF 2LD6A 3B0PA 3OA1A 3KL4A 3SEOA 5L0GA 2XLVA 3U3FA 2NUPA 1RCPA 5CI8A 4G7OF 2L6GA 5FZTA 4DVZA 2NUTB 4OD5A 2R05A 4EBKA 1OCOC 3T6BA 4LLEA 1TWHA 2GDCA 1A7VA 2Q7RA 3U8PA 5B1BC 4J7YA 2OEXA 2QY9A 1UFBA 4KC9A 3ZTZA 4EIYA 1YAUO 2QE9A 2P1AA 4WJ0A 1XZPA 3NKDA 3H65A 4BJTA 1LE2A 1U89A 3IQCA 4JEBA 4DRHB 2VC9A 1WOLA 4U5EE 1RJ9B 1YLMA 5DQTA 1YYJA 3HTKC 4HEAJ 4U5FE 1RMVA 3QMKA 3A9CA 4LERA 2XXAB 3VYWA 1VLSA 3QZCA 3UMIA 3SNHA 1NLXA 1ST6A 3DAGA 1YARO 4BJ5C 1QQ3A 2IM8A 1K05A 3JCUQ 2EILC 2J8WA 2EIKC 3NMJA 1LI5A 4LACB 4EWCA 1BBHA 1G5ZA 4PJNA 4I44A 1R5ID 1CPRA 3RVYA 2Y3DA 5AC4A 2NG1A 1C17M 2C03A 2YHSA 1QSPA 3U3BA 1NFOA 2Y3HA 4CBEA 2GA0A 1SR2A 4NTAA
chains in the Genus database with same CATH topology
2IM8A 2HFIA 2HUJA 2ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IM8 A;  2HFI A;  2HUJ A;  2ETS A; 
#chains in the Genus database with same CATH topology
 2LSE A;  2YLG A;  3ASN C;  4OD4 A;  3LUT B;  3AJM A;  1A0B A;  2YL1 A;  1DOW A;  3Q6N A;  3HJC A;  2R9R B;  3Q7L A;  2IXN A;  1LS4 A;  2EPL X;  3WG7 C;  2AWC A;  1ZHX A;  2HV7 A;  2R03 A;  3FOP A;  4GQH A;  4JTA B;  3H2U A;  1MMD A;  4XLP F;  1YYX A;  2XL6 A;  3IHU A;  1LM3 B;  1AEP A;  3TQO A;  1LPE A;  3GOR A;  2EIM C;  3T6G B;  3W8H A;  3EG9 A;  3VRC A;  3IPM O;  4DRJ B;  5EK0 A;  4MVQ A;  1JMW A;  3ABK C;  3EPV A;  3HNI A;  2KNH A;  3LES A;  4C3D A;  4E0H A;  1HE1 A;  2QTV A;  4LDQ A;  1D0Z A;  1WTY A;  3BRJ A;  4JE9 A;  1Y6D A;  2H7O A;  5K0I A;  2R02 A;  2UUH A;  1NBB A;  4CSA C;  4CIH A;  4XWJ A;  4JCZ A;  2EPK X;  3R2P A;  3EZH A;  3H2V A;  1XWJ A;  3FAP B;  2DI3 A;  1JPJ A;  2OCC C;  3AQB A;  3FHD A;  1UG7 A;  2J9U A;  2KGO A;  4G78 A;  3S90 A;  3ABM C;  2I8B A;  1OCZ C;  2LCH A;  2YEV A;  3SXZ A;  5JRA A;  4H4K C;  5JS5 A;  1YJG A;  3F46 A;  2V3C C;  1ZVZ A;  1GGQ A;  2EIJ C;  2L81 A;  1QLE C;  2XLW A;  2YLD A;  3S27 A;  3NRH A;  3V7O A;  5A6B D;  1ZU4 A;  2BL2 A;  3C7J A;  4JCH A;  1T01 A;  4YJW A;  1MNE A;  2KSF A;  1RKE B;  1M2V A;  4XEF A;  1H9T A;  2EPO A;  3EGD B;  4JKV A;  4MQ9 F;  2R7R A;  3TUL A;  3JSE O;  3AG1 C;  3DWW A;  4YL1 A;  3ZG1 A;  3PHF 2;  4N4W A;  1EA8 A;  3DJN B;  4HFF B;  1D0X A;  3JRM O;  2P61 A;  3K33 A;  4NCQ A;  4D4X A;  4G7H F;  5CIV A;  4DOZ A;  2G3V A;  2EPN A;  1TQG A;  3CAX A;  2NUT A;  3WAQ A;  1PV3 A;  5EHH A;  1T6U A;  1VYK A;  2A0U A;  3U5S A;  2IBF A;  3ZWI A;  2OEV A;  3U0C A;  1MMA A;  1C03 A;  1HE9 A;  1T9K A;  2HJ3 A;  4Q4Z F;  1AVO B;  1FMW A;  3MFN A;  3L0I A;  3NYL A;  4AK9 A;  3EFO B;  3NKE A;  4JJF A;  1E85 A;  4J32 B;  3EG9 B;  4G0H A;  3U2L A;  3ITF A;  3DJU B;  3IEE A;  4U5C E;  3ZSU A;  3MLG A;  4CS8 A;  2IXP A;  5D92 A;  4N6H A;  1YZC A;  1HMD A;  1NU7 D;  4H54 A;  5DVW A;  4CJO A;  3V5Y A;  2XL8 A;  4CIP A;  3FDQ A;  5F5F A;  4JTC B;  3HNJ A;  4CS7 A;  2H7B A;  3LNR A;  1D1A A;  4BG0 A;  3PMR A;  4PJJ A;  2P7V A;  1LS1 A;  2Q9C A;  1PCX A;  2CDQ A;  4L6R A;  3W8I A;  4F4B A;  1NZE A;  3FAJ A;  3KH2 A;  3SXK A;  4IGG A;  1T6I A;  1TKN A;  3OWT A;  1Z3I X;  1KU2 A;  4MS2 A;  4YT5 A;  1VLT A;  2TMV P;  4FWV A;  5JP7 A;  1NFN A;  2GFH A;  5JT4 A;  1SZI A;  1ZHT A;  2IOQ A;  3CZ6 A;  2ZD9 A;  1BR2 A;  2XSE A;  4YN0 B;  3EH2 A;  2PNO A;  1NSG B;  2R7U A;  2PFD A;  2HMQ A;  1WAT A;  2W4M A;  3QW1 A;  3TJ6 A;  4YT8 A;  2R7Q A;  2J0W A;  2IYL D;  3U2M A;  3AG4 C;  1ZHW A;  4DJ9 A;  1S7Z A;  2B0H A;  1LVK A;  1HY5 A;  4C3E A;  3ZQY A;  4E7Z A;  5L0I A;  2Y39 A;  3SZR A;  5HV9 A;  5JVE A;  5AC5 A;  4CS9 C;  1WN0 A;  2HKV A;  3KYJ A;  4JW1 A;  3DMD A;  4ANJ A;  4CSA A;  1EI7 A;  4NQF A;  3PDM P;  1I4Y A;  5T1D B;  5L0F A;  3EQL F;  2R7T A;  4KNW A;  3SP1 A;  5F28 E;  3EHM A;  4N6C A;  1VOM A;  1YA7 O;  1FMV A;  3L8I A;  2ZXO A;  3K1I C;  2W45 A;  3C8G D;  3EGX A;  4RDA A;  1A7D A;  5L0D A;  4NTB A;  1Q0F A;  3ZIB A;  1M2O A;  3CEX A;  3AQC A;  4GYT A;  2UUI A;  1RKC A;  2WZL A;  4EHP A;  1BDJ B;  3RW0 A;  4U5G A;  2XLM A;  5KYU B;  5T3W A;  2F22 A;  2WL8 A;  1OCR C;  2LIG A;  3LEO A;  4JZA A;  5COG A;  2CYD A;  4K1O A;  5F5H A;  2FFH A;  2A6H F;  1FAP B;  3VM6 A;  1CGN A;  1K40 A;  1MMG A;  1RKE A;  3EGD A;  2J7P A;  2YWA A;  5EGY A;  4BEM J;  1T5O A;  1YDI A;  2LFF A;  3VAY A;  3ZVR A;  5BQH A;  2HMZ A;  2R7V A;  1BR4 A;  1V54 C;  1FFT C;  2JPU A;  2VB6 A;  4P6I C;  4AL0 A;  2EIN C;  5E2Q A;  2MHR A;  2CNW D;  1L3P A;  1K04 A;  4E7S A;  4ULW A;  3RQF A;  2A1D D;  3MX3 A;  4CDV A;  1CGM E;  3NDB B;  3T6J A;  1OR3 A;  3R7C A;  3IQ6 A;  4NY3 A;  2ZXW C;  2H8A A;  2Q9B A;  2XLE A;  3G4X A;  3UR3 C;  3EH1 A;  4JIO A;  1G4U S;  1GM5 A;  1IW7 F;  2YKZ A;  1LKX A;  3EFO A;  3FOO A;  4NC3 A;  3MYF A;  1M6T A;  3G4Z A;  3SXM A;  3RFY A;  3LEV A;  3UNG C;  5B3I A;  1E84 A;  4U5H A;  5COF A;  3WOD F;  1ZU5 A;  2GAQ A;  3FXH A;  3EGX B;  4O6M A;  4IAO A;  1ZW2 A;  4J30 B;  1YA9 A;  3N2Z B;  2YL0 A;  4O79 A;  1OW7 A;  3MBG A;  1RXQ A;  1YVI A;  5TJ5 E;  3MYI A;  3N0T A;  3NMI A;  2V26 A;  2A6E F;  2OKU A;  2J9B A;  3NYJ A;  3UMH A;  2WZG A;  1FFH A;  2YL3 A;  5DS6 A;  1Z7Q c;  2XLO A;  1GS9 A;  1PD0 A;  4IAQ A;  3RQE A;  4MW3 A;  3ASO C;  4ONS A;  4KNV A;  4YT4 A;  2L9J A;  3DE8 A;  3JYY A;  4YK5 A;  3U9J A;  1NU9 C;  2R7O A;  3JT1 A;  2OU6 A;  2YLI A;  1OKK A;  5IY5 C;  2Y3B A;  4LDK A;  1JPN A;  3I5P A;  3LAY A;  2QUP A;  1T6Q A;  4IAR A;  4YWQ A;  3M4B A;  2R7S A;  3BEH A;  2Q9A A;  4MTF A;  3X1O A;  3K1I A;  4AE4 A;  4B6I A;  1Z5Z A;  4JC7 A;  4C7O A;  2J46 A;  4A4A A;  5A6A A;  2BC5 A;  5CI9 A;  2ICW G;  4EBB A;  4BJ6 C;  1CPQ A;  2A69 F;  4P9T A;  4Q5S F;  2HJM A;  3POV A;  3TOM A;  3GWL A;  4UDV A;  1WAS A;  2Q00 A;  1IZM A;  2CCY A;  3K7D A;  1A7E A;  3IQT A;  5DS4 A;  3GM2 A;  2YVK A;  3DKA A;  3NYM A;  1QZX A;  5A6J A;  2HSQ A;  1L7C A;  3JTL O;  4PAC A;  4R32 A;  5KYU A;  4O6N A;  1VB5 A;  1I4Z A;  4U9E A;  3FMS A;  1E83 A;  2QLA A;  4BJ5 A;  2OQM A;  1ZYR F;  4OIP F;  3AGU A;  2HS5 A;  4I3M A;  4IRU A;  1Q0D A;  2CGE A;  3NG1 A;  2XRH A;  2PBE A;  3I5Q A;  4CDA A;  3Q7G A;  2J9V A;  1S05 A;  4JVS A;  1JRA A;  2EPM X;  4WGY A;  4X0R A;  4XQ1 A;  2XL4 A;  2KW3 C;  1G4W R;  3GM1 A;  1EKY A;  2WZF A;  1SF8 A;  3V5Z A;  3JZ0 A;  4RD9 A;  3S28 A;  3LNM B;  1ZW3 A;  4MW8 A;  1H9G A;  3GWN A;  2WB7 A;  3S0X A;  1W2W A;  3LLK A;  2M4E A;  1ZZP A;  2JX0 A;  4FES A;  3E70 C;  3UGP A;  3SXY A;  4XTK A;  4QI2 A;  2J45 A;  1PD1 A;  1OXK A;  1LE4 A;  3LJB A;  5L0C A;  5E33 A;  1ORY A;  2HSB A;  3KYI A;  4YT2 A;  5DS5 A;  4PR9 A;  3I4U A;  2RSE B;  4JUR I;  3SYN A;  3HNK A;  3B0U X;  3DM9 B;  1WWP A;  4AL1 A;  1E86 A;  3B29 A;  3V5X A;  4ZLC A;  3M1C B;  1DOV A;  2BE5 F;  4MVR A;  4AE4 B;  4C7O B;  3O10 A;  5E3C A;  2YRF A;  3GOD A;  4RBN A;  3WHN A;  1VTM P;  2Y69 C;  4CDY A;  2HZ8 A;  1J8M F;  2W4B A;  5DLJ A;  1JAF A;  2GWW A;  2AU5 A;  1OCC C;  2MYS A;  2YZS A;  2ETS A;  4K0D A;  3O55 A;  3GAN A;  4LDR A;  1TWC A;  3DXJ F;  3IQ5 A;  3K6B A;  4MVM A;  3S84 A;  4C3B A;  1FNT c;  2OOC A;  3CSK A;  2J9W A;  4CJG A;  3ECS A;  3KMI A;  3U9M A;  1FR0 A;  1QPU A;  4I1O B;  1A41 A;  5D91 A;  3RF3 A;  4FAP B;  4PFO A;  2CW0 F;  1V55 C;  4PFP A;  3ZQV A;  1E2X A;  1ORS C;  2NSF A;  1ORJ A;  1V74 B;  3A11 A;  1CGO A;  4XLN F;  3RH3 A;  1VYI A;  5L0H A;  2D4U A;  3HKK A;  4U5B E;  4DBR A;  1Q0M A;  4YL0 A;  3B0V C;  2J0X A;  2X0C A;  2LFD A;  2AWY A;  1B68 A;  1LIH A;  3L34 A;  4BJ6 A;  2VCB A;  3B71 A;  1C02 A;  2Z15 A;  3GEH A;  2YL7 A;  1F1M A;  3QVZ A;  4IJJ A;  1N1C A;  1VK5 A;  2OJE D;  4P9F A;  2NPU A;  4BJ1 A;  4M63 A;  3RQG A;  3C8G B;  4XPX A;  3S9O A;  2XS1 A;  2D5R B;  1M57 C;  3NMK A;  5KYN A;  4Z9I A;  2XLD A;  1GQA A;  5JSL A;  5KYW B;  3TD7 A;  4N06 A;  3DM5 A;  3M15 A;  1KTM A;  1OR2 A;  2PP4 A;  4MND A;  3M4C A;  4CS8 C;  4Z9H A;  1JR8 A;  2DYS C;  2G3K A;  1JOG A;  1NG1 A;  2VCC A;  2DGJ A;  5A6B A;  1TWG A;  5COM A;  2PX3 A;  1HW1 A;  5T3T A;  1R4T A;  1O87 A;  1TFO B;  5FCL A;  2KC3 A;  3DD7 A;  1XZQ A;  5KYY A;  3RVZ A;  2MWQ A;  3CQZ A;  4DRI B;  4MVS A;  2L7A A;  3U8V A;  3KKB A;  4DXW A;  1D0Y A;  4QDL A;  3EJN A;  3EHN A;  3JSZ A;  1BZ4 A;  1Z23 A;  2OG2 A;  3GM3 A;  3US6 A;  1I5N A;  1H7I A;  3O39 A;  4QI0 A;  5A6K A;  1TFK B;  1Z63 A;  2IXM A;  4PJL A;  2FAP B;  4DVY P;  3C63 A;  4O6Y A;  5BUO A;  2W9Y A;  3KPH A;  3OEO A;  5E3A A;  2RD9 A;  5L3Q A;  2R25 A;  2ZXP A;  4XEV A;  3TK0 A;  2PF4 E;  3G50 A;  5B3S C;  256B A;  2IXO A;  3S29 A;  2J7P D;  2HUJ A;  3O6X A;  1OW8 A;  3X2Q C;  2DYR C;  2NUP B;  1TWA A;  2YQY A;  4JRZ A;  4MTG A;  5B1A C;  5L0J A;  1WGW A;  1D1B A;  1QKR A;  4CS9 A;  2AP3 A;  3ABL C;  2Y3G A;  2VAS A;  1H6G A;  1O3U A;  2A68 F;  2QNL A;  3AG2 C;  4MVO A;  4MVU A;  2XM0 A;  4JEA A;  4U9D A;  2KQ9 A;  4XPY A;  2E87 A;  2DB4 A;  3DE9 A;  3L1M A;  1EQ1 A;  1HW2 A;  3B9Q A;  1ZHY A;  1Q0K A;  2Q3T A;  4HFK B;  1AUE A;  3DI5 A;  3QW0 A;  4Q7C A;  5KYX A;  2KYH A;  2FGY A;  4E18 A;  4OIQ F;  3J06 A;  4WAB A;  1OQC A;  4D4N A;  4CX9 A;  3C62 A;  2VH3 A;  4E0I A;  1G8X A;  2ZPA A;  2KK1 A;  3Q6M A;  3GEI A;  5BQI A;  1OW6 A;  3HNL A;  1LI7 A;  3DZA A;  4IWB A;  1V4A A;  3TOL A;  5GPG B;  3JRT A;  2LQG A;  4K7B A;  3VF0 A;  2KJG A;  3M79 A;  3LLI A;  1VMA A;  3W4Y A;  1U6H A;  4EUK B;  2VCA A;  5KYY B;  3ZTM A;  4I1M A;  5JUA A;  2HV6 A;  4JTD B;  2C04 A;  3AGT A;  3RIP A;  2I15 A;  3DAF A;  3HLZ A;  3AOU A;  1O5H A;  1SMY F;  3EZI A;  3QVY A;  4E17 A;  2NSG A;  3UMK A;  2AVK A;  2G62 A;  1HMO A;  4OIO F;  3ATP A;  2LK4 A;  1M56 C;  1MND A;  4MVZ A;  4EBJ A;  2P0N A;  2O9X A;  5L3V A;  3QTH A;  4EKW A;  4FX5 A;  3AG3 C;  4WGZ A;  4LLC A;  3T9O A;  2R7W A;  3RKO F;  1TR2 A;  2A0B A;  3LS1 A;  2R7X A;  4YL3 A;  1OKK D;  1MMN A;  2PX0 A;  2OJQ A;  2P6V A;  4OIR F;  1D1C A;  2H7V C;  3C8G A;  3JYH A;  4KI2 A;  4W8K A;  1U0B B;  2WVO A;  2LP4 A;  4ZLD A;  5AGF A;  4Z9J A;  3ZDL A;  2L6H A;  5KYW A;  1RJ9 A;  2WVN A;  1J8Y F;  1FTS A;  1ZHZ A;  2XLH A;  4GEH A;  2XXA A;  4O7G A;  4KBL A;  5JLI A;  3W2W A;  3K66 A;  4HE8 D;  2JD3 A;  4IB4 A;  5A69 A;  2ASR A;  2ZXR A;  4A2N B;  5KYX B;  3T4R A;  1MQV A;  4DBQ A;  4AX2 A;  4U5D E;  2HFI A;  4ER9 A;  3C8Z A;  5HSW A;  3N24 A;  3K1H A;  1Q0G A;  3E9V A;  3L8J A;  2M64 A;  3RYL A;  4J7T A;  1APC A;  4PJM A;  3UGO A;  1OXB A;  3W2V A;  4NTF A;  1Y4C A;  2Q4F A;  1KNY A;  4PK4 A;  4W8P A;  4BEJ A;  2L6F A;  1QVX A;  3PCV A;  4JJG A;  4BPM A;  3FVY A;  1M2V B;  2B0J A;  4XPW A;  2XS8 A;  4XEK A;  1Z6A A;  2CNW A;  3F47 A;  5BQG A;  4MTO A;  3C18 A;  1BR1 A;  3LS0 A;  2X51 A;  1SYQ A;  1YZA A;  2XM4 A;  4OIN F;  3ZC4 A;  4ULV A;  2WVQ A;  3GEE A;  3TJ5 A;  5DQZ A;  4G7Z F;  2LD6 A;  3B0P A;  3OA1 A;  3KL4 A;  3SEO A;  5L0G A;  2XLV A;  3U3F A;  2NUP A;  1RCP A;  5CI8 A;  4G7O F;  2L6G A;  5FZT A;  4DVZ A;  2NUT B;  4OD5 A;  2R05 A;  4EBK A;  1OCO C;  3T6B A;  4LLE A;  1TWH A;  2GDC A;  1A7V A;  2Q7R A;  3U8P A;  5B1B C;  4J7Y A;  2OEX A;  2QY9 A;  1UFB A;  4KC9 A;  3ZTZ A;  4EIY A;  1YAU O;  2QE9 A;  2P1A A;  4WJ0 A;  1XZP A;  3NKD A;  3H65 A;  4BJT A;  1LE2 A;  1U89 A;  3IQC A;  4JEB A;  4DRH B;  2VC9 A;  1WOL A;  4U5E E;  1RJ9 B;  1YLM A;  5DQT A;  1YYJ A;  3HTK C;  4HEA J;  4U5F E;  1RMV A;  3QMK A;  3A9C A;  4LER A;  2XXA B;  3VYW A;  1VLS A;  3QZC A;  3UMI A;  3SNH A;  1NLX A;  1ST6 A;  3DAG A;  1YAR O;  4BJ5 C;  1QQ3 A;  2IM8 A;  1K05 A;  3JCU Q;  2EIL C;  2J8W A;  2EIK C;  3NMJ A;  1LI5 A;  4LAC B;  4EWC A;  1BBH A;  1G5Z A;  4PJN A;  4I44 A;  1R5I D;  1CPR A;  3RVY A;  2Y3D A;  5AC4 A;  2NG1 A;  1C17 M;  2C03 A;  2YHS A;  1QSP A;  3U3B A;  1NFO A;  2Y3H A;  4CBE A;  2GA0 A;  1SR2 A;  4NTA A; 
#chains in the Genus database with same CATH homology
 2IM8 A;  2HFI A;  2HUJ A;  2ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...