3O55A

Crystal structure of human fad-linked augmenter of liver regeneration (alr)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Augmenter of liver regeneration
publication title Molecular recognition and substrate mimicry drive the electron-transfer process between MIA40 and ALR.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3o55A00
3U2MA 3R7CA 3TK0A 3U5SA 1JR8A 4E0HA 4LDKA 2HJ3A 1OQCA 3GWNA 1JRAA 3LLIA 4E0IA 3TD7A 3O55A 3GWLA 3U2LA 3W4YA 3MBGA 3LLKA
chains in the Genus database with same CATH superfamily
2XS8A 3K1IC 4U5EE 2EPOA 1L3PA 5JP7A 5A6BA 3V5YA 2R25A 4YWQA 3C62A 2NUPB 3CAXA 2IXMA 5A69A 1Q0MA 2L81A 4MTOA 2YZSA 3EGXA 4U5FE 2LFFA 4JTDB 3EZHA 4PJJA 1JMWA 5B3SC 5EHHA 4N4WA 3ITFA 1IW7F 3QW1A 4C7OA 2WVNA 4U5HA 2W9YA 2X51A 2P1AA 3MX3A 1OCOC 2R7QA 1C03A 1JRAA 1MNEA 3EG9A 1LVKA 2LK4A 2GA0A 3LJBA 3N2ZB 3ATPA 4MVMA 4OD5A 3VAYA 1NSGB 1YARO 1EQ1A 1JPNA 2EILC 3TD7A 4C3BA 4DRIB 4ER9A 2P0NA 1A7EA 4OIPF 1BZ4A 1LKXA 1Y4CA 3AJMA 4MVOA 3JZ0A 3U2LA 4DOZA 4G78A 5JRAA 3E70C 1E86A 2NSFA 3UGPA 1D0ZA 4DXWA 2EIJC 1MMAA 3AQCA 2D5RB 3EGXB 3QZCA 4KBLA 4IB4A 1WASA 1C02A 1JOGA 2XLMA 4OD4A 3K7DA 3ZC4A 3U8VA 2Q4FA 4C7OB 2I8BA 1EA8A 2XLEA 3EGDA 3JRMO 4CBEA 2P7VA 2J8WA 3JSZA 1RXQA 1TWGA 1DOWA 3EG9B 4CS8A 4KC9A 1LI5A 2Q7RA 1BR2A 2HSQA 2ZPAA 3ASOC 3AOUA 4GYTA 3FDQA 3LS0A 1MMNA 4QI0A 3LEOA 3NYJA 1K40A 5JUAA 3UGOA 3AQBA 1EKYA 5JS5A 4G0HA 3GM3A 3HNJA 4I3MA 2J46A 2XM4A 3IHUA 3NRHA 1LS4A 3EGDB 2Z15A 2LQGA 4IAOA 4NTAA 4FWVA 3U5SA 4XPXA 4IWBA 4MVRA 3X2QC 4JCHA 4Z9JA 3ABMC 4BEJA 2MYSA 1VYIA 3E9VA 4YN0B 3QW0A 4JJGA 1V74B 4IRUA 5AC5A 2BC5A 4U5BE 5KYUA 2M4EA 1O87A 1QQ3A 2A68F 4QI2A 2A1DD 2AWYA 2H8AA 4I1MA 4J32B 4DJ9A 2A6HF 2GAQA 3C8GA 3JT1A 4I44A 3GWLA 3BEHA 4FESA 1T6IA 1YA9A 1LM3B 1QZXA 3LNRA 4U9DA 2ETSA 3DZAA 3L0IA 2YQYA 1HW1A 2WVQA 4J7YA 3T6JA 1OKKD 4CJOA 5BQGA 1VTMP 1UG7A 1FFTC 2DYSC 2E87A 1I4ZA 1ZU5A 3LAYA 5L0CA 2L6FA 2LFDA 1NFNA 1G8XA 3EZIA 5DS4A 5KYUB 3M4CA 4JVSA 1NLXA 1J8YF 2C03A 3F47A 1J8MF 1W2WA 5KYWB 2JX0A 2Q9AA 3JRTA 1RMVA 5DQZA 2IXPA 3C8GB 2EIMC 2KW3C 1U6HA 2FGYA 2JD3A 2IOQA 3VYWA 3U3FA 1FAPB 1YZCA 1D0YA 2KNHA 1VOMA 3EHMA 5A6AA 2R7WA 3C18A 2IXNA 1XZPA 3DAGA 3M15A 2R03A 3T9OA 3W4YA 2PNOA 3FMSA 4CIPA 4N06A 1E84A 4JZAA 5L0IA 4LDQA 4MW3A 2X0CA 2HMQA 2J0XA 3SP1A 3FXHA 4U5CE 3OA1A 4YT2A 1CGNA 4N6CA 4E7ZA 4MS2A 1T6QA 3VF0A 1OXKA 5CI9A 3WHNA 4BJ5A 4Q5SF 3B0PA 2H7VC 3L8JA 1IZMA 4RDAA 3RQFA 3MYFA 3IQTA 2W45A 5L0JA 2CW0F 3SXZA 4I1OB 4J7TA 2ZXRA 3X1OA 4XQ1A 4HFKB 1BR4A 2UUHA 4CS8C 1GM5A 3GWNA 1PD0A 3NMIA 4LLEA 4ULVA 2QUPA 4U5GA 2XXAA 2QNLA 5DS5A 3M1CB 1CGME 4NTFA 1SMYF 4O79A 1HE1A 4EBJA 2KYHA 1YAUO 3JYHA 1G5ZA 3GM2A 1YLMA 3V5ZA 1DOVA 4AL1A 3MBGA 5KYNA 5A6JA 2J7PA 2W4MA 4JRZA 4MTGA 3OEOA 1VK5A 4XPWA 1VMAA 2YLDA 2VH3A 4XWJA 5L0FA 1M2VA 1RJ9A 1V4AA 3DM5A 2XLOA 2H7BA 1Y6DA 2PX3A 2DGJA 4PJMA 2Q00A 2PBEA 2AU5A 3WAQA 1MMGA 3B9QA 3QVYA 1VB5A 2P61A 1TWAA 1A7DA 3HJCA 3POVA 2NUTB 4O7GA 5FZTA 1O5HA 4U5DE 3TQOA 2XXAB 1Z23A 4C3EA 4W8KA 5KYYA 4CS7A 2ICWG 3I5QA 2EPNA 3ZVRA 2DI3A 2J9VA 2YL3A 1M57C 3DMDA 4QDLA 1KU2A 2IBFA 2NSGA 1YVIA 2QTVA 3ZQVA 1FMVA 1R4TA 1SZIA 4CS9C 4EIYA 1TFOB 5DLJA 1B68A 2HV7A 2L7AA 2ZD9A 4JIOA 4MVSA 2YKZA 3AG3C 2PX0A 3NYLA 1M2VB 3UMHA 1RJ9B 4JTCB 3ZTMA 2WZGA 4CDYA 5HSWA 4DBQA 2CDQA 1I4YA 1QKRA 2A6EF 2XL4A 3DD7A 3US6A 4AK9A 3IQ6A 5CIVA 1YA7O 3ABKC 4PACA 3SXYA 1ZHZA 1OW6A 4OIQF 3TOLA 2XSEA 2OJQA 3JCUQ 3KKBA 4YT5A 4IJJA 2J9UA 3B0VC 2LD6A 2R7UA 1FTSA 1ZW2A 3M79A 4KI2A 1NFOA 2Y3GA 2YLIA 5COGA 3S90A 1SF8A 3BRJA 4E17A 1H9TA 4EBBA 4K7BA 2KSFA 2ZXOA 4PJNA 1CGOA 1H6GA 2CYDA 3AG4C 4NCQA 4A2NB 3G50A 2EPKX 3EFOA 4JEBA 4PK4A 1OCCC 4YJWA 2HKVA 4ZLDA 1KTMA 1ZHTA 5L3VA 2OOCA 2RSEB 3O55A 1FNTc 2R02A 3RH3A 3NG1A 4LLCA 2EPLX 2KQ9A 5JVEA 1OKKA 3DXJF 3U9MA 4MVZA 2VB6A 3SNHA 4Z9IA 2KK1A 3HLZA 4N6HA 2G62A 4H4KC 4XEFA 2XRHA 4OIOF 4JC7A 4XLNF 5E33A 4G7ZF 1L7CA 2LSEA 5DVWA 4CDVA 3WODF 1PD1A 2XLDA 4BJ5C 1JPJA 1WN0A 2VC9A 1T9KA 1HY5A 4XPYA 3EFOB 5TJ5E 1E2XA 2CNWD 4DBRA 4Q4ZF 1G4WR 1G4US 2NG1A 3FAJA 2XL8A 3LEVA 4FAPB 2FAPB 2R05A 5COMA 3W8HA 2I15A 1K05A 3S27A 4CS9A 3K66A 4MNDA 3RF3A 3ZTZA 2YL7A 4IGGA 2WVOA 1RKCA 3NYMA 4WABA 2R7VA 3ZDLA 2J0WA 4MTFA 1ZYRF 3S84A 3RW0A 4H54A 4KNWA 4G7HF 1XZQA 1ZHYA 2HFIA 2M64A 2YLGA 4LACB 3W8IA 2P6VA 1Q0GA 3VRCA 4YL0A 2UUIA 4HFFB 4R32A 1APCA 3HNIA 3S0XA 2Y3HA 5DS6A 4EKWA 2XL6A 2AWCA 3DWWA 3H2VA 4UDVA 1YYXA 3O6XA 3TJ5A 1Q0KA 1SR2A 4LDKA 3NKDA 2V26A 3KYJA 3ZSUA 2D4UA 2A69F 2XLVA 4K1OA 4J30B 5JSLA 1OCZC 4JE9A 1AEPA 1S05A 5EK0A 3CEXA 2KJGA 1V54C 3ZIBA 2JPUA 3LLIA 3N0TA 3U9JA 3DAFA 4L6RA 4E7SA 4ONSA 2XLHA 2YRFA 4JKVA 1A41A 4NQFA 3S9OA 1BR1A 1NG1A 3RVZA 3FOOA 2B0JA 3SYNA 4YT4A 1OW7A 5AC4A 1OR3A 5FCLA 1ZHWA 3LLKA 1D1BA 3OWTA 3ZG1A 1Z63A 3EH2A 4XLPF 1D1AA 3V7OA 1T6UA 3LNMB 1OXBA 3G4XA 3HKKA 4GEHA 1JR8A 2OEXA 1D0XA 2FFHA 3GANA 2BL2A 2G3VA 3IQCA 3RQEA 3SXKA 5K0IA 3EHNA 4PFOA 3NDBB 3TULA 2G3KA 4C3DA 2YEVA 1GQAA 2HV6A 4JW1A 1VLTA 2EIKC 2YL1A 1M6TA 4YL1A 1Q0DA 3L1MA 4JURI 4AE4A 2CGEA 4F4BA 1ORJA 4IAQA 3C63A 4AX2A 2RD9A 4CX9A 2XLWA 1Q0FA 2DYRC 2YWAA 3C8GD 4NTBA 4NY3A 3T6BA 1QVXA 3ABLC 3DKAA 2CCYA 2HMZA 4JCZA 1MMDA 1TWCA 3SXMA 2XM0A 3C8ZA 4BJ6A 2H7OA 1ZU4A 3F46A 4BG0A 3EPVA 4JTAB 3K1HA 3I5PA 4PR9A 4CJGA 4O6NA 4YL3A 2KC3A 4MVQA 2IXOA 3Q7LA 2XS1A 3CQZA 4U9EA 1UFBA 2KGOA 2VCCA 1XWJA 1S7ZA 1WWPA 1YJGA 4AE4B 2R7RA 4XEKA 3B71A 3NMJA 4PFPA 1NBBA 1OQCA 4O6YA 4JEAA 3QVZA 1OW8A 1VLSA 3T4RA 1TR2A 4ZLCA 4WJ0A 2AVKA 3A9CA 1SYQA 2R7XA 4XEVA 3AGTA 1HMOA 3TOMA 1MNDA 2J9WA 1V55C 4MQ9F 2B0HA 3GEEA 4Z9HA 3K33A 4B6IA 2J45A 5JT4A 1D1CA 5JLIA 1E85A 5BUOA 3NKEA 5B1AC 2A0UA 5F28E 3B0UX 2W4BA 4Q7CA 3U2MA 3MYIA 3GM1A 3ZQYA 2QE9A 4NC3A 2EPMX 3GEHA 2OCCC 4P9TA 1K04A 2J9BA 4E0HA 2TMVP 2GWWA 2LP4A 3VM6A 2Y3DA 4P9FA 5D91A 4WGZA 2CNWA 3MFNA 5KYYB 4MW8A 2YL0A 2HJ3A 5T3WA 3RFYA 5HV9A 4EBKA 1E83A 3H65A 3A11A 1AUEA 2VCAA 5DQTA 4DVYP 3IEEA 3MLGA 5IY5C 2MHRA 5KYXA 1OCRC 1QSPA 5AGFA 4O6MA 2Y39A 3IQ5A 3L8IA 4W8PA 1OR2A 4BEMJ 1ORSC 3J06A 3UMIA 3M4BA 1H7IA 2J7PD 3DI5A 5T3TA 4OIRF 1NZEA 3HNLA 4DVZA 5A6KA 2HS5A 4CSAA 3PCVA 3IPMO 3UMKA 3W2VA 3LUTB 1H9GA 4LDRA 2L6HA 5A6BD 1QLEC 1JAFA 2WZFA 5F5FA 1PCXA 1BBHA 3TK0A 3UNGC 1PV3A 3DJUB 5CI8A 1VYKA 2C04A 2GFHA 3RKOF 4EUKB 1A0BA 2YHSA 1A7VA 2R9RB 2YVKA 3DE9A 4P6IC 3SZRA 5GPGB 1GS9A 3KYIA 4BJTA 1T01A 1BDJB 2VASA 1ORYA 1LE4A 1U89A 2MWQA 2QY9A 2R7OA 5D92A 3S29A 2ASRA 2HZ8A 5KYXB 1HW2A 3Q6MA 5COFA 5BQHA 3PMRA 4HE8D 2Q3TA 3UR3C 3GODA 2OG2A 3JTLO 2ZXPA 3K1IA 3TJ6A 5E3CA 4YK5A 4X0RA 2ZXWC 4AL0A 1KNYA 256BA 2R7TA 3KPHA 4BJ6C 3RVYA 3HTKC 3JYYA 1EI7A 1WGWA 4RD9A 1U0BB 2AP3A 1LI7A 1O3UA 2O9XA 2LIGA 2BE5F 1TQGA 4WGYA 4DRJB 3CZ6A 2OQMA 2WZLA 3GEIA 3LS1A 3N24A 4GQHA 4M63A 3U0CA 1LIHA 4PJLA 4YT8A 5KYWA 4DRHB 3T6GB 4E0IA 2Y3BA 5BQIA 4G7OF 4FX5A 4CDAA 3ASNC 3FAPB 2IM8A 2LCHA 3R2PA 2Q9CA 3DE8A 4OINF 3S28A 1GGQA 4E18A 5L0GA 3FOPA 3O39A 5L3QA 2IYLD 2PFDA 1M56C 1YZAA 3KMIA 2WL8A 4LERA 1ZHXA 2OJED 3SEOA 2V3CC 2R7SA 2PF4E 2L9JA 3PDMP 1I5NA 1Z5ZA 1HMDA 2Y69C 1HE9A 2EINC 2HJMA 3CSKA 5B1BC 2OKUA 3L34A 1LE2A 3K6BA 3KH2A 1RKEA 3Q7GA 4MVUA 5F5HA 4ANJA 1NU7D 5EGYA 3ECSA 3FHDA 1LS1A 3U3BA 3RYLA 1T5OA 1CPQA 2L6GA 2OU6A 3I4UA 1M2OA 3NMKA 4XTKA 3RIPA 1NU9C 5L0HA 3C7JA 1F1MA 2A0BA 3DJNB 1Z6AA 3AGUA 3FVYA 4KNVA 5E2QA 3H2UA 3DM9B 1C17M 3O10A 1LPEA 2HSBA 5E3AA 1ST6A 3GORA 1WATA 1TFKB 3HNKA 3W2WA 2DB4A 1Z3IX 4EHPA 3U8PA 1ZW3A 3LESA 5B3IA 1AVOB 1FFHA 1FMWA 1ZVZA 4BPMA 4CSAC 4IARA 3WG7C 1N1CA 1RKEB 3QMKA 2PP4A 4ULWA 3R7CA 2QLAA 2HUJA 1TKNA 1ZZPA 3QTHA 3EQLF 4CIHA 3PHF2 1QPUA 2VCBA 1YYJA 4K0DA 5T1DB 3EH1A 2NUPA 1FR0A 2NPUA 1MQVA 3RQGA 5L0DA 1TWHA 3KL4A 3Q6NA 4RBNA 3B29A 3V5XA 2NUTA 4HEAJ 1R5ID 3EJNA 3ZWIA 1YDIA 4EWCA 1Z7Qc 4D4XA 1CPRA 1WTYA 4JJFA 3AG1C 2F22A 3JSEO 2WB7A 4BJ1A 1RCPA 3AG2C 2GDCA 4A4AA 3G4ZA 4D4NA 1WOLA 2Q9BA 2OEVA
chains in the Genus database with same CATH topology
3U2MA 3R7CA 3TK0A 3U5SA 1JR8A 4E0HA 4LDKA 2HJ3A 1OQCA 3GWNA 1JRAA 3LLIA 4E0IA 3TD7A 3O55A 3GWLA 3U2LA 3W4YA 3MBGA 3LLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2M A;  3R7C A;  3TK0 A;  3U5S A;  1JR8 A;  4E0H A;  4LDK A;  2HJ3 A;  1OQC A;  3GWN A;  1JRA A;  3LLI A;  4E0I A;  3TD7 A;  3O55 A;  3GWL A;  3U2L A;  3W4Y A;  3MBG A;  3LLK A; 
#chains in the Genus database with same CATH topology
 2XS8 A;  3K1I C;  4U5E E;  2EPO A;  1L3P A;  5JP7 A;  5A6B A;  3V5Y A;  2R25 A;  4YWQ A;  3C62 A;  2NUP B;  3CAX A;  2IXM A;  5A69 A;  1Q0M A;  2L81 A;  4MTO A;  2YZS A;  3EGX A;  4U5F E;  2LFF A;  4JTD B;  3EZH A;  4PJJ A;  1JMW A;  5B3S C;  5EHH A;  4N4W A;  3ITF A;  1IW7 F;  3QW1 A;  4C7O A;  2WVN A;  4U5H A;  2W9Y A;  2X51 A;  2P1A A;  3MX3 A;  1OCO C;  2R7Q A;  1C03 A;  1JRA A;  1MNE A;  3EG9 A;  1LVK A;  2LK4 A;  2GA0 A;  3LJB A;  3N2Z B;  3ATP A;  4MVM A;  4OD5 A;  3VAY A;  1NSG B;  1YAR O;  1EQ1 A;  1JPN A;  2EIL C;  3TD7 A;  4C3B A;  4DRI B;  4ER9 A;  2P0N A;  1A7E A;  4OIP F;  1BZ4 A;  1LKX A;  1Y4C A;  3AJM A;  4MVO A;  3JZ0 A;  3U2L A;  4DOZ A;  4G78 A;  5JRA A;  3E70 C;  1E86 A;  2NSF A;  3UGP A;  1D0Z A;  4DXW A;  2EIJ C;  1MMA A;  3AQC A;  2D5R B;  3EGX B;  3QZC A;  4KBL A;  4IB4 A;  1WAS A;  1C02 A;  1JOG A;  2XLM A;  4OD4 A;  3K7D A;  3ZC4 A;  3U8V A;  2Q4F A;  4C7O B;  2I8B A;  1EA8 A;  2XLE A;  3EGD A;  3JRM O;  4CBE A;  2P7V A;  2J8W A;  3JSZ A;  1RXQ A;  1TWG A;  1DOW A;  3EG9 B;  4CS8 A;  4KC9 A;  1LI5 A;  2Q7R A;  1BR2 A;  2HSQ A;  2ZPA A;  3ASO C;  3AOU A;  4GYT A;  3FDQ A;  3LS0 A;  1MMN A;  4QI0 A;  3LEO A;  3NYJ A;  1K40 A;  5JUA A;  3UGO A;  3AQB A;  1EKY A;  5JS5 A;  4G0H A;  3GM3 A;  3HNJ A;  4I3M A;  2J46 A;  2XM4 A;  3IHU A;  3NRH A;  1LS4 A;  3EGD B;  2Z15 A;  2LQG A;  4IAO A;  4NTA A;  4FWV A;  3U5S A;  4XPX A;  4IWB A;  4MVR A;  3X2Q C;  4JCH A;  4Z9J A;  3ABM C;  4BEJ A;  2MYS A;  1VYI A;  3E9V A;  4YN0 B;  3QW0 A;  4JJG A;  1V74 B;  4IRU A;  5AC5 A;  2BC5 A;  4U5B E;  5KYU A;  2M4E A;  1O87 A;  1QQ3 A;  2A68 F;  4QI2 A;  2A1D D;  2AWY A;  2H8A A;  4I1M A;  4J32 B;  4DJ9 A;  2A6H F;  2GAQ A;  3C8G A;  3JT1 A;  4I44 A;  3GWL A;  3BEH A;  4FES A;  1T6I A;  1YA9 A;  1LM3 B;  1QZX A;  3LNR A;  4U9D A;  2ETS A;  3DZA A;  3L0I A;  2YQY A;  1HW1 A;  2WVQ A;  4J7Y A;  3T6J A;  1OKK D;  4CJO A;  5BQG A;  1VTM P;  1UG7 A;  1FFT C;  2DYS C;  2E87 A;  1I4Z A;  1ZU5 A;  3LAY A;  5L0C A;  2L6F A;  2LFD A;  1NFN A;  1G8X A;  3EZI A;  5DS4 A;  5KYU B;  3M4C A;  4JVS A;  1NLX A;  1J8Y F;  2C03 A;  3F47 A;  1J8M F;  1W2W A;  5KYW B;  2JX0 A;  2Q9A A;  3JRT A;  1RMV A;  5DQZ A;  2IXP A;  3C8G B;  2EIM C;  2KW3 C;  1U6H A;  2FGY A;  2JD3 A;  2IOQ A;  3VYW A;  3U3F A;  1FAP B;  1YZC A;  1D0Y A;  2KNH A;  1VOM A;  3EHM A;  5A6A A;  2R7W A;  3C18 A;  2IXN A;  1XZP A;  3DAG A;  3M15 A;  2R03 A;  3T9O A;  3W4Y A;  2PNO A;  3FMS A;  4CIP A;  4N06 A;  1E84 A;  4JZA A;  5L0I A;  4LDQ A;  4MW3 A;  2X0C A;  2HMQ A;  2J0X A;  3SP1 A;  3FXH A;  4U5C E;  3OA1 A;  4YT2 A;  1CGN A;  4N6C A;  4E7Z A;  4MS2 A;  1T6Q A;  3VF0 A;  1OXK A;  5CI9 A;  3WHN A;  4BJ5 A;  4Q5S F;  3B0P A;  2H7V C;  3L8J A;  1IZM A;  4RDA A;  3RQF A;  3MYF A;  3IQT A;  2W45 A;  5L0J A;  2CW0 F;  3SXZ A;  4I1O B;  4J7T A;  2ZXR A;  3X1O A;  4XQ1 A;  4HFK B;  1BR4 A;  2UUH A;  4CS8 C;  1GM5 A;  3GWN A;  1PD0 A;  3NMI A;  4LLE A;  4ULV A;  2QUP A;  4U5G A;  2XXA A;  2QNL A;  5DS5 A;  3M1C B;  1CGM E;  4NTF A;  1SMY F;  4O79 A;  1HE1 A;  4EBJ A;  2KYH A;  1YAU O;  3JYH A;  1G5Z A;  3GM2 A;  1YLM A;  3V5Z A;  1DOV A;  4AL1 A;  3MBG A;  5KYN A;  5A6J A;  2J7P A;  2W4M A;  4JRZ A;  4MTG A;  3OEO A;  1VK5 A;  4XPW A;  1VMA A;  2YLD A;  2VH3 A;  4XWJ A;  5L0F A;  1M2V A;  1RJ9 A;  1V4A A;  3DM5 A;  2XLO A;  2H7B A;  1Y6D A;  2PX3 A;  2DGJ A;  4PJM A;  2Q00 A;  2PBE A;  2AU5 A;  3WAQ A;  1MMG A;  3B9Q A;  3QVY A;  1VB5 A;  2P61 A;  1TWA A;  1A7D A;  3HJC A;  3POV A;  2NUT B;  4O7G A;  5FZT A;  1O5H A;  4U5D E;  3TQO A;  2XXA B;  1Z23 A;  4C3E A;  4W8K A;  5KYY A;  4CS7 A;  2ICW G;  3I5Q A;  2EPN A;  3ZVR A;  2DI3 A;  2J9V A;  2YL3 A;  1M57 C;  3DMD A;  4QDL A;  1KU2 A;  2IBF A;  2NSG A;  1YVI A;  2QTV A;  3ZQV A;  1FMV A;  1R4T A;  1SZI A;  4CS9 C;  4EIY A;  1TFO B;  5DLJ A;  1B68 A;  2HV7 A;  2L7A A;  2ZD9 A;  4JIO A;  4MVS A;  2YKZ A;  3AG3 C;  2PX0 A;  3NYL A;  1M2V B;  3UMH A;  1RJ9 B;  4JTC B;  3ZTM A;  2WZG A;  4CDY A;  5HSW A;  4DBQ A;  2CDQ A;  1I4Y A;  1QKR A;  2A6E F;  2XL4 A;  3DD7 A;  3US6 A;  4AK9 A;  3IQ6 A;  5CIV A;  1YA7 O;  3ABK C;  4PAC A;  3SXY A;  1ZHZ A;  1OW6 A;  4OIQ F;  3TOL A;  2XSE A;  2OJQ A;  3JCU Q;  3KKB A;  4YT5 A;  4IJJ A;  2J9U A;  3B0V C;  2LD6 A;  2R7U A;  1FTS A;  1ZW2 A;  3M79 A;  4KI2 A;  1NFO A;  2Y3G A;  2YLI A;  5COG A;  3S90 A;  1SF8 A;  3BRJ A;  4E17 A;  1H9T A;  4EBB A;  4K7B A;  2KSF A;  2ZXO A;  4PJN A;  1CGO A;  1H6G A;  2CYD A;  3AG4 C;  4NCQ A;  4A2N B;  3G50 A;  2EPK X;  3EFO A;  4JEB A;  4PK4 A;  1OCC C;  4YJW A;  2HKV A;  4ZLD A;  1KTM A;  1ZHT A;  5L3V A;  2OOC A;  2RSE B;  3O55 A;  1FNT c;  2R02 A;  3RH3 A;  3NG1 A;  4LLC A;  2EPL X;  2KQ9 A;  5JVE A;  1OKK A;  3DXJ F;  3U9M A;  4MVZ A;  2VB6 A;  3SNH A;  4Z9I A;  2KK1 A;  3HLZ A;  4N6H A;  2G62 A;  4H4K C;  4XEF A;  2XRH A;  4OIO F;  4JC7 A;  4XLN F;  5E33 A;  4G7Z F;  1L7C A;  2LSE A;  5DVW A;  4CDV A;  3WOD F;  1PD1 A;  2XLD A;  4BJ5 C;  1JPJ A;  1WN0 A;  2VC9 A;  1T9K A;  1HY5 A;  4XPY A;  3EFO B;  5TJ5 E;  1E2X A;  2CNW D;  4DBR A;  4Q4Z F;  1G4W R;  1G4U S;  2NG1 A;  3FAJ A;  2XL8 A;  3LEV A;  4FAP B;  2FAP B;  2R05 A;  5COM A;  3W8H A;  2I15 A;  1K05 A;  3S27 A;  4CS9 A;  3K66 A;  4MND A;  3RF3 A;  3ZTZ A;  2YL7 A;  4IGG A;  2WVO A;  1RKC A;  3NYM A;  4WAB A;  2R7V A;  3ZDL A;  2J0W A;  4MTF A;  1ZYR F;  3S84 A;  3RW0 A;  4H54 A;  4KNW A;  4G7H F;  1XZQ A;  1ZHY A;  2HFI A;  2M64 A;  2YLG A;  4LAC B;  3W8I A;  2P6V A;  1Q0G A;  3VRC A;  4YL0 A;  2UUI A;  4HFF B;  4R32 A;  1APC A;  3HNI A;  3S0X A;  2Y3H A;  5DS6 A;  4EKW A;  2XL6 A;  2AWC A;  3DWW A;  3H2V A;  4UDV A;  1YYX A;  3O6X A;  3TJ5 A;  1Q0K A;  1SR2 A;  4LDK A;  3NKD A;  2V26 A;  3KYJ A;  3ZSU A;  2D4U A;  2A69 F;  2XLV A;  4K1O A;  4J30 B;  5JSL A;  1OCZ C;  4JE9 A;  1AEP A;  1S05 A;  5EK0 A;  3CEX A;  2KJG A;  1V54 C;  3ZIB A;  2JPU A;  3LLI A;  3N0T A;  3U9J A;  3DAF A;  4L6R A;  4E7S A;  4ONS A;  2XLH A;  2YRF A;  4JKV A;  1A41 A;  4NQF A;  3S9O A;  1BR1 A;  1NG1 A;  3RVZ A;  3FOO A;  2B0J A;  3SYN A;  4YT4 A;  1OW7 A;  5AC4 A;  1OR3 A;  5FCL A;  1ZHW A;  3LLK A;  1D1B A;  3OWT A;  3ZG1 A;  1Z63 A;  3EH2 A;  4XLP F;  1D1A A;  3V7O A;  1T6U A;  3LNM B;  1OXB A;  3G4X A;  3HKK A;  4GEH A;  1JR8 A;  2OEX A;  1D0X A;  2FFH A;  3GAN A;  2BL2 A;  2G3V A;  3IQC A;  3RQE A;  3SXK A;  5K0I A;  3EHN A;  4PFO A;  3NDB B;  3TUL A;  2G3K A;  4C3D A;  2YEV A;  1GQA A;  2HV6 A;  4JW1 A;  1VLT A;  2EIK C;  2YL1 A;  1M6T A;  4YL1 A;  1Q0D A;  3L1M A;  4JUR I;  4AE4 A;  2CGE A;  4F4B A;  1ORJ A;  4IAQ A;  3C63 A;  4AX2 A;  2RD9 A;  4CX9 A;  2XLW A;  1Q0F A;  2DYR C;  2YWA A;  3C8G D;  4NTB A;  4NY3 A;  3T6B A;  1QVX A;  3ABL C;  3DKA A;  2CCY A;  2HMZ A;  4JCZ A;  1MMD A;  1TWC A;  3SXM A;  2XM0 A;  3C8Z A;  4BJ6 A;  2H7O A;  1ZU4 A;  3F46 A;  4BG0 A;  3EPV A;  4JTA B;  3K1H A;  3I5P A;  4PR9 A;  4CJG A;  4O6N A;  4YL3 A;  2KC3 A;  4MVQ A;  2IXO A;  3Q7L A;  2XS1 A;  3CQZ A;  4U9E A;  1UFB A;  2KGO A;  2VCC A;  1XWJ A;  1S7Z A;  1WWP A;  1YJG A;  4AE4 B;  2R7R A;  4XEK A;  3B71 A;  3NMJ A;  4PFP A;  1NBB A;  1OQC A;  4O6Y A;  4JEA A;  3QVZ A;  1OW8 A;  1VLS A;  3T4R A;  1TR2 A;  4ZLC A;  4WJ0 A;  2AVK A;  3A9C A;  1SYQ A;  2R7X A;  4XEV A;  3AGT A;  1HMO A;  3TOM A;  1MND A;  2J9W A;  1V55 C;  4MQ9 F;  2B0H A;  3GEE A;  4Z9H A;  3K33 A;  4B6I A;  2J45 A;  5JT4 A;  1D1C A;  5JLI A;  1E85 A;  5BUO A;  3NKE A;  5B1A C;  2A0U A;  5F28 E;  3B0U X;  2W4B A;  4Q7C A;  3U2M A;  3MYI A;  3GM1 A;  3ZQY A;  2QE9 A;  4NC3 A;  2EPM X;  3GEH A;  2OCC C;  4P9T A;  1K04 A;  2J9B A;  4E0H A;  2TMV P;  2GWW A;  2LP4 A;  3VM6 A;  2Y3D A;  4P9F A;  5D91 A;  4WGZ A;  2CNW A;  3MFN A;  5KYY B;  4MW8 A;  2YL0 A;  2HJ3 A;  5T3W A;  3RFY A;  5HV9 A;  4EBK A;  1E83 A;  3H65 A;  3A11 A;  1AUE A;  2VCA A;  5DQT A;  4DVY P;  3IEE A;  3MLG A;  5IY5 C;  2MHR A;  5KYX A;  1OCR C;  1QSP A;  5AGF A;  4O6M A;  2Y39 A;  3IQ5 A;  3L8I A;  4W8P A;  1OR2 A;  4BEM J;  1ORS C;  3J06 A;  3UMI A;  3M4B A;  1H7I A;  2J7P D;  3DI5 A;  5T3T A;  4OIR F;  1NZE A;  3HNL A;  4DVZ A;  5A6K A;  2HS5 A;  4CSA A;  3PCV A;  3IPM O;  3UMK A;  3W2V A;  3LUT B;  1H9G A;  4LDR A;  2L6H A;  5A6B D;  1QLE C;  1JAF A;  2WZF A;  5F5F A;  1PCX A;  1BBH A;  3TK0 A;  3UNG C;  1PV3 A;  3DJU B;  5CI8 A;  1VYK A;  2C04 A;  2GFH A;  3RKO F;  4EUK B;  1A0B A;  2YHS A;  1A7V A;  2R9R B;  2YVK A;  3DE9 A;  4P6I C;  3SZR A;  5GPG B;  1GS9 A;  3KYI A;  4BJT A;  1T01 A;  1BDJ B;  2VAS A;  1ORY A;  1LE4 A;  1U89 A;  2MWQ A;  2QY9 A;  2R7O A;  5D92 A;  3S29 A;  2ASR A;  2HZ8 A;  5KYX B;  1HW2 A;  3Q6M A;  5COF A;  5BQH A;  3PMR A;  4HE8 D;  2Q3T A;  3UR3 C;  3GOD A;  2OG2 A;  3JTL O;  2ZXP A;  3K1I A;  3TJ6 A;  5E3C A;  4YK5 A;  4X0R A;  2ZXW C;  4AL0 A;  1KNY A;  256B A;  2R7T A;  3KPH A;  4BJ6 C;  3RVY A;  3HTK C;  3JYY A;  1EI7 A;  1WGW A;  4RD9 A;  1U0B B;  2AP3 A;  1LI7 A;  1O3U A;  2O9X A;  2LIG A;  2BE5 F;  1TQG A;  4WGY A;  4DRJ B;  3CZ6 A;  2OQM A;  2WZL A;  3GEI A;  3LS1 A;  3N24 A;  4GQH A;  4M63 A;  3U0C A;  1LIH A;  4PJL A;  4YT8 A;  5KYW A;  4DRH B;  3T6G B;  4E0I A;  2Y3B A;  5BQI A;  4G7O F;  4FX5 A;  4CDA A;  3ASN C;  3FAP B;  2IM8 A;  2LCH A;  3R2P A;  2Q9C A;  3DE8 A;  4OIN F;  3S28 A;  1GGQ A;  4E18 A;  5L0G A;  3FOP A;  3O39 A;  5L3Q A;  2IYL D;  2PFD A;  1M56 C;  1YZA A;  3KMI A;  2WL8 A;  4LER A;  1ZHX A;  2OJE D;  3SEO A;  2V3C C;  2R7S A;  2PF4 E;  2L9J A;  3PDM P;  1I5N A;  1Z5Z A;  1HMD A;  2Y69 C;  1HE9 A;  2EIN C;  2HJM A;  3CSK A;  5B1B C;  2OKU A;  3L34 A;  1LE2 A;  3K6B A;  3KH2 A;  1RKE A;  3Q7G A;  4MVU A;  5F5H A;  4ANJ A;  1NU7 D;  5EGY A;  3ECS A;  3FHD A;  1LS1 A;  3U3B A;  3RYL A;  1T5O A;  1CPQ A;  2L6G A;  2OU6 A;  3I4U A;  1M2O A;  3NMK A;  4XTK A;  3RIP A;  1NU9 C;  5L0H A;  3C7J A;  1F1M A;  2A0B A;  3DJN B;  1Z6A A;  3AGU A;  3FVY A;  4KNV A;  5E2Q A;  3H2U A;  3DM9 B;  1C17 M;  3O10 A;  1LPE A;  2HSB A;  5E3A A;  1ST6 A;  3GOR A;  1WAT A;  1TFK B;  3HNK A;  3W2W A;  2DB4 A;  1Z3I X;  4EHP A;  3U8P A;  1ZW3 A;  3LES A;  5B3I A;  1AVO B;  1FFH A;  1FMW A;  1ZVZ A;  4BPM A;  4CSA C;  4IAR A;  3WG7 C;  1N1C A;  1RKE B;  3QMK A;  2PP4 A;  4ULW A;  3R7C A;  2QLA A;  2HUJ A;  1TKN A;  1ZZP A;  3QTH A;  3EQL F;  4CIH A;  3PHF 2;  1QPU A;  2VCB A;  1YYJ A;  4K0D A;  5T1D B;  3EH1 A;  2NUP A;  1FR0 A;  2NPU A;  1MQV A;  3RQG A;  5L0D A;  1TWH A;  3KL4 A;  3Q6N A;  4RBN A;  3B29 A;  3V5X A;  2NUT A;  4HEA J;  1R5I D;  3EJN A;  3ZWI A;  1YDI A;  4EWC A;  1Z7Q c;  4D4X A;  1CPR A;  1WTY A;  4JJF A;  3AG1 C;  2F22 A;  3JSE O;  2WB7 A;  4BJ1 A;  1RCP A;  3AG2 C;  2GDC A;  4A4A A;  3G4Z A;  4D4N A;  1WOL A;  2Q9B A;  2OEV A; 
#chains in the Genus database with same CATH homology
 3U2M A;  3R7C A;  3TK0 A;  3U5S A;  1JR8 A;  4E0H A;  4LDK A;  2HJ3 A;  1OQC A;  3GWN A;  1JRA A;  3LLI A;  4E0I A;  3TD7 A;  3O55 A;  3GWL A;  3U2L A;  3W4Y A;  3MBG A;  3LLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...