3O55A

Crystal structure of human fad-linked augmenter of liver regeneration (alr)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Augmenter of liver regeneration
publication title Molecular recognition and substrate mimicry drive the electron-transfer process between MIA40 and ALR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 43
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3o55A00
3MBGA 3O55A 3GWLA 3W4YA 3TD7A 4LDKA 4E0HA 3U2MA 1JRAA 1JR8A 3LLKA 1OQCA 3U5SA 3LLIA 2HJ3A 3TK0A 4E0IA 3R7CA 3GWNA 3U2LA
chains in the Genus database with same CATH superfamily
1YYXA 1NG1A 3NYJA 4CS8C 2YZSA 2XLEA 3KL4A 3PHF2 4B6IA 4U9EA 4U5FE 4Q4ZF 2Y3HA 1H7IA 1RJ9A 1ZHWA 2CNWD 3NMIA 2R05A 1L3PA 2R7VA 2KGOA 1TFOB 1OR3A 4C7OA 3TJ5A 2W4BA 1OXKA 2A6EF 5KYUA 3AJMA 4I1OB 1GGQA 3HNKA 2VH3A 1OQCA 3QZCA 1T5OA 2LK4A 2YRFA 4O6NA 1LI5A 4J32B 4CX9A 1E84A 3I5PA 3G4ZA 5KYYA 2HJ3A 3S29A 1Y4CA 3WODF 3CEXA 2OU6A 2YKZA 4F4BA 1Q0DA 4MNDA 4CDAA 4DRHB 1VLSA 4N06A 2EILC 3U8PA 3DI5A 4J7TA 2R7OA 3C63A 3HTKC 3O10A 4XLNF 3GM3A 3ZTMA 1OCRC 2PX3A 1TR2A 1D1BA 3EGXA 3MBGA 4LACB 3RW0A 4FAPB 2OEVA 3ZIBA 5L3VA 4OD4A 4EBKA 2P6VA 1A41A 1AUEA 2J9WA 1OW8A 2KYHA 3H2VA 3LS0A 4JKVA 1RKCA 2EPOA 1NLXA 1Y6DA 4JJGA 3EH1A 5B3SC 1NU7D 2NUTA 2KC3A 5COFA 3U8VA 5EGYA 2P0NA 2R7UA 4L6RA 1CGNA 3L34A 1SR2A 3US6A 3SNHA 2L6HA 2CW0F 4RDAA 3IHUA 4IAQA 3GEIA 2WVQA 2XL4A 2PX0A 3B29A 1U6HA 3HKKA 4NY3A 1V4AA 1Z3IX 4O79A 3MFNA 3UGOA 4CJOA 4DBQA 4WJ0A 1PCXA 2XXAA 4JE9A 2XS1A 1Z6AA 4GYTA 1E2XA 2A0BA 1W2WA 4CS9C 3GWLA 3TJ6A 4YWQA 2WVOA 2P61A 1F1MA 4JURI 2KW3C 3T9OA 3DD7A 3C62A 3POVA 2ZPAA 4U5GA 3VM6A 1V74B 3HLZA 2L9JA 3B0PA 4AK9A 2Y39A 5D91A 5JP7A 3UMKA 1DOWA 3B9QA 1C03A 2Z15A 4PJNA 4UDVA 3SXYA 4P6IC 1M57C 2IXNA 3RH3A 3SYNA 3HNJA 1YJGA 5DVWA 2QLAA 1D0YA 1QSPA 2JX0A 3JT1A 3I5QA 4IGGA 2R02A 3T6BA 1M6TA 1RKEA 1WOLA 1Q0MA 5F5HA 4E0IA 1M2VA 1SF8A 2VCAA 4KI2A 2J46A 4BJ1A 3KH2A 3IQ5A 4XEKA 2G3KA 2GFHA 3PMRA 4HFKB 4PACA 1Q0KA 2WZLA 1J8MF 5JLIA 1VTMP 3EG9A 4JCZA 2J9UA 3VRCA 3MYFA 3EFOB 4CIPA 3K33A 3HNIA 3C8GB 3EHMA 3NMJA 4FX5A 2EIJC 4CSAC 2LFDA 1A7EA 2L6FA 1YZCA 3FOPA 3VYWA 4DJ9A 1TFKB 4OIRF 2EPNA 3M79A 1TQGA 4I1MA 5BQIA 2H8AA 2J45A 2Q7RA 1A0BA 2UUHA 2LIGA 1T9KA 4BJ6A 1LKXA 3Q7LA 5IY5C 4JJFA 4OIOF 2CGEA 3SP1A 2G62A 2X0CA 4CBEA 1ZW3A 3L8IA 2J8WA 1L7CA 3ASOC 1I5NA 1D1AA 1BBHA 4PJLA 4CIHA 4C3BA 3TOLA 1OCZC 4DRJB 1FTSA 1LE2A 1VOMA 3ZQVA 4KC9A 4ULVA 3ABKC 4AE4A 1RCPA 2WVNA 1OCOC 2EIKC 4MVSA 3B0UX 4Q7CA 2EPKX 2XLMA 3RFYA 2OCCC 3KPHA 4XLPF 1WWPA 2OEXA 1CGME 2EPLX 1A7DA 2EPMX 2YEVA 2A69F 3G4XA 3DM5A 4NCQA 2R03A 2LQGA 2XLDA 4AL1A 1G4US 2YWAA 3EH2A 3DAFA 3N2ZB 2PP4A 2JD3A 1EI7A 1R5ID 3FAJA 5KYYB 3JRMO 4EBBA 2M64A 4MQ9F 3JYHA 1PV3A 4BJ5C 2TMVP 2A68F 2I8BA 4WGZA 3TQOA 5L0FA 1AVOB 1U89A 3E70C 5BQGA 5KYWA 2JPUA 2AU5A 5DQTA 2IYLD 3DE9A 1O3UA 2FGYA 3LUTB 2R7WA 4IRUA 2L7AA 3ZTZA 3S0XA 3EGDB 1G8XA 1A7VA 2HSBA 3T6JA 2Q4FA 4K0DA 4MVMA 2C03A 5CI9A 4JW1A 4OINF 4Z9HA 1XWJA 3KYIA 4JZAA 3ZSUA 5L0CA 1FMWA 3K66A 4U5EE 3ZDLA 1SYQA 4C3DA 5DLJA 4JTDB 2QUPA 3Q6NA 3NDBB 3Q7GA 2WB7A 2W45A 1R4TA 1YDIA 4HE8D 1QZXA 2ASRA 3WAQA 4IARA 4G7HF 2EIMC 2F22A 2WZGA 4D4NA 5KYXB 5JS5A 1E83A 2XLOA 3GM1A 3ITFA 4YT5A 2H7OA 1Z63A 3U3FA 1ZU4A 2OJED 2ZXRA 5EK0A 5F28E 4YK5A 3UMHA 1JPNA 3F46A 3W4YA 5BUOA 3SZRA 2L6GA 1NU9C 2HMQA 3DKAA 3W2VA 3I4UA 2XLWA 3VF0A 4G7ZF 1JAFA 1TWHA 2XL6A 1E85A 1MNEA 2OQMA 2XM0A 2AWYA 3JYYA 1G4WR 2LCHA 2HS5A 5DS5A 3FMSA 4PFOA 5KYNA 1DOVA 3G50A 1E86A 4JTAB 1NBBA 3O39A 1C17M 1RXQA 2KNHA 5B1BC 3L8JA 1UFBA 2IOQA 3V5XA 4RBNA 3NYLA 2QY9A 5B1AC 4DRIB 2MYSA 3AG2C 1OW7A 1JPJA 1NSGB 1SMYF 2VB6A 3GEHA 5T3WA 3LJBA 5HSWA 2RD9A 3AG4C 4MS2A 4MW3A 2GAQA 1TWCA 2HFIA 3EG9B 3U9MA 4BJ6C 1V55C 3CZ6A 1CPQA 1QLEC 3EZIA 2WZFA 4EWCA 2NG1A 4XEFA 4E7SA 2VCBA 5B3IA 1YARO 3MLGA 4JIOA 3ABLC 1T6QA 1M2OA 2X51A 3K1HA 2H7VC 4K1OA 3IEEA 2XLHA 4MVRA 2CYDA 3N0TA 2NSFA 3S84A 3LEOA 4O6YA 4W8PA 3B71A 1JOGA 4CS8A 4CDVA 3JSEO 2ZD9A 1OKKA 3K1IC 3LLKA 2NPUA 3QVZA 1LS4A 1Q0FA 1ZYRF 2KSFA 2P1AA 4G78A 4ZLCA 3OEOA 1WGWA 1ZVZA 3ZG1A 1FFHA 2HV7A 1OKKD 2V26A 4MVUA 4NC3A 4G7OF 1HE9A 4MTFA 4ONSA 4G0HA 4RD9A 1OW6A 5JT4A 2ICWG 2Q00A 1S05A 4NQFA 1KU2A 3NG1A 1FFTC 3LAYA 1OR2A 2OJQA 3GORA 3JTLO 3LS1A 2HKVA 1T01A 3B0VC 2NUPB 1BDJB 2Q9BA 3IQ6A 2ZXWC 1FNTc 3TOMA 5AC5A 4OIPF 3X2QC 4DXWA 1J8YF 4W8KA 3MYIA 3BRJA 3SXMA 1M56C 5JUAA 4E17A 4XPXA 1C02A 2V3CC 4FESA 5E2QA 2E87A 1SZIA 2YLDA 1EKYA 1ZHXA 2P7VA 3TULA 4CDYA 4YT2A 4E18A 2ETSA 2G3VA 3DWWA 4YJWA 2EINC 4BPMA 2J7PA 3C8ZA 3DJUB 1HE1A 4Z9IA 3L1MA 4ANJA 5DS6A 3PDMP 1ORJA 3AQBA 3QW0A 4JC7A 3MX3A 4KNVA 2DYSC 1Q0GA 3IPMO 2IXOA 4J7YA 4XEVA 2CDQA 5DQZA 4BEMJ 1IW7F 2J7PD 1PD1A 5L0GA 2QNLA 3SXKA 1I4ZA 2M4EA 5FZTA 3RVZA 4A4AA 1EA8A 2LD6A 2OKUA 1JMWA 1N1CA 2R25A 2XM4A 4MTOA 3QW1A 2J0XA 1RJ9B 1YVIA 2D4UA 4E0HA 4QDLA 2HUJA 3GEEA 4CS9A 4YT4A 1JRAA 4N6CA 4XPYA 3NKEA 1LVKA 1VYIA 4C7OB 3KKBA 2IM8A 3HNLA 3LNMB 4R32A 4XWJA 5A6KA 5KYUB 1S7ZA 3AG3C 2YQYA 1QKRA 1V54C 4WABA 2QE9A 4P9FA 1HW1A 2DYRC 4DOZA 3R7CA 2VC9A 2KJGA 2I15A 4NTBA 2PFDA 1LE4A 4NTAA 4AX2A 4IAOA 2DI3A 5L0IA 3C8GA 2HZ8A 5CIVA 3ATPA 1WATA 3C18A 2A1DD 3RKOF 3ECSA 1TWGA 3RQGA 4IWBA 1B68A 4MTGA 1KNYA 4EIYA 2LP4A 3C8GD 3EGXB 2YLGA 3TD7A 3UNGC 4EKWA 1OXBA 1ZHYA 1LM3B 2CCYA 4J30B 3RIPA 2IXPA 1VLTA 3GANA 2HMZA 3A9CA 3ZQYA 1CGOA 3X1OA 2NUTB 2W4MA 2GWWA 3GODA 1JR8A 3U0CA 3LESA 3QVYA 1ZU5A 4CSAA 2L81A 3AGUA 4H4KC 3JZ0A 2R7RA 3E9VA 4YT8A 3OWTA 1ST6A 2A6HF 2BL2A 1YZAA 4BG0A 5E3AA 3DXJF 4GEHA 2DB4A 4LLCA 3EZHA 2Y3GA 1ZHZA 1NFOA 2RSEB 4P9TA 1Z7Qc 1VMAA 1LIHA 3RQFA 4U5BE 5E33A 2PNOA 2Q9AA 4KBLA 4GQHA 1XZQA 3JRTA 2XXAB 5TJ5E 1KTMA 5JRAA 5JVEA 1OCCC 3EHNA 1EQ1A 4JTCB 1UG7A 2HJMA 2J9VA 2ZXOA 4U5HA 4YL1A 3V5ZA 3DM9B 3ZWIA 4AL0A 2FFHA 2XL8A 4E7ZA 2R7TA 4M63A 1D1CA 1CPRA 3RVYA 2HSQA 3V7OA 1GS9A 1D0ZA 3W2WA 3ASNC 5K0IA 1ZHTA 3DMDA 3A11A 2DGJA 5COGA 4PR9A 2KQ9A 4XQ1A 1YAUO 3FAPB 4XPWA 3T6GB 1RKEB 3H65A 4CS7A 3SEOA 1M2VB 5A6BA 1APCA 4JVSA 2AWCA 2BC5A 1QVXA 2MHRA 2UUIA 4ULWA 5CI8A 4ZLDA 3M4BA 3EGDA 3OA1A 1MMGA 3L0IA 3UGPA 1I4YA 3R2PA 5A6BD 2B0HA 3M1CB 1HW2A 4Q5SF 3AOUA 2R7SA 2Y69C 2ZXPA 3UMIA 4ER9A 4YL0A 1T6UA 4O6MA 4JCHA 1RMVA 4BJ5A 1HMDA 1O87A 2YLIA 1T6IA 4DVZA 5JSLA 4JEBA 1VYKA 1YA9A 3AQCA 5GPGB 1LI7A 4D4XA 3U2MA 256BA 3SXZA 1LPEA 2Q3TA 2MWQA 4YN0B 3C7JA 3NKDA 1K04A 3IQCA 3U5SA 2AP3A 5EHHA 1MMDA 4JRZA 3LLIA 4O7GA 2VASA 3K6BA 5L0DA 5KYXA 2IXMA 4WGYA 4H54A 4MVZA 3TK0A 4HFFB 1NFNA 3CQZA 4Z9JA 1HMOA 3AGTA 3EQLF 3JSZA 3M15A 3KYJA 4N4WA 4MVQA 3WG7C 1YA7O 2NSGA 2PBEA 4PFPA 3NMKA 4N6HA 5FCLA 1HY5A 2WL8A 1ZW2A 1K40A 2YL3A 4K7BA 3FHDA 4YL3A 1WN0A 3F47A 4LLEA 3S28A 3Q6MA 3V5YA 3W8HA 4I3MA 5T3TA 5A6JA 3EJNA 3ABMC 3H2UA 4MW8A 4AE4B 1ORYA 3K7DA 3S9OA 2Y3BA 5L0HA 3JCUQ 4DVYP 2H7BA 2R9RB 3EPVA 1H9GA 1IZMA 1ZZPA 2YL1A 4OIQF 4IJJA 4FWVA 1MQVA 1WASA 1XZPA 4DBRA 1NZEA 1Z5ZA 4PJJA 5D92A 3FDQA 2FAPB 3S27A 4CJGA 2QTVA 3DE8A 1WTYA 2O9XA 4BEJA 2LSEA 3PCVA 3DAGA 3U9JA 1BR2A 4C3EA 4JEAA 1H9TA 3ZC4A 2LFFA 3O55A 3W8IA 4U5CE 3CSKA 1VK5A 2OOCA 5AC4A 3KMIA 2YVKA 4U5DE 2Y3DA 2C04A 4MVOA 2AVKA 5KYWB 2W9YA 3O6XA 1LS1A 5T1DB 3RYLA 4QI0A 3T4RA 3FVYA 4LDKA 1G5ZA 1ORSC 1TWAA 3QMKA 4OD5A 5A69A 4QI2A 1K05A 2R7XA 3FOOA 1MMAA 5L0JA 1BR4A 3BEHA 4IB4A 5COMA 2B0JA 5HV9A 2J9BA 2BE5F 2OG2A 1MMNA 3U3BA 2A0UA 3ZVRA 2YL0A 3LEVA 4A2NB 4HEAJ 1O5HA 1VB5A 4NTFA 3WHNA 3IQTA 3GM2A 2KK1A 4LDRA 4PK4A 4U9DA 2XLVA 2NUPA 3K1IA 3UR3C 3S90A 2GDCA 2XS8A 3EFOA 4I44A 1YYJA 1BZ4A 5L3QA 2IBFA 4EHPA 3J06A 3N24A 1D0XA 4BJTA 3CAXA 4PJMA 3DZAA 2YHSA 3DJNB 5A6AA 2PF4E 3NRHA 3NYMA 2Q9CA 3HJCA 1GQAA 3FXHA 2VCCA 3M4CA 2D5RB 1H6GA 3RQEA 2XRHA 2XSEA 3LNRA 4KNWA 3RF3A 1FR0A 2J0WA 1FAPB 1AEPA 5BQHA 1MNDA 1BR1A 2YL7A 4EUKB 5DS4A 4LERA 1PD0A 1FMVA 3AG1C 3VAYA 1QQ3A 1U0BB 5F5FA 2GA0A 4X0RA 5AGFA 5E3CA 3GWNA 1Z23A 2R7QA 1TKNA 3QTHA 3U2LA 4LDQA 4EBJA 2HV6A 1YLMA 4XTKA 1GM5A 2CNWA 1QPUA
chains in the Genus database with same CATH topology
3MBGA 3O55A 3GWLA 3W4YA 3TD7A 4LDKA 4E0HA 3U2MA 1JRAA 1JR8A 3LLKA 1OQCA 3U5SA 3LLIA 2HJ3A 3TK0A 4E0IA 3R7CA 3GWNA 3U2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MBG A;  3O55 A;  3GWL A;  3W4Y A;  3TD7 A;  4LDK A;  4E0H A;  3U2M A;  1JRA A;  1JR8 A;  3LLK A;  1OQC A;  3U5S A;  3LLI A;  2HJ3 A;  3TK0 A;  4E0I A;  3R7C A;  3GWN A;  3U2L A; 
#chains in the Genus database with same CATH topology
 1YYX A;  1NG1 A;  3NYJ A;  4CS8 C;  2YZS A;  2XLE A;  3KL4 A;  3PHF 2;  4B6I A;  4U9E A;  4U5F E;  4Q4Z F;  2Y3H A;  1H7I A;  1RJ9 A;  1ZHW A;  2CNW D;  3NMI A;  2R05 A;  1L3P A;  2R7V A;  2KGO A;  1TFO B;  1OR3 A;  4C7O A;  3TJ5 A;  2W4B A;  1OXK A;  2A6E F;  5KYU A;  3AJM A;  4I1O B;  1GGQ A;  3HNK A;  2VH3 A;  1OQC A;  3QZC A;  1T5O A;  2LK4 A;  2YRF A;  4O6N A;  1LI5 A;  4J32 B;  4CX9 A;  1E84 A;  3I5P A;  3G4Z A;  5KYY A;  2HJ3 A;  3S29 A;  1Y4C A;  3WOD F;  3CEX A;  2OU6 A;  2YKZ A;  4F4B A;  1Q0D A;  4MND A;  4CDA A;  4DRH B;  1VLS A;  4N06 A;  2EIL C;  3U8P A;  3DI5 A;  4J7T A;  2R7O A;  3C63 A;  3HTK C;  3O10 A;  4XLN F;  3GM3 A;  3ZTM A;  1OCR C;  2PX3 A;  1TR2 A;  1D1B A;  3EGX A;  3MBG A;  4LAC B;  3RW0 A;  4FAP B;  2OEV A;  3ZIB A;  5L3V A;  4OD4 A;  4EBK A;  2P6V A;  1A41 A;  1AUE A;  2J9W A;  1OW8 A;  2KYH A;  3H2V A;  3LS0 A;  4JKV A;  1RKC A;  2EPO A;  1NLX A;  1Y6D A;  4JJG A;  3EH1 A;  5B3S C;  1NU7 D;  2NUT A;  2KC3 A;  5COF A;  3U8V A;  5EGY A;  2P0N A;  2R7U A;  4L6R A;  1CGN A;  3L34 A;  1SR2 A;  3US6 A;  3SNH A;  2L6H A;  2CW0 F;  4RDA A;  3IHU A;  4IAQ A;  3GEI A;  2WVQ A;  2XL4 A;  2PX0 A;  3B29 A;  1U6H A;  3HKK A;  4NY3 A;  1V4A A;  1Z3I X;  4O79 A;  3MFN A;  3UGO A;  4CJO A;  4DBQ A;  4WJ0 A;  1PCX A;  2XXA A;  4JE9 A;  2XS1 A;  1Z6A A;  4GYT A;  1E2X A;  2A0B A;  1W2W A;  4CS9 C;  3GWL A;  3TJ6 A;  4YWQ A;  2WVO A;  2P61 A;  1F1M A;  4JUR I;  2KW3 C;  3T9O A;  3DD7 A;  3C62 A;  3POV A;  2ZPA A;  4U5G A;  3VM6 A;  1V74 B;  3HLZ A;  2L9J A;  3B0P A;  4AK9 A;  2Y39 A;  5D91 A;  5JP7 A;  3UMK A;  1DOW A;  3B9Q A;  1C03 A;  2Z15 A;  4PJN A;  4UDV A;  3SXY A;  4P6I C;  1M57 C;  2IXN A;  3RH3 A;  3SYN A;  3HNJ A;  1YJG A;  5DVW A;  2QLA A;  1D0Y A;  1QSP A;  2JX0 A;  3JT1 A;  3I5Q A;  4IGG A;  2R02 A;  3T6B A;  1M6T A;  1RKE A;  1WOL A;  1Q0M A;  5F5H A;  4E0I A;  1M2V A;  1SF8 A;  2VCA A;  4KI2 A;  2J46 A;  4BJ1 A;  3KH2 A;  3IQ5 A;  4XEK A;  2G3K A;  2GFH A;  3PMR A;  4HFK B;  4PAC A;  1Q0K A;  2WZL A;  1J8M F;  5JLI A;  1VTM P;  3EG9 A;  4JCZ A;  2J9U A;  3VRC A;  3MYF A;  3EFO B;  4CIP A;  3K33 A;  3HNI A;  3C8G B;  3EHM A;  3NMJ A;  4FX5 A;  2EIJ C;  4CSA C;  2LFD A;  1A7E A;  2L6F A;  1YZC A;  3FOP A;  3VYW A;  4DJ9 A;  1TFK B;  4OIR F;  2EPN A;  3M79 A;  1TQG A;  4I1M A;  5BQI A;  2H8A A;  2J45 A;  2Q7R A;  1A0B A;  2UUH A;  2LIG A;  1T9K A;  4BJ6 A;  1LKX A;  3Q7L A;  5IY5 C;  4JJF A;  4OIO F;  2CGE A;  3SP1 A;  2G62 A;  2X0C A;  4CBE A;  1ZW3 A;  3L8I A;  2J8W A;  1L7C A;  3ASO C;  1I5N A;  1D1A A;  1BBH A;  4PJL A;  4CIH A;  4C3B A;  3TOL A;  1OCZ C;  4DRJ B;  1FTS A;  1LE2 A;  1VOM A;  3ZQV A;  4KC9 A;  4ULV A;  3ABK C;  4AE4 A;  1RCP A;  2WVN A;  1OCO C;  2EIK C;  4MVS A;  3B0U X;  4Q7C A;  2EPK X;  2XLM A;  3RFY A;  2OCC C;  3KPH A;  4XLP F;  1WWP A;  2OEX A;  1CGM E;  2EPL X;  1A7D A;  2EPM X;  2YEV A;  2A69 F;  3G4X A;  3DM5 A;  4NCQ A;  2R03 A;  2LQG A;  2XLD A;  4AL1 A;  1G4U S;  2YWA A;  3EH2 A;  3DAF A;  3N2Z B;  2PP4 A;  2JD3 A;  1EI7 A;  1R5I D;  3FAJ A;  5KYY B;  3JRM O;  4EBB A;  2M64 A;  4MQ9 F;  3JYH A;  1PV3 A;  4BJ5 C;  2TMV P;  2A68 F;  2I8B A;  4WGZ A;  3TQO A;  5L0F A;  1AVO B;  1U89 A;  3E70 C;  5BQG A;  5KYW A;  2JPU A;  2AU5 A;  5DQT A;  2IYL D;  3DE9 A;  1O3U A;  2FGY A;  3LUT B;  2R7W A;  4IRU A;  2L7A A;  3ZTZ A;  3S0X A;  3EGD B;  1G8X A;  1A7V A;  2HSB A;  3T6J A;  2Q4F A;  4K0D A;  4MVM A;  2C03 A;  5CI9 A;  4JW1 A;  4OIN F;  4Z9H A;  1XWJ A;  3KYI A;  4JZA A;  3ZSU A;  5L0C A;  1FMW A;  3K66 A;  4U5E E;  3ZDL A;  1SYQ A;  4C3D A;  5DLJ A;  4JTD B;  2QUP A;  3Q6N A;  3NDB B;  3Q7G A;  2WB7 A;  2W45 A;  1R4T A;  1YDI A;  4HE8 D;  1QZX A;  2ASR A;  3WAQ A;  4IAR A;  4G7H F;  2EIM C;  2F22 A;  2WZG A;  4D4N A;  5KYX B;  5JS5 A;  1E83 A;  2XLO A;  3GM1 A;  3ITF A;  4YT5 A;  2H7O A;  1Z63 A;  3U3F A;  1ZU4 A;  2OJE D;  2ZXR A;  5EK0 A;  5F28 E;  4YK5 A;  3UMH A;  1JPN A;  3F46 A;  3W4Y A;  5BUO A;  3SZR A;  2L6G A;  1NU9 C;  2HMQ A;  3DKA A;  3W2V A;  3I4U A;  2XLW A;  3VF0 A;  4G7Z F;  1JAF A;  1TWH A;  2XL6 A;  1E85 A;  1MNE A;  2OQM A;  2XM0 A;  2AWY A;  3JYY A;  1G4W R;  2LCH A;  2HS5 A;  5DS5 A;  3FMS A;  4PFO A;  5KYN A;  1DOV A;  3G50 A;  1E86 A;  4JTA B;  1NBB A;  3O39 A;  1C17 M;  1RXQ A;  2KNH A;  5B1B C;  3L8J A;  1UFB A;  2IOQ A;  3V5X A;  4RBN A;  3NYL A;  2QY9 A;  5B1A C;  4DRI B;  2MYS A;  3AG2 C;  1OW7 A;  1JPJ A;  1NSG B;  1SMY F;  2VB6 A;  3GEH A;  5T3W A;  3LJB A;  5HSW A;  2RD9 A;  3AG4 C;  4MS2 A;  4MW3 A;  2GAQ A;  1TWC A;  2HFI A;  3EG9 B;  3U9M A;  4BJ6 C;  1V55 C;  3CZ6 A;  1CPQ A;  1QLE C;  3EZI A;  2WZF A;  4EWC A;  2NG1 A;  4XEF A;  4E7S A;  2VCB A;  5B3I A;  1YAR O;  3MLG A;  4JIO A;  3ABL C;  1T6Q A;  1M2O A;  2X51 A;  3K1H A;  2H7V C;  4K1O A;  3IEE A;  2XLH A;  4MVR A;  2CYD A;  3N0T A;  2NSF A;  3S84 A;  3LEO A;  4O6Y A;  4W8P A;  3B71 A;  1JOG A;  4CS8 A;  4CDV A;  3JSE O;  2ZD9 A;  1OKK A;  3K1I C;  3LLK A;  2NPU A;  3QVZ A;  1LS4 A;  1Q0F A;  1ZYR F;  2KSF A;  2P1A A;  4G78 A;  4ZLC A;  3OEO A;  1WGW A;  1ZVZ A;  3ZG1 A;  1FFH A;  2HV7 A;  1OKK D;  2V26 A;  4MVU A;  4NC3 A;  4G7O F;  1HE9 A;  4MTF A;  4ONS A;  4G0H A;  4RD9 A;  1OW6 A;  5JT4 A;  2ICW G;  2Q00 A;  1S05 A;  4NQF A;  1KU2 A;  3NG1 A;  1FFT C;  3LAY A;  1OR2 A;  2OJQ A;  3GOR A;  3JTL O;  3LS1 A;  2HKV A;  1T01 A;  3B0V C;  2NUP B;  1BDJ B;  2Q9B A;  3IQ6 A;  2ZXW C;  1FNT c;  3TOM A;  5AC5 A;  4OIP F;  3X2Q C;  4DXW A;  1J8Y F;  4W8K A;  3MYI A;  3BRJ A;  3SXM A;  1M56 C;  5JUA A;  4E17 A;  4XPX A;  1C02 A;  2V3C C;  4FES A;  5E2Q A;  2E87 A;  1SZI A;  2YLD A;  1EKY A;  1ZHX A;  2P7V A;  3TUL A;  4CDY A;  4YT2 A;  4E18 A;  2ETS A;  2G3V A;  3DWW A;  4YJW A;  2EIN C;  4BPM A;  2J7P A;  3C8Z A;  3DJU B;  1HE1 A;  4Z9I A;  3L1M A;  4ANJ A;  5DS6 A;  3PDM P;  1ORJ A;  3AQB A;  3QW0 A;  4JC7 A;  3MX3 A;  4KNV A;  2DYS C;  1Q0G A;  3IPM O;  2IXO A;  4J7Y A;  4XEV A;  2CDQ A;  5DQZ A;  4BEM J;  1IW7 F;  2J7P D;  1PD1 A;  5L0G A;  2QNL A;  3SXK A;  1I4Z A;  2M4E A;  5FZT A;  3RVZ A;  4A4A A;  1EA8 A;  2LD6 A;  2OKU A;  1JMW A;  1N1C A;  2R25 A;  2XM4 A;  4MTO A;  3QW1 A;  2J0X A;  1RJ9 B;  1YVI A;  2D4U A;  4E0H A;  4QDL A;  2HUJ A;  3GEE A;  4CS9 A;  4YT4 A;  1JRA A;  4N6C A;  4XPY A;  3NKE A;  1LVK A;  1VYI A;  4C7O B;  3KKB A;  2IM8 A;  3HNL A;  3LNM B;  4R32 A;  4XWJ A;  5A6K A;  5KYU B;  1S7Z A;  3AG3 C;  2YQY A;  1QKR A;  1V54 C;  4WAB A;  2QE9 A;  4P9F A;  1HW1 A;  2DYR C;  4DOZ A;  3R7C A;  2VC9 A;  2KJG A;  2I15 A;  4NTB A;  2PFD A;  1LE4 A;  4NTA A;  4AX2 A;  4IAO A;  2DI3 A;  5L0I A;  3C8G A;  2HZ8 A;  5CIV A;  3ATP A;  1WAT A;  3C18 A;  2A1D D;  3RKO F;  3ECS A;  1TWG A;  3RQG A;  4IWB A;  1B68 A;  4MTG A;  1KNY A;  4EIY A;  2LP4 A;  3C8G D;  3EGX B;  2YLG A;  3TD7 A;  3UNG C;  4EKW A;  1OXB A;  1ZHY A;  1LM3 B;  2CCY A;  4J30 B;  3RIP A;  2IXP A;  1VLT A;  3GAN A;  2HMZ A;  3A9C A;  3ZQY A;  1CGO A;  3X1O A;  2NUT B;  2W4M A;  2GWW A;  3GOD A;  1JR8 A;  3U0C A;  3LES A;  3QVY A;  1ZU5 A;  4CSA A;  2L81 A;  3AGU A;  4H4K C;  3JZ0 A;  2R7R A;  3E9V A;  4YT8 A;  3OWT A;  1ST6 A;  2A6H F;  2BL2 A;  1YZA A;  4BG0 A;  5E3A A;  3DXJ F;  4GEH A;  2DB4 A;  4LLC A;  3EZH A;  2Y3G A;  1ZHZ A;  1NFO A;  2RSE B;  4P9T A;  1Z7Q c;  1VMA A;  1LIH A;  3RQF A;  4U5B E;  5E33 A;  2PNO A;  2Q9A A;  4KBL A;  4GQH A;  1XZQ A;  3JRT A;  2XXA B;  5TJ5 E;  1KTM A;  5JRA A;  5JVE A;  1OCC C;  3EHN A;  1EQ1 A;  4JTC B;  1UG7 A;  2HJM A;  2J9V A;  2ZXO A;  4U5H A;  4YL1 A;  3V5Z A;  3DM9 B;  3ZWI A;  4AL0 A;  2FFH A;  2XL8 A;  4E7Z A;  2R7T A;  4M63 A;  1D1C A;  1CPR A;  3RVY A;  2HSQ A;  3V7O A;  1GS9 A;  1D0Z A;  3W2W A;  3ASN C;  5K0I A;  1ZHT A;  3DMD A;  3A11 A;  2DGJ A;  5COG A;  4PR9 A;  2KQ9 A;  4XQ1 A;  1YAU O;  3FAP B;  4XPW A;  3T6G B;  1RKE B;  3H65 A;  4CS7 A;  3SEO A;  1M2V B;  5A6B A;  1APC A;  4JVS A;  2AWC A;  2BC5 A;  1QVX A;  2MHR A;  2UUI A;  4ULW A;  5CI8 A;  4ZLD A;  3M4B A;  3EGD A;  3OA1 A;  1MMG A;  3L0I A;  3UGP A;  1I4Y A;  3R2P A;  5A6B D;  2B0H A;  3M1C B;  1HW2 A;  4Q5S F;  3AOU A;  2R7S A;  2Y69 C;  2ZXP A;  3UMI A;  4ER9 A;  4YL0 A;  1T6U A;  4O6M A;  4JCH A;  1RMV A;  4BJ5 A;  1HMD A;  1O87 A;  2YLI A;  1T6I A;  4DVZ A;  5JSL A;  4JEB A;  1VYK A;  1YA9 A;  3AQC A;  5GPG B;  1LI7 A;  4D4X A;  3U2M A;  256B A;  3SXZ A;  1LPE A;  2Q3T A;  2MWQ A;  4YN0 B;  3C7J A;  3NKD A;  1K04 A;  3IQC A;  3U5S A;  2AP3 A;  5EHH A;  1MMD A;  4JRZ A;  3LLI A;  4O7G A;  2VAS A;  3K6B A;  5L0D A;  5KYX A;  2IXM A;  4WGY A;  4H54 A;  4MVZ A;  3TK0 A;  4HFF B;  1NFN A;  3CQZ A;  4Z9J A;  1HMO A;  3AGT A;  3EQL F;  3JSZ A;  3M15 A;  3KYJ A;  4N4W A;  4MVQ A;  3WG7 C;  1YA7 O;  2NSG A;  2PBE A;  4PFP A;  3NMK A;  4N6H A;  5FCL A;  1HY5 A;  2WL8 A;  1ZW2 A;  1K40 A;  2YL3 A;  4K7B A;  3FHD A;  4YL3 A;  1WN0 A;  3F47 A;  4LLE A;  3S28 A;  3Q6M A;  3V5Y A;  3W8H A;  4I3M A;  5T3T A;  5A6J A;  3EJN A;  3ABM C;  3H2U A;  4MW8 A;  4AE4 B;  1ORY A;  3K7D A;  3S9O A;  2Y3B A;  5L0H A;  3JCU Q;  4DVY P;  2H7B A;  2R9R B;  3EPV A;  1H9G A;  1IZM A;  1ZZP A;  2YL1 A;  4OIQ F;  4IJJ A;  4FWV A;  1MQV A;  1WAS A;  1XZP A;  4DBR A;  1NZE A;  1Z5Z A;  4PJJ A;  5D92 A;  3FDQ A;  2FAP B;  3S27 A;  4CJG A;  2QTV A;  3DE8 A;  1WTY A;  2O9X A;  4BEJ A;  2LSE A;  3PCV A;  3DAG A;  3U9J A;  1BR2 A;  4C3E A;  4JEA A;  1H9T A;  3ZC4 A;  2LFF A;  3O55 A;  3W8I A;  4U5C E;  3CSK A;  1VK5 A;  2OOC A;  5AC4 A;  3KMI A;  2YVK A;  4U5D E;  2Y3D A;  2C04 A;  4MVO A;  2AVK A;  5KYW B;  2W9Y A;  3O6X A;  1LS1 A;  5T1D B;  3RYL A;  4QI0 A;  3T4R A;  3FVY A;  4LDK A;  1G5Z A;  1ORS C;  1TWA A;  3QMK A;  4OD5 A;  5A69 A;  4QI2 A;  1K05 A;  2R7X A;  3FOO A;  1MMA A;  5L0J A;  1BR4 A;  3BEH A;  4IB4 A;  5COM A;  2B0J A;  5HV9 A;  2J9B A;  2BE5 F;  2OG2 A;  1MMN A;  3U3B A;  2A0U A;  3ZVR A;  2YL0 A;  3LEV A;  4A2N B;  4HEA J;  1O5H A;  1VB5 A;  4NTF A;  3WHN A;  3IQT A;  3GM2 A;  2KK1 A;  4LDR A;  4PK4 A;  4U9D A;  2XLV A;  2NUP A;  3K1I A;  3UR3 C;  3S90 A;  2GDC A;  2XS8 A;  3EFO A;  4I44 A;  1YYJ A;  1BZ4 A;  5L3Q A;  2IBF A;  4EHP A;  3J06 A;  3N24 A;  1D0X A;  4BJT A;  3CAX A;  4PJM A;  3DZA A;  2YHS A;  3DJN B;  5A6A A;  2PF4 E;  3NRH A;  3NYM A;  2Q9C A;  3HJC A;  1GQA A;  3FXH A;  2VCC A;  3M4C A;  2D5R B;  1H6G A;  3RQE A;  2XRH A;  2XSE A;  3LNR A;  4KNW A;  3RF3 A;  1FR0 A;  2J0W A;  1FAP B;  1AEP A;  5BQH A;  1MND A;  1BR1 A;  2YL7 A;  4EUK B;  5DS4 A;  4LER A;  1PD0 A;  1FMV A;  3AG1 C;  3VAY A;  1QQ3 A;  1U0B B;  5F5F A;  2GA0 A;  4X0R A;  5AGF A;  5E3C A;  3GWN A;  1Z23 A;  2R7Q A;  1TKN A;  3QTH A;  3U2L A;  4LDQ A;  4EBJ A;  2HV6 A;  1YLM A;  4XTK A;  1GM5 A;  2CNW A;  1QPU A; 
#chains in the Genus database with same CATH homology
 3MBG A;  3O55 A;  3GWL A;  3W4Y A;  3TD7 A;  4LDK A;  4E0H A;  3U2M A;  1JRA A;  1JR8 A;  3LLK A;  1OQC A;  3U5S A;  3LLI A;  2HJ3 A;  3TK0 A;  4E0I A;  3R7C A;  3GWN A;  3U2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...