3O55A

Crystal structure of human fad-linked augmenter of liver regeneration (alr)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Augmenter of liver regeneration
publication title Molecular recognition and substrate mimicry drive the electron-transfer process between MIA40 and ALR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 43
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3o55A00
3R7CA 3U2MA 1OQCA 2HJ3A 4LDKA 1JRAA 3LLKA 3O55A 1JR8A 3W4YA 3TK0A 4E0IA 3GWLA 3GWNA 3U2LA 3U5SA 3TD7A 3LLIA 3MBGA 4E0HA
chains in the Genus database with same CATH superfamily
3R7CA 1L3PA 2CGEA 3WODF 2C03A 4DVZA 5HSWA 2R7OA 3U9MA 4AE4A 3S27A 1O87A 2HJ3A 4BEJA 3EQLF 2L6GA 4CS9C 4LDKA 2XLDA 3UMKA 3KPHA 4AE4B 1HW2A 4ER9A 1MNEA 3LLKA 5E3CA 4DJ9A 1VYKA 4PR9A 2P7VA 3M15A 1MMNA 2EPKX 2OCCC 3Q6NA 3W2WA 4CIHA 5BQGA 4N4WA 2IOQA 2A69F 2Y3DA 5TJ5E 2XXAB 3J06A 1A7EA 2GWWA 3IHUA 1RJ9B 2ZXWC 1LI7A 3NYLA 4J30B 3LEOA 2DB4A 3C8ZA 5K0IA 3OA1A 3NMJA 2NUPA 3QVZA 3U9JA 2KW3C 1QLEC 2WVQA 4D4XA 1HE1A 2HJMA 3SNHA 1Q0FA 1A41A 3N0TA 1VTMP 3U2MA 3JRTA 1MMGA 4YL3A 3ZDLA 1OQCA 3NMKA 4F4BA 3JSEO 1ZHTA 1V54C 1OCRC 1VB5A 2PBEA 5AC5A 5F5HA 2P61A 2L9JA 1E86A 2AWYA 3DKAA 5E2QA 1Z63A 1JAFA 3M1CB 3RQFA 1RKEB 2HV6A 2HZ8A 4PJJA 3RH3A 5L3QA 2XL8A 4IAOA 4YT5A 5DQTA 3ZQYA 2XLOA 2P1AA 1AUEA 1KNYA 5AGFA 1YLMA 5JRAA 3EG9B 1G4WR 2CYDA 2EILC 3CEXA 4JURI 1YAUO 1T6IA 3ZSUA 2HMQA 5EK0A 5A6AA 4PJLA 1ZW3A 2AU5A 3A11A 3CQZA 2W4BA 4CBEA 1Z3IX 1ZU5A 5COGA 2Q7RA 2YLGA 2HKVA 2R05A 1TWGA 4ULWA 4KC9A 5COMA 2R7SA 3CSKA 3RVZA 3EH2A 3U8VA 1M2VA 3C7JA 3DD7A 4GEHA 3U0CA 3AGTA 5JT4A 2Q4FA 3VM6A 3U8PA 2R7XA 3N2ZB 1NG1A 3NMIA 1V55C 4MQ9F 1PV3A 3T6BA 1B68A 3EGXA 1SYQA 1HMDA 1ZW2A 1G4US 1S05A 3SZRA 2IBFA 1M57C 2CNWA 2ZPAA 3ITFA 4BJTA 2VCAA 2Y69C 3BEHA 4WABA 3EGXB 4BJ6A 2VC9A 2NUTA 2AVKA 4MVRA 2H7BA 1WATA 3C8GB 4EWCA 5KYXA 3AJMA 1HW1A 3M4BA 1NSGB 3U5SA 3AOUA 2XLWA 4PFOA 3O6XA 3HNJA 3DM9B 2HS5A 3TD7A 5JP7A 4EBJA 1LKXA 5A69A 3EFOB 3ZWIA 2MHRA 2WZLA 1FNTc 3LUTB 4G78A 2ZD9A 1MQVA 3UR3C 5KYWA 1MNDA 4Z9HA 1XZQA 3TOMA 2QUPA 3MYFA 4LDRA 3KL4A 4R32A 4C3EA 3JTLO 2KSFA 2QY9A 3G4XA 2EIMC 1K04A 2OEVA 3ZG1A 1OW8A 1GM5A 3LAYA 3O10A 3VF0A 1D0XA 1LI5A 2LCHA 3SXYA 3TJ5A 2YL0A 5L0JA 1EI7A 4A4AA 4E0IA 1O5HA 3V5YA 3DI5A 5JSLA 3K66A 1KU2A 2R7RA 2LK4A 1LPEA 1WASA 3B0PA 3JSZA 1FTSA 2XL6A 5CI9A 5GPGB 4CIPA 3MFNA 4PK4A 5KYUA 3H2VA 4I3MA 5T3TA 1HMOA 2L7AA 5IY5C 1MMDA 3DJUB 3MBGA 1ZYRF 2A0BA 3GANA 3HJCA 4QI0A 3JRMO 3A9CA 3W8HA 2DGJA 3OEOA 3T6GB 3CZ6A 1OCCC 3EGDB 1QZXA 4WGZA 2W9YA 4PJMA 1OW6A 4PJNA 4HEAJ 1T01A 4WJ0A 4HFKB 1Z23A 4JEAA 4XLPF 2OEXA 2PFDA 1C03A 2KQ9A 2AWCA 3FXHA 5DVWA 3W4YA 2H8AA 2PX3A 2OQMA 1OXBA 4EIYA 1Z5ZA 3W2VA 1E84A 3ABKC 5BUOA 1EA8A 2R02A 4U9EA 3I5QA 1ZHYA 5CIVA 1YZCA 2WL8A 1RMVA 1K40A 2CNWD 3SXKA 4AK9A 5KYYA 2G62A 2HSQA 1ZVZA 4DRJB 1HY5A 3H65A 3JYHA 1NLXA 2J7PA 3DAGA 2WVNA 2J9UA 5EGYA 4CJGA 4C3DA 2CW0F 2HV7A 1RKCA 3TULA 1ZHXA 4NTBA 2YL1A 4YL0A 4Q5SF 2EPMX 3SXZA 2XRHA 3E9VA 3SEOA 3KMIA 4CDVA 2GDCA 3HLZA 1YA7O 2KYHA 3S28A 1L7CA 2ICWG 2XS1A 4W8KA 2RSEB 4Z9JA 1BZ4A 2ZXPA 4JJFA 4E7SA 4H4KC 4IARA 1J8YF 3LNRA 4O6YA 4ZLDA 1JOGA 3HNKA 4FESA 1UG7A 2EIJC 3MYIA 3N24A 3GM2A 3L8IA 4KBLA 4P9TA 3TJ6A 2J8WA 2X51A 3JT1A 4YWQA 3DMDA 4BJ5A 4BEMJ 4EKWA 3F46A 2J9VA 1BR2A 2QTVA 2NUPB 2A68F 2E87A 3PHF2 4OIOF 4E17A 1S7ZA 2M64A 4U5DE 5L0IA 4ULVA 1I5NA 2G3VA 2M4EA 2KJGA 2W4MA 3S29A 2LSEA 1JRAA 3RQGA 2YL3A 3LJBA 5D91A 4Q7CA 2EPLX 4MVZA 3IQ6A 1TFKB 5L0DA 4C3BA 4JCHA 3TK0A 2P0NA 4P9FA 5CI8A 1OR3A 1I4ZA 1T5OA 2OJED 1SZIA 4CDYA 2EPNA 3DM5A 3IPMO 4KNWA 1TKNA 4JZAA 1YA9A 3FAJA 4IGGA 4XQ1A 3SYNA 4C7OA 3NYJA 5L0HA 2HSBA 1YYJA 2PNOA 2V3CC 4MVSA 4BPMA 3AG2C 4JRZA 1SF8A 2A1DD 1Y6DA 3T6JA 3RF3A 2YRFA 4M63A 2PP4A 2H7VC 1NU7D 2EINC 1FR0A 4DXWA 2LFFA 4DRHB 5B3SC 1NBBA 5JS5A 4J32B 4XPWA 4OIRF 5DS4A 1OKKA 3W8IA 4EBBA 1LS1A 1G8XA 4GQHA 4XLNF 2JPUA 4EBKA 1NZEA 2Q9CA 1M2VB 2XM0A 4BJ1A 4A2NB 2J7PD 2HUJA 1QPUA 3GODA 3QZCA 3FDQA 4YK5A 4AL0A 4MS2A 4BJ5C 3K7DA 1M2OA 3IEEA 3DJNB 3GWLA 4MW8A 1D1AA 2C04A 3VYWA 2R7TA 2V26A 3C63A 1H9GA 3GM3A 1CGNA 4B6IA 1UFBA 2NUTB 3ZIBA 2YHSA 3FMSA 3G4ZA 1A7VA 5KYXB 3NRHA 3G50A 3QW1A 3K33A 5B3IA 1Q0MA 3EHMA 3RKOF 4CX9A 4DVYP 1H9TA 4MVQA 3DE8A 4JTCB 1EKYA 2FFHA 2IXNA 5L3VA 2QE9A 4K1OA 2A0UA 2KGOA 5KYWB 4QI2A 2YKZA 1R4TA 4LLCA 1O3UA 1U6HA 4NTAA 3HKKA 2A6HF 4JE9A 4E18A 3EJNA 4NQFA 4MTOA 1FAPB 1A7DA 2JX0A 3QW0A 2I15A 2DYRC 1ORYA 2EIKC 2LD6A 4U5FE 3K1IC 4XPXA 3VAYA 5E33A 3FOPA 1V4AA 1PCXA 3L34A 4OIQF 1NU9C 2KC3A 3AQBA 1QKRA 3LESA 4G7OF 1D0YA 2D4UA 4I44A 2ASRA 4YT4A 1T9KA 2KNHA 4I1OB 3EH1A 2A6EF 1HE9A 2Z15A 4ONSA 2F22A 2ZXRA 5B1AC 3US6A 4E0HA 5KYNA 4OINF 2OKUA 4N6CA 4NY3A 4AX2A 2BC5A 5KYUB 2Q9AA 4EUKB 4ZLCA 2DYSC 1VOMA 3FVYA 1FMVA 3DZAA 3GEIA 2X0CA 3ABLC 3T9OA 3AG4C 1QSPA 3E70C 3RVYA 3Q7LA 2YZSA 1OW7A 3I5PA 5DQZA 2FAPB 5L0FA 4LDQA 2GFHA 4P6IC 4J7TA 1ORSC 1TWCA 1GQAA 1ZU4A 1Q0KA 3K1HA 3S0XA 1OKKD 1F1MA 2IXOA 4DBRA 2Q9BA 2XM4A 3KYIA 3RW0A 3NG1A 2R7VA 4CS8A 3IQCA 4MTGA 2R25A 3SP1A 3KYJA 2J9WA 3ECSA 4XPYA 5T3WA 4CJOA 5FCLA 1VK5A 3DXJF 4NTFA 3GM1A 1BR4A 3NKDA 1KTMA 4DRIB 1NFNA 3WAQA 5KYYB 3R2PA 1LE2A 2L6FA 4CDAA 1Q0DA 3L1MA 3L0IA 1AVOB 4JW1A 3UGOA 1LIHA 4U5HA 4DBQA 4JIOA 1LM3B 1ZHZA 2LP4A 4OD4A 2R7QA 4U5CE 4YN0B 3EZIA 3M79A 3O55A 1JR8A 1K05A 2YEVA 4K0DA 1SR2A 1GS9A 2PX0A 1EQ1A 4Z9IA 3S84A 4JTAB 1E2XA 3I4UA 4IJJA 5JUAA 2P6VA 4HFFB 2YLDA 3LEVA 3FHDA 1BR1A 2LFDA 1VMAA 3B29A 3RFYA 3RQEA 1W2WA 4W8PA 3HNIA 4CS7A 1TFOB 1BBHA 4LLEA 2RD9A 1JPJA 2IM8A 1YZAA 2J46A 4NCQA 2O9XA 2VCCA 1A0BA 3B9QA 3GEHA 4O7GA 3UMHA 5EHHA 5JVEA 4MNDA 2WZGA 3ABMC 4CS8C 4JKVA 2XXAA 1OXKA 3UNGC 1N1CA 3ZTMA 4L6RA 1CGOA 1RJ9A 1WWPA 3EHNA 2J0XA 1VYIA 2YVKA 2R7WA 2TMVP 3WHNA 2J45A 2HMZA 2Y3HA 1DOWA 1QVXA 4BJ6C 4CSAA 4G7ZF 1XWJA 4G7HF 1V74B 3LS0A 3QVYA 5DS5A 2CDQA 3V5ZA 4C7OB 4OIPF 4NC3A 1RXQA 1YARO 3ASNC 1J8MF 1D0ZA 1WGWA 1WOLA 3C18A 1TQGA 3TQOA 2OU6A 2UUIA 2IXMA 4FX5A 4IRUA 1FFTC 2L81A 5BQIA 3K1IA 3ATPA 4XEVA 2QNLA 3KKBA 2BL2A 1G5ZA 4IB4A 1RKEA 4XWJA 3TOLA 3X2QC 3JZ0A 1PD1A 2CCYA 1PD0A 2XLEA 4FWVA 3LS1A 1CPQA 1D1BA 2Q3TA 2VCBA 3AG1C 4RD9A 5F28E 5D92A 2WZFA 256BA 1TWHA 3NDBB 3JYYA 3NKEA 4JEBA 1TWAA 5A6JA 3PMRA 4JTDB 3EG9A 3UMIA 3ZQVA 4AL1A 2G3KA 5FZTA 2UUHA 3KH2A 3T4RA 4JVSA 3F47A 5A6KA 3ZVRA 2XLMA 4XEKA 1APCA 1D1CA 3NYMA 3C62A 4O79A 3ZTZA 3DWWA 5HV9A 2WVOA 1ST6A 3IQ5A 2R03A 1M56C 1SMYF 1VLSA 5L0CA 1T6UA 3B0UX 2H7OA 2KK1A 3JCUQ 4BG0A 1DOVA 3O39A 1H7IA 4OD5A 2HFIA 1LS4A 1I4YA 1JPNA 1YVIA 3EPVA 4XEFA 3LNMB 4FAPB 1OCOC 2AP3A 2JD3A 2Y3BA 1BDJB 4G0HA 2GA0A 3AQCA 5A6BA 2NPUA 1R5ID 2YLIA 4CSAC 5T1DB 3V5XA 3RIPA 2J9BA 3VRCA 1H6GA 3C8GA 4MVUA 1LE4A 1T6QA 4U5EE 3EZHA 2LQGA 3GWNA 1RCPA 3V7OA 4MVMA 2D5RB 4Q4ZF 3EFOA 4JJGA 4JC7A 2B0HA 1VLTA 2ETSA 4DOZA 1Y4CA 2L6HA 2WB7A 3Q6MA 4U5GA 4U9DA 3ZC4A 4E7ZA 5L0GA 1CGME 1E85A 3HTKC 2EPOA 2NSFA 1CPRA 4MW3A 3X1OA 1FMWA 2I8BA 2J0WA 3U3FA 2BE5F 4H54A 4O6MA 1YYXA 5COFA 4PACA 3GEEA 3HNLA 3CAXA 4ANJA 5DS6A 4JCZA 2PF4E 4HE8D 4U5BE 3H2UA 4XTKA 4YL1A 2OOCA 3K6BA 5B1BC 4KI2A 1C02A 4IWBA 3MX3A 1LVKA 3ASOC 1Z7Qc 1WN0A 1TR2A 4N6HA 4X0RA 3L8JA 1U89A 2GAQA 1AEPA 2OJQA 2XLHA 4KNVA 4YJWA 3SXMA 4CS9A 2XS8A 2MWQA 2YWAA 4QDLA 2R7UA 3GORA 1C17M 4K7BA 4WGYA 3AGUA 4MTFA 4MVOA 2YQYA 2FGYA 3IQTA 3OWTA 2NG1A 3QMKA 2OG2A 5JLIA 1E83A 3EGDA 3PDMP 1WTYA 4YT2A 4RDAA 2XL4A 2VASA 4YT8A 2W45A 2XLVA 1OR2A 4I1MA 2QLAA 4IAQA 1OCZC 1JMWA 1ORJA 4PFPA 2NSGA 2IYLD 5DLJA 4EHPA 1U0BB 1QQ3A 4O6NA 2YL7A 4LACB 1YJGA 4UDVA 1FFHA 4RBNA 3DAFA 3Q7GA 3FOOA 2LIGA 5F5FA 1Z6AA 1NFOA 3WG7C 5A6BD 4D4NA 3S90A 1IW7F 4LERA 3S9OA 3UGPA 3QTHA 3U3BA 1XZPA 5E3AA 5AC4A 2VH3A 2DI3A 3B71A 2Y3GA 2XSEA 3BRJA 3RYLA 1ZZPA 1IZMA 3PCVA 1M6TA 3U2LA 2MYSA 3M4CA 3C8GD 3POVA 3FAPB 1GGQA 3DE9A 2R9RB 2VB6A 5BQHA 3AG3C 2B0JA 1MMAA 2Q00A 2Y39A 1Q0GA 3LLIA 1YDIA 3MLGA 4GYTA 2IXPA 4J7YA 3B0VC 4N06A 1ZHWA 2ZXOA
chains in the Genus database with same CATH topology
3R7CA 3U2MA 1OQCA 2HJ3A 4LDKA 1JRAA 3LLKA 3O55A 1JR8A 3W4YA 3TK0A 4E0IA 3GWLA 3GWNA 3U2LA 3U5SA 3TD7A 3LLIA 3MBGA 4E0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7C A;  3U2M A;  1OQC A;  2HJ3 A;  4LDK A;  1JRA A;  3LLK A;  3O55 A;  1JR8 A;  3W4Y A;  3TK0 A;  4E0I A;  3GWL A;  3GWN A;  3U2L A;  3U5S A;  3TD7 A;  3LLI A;  3MBG A;  4E0H A; 
#chains in the Genus database with same CATH topology
 3R7C A;  1L3P A;  2CGE A;  3WOD F;  2C03 A;  4DVZ A;  5HSW A;  2R7O A;  3U9M A;  4AE4 A;  3S27 A;  1O87 A;  2HJ3 A;  4BEJ A;  3EQL F;  2L6G A;  4CS9 C;  4LDK A;  2XLD A;  3UMK A;  3KPH A;  4AE4 B;  1HW2 A;  4ER9 A;  1MNE A;  3LLK A;  5E3C A;  4DJ9 A;  1VYK A;  4PR9 A;  2P7V A;  3M15 A;  1MMN A;  2EPK X;  2OCC C;  3Q6N A;  3W2W A;  4CIH A;  5BQG A;  4N4W A;  2IOQ A;  2A69 F;  2Y3D A;  5TJ5 E;  2XXA B;  3J06 A;  1A7E A;  2GWW A;  3IHU A;  1RJ9 B;  2ZXW C;  1LI7 A;  3NYL A;  4J30 B;  3LEO A;  2DB4 A;  3C8Z A;  5K0I A;  3OA1 A;  3NMJ A;  2NUP A;  3QVZ A;  3U9J A;  2KW3 C;  1QLE C;  2WVQ A;  4D4X A;  1HE1 A;  2HJM A;  3SNH A;  1Q0F A;  1A41 A;  3N0T A;  1VTM P;  3U2M A;  3JRT A;  1MMG A;  4YL3 A;  3ZDL A;  1OQC A;  3NMK A;  4F4B A;  3JSE O;  1ZHT A;  1V54 C;  1OCR C;  1VB5 A;  2PBE A;  5AC5 A;  5F5H A;  2P61 A;  2L9J A;  1E86 A;  2AWY A;  3DKA A;  5E2Q A;  1Z63 A;  1JAF A;  3M1C B;  3RQF A;  1RKE B;  2HV6 A;  2HZ8 A;  4PJJ A;  3RH3 A;  5L3Q A;  2XL8 A;  4IAO A;  4YT5 A;  5DQT A;  3ZQY A;  2XLO A;  2P1A A;  1AUE A;  1KNY A;  5AGF A;  1YLM A;  5JRA A;  3EG9 B;  1G4W R;  2CYD A;  2EIL C;  3CEX A;  4JUR I;  1YAU O;  1T6I A;  3ZSU A;  2HMQ A;  5EK0 A;  5A6A A;  4PJL A;  1ZW3 A;  2AU5 A;  3A11 A;  3CQZ A;  2W4B A;  4CBE A;  1Z3I X;  1ZU5 A;  5COG A;  2Q7R A;  2YLG A;  2HKV A;  2R05 A;  1TWG A;  4ULW A;  4KC9 A;  5COM A;  2R7S A;  3CSK A;  3RVZ A;  3EH2 A;  3U8V A;  1M2V A;  3C7J A;  3DD7 A;  4GEH A;  3U0C A;  3AGT A;  5JT4 A;  2Q4F A;  3VM6 A;  3U8P A;  2R7X A;  3N2Z B;  1NG1 A;  3NMI A;  1V55 C;  4MQ9 F;  1PV3 A;  3T6B A;  1B68 A;  3EGX A;  1SYQ A;  1HMD A;  1ZW2 A;  1G4U S;  1S05 A;  3SZR A;  2IBF A;  1M57 C;  2CNW A;  2ZPA A;  3ITF A;  4BJT A;  2VCA A;  2Y69 C;  3BEH A;  4WAB A;  3EGX B;  4BJ6 A;  2VC9 A;  2NUT A;  2AVK A;  4MVR A;  2H7B A;  1WAT A;  3C8G B;  4EWC A;  5KYX A;  3AJM A;  1HW1 A;  3M4B A;  1NSG B;  3U5S A;  3AOU A;  2XLW A;  4PFO A;  3O6X A;  3HNJ A;  3DM9 B;  2HS5 A;  3TD7 A;  5JP7 A;  4EBJ A;  1LKX A;  5A69 A;  3EFO B;  3ZWI A;  2MHR A;  2WZL A;  1FNT c;  3LUT B;  4G78 A;  2ZD9 A;  1MQV A;  3UR3 C;  5KYW A;  1MND A;  4Z9H A;  1XZQ A;  3TOM A;  2QUP A;  3MYF A;  4LDR A;  3KL4 A;  4R32 A;  4C3E A;  3JTL O;  2KSF A;  2QY9 A;  3G4X A;  2EIM C;  1K04 A;  2OEV A;  3ZG1 A;  1OW8 A;  1GM5 A;  3LAY A;  3O10 A;  3VF0 A;  1D0X A;  1LI5 A;  2LCH A;  3SXY A;  3TJ5 A;  2YL0 A;  5L0J A;  1EI7 A;  4A4A A;  4E0I A;  1O5H A;  3V5Y A;  3DI5 A;  5JSL A;  3K66 A;  1KU2 A;  2R7R A;  2LK4 A;  1LPE A;  1WAS A;  3B0P A;  3JSZ A;  1FTS A;  2XL6 A;  5CI9 A;  5GPG B;  4CIP A;  3MFN A;  4PK4 A;  5KYU A;  3H2V A;  4I3M A;  5T3T A;  1HMO A;  2L7A A;  5IY5 C;  1MMD A;  3DJU B;  3MBG A;  1ZYR F;  2A0B A;  3GAN A;  3HJC A;  4QI0 A;  3JRM O;  3A9C A;  3W8H A;  2DGJ A;  3OEO A;  3T6G B;  3CZ6 A;  1OCC C;  3EGD B;  1QZX A;  4WGZ A;  2W9Y A;  4PJM A;  1OW6 A;  4PJN A;  4HEA J;  1T01 A;  4WJ0 A;  4HFK B;  1Z23 A;  4JEA A;  4XLP F;  2OEX A;  2PFD A;  1C03 A;  2KQ9 A;  2AWC A;  3FXH A;  5DVW A;  3W4Y A;  2H8A A;  2PX3 A;  2OQM A;  1OXB A;  4EIY A;  1Z5Z A;  3W2V A;  1E84 A;  3ABK C;  5BUO A;  1EA8 A;  2R02 A;  4U9E A;  3I5Q A;  1ZHY A;  5CIV A;  1YZC A;  2WL8 A;  1RMV A;  1K40 A;  2CNW D;  3SXK A;  4AK9 A;  5KYY A;  2G62 A;  2HSQ A;  1ZVZ A;  4DRJ B;  1HY5 A;  3H65 A;  3JYH A;  1NLX A;  2J7P A;  3DAG A;  2WVN A;  2J9U A;  5EGY A;  4CJG A;  4C3D A;  2CW0 F;  2HV7 A;  1RKC A;  3TUL A;  1ZHX A;  4NTB A;  2YL1 A;  4YL0 A;  4Q5S F;  2EPM X;  3SXZ A;  2XRH A;  3E9V A;  3SEO A;  3KMI A;  4CDV A;  2GDC A;  3HLZ A;  1YA7 O;  2KYH A;  3S28 A;  1L7C A;  2ICW G;  2XS1 A;  4W8K A;  2RSE B;  4Z9J A;  1BZ4 A;  2ZXP A;  4JJF A;  4E7S A;  4H4K C;  4IAR A;  1J8Y F;  3LNR A;  4O6Y A;  4ZLD A;  1JOG A;  3HNK A;  4FES A;  1UG7 A;  2EIJ C;  3MYI A;  3N24 A;  3GM2 A;  3L8I A;  4KBL A;  4P9T A;  3TJ6 A;  2J8W A;  2X51 A;  3JT1 A;  4YWQ A;  3DMD A;  4BJ5 A;  4BEM J;  4EKW A;  3F46 A;  2J9V A;  1BR2 A;  2QTV A;  2NUP B;  2A68 F;  2E87 A;  3PHF 2;  4OIO F;  4E17 A;  1S7Z A;  2M64 A;  4U5D E;  5L0I A;  4ULV A;  1I5N A;  2G3V A;  2M4E A;  2KJG A;  2W4M A;  3S29 A;  2LSE A;  1JRA A;  3RQG A;  2YL3 A;  3LJB A;  5D91 A;  4Q7C A;  2EPL X;  4MVZ A;  3IQ6 A;  1TFK B;  5L0D A;  4C3B A;  4JCH A;  3TK0 A;  2P0N A;  4P9F A;  5CI8 A;  1OR3 A;  1I4Z A;  1T5O A;  2OJE D;  1SZI A;  4CDY A;  2EPN A;  3DM5 A;  3IPM O;  4KNW A;  1TKN A;  4JZA A;  1YA9 A;  3FAJ A;  4IGG A;  4XQ1 A;  3SYN A;  4C7O A;  3NYJ A;  5L0H A;  2HSB A;  1YYJ A;  2PNO A;  2V3C C;  4MVS A;  4BPM A;  3AG2 C;  4JRZ A;  1SF8 A;  2A1D D;  1Y6D A;  3T6J A;  3RF3 A;  2YRF A;  4M63 A;  2PP4 A;  2H7V C;  1NU7 D;  2EIN C;  1FR0 A;  4DXW A;  2LFF A;  4DRH B;  5B3S C;  1NBB A;  5JS5 A;  4J32 B;  4XPW A;  4OIR F;  5DS4 A;  1OKK A;  3W8I A;  4EBB A;  1LS1 A;  1G8X A;  4GQH A;  4XLN F;  2JPU A;  4EBK A;  1NZE A;  2Q9C A;  1M2V B;  2XM0 A;  4BJ1 A;  4A2N B;  2J7P D;  2HUJ A;  1QPU A;  3GOD A;  3QZC A;  3FDQ A;  4YK5 A;  4AL0 A;  4MS2 A;  4BJ5 C;  3K7D A;  1M2O A;  3IEE A;  3DJN B;  3GWL A;  4MW8 A;  1D1A A;  2C04 A;  3VYW A;  2R7T A;  2V26 A;  3C63 A;  1H9G A;  3GM3 A;  1CGN A;  4B6I A;  1UFB A;  2NUT B;  3ZIB A;  2YHS A;  3FMS A;  3G4Z A;  1A7V A;  5KYX B;  3NRH A;  3G50 A;  3QW1 A;  3K33 A;  5B3I A;  1Q0M A;  3EHM A;  3RKO F;  4CX9 A;  4DVY P;  1H9T A;  4MVQ A;  3DE8 A;  4JTC B;  1EKY A;  2FFH A;  2IXN A;  5L3V A;  2QE9 A;  4K1O A;  2A0U A;  2KGO A;  5KYW B;  4QI2 A;  2YKZ A;  1R4T A;  4LLC A;  1O3U A;  1U6H A;  4NTA A;  3HKK A;  2A6H F;  4JE9 A;  4E18 A;  3EJN A;  4NQF A;  4MTO A;  1FAP B;  1A7D A;  2JX0 A;  3QW0 A;  2I15 A;  2DYR C;  1ORY A;  2EIK C;  2LD6 A;  4U5F E;  3K1I C;  4XPX A;  3VAY A;  5E33 A;  3FOP A;  1V4A A;  1PCX A;  3L34 A;  4OIQ F;  1NU9 C;  2KC3 A;  3AQB A;  1QKR A;  3LES A;  4G7O F;  1D0Y A;  2D4U A;  4I44 A;  2ASR A;  4YT4 A;  1T9K A;  2KNH A;  4I1O B;  3EH1 A;  2A6E F;  1HE9 A;  2Z15 A;  4ONS A;  2F22 A;  2ZXR A;  5B1A C;  3US6 A;  4E0H A;  5KYN A;  4OIN F;  2OKU A;  4N6C A;  4NY3 A;  4AX2 A;  2BC5 A;  5KYU B;  2Q9A A;  4EUK B;  4ZLC A;  2DYS C;  1VOM A;  3FVY A;  1FMV A;  3DZA A;  3GEI A;  2X0C A;  3ABL C;  3T9O A;  3AG4 C;  1QSP A;  3E70 C;  3RVY A;  3Q7L A;  2YZS A;  1OW7 A;  3I5P A;  5DQZ A;  2FAP B;  5L0F A;  4LDQ A;  2GFH A;  4P6I C;  4J7T A;  1ORS C;  1TWC A;  1GQA A;  1ZU4 A;  1Q0K A;  3K1H A;  3S0X A;  1OKK D;  1F1M A;  2IXO A;  4DBR A;  2Q9B A;  2XM4 A;  3KYI A;  3RW0 A;  3NG1 A;  2R7V A;  4CS8 A;  3IQC A;  4MTG A;  2R25 A;  3SP1 A;  3KYJ A;  2J9W A;  3ECS A;  4XPY A;  5T3W A;  4CJO A;  5FCL A;  1VK5 A;  3DXJ F;  4NTF A;  3GM1 A;  1BR4 A;  3NKD A;  1KTM A;  4DRI B;  1NFN A;  3WAQ A;  5KYY B;  3R2P A;  1LE2 A;  2L6F A;  4CDA A;  1Q0D A;  3L1M A;  3L0I A;  1AVO B;  4JW1 A;  3UGO A;  1LIH A;  4U5H A;  4DBQ A;  4JIO A;  1LM3 B;  1ZHZ A;  2LP4 A;  4OD4 A;  2R7Q A;  4U5C E;  4YN0 B;  3EZI A;  3M79 A;  3O55 A;  1JR8 A;  1K05 A;  2YEV A;  4K0D A;  1SR2 A;  1GS9 A;  2PX0 A;  1EQ1 A;  4Z9I A;  3S84 A;  4JTA B;  1E2X A;  3I4U A;  4IJJ A;  5JUA A;  2P6V A;  4HFF B;  2YLD A;  3LEV A;  3FHD A;  1BR1 A;  2LFD A;  1VMA A;  3B29 A;  3RFY A;  3RQE A;  1W2W A;  4W8P A;  3HNI A;  4CS7 A;  1TFO B;  1BBH A;  4LLE A;  2RD9 A;  1JPJ A;  2IM8 A;  1YZA A;  2J46 A;  4NCQ A;  2O9X A;  2VCC A;  1A0B A;  3B9Q A;  3GEH A;  4O7G A;  3UMH A;  5EHH A;  5JVE A;  4MND A;  2WZG A;  3ABM C;  4CS8 C;  4JKV A;  2XXA A;  1OXK A;  3UNG C;  1N1C A;  3ZTM A;  4L6R A;  1CGO A;  1RJ9 A;  1WWP A;  3EHN A;  2J0X A;  1VYI A;  2YVK A;  2R7W A;  2TMV P;  3WHN A;  2J45 A;  2HMZ A;  2Y3H A;  1DOW A;  1QVX A;  4BJ6 C;  4CSA A;  4G7Z F;  1XWJ A;  4G7H F;  1V74 B;  3LS0 A;  3QVY A;  5DS5 A;  2CDQ A;  3V5Z A;  4C7O B;  4OIP F;  4NC3 A;  1RXQ A;  1YAR O;  3ASN C;  1J8M F;  1D0Z A;  1WGW A;  1WOL A;  3C18 A;  1TQG A;  3TQO A;  2OU6 A;  2UUI A;  2IXM A;  4FX5 A;  4IRU A;  1FFT C;  2L81 A;  5BQI A;  3K1I A;  3ATP A;  4XEV A;  2QNL A;  3KKB A;  2BL2 A;  1G5Z A;  4IB4 A;  1RKE A;  4XWJ A;  3TOL A;  3X2Q C;  3JZ0 A;  1PD1 A;  2CCY A;  1PD0 A;  2XLE A;  4FWV A;  3LS1 A;  1CPQ A;  1D1B A;  2Q3T A;  2VCB A;  3AG1 C;  4RD9 A;  5F28 E;  5D92 A;  2WZF A;  256B A;  1TWH A;  3NDB B;  3JYY A;  3NKE A;  4JEB A;  1TWA A;  5A6J A;  3PMR A;  4JTD B;  3EG9 A;  3UMI A;  3ZQV A;  4AL1 A;  2G3K A;  5FZT A;  2UUH A;  3KH2 A;  3T4R A;  4JVS A;  3F47 A;  5A6K A;  3ZVR A;  2XLM A;  4XEK A;  1APC A;  1D1C A;  3NYM A;  3C62 A;  4O79 A;  3ZTZ A;  3DWW A;  5HV9 A;  2WVO A;  1ST6 A;  3IQ5 A;  2R03 A;  1M56 C;  1SMY F;  1VLS A;  5L0C A;  1T6U A;  3B0U X;  2H7O A;  2KK1 A;  3JCU Q;  4BG0 A;  1DOV A;  3O39 A;  1H7I A;  4OD5 A;  2HFI A;  1LS4 A;  1I4Y A;  1JPN A;  1YVI A;  3EPV A;  4XEF A;  3LNM B;  4FAP B;  1OCO C;  2AP3 A;  2JD3 A;  2Y3B A;  1BDJ B;  4G0H A;  2GA0 A;  3AQC A;  5A6B A;  2NPU A;  1R5I D;  2YLI A;  4CSA C;  5T1D B;  3V5X A;  3RIP A;  2J9B A;  3VRC A;  1H6G A;  3C8G A;  4MVU A;  1LE4 A;  1T6Q A;  4U5E E;  3EZH A;  2LQG A;  3GWN A;  1RCP A;  3V7O A;  4MVM A;  2D5R B;  4Q4Z F;  3EFO A;  4JJG A;  4JC7 A;  2B0H A;  1VLT A;  2ETS A;  4DOZ A;  1Y4C A;  2L6H A;  2WB7 A;  3Q6M A;  4U5G A;  4U9D A;  3ZC4 A;  4E7Z A;  5L0G A;  1CGM E;  1E85 A;  3HTK C;  2EPO A;  2NSF A;  1CPR A;  4MW3 A;  3X1O A;  1FMW A;  2I8B A;  2J0W A;  3U3F A;  2BE5 F;  4H54 A;  4O6M A;  1YYX A;  5COF A;  4PAC A;  3GEE A;  3HNL A;  3CAX A;  4ANJ A;  5DS6 A;  4JCZ A;  2PF4 E;  4HE8 D;  4U5B E;  3H2U A;  4XTK A;  4YL1 A;  2OOC A;  3K6B A;  5B1B C;  4KI2 A;  1C02 A;  4IWB A;  3MX3 A;  1LVK A;  3ASO C;  1Z7Q c;  1WN0 A;  1TR2 A;  4N6H A;  4X0R A;  3L8J A;  1U89 A;  2GAQ A;  1AEP A;  2OJQ A;  2XLH A;  4KNV A;  4YJW A;  3SXM A;  4CS9 A;  2XS8 A;  2MWQ A;  2YWA A;  4QDL A;  2R7U A;  3GOR A;  1C17 M;  4K7B A;  4WGY A;  3AGU A;  4MTF A;  4MVO A;  2YQY A;  2FGY A;  3IQT A;  3OWT A;  2NG1 A;  3QMK A;  2OG2 A;  5JLI A;  1E83 A;  3EGD A;  3PDM P;  1WTY A;  4YT2 A;  4RDA A;  2XL4 A;  2VAS A;  4YT8 A;  2W45 A;  2XLV A;  1OR2 A;  4I1M A;  2QLA A;  4IAQ A;  1OCZ C;  1JMW A;  1ORJ A;  4PFP A;  2NSG A;  2IYL D;  5DLJ A;  4EHP A;  1U0B B;  1QQ3 A;  4O6N A;  2YL7 A;  4LAC B;  1YJG A;  4UDV A;  1FFH A;  4RBN A;  3DAF A;  3Q7G A;  3FOO A;  2LIG A;  5F5F A;  1Z6A A;  1NFO A;  3WG7 C;  5A6B D;  4D4N A;  3S90 A;  1IW7 F;  4LER A;  3S9O A;  3UGP A;  3QTH A;  3U3B A;  1XZP A;  5E3A A;  5AC4 A;  2VH3 A;  2DI3 A;  3B71 A;  2Y3G A;  2XSE A;  3BRJ A;  3RYL A;  1ZZP A;  1IZM A;  3PCV A;  1M6T A;  3U2L A;  2MYS A;  3M4C A;  3C8G D;  3POV A;  3FAP B;  1GGQ A;  3DE9 A;  2R9R B;  2VB6 A;  5BQH A;  3AG3 C;  2B0J A;  1MMA A;  2Q00 A;  2Y39 A;  1Q0G A;  3LLI A;  1YDI A;  3MLG A;  4GYT A;  2IXP A;  4J7Y A;  3B0V C;  4N06 A;  1ZHW A;  2ZXO A; 
#chains in the Genus database with same CATH homology
 3R7C A;  3U2M A;  1OQC A;  2HJ3 A;  4LDK A;  1JRA A;  3LLK A;  3O55 A;  1JR8 A;  3W4Y A;  3TK0 A;  4E0I A;  3GWL A;  3GWN A;  3U2L A;  3U5S A;  3TD7 A;  3LLI A;  3MBG A;  4E0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...