3O55A

Crystal structure of human fad-linked augmenter of liver regeneration (alr)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
b'FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Augmenter of liver regeneration
publication title Molecular recognition and substrate mimicry drive the electron-transfer process between MIA40 and ALR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 43
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3o55A00
3W4YA 3LLKA 3MBGA 4E0HA 3U2LA 3TK0A 1JRAA 4LDKA 3R7CA 3LLIA 3O55A 3U5SA 3GWNA 3U2MA 3GWLA 4E0IA 2HJ3A 1OQCA 3TD7A 1JR8A
chains in the Genus database with same CATH superfamily
2J45A 2PX3A 1RJ9B 5D91A 1OCCC 2Y69C 5E33A 4YT4A 2XLHA 2DB4A 3ZQYA 4MVRA 2EINC 3CQZA 2XLEA 5DVWA 1AUEA 3UNGC 3K7DA 4CSAA 5JLIA 3HNJA 1PV3A 2WVOA 1D1CA 2KQ9A 3DD7A 1TWGA 2XLDA 3FAJA 2JX0A 2Q7RA 1FNTc 1AEPA 3RYLA 3Q6NA 2LIGA 3OEOA 5KYUA 3RFYA 4E18A 2DYSC 2W4BA 4HEAJ 4E7SA 4ZLCA 2Y3HA 3O55A 5L0JA 1VLSA 3B0UX 3ZVRA 1Y6DA 1XZPA 3QW0A 1LI5A 4OIPF 4C7OA 1JPNA 3IQTA 3WODF 2HV6A 1K40A 1M2OA 2R05A 3NYJA 4H54A 3U9JA 4BJ5C 3S0XA 4HE8D 4N4WA 4CS8A 2NPUA 4W8KA 3JCUQ 3HNKA 2R03A 3NG1A 3S27A 3TOLA 5DS4A 1N1CA 3GEEA 4XPXA 2XM0A 1WTYA 3RQEA 5L0FA 2R7WA 2R7SA 4HFKB 2NUPB 1J8MF 2P0NA 2W9YA 3VYWA 1A7EA 5JUAA 1VLTA 2Q9BA 4M63A 3RIPA 1HE1A 3N24A 4KBLA 4PJNA 1JAFA 4IAOA 3TK0A 3UR3C 1E86A 1O5HA 1Z6AA 1SR2A 2HMZA 2VCCA 3JYHA 3GM1A 4YL3A 3X1OA 2NSFA 4FAPB 4YWQA 2VCBA 4EWCA 3DI5A 1WN0A 2MYSA 3U3BA 1RXQA 3VF0A 3G50A 2BE5F 1MQVA 1TFKB 2WB7A 1HMDA 1MMAA 2I8BA 2P7VA 5CIVA 1VB5A 3U9MA 1T6QA 2IXOA 5FZTA 3U8VA 4Q4ZF 2W4MA 3N0TA 2Y3DA 1TQGA 4RDAA 4A2NB 4B6IA 5A6AA 4YT5A 2QTVA 2FFHA 5JRAA 5B1AC 4XQ1A 2HUJA 1BZ4A 4CS9A 1NG1A 1BR4A 1VYKA 2H7VC 1RKCA 3B71A 3JZ0A 4GQHA 3EG9B 1YYXA 3EHMA 3DE9A 2KW3C 2XL6A 5A69A 1V74B 2MWQA 1C02A 3EQLF 2KGOA 2EIMC 1PCXA 3I5QA 1YYJA 1ZHZA 1K05A 1NSGB 1VYIA 2RD9A 3I5PA 3QVZA 3DM5A 2WVNA 4JKVA 4LLEA 4OD5A 5JS5A 4I44A 1OCZC 2CW0F 3DJNB 4JRZA 3FMSA 2EIJC 3DAFA 2V26A 1ZHTA 4J7YA 4ER9A 2R7VA 4Q7CA 4XLNF 3PHF2 1O87A 3NYMA 1YLMA 1JR8A 1ZU4A 5COMA 2LSEA 1SMYF 4IRUA 1YAUO 3FOPA 3DE8A 2B0HA 2OQMA 3MBGA 1LIHA 3C8GD 5A6BA 2KK1A 4OIOF 1KTMA 1ZU5A 2R7RA 4GYTA 5BQGA 2NUTB 3VRCA 4NQFA 3H65A 3LESA 1FFTC 1NU9C 2OOCA 4XEVA 1OKKD 5F28E 4DRHB 3NDBB 4PACA 2X51A 2BC5A 4MTOA 4N6CA 2BL2A 3EH2A 3SP1A 2DI3A 2WL8A 2YLGA 3ABKC 4IGGA 3MLGA 1LKXA 2MHRA 3O10A 4O6MA 1LPEA 3MYFA 1C17M 4OIQF 1FFHA 3K33A 3US6A 3AG3C 4CDVA 1FMVA 1S05A 2A0BA 2YRFA 3NRHA 4RBNA 4MVMA 4EHPA 2KC3A 1I4ZA 3JTLO 4BEMJ 1M2VB 4BEJA 1F1MA 1RCPA 2EILC 2KSFA 4PJJA 4LACB 2Q9CA 5KYWA 2R25A 4MVQA 1Q0FA 3K1IC 2GAQA 2HSQA 3JRMO 3DJUB 1D0XA 3IQ6A 3L8IA 4QI0A 4U5CE 5EK0A 4E7ZA 3POVA 1S7ZA 1T9KA 1MMDA 4J7TA 4ONSA 1JRAA 2L6HA 4W8PA 3UMIA 4PK4A 1CPRA 2OKUA 3ZDLA 4CSAC 2XM4A 3H2UA 5AC5A 3S84A 1MMGA 4JURI 1HW2A 2YKZA 2DYRC 2LFDA 2R7QA 3Q7GA 4JTCB 4LDQA 4O6NA 4EBKA 1C03A 1I4YA 3O39A 2P6VA 2YLDA 2B0JA 3DMDA 3GANA 1A7VA 1OCOC 4C7OB 5B1BC 3VAYA 1YDIA 3LNRA 1G5ZA 1WWPA 2CGEA 3B0PA 2GWWA 4CS8C 3SXMA 2J7PD 3GM2A 3WHNA 3ASNC 2XXAA 3BRJA 3AG1C 2LK4A 1WASA 2X0CA 2EPKX 3SNHA 3KYJA 3C7JA 4PFPA 1BBHA 4D4NA 1U6HA 5BUOA 4I1MA 3RKOF 1E83A 4MTGA 4Q5SF 4BG0A 3L0IA 2FGYA 3U0CA 1LM3B 2LD6A 3W8HA 1A0BA 3C8GA 4H4KC 2OCCC 4XPYA 4XTKA 3LLIA 5COGA 4EBBA 4U9DA 1Z5ZA 1NZEA 2J9VA 4JC7A 4JW1A 1Z7Qc 2A69F 4MQ9F 3VM6A 1QSPA 4JCHA 2QNLA 1E85A 4RD9A 2R7UA 3ZG1A 4KNVA 2PX0A 2R7XA 4N6HA 3ZWIA 4AE4B 3EGXA 2XLVA 3F47A 4CDYA 1EI7A 2XRHA 3EGDB 1D1BA 3EFOA 1YZCA 2ZXWC 3SZRA 1RKEB 2M4EA 3DAGA 3M15A 3OWTA 2WZFA 4MNDA 1QZXA 1Q0DA 4OIRF 3JYYA 2YVKA 3ABLC 5HV9A 4C3DA 3T6GB 4JJGA 3HNIA 3GM3A 4CS9C 2VH3A 4CIHA 3V5YA 4EIYA 1IW7F 1H7IA 1G4US 4ULVA 2GDCA 1G4WR 2R9RB 2VCAA 4YL0A 1I5NA 5KYYA 3HNLA 3MYIA 3O6XA 3U5SA 1FR0A 3DM9B 2EIKC 3HTKC 4U5FE 4YL1A 3ZQVA 1OW7A 1V54C 3CEXA 4JEAA 2A6EF 3SXZA 1HMOA 3KMIA 2IYLD 1DOWA 3K1HA 3TULA 3B29A 4XLPF 3X2QC 3S90A 4IB4A 1R5ID 2D5RB 2Q4FA 4ULWA 4XWJA 5CI8A 1EKYA 5B3SC 3L8JA 2C04A 2IOQA 2OU6A 4O79A 4E0HA 3WG7C 4KI2A 2OEVA 2IXPA 2XSEA 5GPGB 2J7PA 2R7OA 1OR2A 2EPNA 5T3WA 1YJGA 4BJ1A 4OD4A 1MNDA 3UGPA 5HSWA 3F46A 5CI9A 2Y3GA 1QLEC 4WJ0A 1LE4A 1TWHA 2ASRA 3GWNA 4DBRA 2AP3A 4JTDB 2JPUA 3N2ZB 1NLXA 5L0IA 5E3AA 3RVYA 1Z23A 1UFBA 5JSLA 4XEKA 5T3TA 4DVZA 3SXKA 3AGUA 3RH3A 1WATA 1ZYRF 2YLIA 2ETSA 2ZD9A 5DQTA 4EUKB 5AC4A 2J9UA 3QTHA 4LERA 1SZIA 2Q9AA 3DWWA 3KH2A 1NFOA 1OXKA 2XLMA 2XL8A 2YEVA 3KYIA 5COFA 4FX5A 3I4UA 1CPQA 5L3VA 3NMJA 5IY5C 2XS1A 2HJMA 2G3VA 4NTBA 4O6YA 3RVZA 3MFNA 4LDKA 4DJ9A 4LDRA 1NFNA 2ZXOA 3QW1A 3LEVA 1GGQA 3IHUA 4U5GA 1MMNA 2VC9A 1WOLA 3KKBA 1PD1A 4O7GA 4ZLDA 4E0IA 4WABA 2TMVP 2G3KA 3DXJF 3EG9A 3M4CA 2UUIA 1ZHWA 3UMKA 2Y3BA 1LS1A 3FDQA 1ORJA 4JCZA 3FHDA 1ZZPA 4WGZA 4C3BA 2CDQA 1JOGA 4G78A 2CNWD 3W2VA 3JSEO 3AJMA 1B68A 4BJ6A 1JMWA 2R02A 2OEXA 3A9CA 3K66A 5KYWB 3C18A 1ZW3A 2Q3TA 2R7TA 2AWCA 3EH1A 2IBFA 2XXAB 3L34A 1JPJA 2EPLX 3DZAA 1Z63A 4HFFB 1VOMA 1M6TA 3M79A 1G8XA 1YZAA 1TWCA 2LP4A 1DOVA 2L9JA 4A4AA 4UDVA 3C8GB 4CBEA 5KYUB 4DVYP 5F5FA 2HJ3A 1QVXA 3CSKA 4PJLA 1GS9A 2ICWG 4PR9A 2YZSA 2HFIA 2XS8A 2P1AA 4NY3A 3W4YA 3HKKA 2A0UA 4P9TA 2OG2A 4EBJA 3GEIA 3Q6MA 4P6IC 2J8WA 4DBQA 1YVIA 4MVOA 4K7BA 3EGXB 4OINF 3U2LA 3ASOC 2YL7A 2XLOA 2KJGA 4JIOA 2A6HF 3EFOB 1CGME 4AK9A 5TJ5E 1XZQA 5DS6A 5L0GA 1BR2A 1FMWA 1PD0A 2YQYA 1HY5A 1D0ZA 3E9VA 3GEHA 3R7CA 4CJOA 3NMKA 4U5DE 3ATPA 1NBBA 2O9XA 3FVYA 5L3QA 4QI2A 4MW8A 3ZC4A 2QY9A 5T1DB 4JZAA 3M4BA 3U2MA 1FTSA 1OKKA 3LNMB 1SF8A 4NC3A 4YJWA 4KC9A 3MX3A 4K1OA 1T01A 1T5OA 2J46A 3PMRA 256BA 5DLJA 4F4BA 1Y4CA 2CYDA 2H7BA 4U5HA 3AGTA 4Z9IA 2D4UA 2Q00A 1U89A 2DGJA 3T4RA 4MS2A 4G7HF 4L6RA 4ANJA 2IXMA 3SXYA 4U5BE 5EGYA 2CNWA 1H6GA 5K0IA 2OJQA 4G0HA 1OCRC 3AQCA 4YN0B 2YL0A 2YHSA 2LQGA 3QZCA 3W2WA 2V3CC 5KYXA 1QKRA 3V7OA 3QVYA 2QUPA 4CX9A 4CIPA 3GODA 1KNYA 1RJ9A 3JSZA 3Q7LA 3LJBA 1L7CA 3S9OA 4I3MA 5A6KA 1ORYA 4QDLA 3CAXA 3TQOA 3U8PA 2J0XA 3FAPB 5A6BD 1E84A 3ECSA 1MNEA 4IJJA 4IWBA 3T9OA 4CS7A 3EZHA 5L0CA 2ZXRA 3U3FA 1BR1A 2HZ8A 2XL4A 2KNHA 1Z3IX 4G7OF 1E2XA 1O3UA 5AGFA 3ZIBA 1LI7A 1R4TA 3ZTZA 1YA7O 2H8AA 3S29A 1T6IA 3ZSUA 4AE4A 1LS4A 4BJ5A 3W8IA 5BQHA 5FCLA 1HW1A 2F22A 1T6UA 2PNOA 3EGDA 3V5ZA 2AU5A 2G62A 1Q0KA 3CZ6A 3EZIA 3UMHA 2NUPA 2QLAA 1RKEA 1APCA 3LUTB 4JVSA 4NTFA 4U5EE 2ZPAA 2PF4E 3LS0A 4FESA 4AL0A 3S28A 3V5XA 4Z9JA 4BJTA 5BQIA 3T6JA 3LEOA 2RSEB 1XWJA 1TWAA 4EKWA 4YT2A 1AVOB 2NG1A 1TR2A 2A68F 2C03A 1ORSC 4K0DA 3RQGA 4YK5A 4GEHA 4DXWA 1RMVA 4MTFA 3RW0A 3LLKA 1L3PA 4PFOA 1VK5A 4DRJB 4DOZA 2HKVA 2H7OA 2LCHA 4MVZA 4XPWA 3G4ZA 4J32B 5L0DA 1TKNA 3T6BA 4LLCA 2L6FA 1VMAA 2J0WA 4MW3A 5DS5A 4NTAA 2Y39A 4BJ6C 3J06A 3PDMP 3M1CB 4P9FA 1KU2A 3UGOA 2KYHA 3AG4C 3IEEA 1WGWA 1ZW2A 4JJFA 2PP4A 4D4XA 5EHHA 3TJ5A 4XEFA 2IXNA 1D0YA 2GA0A 5JP7A 4AL1A 3LAYA 2EPOA 4BPMA 1ZVZA 2YL1A 3B9QA 5F5HA 4MVUA 4YT8A 3SYNA 3FOOA 1QQ3A 4NCQA 4I1OB 3TOMA 3R2PA 4MVSA 3FXHA 1EA8A 3RQFA 2VB6A 1CGNA 1V4AA 1BDJB 2W45A 3WAQA 2UUHA 4AX2A 3B0VC 3TJ6A 1CGOA 1FAPB 2HS5A 2P61A 3K6BA 2HMQA 2OJED 2PFDA 1GQAA 1IZMA 1W2WA 3BEHA 2A1DD 3AQBA 3IPMO 3RF3A 2HSBA 2VASA 1OW8A 3GORA 1V55C 2JD3A 1QPUA 3L1MA 3LS1A 3NKEA 3NMIA 4IARA 2XLWA 5KYNA 3PCVA 2L7AA 3OA1A 2J9WA 2NSGA 1M56C 2GFHA 1Q0GA 3JRTA 1SYQA 1LVKA 3H2VA 4DRIB 4WGYA 2CCYA 3EPVA 1U0BB 5B3IA 3A11A 4G7ZF 2E87A 1YA9A 2L81A 2WZGA 2AWYA 1H9GA 2IM8A 3C63A 1A41A 1Q0MA 3NKDA 3JT1A 1EQ1A 1YARO 3TD7A 3IQ5A 4PJMA 4X0RA 1ZHYA 2NUTA 1LE2A 4C3EA 3ABMC 5L0HA 5E2QA 2FAPB 1NU7D 1H9TA 1OXBA 2ZXPA 1TFOB 2L6GA 3ITFA 4CDAA 1GM5A 4IAQA 1VTMP 2J9BA 5D92A 2WZLA 4FWVA 1A7DA 2I15A 4R32A 4U9EA 4JE9A 2YL3A 3EJNA 1J8YF 4Z9HA 2M64A 2Z15A 1HE9A 3C8ZA 2AVKA 4JEBA 3SEOA 5JT4A 1M57C 1D1AA 3KL4A 2EPMX 4E17A 4J30B 1M2VA 3AG2C 1K04A 3GWLA 1OR3A 1OW6A 2LFFA 3G4XA 3QMKA 4KNWA 3KPHA 3HJCA 2PBEA 1ZHXA 3EHNA 3NYLA 2HV7A 3DKAA 3IQCA 2WVQA 4JTAB 5E3CA 2YWAA 3HLZA 1OQCA 3C62A 3ZTMA 5DQZA 4CJGA 5A6JA 1ST6A 3AOUA 5KYYB 2QE9A 5KYXB 3K1IA 5JVEA 4N06A 1UG7A 3E70C
chains in the Genus database with same CATH topology
3W4YA 3LLKA 3MBGA 4E0HA 3U2LA 3TK0A 1JRAA 4LDKA 3R7CA 3LLIA 3O55A 3U5SA 3GWNA 3U2MA 3GWLA 4E0IA 2HJ3A 1OQCA 3TD7A 1JR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4Y A;  3LLK A;  3MBG A;  4E0H A;  3U2L A;  3TK0 A;  1JRA A;  4LDK A;  3R7C A;  3LLI A;  3O55 A;  3U5S A;  3GWN A;  3U2M A;  3GWL A;  4E0I A;  2HJ3 A;  1OQC A;  3TD7 A;  1JR8 A; 
#chains in the Genus database with same CATH topology
 2J45 A;  2PX3 A;  1RJ9 B;  5D91 A;  1OCC C;  2Y69 C;  5E33 A;  4YT4 A;  2XLH A;  2DB4 A;  3ZQY A;  4MVR A;  2EIN C;  3CQZ A;  2XLE A;  5DVW A;  1AUE A;  3UNG C;  3K7D A;  4CSA A;  5JLI A;  3HNJ A;  1PV3 A;  2WVO A;  1D1C A;  2KQ9 A;  3DD7 A;  1TWG A;  2XLD A;  3FAJ A;  2JX0 A;  2Q7R A;  1FNT c;  1AEP A;  3RYL A;  3Q6N A;  2LIG A;  3OEO A;  5KYU A;  3RFY A;  4E18 A;  2DYS C;  2W4B A;  4HEA J;  4E7S A;  4ZLC A;  2Y3H A;  3O55 A;  5L0J A;  1VLS A;  3B0U X;  3ZVR A;  1Y6D A;  1XZP A;  3QW0 A;  1LI5 A;  4OIP F;  4C7O A;  1JPN A;  3IQT A;  3WOD F;  2HV6 A;  1K40 A;  1M2O A;  2R05 A;  3NYJ A;  4H54 A;  3U9J A;  4BJ5 C;  3S0X A;  4HE8 D;  4N4W A;  4CS8 A;  2NPU A;  4W8K A;  3JCU Q;  3HNK A;  2R03 A;  3NG1 A;  3S27 A;  3TOL A;  5DS4 A;  1N1C A;  3GEE A;  4XPX A;  2XM0 A;  1WTY A;  3RQE A;  5L0F A;  2R7W A;  2R7S A;  4HFK B;  2NUP B;  1J8M F;  2P0N A;  2W9Y A;  3VYW A;  1A7E A;  5JUA A;  1VLT A;  2Q9B A;  4M63 A;  3RIP A;  1HE1 A;  3N24 A;  4KBL A;  4PJN A;  1JAF A;  4IAO A;  3TK0 A;  3UR3 C;  1E86 A;  1O5H A;  1Z6A A;  1SR2 A;  2HMZ A;  2VCC A;  3JYH A;  3GM1 A;  4YL3 A;  3X1O A;  2NSF A;  4FAP B;  4YWQ A;  2VCB A;  4EWC A;  3DI5 A;  1WN0 A;  2MYS A;  3U3B A;  1RXQ A;  3VF0 A;  3G50 A;  2BE5 F;  1MQV A;  1TFK B;  2WB7 A;  1HMD A;  1MMA A;  2I8B A;  2P7V A;  5CIV A;  1VB5 A;  3U9M A;  1T6Q A;  2IXO A;  5FZT A;  3U8V A;  4Q4Z F;  2W4M A;  3N0T A;  2Y3D A;  1TQG A;  4RDA A;  4A2N B;  4B6I A;  5A6A A;  4YT5 A;  2QTV A;  2FFH A;  5JRA A;  5B1A C;  4XQ1 A;  2HUJ A;  1BZ4 A;  4CS9 A;  1NG1 A;  1BR4 A;  1VYK A;  2H7V C;  1RKC A;  3B71 A;  3JZ0 A;  4GQH A;  3EG9 B;  1YYX A;  3EHM A;  3DE9 A;  2KW3 C;  2XL6 A;  5A69 A;  1V74 B;  2MWQ A;  1C02 A;  3EQL F;  2KGO A;  2EIM C;  1PCX A;  3I5Q A;  1YYJ A;  1ZHZ A;  1K05 A;  1NSG B;  1VYI A;  2RD9 A;  3I5P A;  3QVZ A;  3DM5 A;  2WVN A;  4JKV A;  4LLE A;  4OD5 A;  5JS5 A;  4I44 A;  1OCZ C;  2CW0 F;  3DJN B;  4JRZ A;  3FMS A;  2EIJ C;  3DAF A;  2V26 A;  1ZHT A;  4J7Y A;  4ER9 A;  2R7V A;  4Q7C A;  4XLN F;  3PHF 2;  1O87 A;  3NYM A;  1YLM A;  1JR8 A;  1ZU4 A;  5COM A;  2LSE A;  1SMY F;  4IRU A;  1YAU O;  3FOP A;  3DE8 A;  2B0H A;  2OQM A;  3MBG A;  1LIH A;  3C8G D;  5A6B A;  2KK1 A;  4OIO F;  1KTM A;  1ZU5 A;  2R7R A;  4GYT A;  5BQG A;  2NUT B;  3VRC A;  4NQF A;  3H65 A;  3LES A;  1FFT C;  1NU9 C;  2OOC A;  4XEV A;  1OKK D;  5F28 E;  4DRH B;  3NDB B;  4PAC A;  2X51 A;  2BC5 A;  4MTO A;  4N6C A;  2BL2 A;  3EH2 A;  3SP1 A;  2DI3 A;  2WL8 A;  2YLG A;  3ABK C;  4IGG A;  3MLG A;  1LKX A;  2MHR A;  3O10 A;  4O6M A;  1LPE A;  3MYF A;  1C17 M;  4OIQ F;  1FFH A;  3K33 A;  3US6 A;  3AG3 C;  4CDV A;  1FMV A;  1S05 A;  2A0B A;  2YRF A;  3NRH A;  4RBN A;  4MVM A;  4EHP A;  2KC3 A;  1I4Z A;  3JTL O;  4BEM J;  1M2V B;  4BEJ A;  1F1M A;  1RCP A;  2EIL C;  2KSF A;  4PJJ A;  4LAC B;  2Q9C A;  5KYW A;  2R25 A;  4MVQ A;  1Q0F A;  3K1I C;  2GAQ A;  2HSQ A;  3JRM O;  3DJU B;  1D0X A;  3IQ6 A;  3L8I A;  4QI0 A;  4U5C E;  5EK0 A;  4E7Z A;  3POV A;  1S7Z A;  1T9K A;  1MMD A;  4J7T A;  4ONS A;  1JRA A;  2L6H A;  4W8P A;  3UMI A;  4PK4 A;  1CPR A;  2OKU A;  3ZDL A;  4CSA C;  2XM4 A;  3H2U A;  5AC5 A;  3S84 A;  1MMG A;  4JUR I;  1HW2 A;  2YKZ A;  2DYR C;  2LFD A;  2R7Q A;  3Q7G A;  4JTC B;  4LDQ A;  4O6N A;  4EBK A;  1C03 A;  1I4Y A;  3O39 A;  2P6V A;  2YLD A;  2B0J A;  3DMD A;  3GAN A;  1A7V A;  1OCO C;  4C7O B;  5B1B C;  3VAY A;  1YDI A;  3LNR A;  1G5Z A;  1WWP A;  2CGE A;  3B0P A;  2GWW A;  4CS8 C;  3SXM A;  2J7P D;  3GM2 A;  3WHN A;  3ASN C;  2XXA A;  3BRJ A;  3AG1 C;  2LK4 A;  1WAS A;  2X0C A;  2EPK X;  3SNH A;  3KYJ A;  3C7J A;  4PFP A;  1BBH A;  4D4N A;  1U6H A;  5BUO A;  4I1M A;  3RKO F;  1E83 A;  4MTG A;  4Q5S F;  4BG0 A;  3L0I A;  2FGY A;  3U0C A;  1LM3 B;  2LD6 A;  3W8H A;  1A0B A;  3C8G A;  4H4K C;  2OCC C;  4XPY A;  4XTK A;  3LLI A;  5COG A;  4EBB A;  4U9D A;  1Z5Z A;  1NZE A;  2J9V A;  4JC7 A;  4JW1 A;  1Z7Q c;  2A69 F;  4MQ9 F;  3VM6 A;  1QSP A;  4JCH A;  2QNL A;  1E85 A;  4RD9 A;  2R7U A;  3ZG1 A;  4KNV A;  2PX0 A;  2R7X A;  4N6H A;  3ZWI A;  4AE4 B;  3EGX A;  2XLV A;  3F47 A;  4CDY A;  1EI7 A;  2XRH A;  3EGD B;  1D1B A;  3EFO A;  1YZC A;  2ZXW C;  3SZR A;  1RKE B;  2M4E A;  3DAG A;  3M15 A;  3OWT A;  2WZF A;  4MND A;  1QZX A;  1Q0D A;  4OIR F;  3JYY A;  2YVK A;  3ABL C;  5HV9 A;  4C3D A;  3T6G B;  4JJG A;  3HNI A;  3GM3 A;  4CS9 C;  2VH3 A;  4CIH A;  3V5Y A;  4EIY A;  1IW7 F;  1H7I A;  1G4U S;  4ULV A;  2GDC A;  1G4W R;  2R9R B;  2VCA A;  4YL0 A;  1I5N A;  5KYY A;  3HNL A;  3MYI A;  3O6X A;  3U5S A;  1FR0 A;  3DM9 B;  2EIK C;  3HTK C;  4U5F E;  4YL1 A;  3ZQV A;  1OW7 A;  1V54 C;  3CEX A;  4JEA A;  2A6E F;  3SXZ A;  1HMO A;  3KMI A;  2IYL D;  1DOW A;  3K1H A;  3TUL A;  3B29 A;  4XLP F;  3X2Q C;  3S90 A;  4IB4 A;  1R5I D;  2D5R B;  2Q4F A;  4ULW A;  4XWJ A;  5CI8 A;  1EKY A;  5B3S C;  3L8J A;  2C04 A;  2IOQ A;  2OU6 A;  4O79 A;  4E0H A;  3WG7 C;  4KI2 A;  2OEV A;  2IXP A;  2XSE A;  5GPG B;  2J7P A;  2R7O A;  1OR2 A;  2EPN A;  5T3W A;  1YJG A;  4BJ1 A;  4OD4 A;  1MND A;  3UGP A;  5HSW A;  3F46 A;  5CI9 A;  2Y3G A;  1QLE C;  4WJ0 A;  1LE4 A;  1TWH A;  2ASR A;  3GWN A;  4DBR A;  2AP3 A;  4JTD B;  2JPU A;  3N2Z B;  1NLX A;  5L0I A;  5E3A A;  3RVY A;  1Z23 A;  1UFB A;  5JSL A;  4XEK A;  5T3T A;  4DVZ A;  3SXK A;  3AGU A;  3RH3 A;  1WAT A;  1ZYR F;  2YLI A;  2ETS A;  2ZD9 A;  5DQT A;  4EUK B;  5AC4 A;  2J9U A;  3QTH A;  4LER A;  1SZI A;  2Q9A A;  3DWW A;  3KH2 A;  1NFO A;  1OXK A;  2XLM A;  2XL8 A;  2YEV A;  3KYI A;  5COF A;  4FX5 A;  3I4U A;  1CPQ A;  5L3V A;  3NMJ A;  5IY5 C;  2XS1 A;  2HJM A;  2G3V A;  4NTB A;  4O6Y A;  3RVZ A;  3MFN A;  4LDK A;  4DJ9 A;  4LDR A;  1NFN A;  2ZXO A;  3QW1 A;  3LEV A;  1GGQ A;  3IHU A;  4U5G A;  1MMN A;  2VC9 A;  1WOL A;  3KKB A;  1PD1 A;  4O7G A;  4ZLD A;  4E0I A;  4WAB A;  2TMV P;  2G3K A;  3DXJ F;  3EG9 A;  3M4C A;  2UUI A;  1ZHW A;  3UMK A;  2Y3B A;  1LS1 A;  3FDQ A;  1ORJ A;  4JCZ A;  3FHD A;  1ZZP A;  4WGZ A;  4C3B A;  2CDQ A;  1JOG A;  4G78 A;  2CNW D;  3W2V A;  3JSE O;  3AJM A;  1B68 A;  4BJ6 A;  1JMW A;  2R02 A;  2OEX A;  3A9C A;  3K66 A;  5KYW B;  3C18 A;  1ZW3 A;  2Q3T A;  2R7T A;  2AWC A;  3EH1 A;  2IBF A;  2XXA B;  3L34 A;  1JPJ A;  2EPL X;  3DZA A;  1Z63 A;  4HFF B;  1VOM A;  1M6T A;  3M79 A;  1G8X A;  1YZA A;  1TWC A;  2LP4 A;  1DOV A;  2L9J A;  4A4A A;  4UDV A;  3C8G B;  4CBE A;  5KYU B;  4DVY P;  5F5F A;  2HJ3 A;  1QVX A;  3CSK A;  4PJL A;  1GS9 A;  2ICW G;  4PR9 A;  2YZS A;  2HFI A;  2XS8 A;  2P1A A;  4NY3 A;  3W4Y A;  3HKK A;  2A0U A;  4P9T A;  2OG2 A;  4EBJ A;  3GEI A;  3Q6M A;  4P6I C;  2J8W A;  4DBQ A;  1YVI A;  4MVO A;  4K7B A;  3EGX B;  4OIN F;  3U2L A;  3ASO C;  2YL7 A;  2XLO A;  2KJG A;  4JIO A;  2A6H F;  3EFO B;  1CGM E;  4AK9 A;  5TJ5 E;  1XZQ A;  5DS6 A;  5L0G A;  1BR2 A;  1FMW A;  1PD0 A;  2YQY A;  1HY5 A;  1D0Z A;  3E9V A;  3GEH A;  3R7C A;  4CJO A;  3NMK A;  4U5D E;  3ATP A;  1NBB A;  2O9X A;  3FVY A;  5L3Q A;  4QI2 A;  4MW8 A;  3ZC4 A;  2QY9 A;  5T1D B;  4JZA A;  3M4B A;  3U2M A;  1FTS A;  1OKK A;  3LNM B;  1SF8 A;  4NC3 A;  4YJW A;  4KC9 A;  3MX3 A;  4K1O A;  1T01 A;  1T5O A;  2J46 A;  3PMR A;  256B A;  5DLJ A;  4F4B A;  1Y4C A;  2CYD A;  2H7B A;  4U5H A;  3AGT A;  4Z9I A;  2D4U A;  2Q00 A;  1U89 A;  2DGJ A;  3T4R A;  4MS2 A;  4G7H F;  4L6R A;  4ANJ A;  2IXM A;  3SXY A;  4U5B E;  5EGY A;  2CNW A;  1H6G A;  5K0I A;  2OJQ A;  4G0H A;  1OCR C;  3AQC A;  4YN0 B;  2YL0 A;  2YHS A;  2LQG A;  3QZC A;  3W2W A;  2V3C C;  5KYX A;  1QKR A;  3V7O A;  3QVY A;  2QUP A;  4CX9 A;  4CIP A;  3GOD A;  1KNY A;  1RJ9 A;  3JSZ A;  3Q7L A;  3LJB A;  1L7C A;  3S9O A;  4I3M A;  5A6K A;  1ORY A;  4QDL A;  3CAX A;  3TQO A;  3U8P A;  2J0X A;  3FAP B;  5A6B D;  1E84 A;  3ECS A;  1MNE A;  4IJJ A;  4IWB A;  3T9O A;  4CS7 A;  3EZH A;  5L0C A;  2ZXR A;  3U3F A;  1BR1 A;  2HZ8 A;  2XL4 A;  2KNH A;  1Z3I X;  4G7O F;  1E2X A;  1O3U A;  5AGF A;  3ZIB A;  1LI7 A;  1R4T A;  3ZTZ A;  1YA7 O;  2H8A A;  3S29 A;  1T6I A;  3ZSU A;  4AE4 A;  1LS4 A;  4BJ5 A;  3W8I A;  5BQH A;  5FCL A;  1HW1 A;  2F22 A;  1T6U A;  2PNO A;  3EGD A;  3V5Z A;  2AU5 A;  2G62 A;  1Q0K A;  3CZ6 A;  3EZI A;  3UMH A;  2NUP A;  2QLA A;  1RKE A;  1APC A;  3LUT B;  4JVS A;  4NTF A;  4U5E E;  2ZPA A;  2PF4 E;  3LS0 A;  4FES A;  4AL0 A;  3S28 A;  3V5X A;  4Z9J A;  4BJT A;  5BQI A;  3T6J A;  3LEO A;  2RSE B;  1XWJ A;  1TWA A;  4EKW A;  4YT2 A;  1AVO B;  2NG1 A;  1TR2 A;  2A68 F;  2C03 A;  1ORS C;  4K0D A;  3RQG A;  4YK5 A;  4GEH A;  4DXW A;  1RMV A;  4MTF A;  3RW0 A;  3LLK A;  1L3P A;  4PFO A;  1VK5 A;  4DRJ B;  4DOZ A;  2HKV A;  2H7O A;  2LCH A;  4MVZ A;  4XPW A;  3G4Z A;  4J32 B;  5L0D A;  1TKN A;  3T6B A;  4LLC A;  2L6F A;  1VMA A;  2J0W A;  4MW3 A;  5DS5 A;  4NTA A;  2Y39 A;  4BJ6 C;  3J06 A;  3PDM P;  3M1C B;  4P9F A;  1KU2 A;  3UGO A;  2KYH A;  3AG4 C;  3IEE A;  1WGW A;  1ZW2 A;  4JJF A;  2PP4 A;  4D4X A;  5EHH A;  3TJ5 A;  4XEF A;  2IXN A;  1D0Y A;  2GA0 A;  5JP7 A;  4AL1 A;  3LAY A;  2EPO A;  4BPM A;  1ZVZ A;  2YL1 A;  3B9Q A;  5F5H A;  4MVU A;  4YT8 A;  3SYN A;  3FOO A;  1QQ3 A;  4NCQ A;  4I1O B;  3TOM A;  3R2P A;  4MVS A;  3FXH A;  1EA8 A;  3RQF A;  2VB6 A;  1CGN A;  1V4A A;  1BDJ B;  2W45 A;  3WAQ A;  2UUH A;  4AX2 A;  3B0V C;  3TJ6 A;  1CGO A;  1FAP B;  2HS5 A;  2P61 A;  3K6B A;  2HMQ A;  2OJE D;  2PFD A;  1GQA A;  1IZM A;  1W2W A;  3BEH A;  2A1D D;  3AQB A;  3IPM O;  3RF3 A;  2HSB A;  2VAS A;  1OW8 A;  3GOR A;  1V55 C;  2JD3 A;  1QPU A;  3L1M A;  3LS1 A;  3NKE A;  3NMI A;  4IAR A;  2XLW A;  5KYN A;  3PCV A;  2L7A A;  3OA1 A;  2J9W A;  2NSG A;  1M56 C;  2GFH A;  1Q0G A;  3JRT A;  1SYQ A;  1LVK A;  3H2V A;  4DRI B;  4WGY A;  2CCY A;  3EPV A;  1U0B B;  5B3I A;  3A11 A;  4G7Z F;  2E87 A;  1YA9 A;  2L81 A;  2WZG A;  2AWY A;  1H9G A;  2IM8 A;  3C63 A;  1A41 A;  1Q0M A;  3NKD A;  3JT1 A;  1EQ1 A;  1YAR O;  3TD7 A;  3IQ5 A;  4PJM A;  4X0R A;  1ZHY A;  2NUT A;  1LE2 A;  4C3E A;  3ABM C;  5L0H A;  5E2Q A;  2FAP B;  1NU7 D;  1H9T A;  1OXB A;  2ZXP A;  1TFO B;  2L6G A;  3ITF A;  4CDA A;  1GM5 A;  4IAQ A;  1VTM P;  2J9B A;  5D92 A;  2WZL A;  4FWV A;  1A7D A;  2I15 A;  4R32 A;  4U9E A;  4JE9 A;  2YL3 A;  3EJN A;  1J8Y F;  4Z9H A;  2M64 A;  2Z15 A;  1HE9 A;  3C8Z A;  2AVK A;  4JEB A;  3SEO A;  5JT4 A;  1M57 C;  1D1A A;  3KL4 A;  2EPM X;  4E17 A;  4J30 B;  1M2V A;  3AG2 C;  1K04 A;  3GWL A;  1OR3 A;  1OW6 A;  2LFF A;  3G4X A;  3QMK A;  4KNW A;  3KPH A;  3HJC A;  2PBE A;  1ZHX A;  3EHN A;  3NYL A;  2HV7 A;  3DKA A;  3IQC A;  2WVQ A;  4JTA B;  5E3C A;  2YWA A;  3HLZ A;  1OQC A;  3C62 A;  3ZTM A;  5DQZ A;  4CJG A;  5A6J A;  1ST6 A;  3AOU A;  5KYY B;  2QE9 A;  5KYX B;  3K1I A;  5JVE A;  4N06 A;  1UG7 A;  3E70 C; 
#chains in the Genus database with same CATH homology
 3W4Y A;  3LLK A;  3MBG A;  4E0H A;  3U2L A;  3TK0 A;  1JRA A;  4LDK A;  3R7C A;  3LLI A;  3O55 A;  3U5S A;  3GWN A;  3U2M A;  3GWL A;  4E0I A;  2HJ3 A;  1OQC A;  3TD7 A;  1JR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...