4AE4B

The ubap1 subunit of escrt-i interacts with ubiquitin via a novel souba domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
113
Chain Sequence
SHMSPSERQCVETVVNGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVEEALEHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords UBIQUITIN-ASSOCIATED PROTEIN 1
publication title The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 113
sequence length 115
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ae4B00
4AE4B 4AE4A
chains in the Genus database with same CATH superfamily
4N4WA 2IXNA 1VLSA 2YL0A 1WGWA 1OXKA 3H2VA 2V26A 2CNWD 4RBNA 5E3CA 4JURI 1L7CA 5A6BA 1YVIA 2X51A 4MS2A 5KYYB 2PX0A 3JRTA 2J8WA 3ZWIA 2XLMA 3K1HA 4ONSA 4U5GA 3U9JA 3S90A 1H9TA 4XLPF 5A69A 3ZTMA 1ZVZA 4YT2A 3B0VC 3JYHA 3GEIA 3U9MA 4C7OA 4KBLA 5CI8A 1S7ZA 1RKEB 2Y39A 3G4XA 3MYFA 1T6UA 5CI9A 2QE9A 3GWNA 5JVEA 3CEXA 2BC5A 4OINF 3LAYA 2H7BA 4DRIB 2HMQA 1G4WR 5CIVA 4DBRA 2LCHA 1M2VB 4UDVA 1R5ID 1XZPA 3JT1A 4G7HF 5L0FA 1G8XA 3TD7A 3U3BA 3UNGC 3NDBB 2H7VC 1Y4CA 2WB7A 1D1AA 3AOUA 5T1DB 1YLMA 1E85A 2XXAA 2Q9AA 2IOQA 1GQAA 4A4AA 1V54C 1ZZPA 1HW1A 1H7IA 3SNHA 5KYNA 3JRMO 5DLJA 3KYJA 1OCCC 4CDYA 4A2NB 3FDQA 2EIKC 4E0IA 3GM2A 2EPOA 1TWHA 5HSWA 4GEHA 2YLGA 1FNTc 1UFBA 2R7VA 3TJ6A 2Z15A 2J7PD 3DJNB 3V5ZA 2LFFA 3N2ZB 2P61A 4O6MA 3AG3C 1YZCA 2EINC 5COGA 2WVOA 2E87A 4CS8A 2PFDA 1B68A 3KL4A 3FVYA 4JTAB 3VRCA 4Q4ZF 1TWAA 2D5RB 3EFOA 2GDCA 4BEJA 3AQBA 4CSAA 2NG1A 2FGYA 5F28E 1YZAA 2LK4A 1Q0GA 2PNOA 4HFFB 4AE4B 4JKVA 2ZXPA 1A7EA 3M79A 4NTFA 1VLTA 2J46A 4X0RA 1C17M 3NMKA 5KYXA 4CIHA 3QZCA 4PACA 3DZAA 1JRAA 2EIJC 1OXBA 1WATA 2R7OA 1E86A 2J45A 1N1CA 1YARO 2XL4A 3L0IA 4YT4A 2EILC 1H6GA 1SF8A 2H8AA 4XQ1A 5KYXB 5L0HA 1GM5A 5DS6A 4LACB 3CQZA 3LS0A 2P7VA 2Y69C 2ZXRA 5BQHA 4HE8D 2Q7RA 5JUAA 2R05A 3MBGA 2C03A 4CBEA 5T3TA 1I5NA 2A1DD 3LEVA 3JCUQ 2F22A 4EUKB 4CJGA 2A69F 3TJ5A 1HE9A 1OCZC 3QVYA 1E2XA 4JEBA 4M63A 1FMVA 1A7DA 5JRAA 2EPNA 1SYQA 2GAQA 2Y3GA 3EPVA 3H2UA 1GS9A 3ZIBA 1ST6A 1UG7A 3LLIA 3J06A 3JSEO 3B29A 3C8ZA 1QQ3A 3ZQVA 4LLCA 2HUJA 1Z63A 2YZSA 4MTOA 2Y3BA 2KK1A 4BEMJ 3JTLO 3AG1C 1BR2A 3KKBA 1RCPA 3DJUB 4E18A 4RDAA 1OW8A 1RXQA 1BR4A 3K66A 1HE1A 4C3EA 4J7TA 4MVOA 3V5XA 3W8IA 1ORSC 2JPUA 2NUTB 1LS4A 3WAQA 1V4AA 3E9VA 3W4YA 2QTVA 3GEEA 4Q5SF 1K04A 3L34A 1OKKA 3RQEA 2C04A 3F46A 3MX3A 2HV6A 4P9TA 3R7CA 1E84A 1DOWA 1BR1A 2FAPB 3SXZA 1MMAA 5B1AC 1PD0A 1RMVA 3ABKC 4PJLA 3DI5A 3ASNC 3UMIA 4C3BA 1SR2A 2Q3TA 3RVYA 3NYMA 5EGYA 4MW3A 2P6VA 3POVA 3SP1A 3VM6A 2EPMX 3B0PA 5KYWA 4JVSA 3GM3A 5E2QA 2WZGA 4PK4A 4AK9A 3EHNA 3S0XA 2XLOA 4CDAA 1K05A 2NSFA 3NYJA 3R2PA 4J32B 4ZLDA 3ZSUA 4Q7CA 4KI2A 1LS1A 2KQ9A 4IAOA 3RF3A 4AL1A 3FMSA 2QLAA 2J9WA 2LSEA 4U5HA 1NFNA 3U3FA 4EIYA 1ZHYA 3TOLA 3EGDA 4E17A 1APCA 1ZHWA 4IB4A 3Q7LA 2XS1A 1M57C 2Q4FA 3NKEA 1LIHA 3RQGA 1RJ9B 3HKKA 1Z5ZA 1TR2A 3KMIA 3X2QC 2R7WA 2IM8A 4XLNF 1TKNA 3W2WA 3I5PA 4JZAA 1OQCA 4BJ6C 3ABMC 1MMDA 5DS5A 1QSPA 1JOGA 3RH3A 1VB5A 4I1OB 3EH2A 2WZLA 1D0YA 2LFDA 1R4TA 2WZFA 4JIOA 3CAXA 2J9BA 4B6IA 4MVSA 1DOVA 3OWTA 4H54A 3C7JA 1WN0A 4CDVA 1M6TA 4PJMA 3TULA 1QPUA 256BA 2I8BA 3NRHA 4JE9A 4PJNA 3EZIA 3ATPA 3CZ6A 1LKXA 4MVMA 2H7OA 1KU2A 2B0JA 4C7OB 2NSGA 1VYKA 2PX3A 3C8GA 2HSBA 3EQLF 1VTMP 1KTMA 3TQOA 2HKVA 1PV3A 2XM4A 3L1MA 1BZ4A 3K1IA 4WGZA 3GANA 4Z9JA 3RW0A 4YK5A 1HY5A 3W8HA 4L6RA 2R7QA 4PR9A 2W4BA 3DE8A 3QTHA 3RQFA 1VOMA 1OW6A 2OOCA 1RKCA 2YQYA 3ECSA 1T9KA 4J7YA 1IZMA 2IXOA 3MLGA 3O55A 1NBBA 1D0ZA 5L0DA 1S05A 2CYDA 2HFIA 1FFHA 1JPNA 4XEKA 2XXAB 1JAFA 1VYIA 1ORJA 3LNRA 4BJTA 4I44A 4Z9HA 4XEVA 3DXJF 3PHF2 2O9XA 2PF4E 4C3DA 4BJ1A 4XPWA 2R7UA 2QY9A 1L3PA 2G3KA 4KC9A 2ETSA 1V74B 2VCBA 4AL0A 1ZU4A 2R02A 4CIPA 3B0UX 3DE9A 4CS8C 1YA7O 2P1AA 3NMIA 3UR3C 3DAFA 3ITFA 4K1OA 1ORYA 1V55C 1Z3IX 4ER9A 5L0IA 1Z7Qc 2ASRA 3ZVRA 4PFOA 2KGOA 5GPGB 4CS9C 2NUPA 3Q6NA 5L0JA 2GWWA 4O79A 3EFOB 4OIOF 2WL8A 3DM9B 3PMRA 2D4UA 5L0CA 1OCRC 1LPEA 1TWCA 3FXHA 4I3MA 5D92A 4WGYA 1I4YA 4FWVA 4JTCB 1SMYF 1Q0DA 3OA1A 2JX0A 3IQ5A 1A0BA 2VCAA 4IAQA 1NG1A 3T6GB 4XPXA 1OR3A 1T01A 1JPJA 2YEVA 3LEOA 5FCLA 3G50A 4QDLA 2R03A 3NKDA 3U8PA 2EPLX 2PP4A 1NLXA 4JRZA 3RVZA 4CX9A 3IQTA 3SXMA 3DMDA 3JYYA 4G7ZF 1FAPB 1MNEA 2XLWA 2CNWA 2PBEA 3GORA 4O6YA 3SXKA 5A6BD 2V3CC 4JC7A 4ULVA 5B3SC 4IRUA 4OIPF 1U89A 4NTAA 1KNYA 4H4KC 4MVRA 1AVOB 3AGUA 2XSEA 3Q7GA 2YLIA 4DRJB 4OD4A 2LQGA 4BJ5A 2OQMA 1U0BB 4NTBA 5TJ5E 1ZW3A 3I4UA 5E3AA 3T9OA 1HMDA 3U8VA 3AQCA 4E7ZA 1NFOA 4XPYA 1D1BA 2YL7A 4RD9A 3SZRA 2JD3A 2CDQA 2A6HF 2L6HA 3S29A 2Y3DA 3NG1A 3W2VA 2MWQA 3BRJA 1W2WA 2R7SA 2KSFA 3VYWA 1OR2A 3U2MA 3HTKC 1OW7A 2HS5A 3HNIA 3V5YA 4W8KA 2ZXOA 4U5CE 3IQ6A 2IYLD 3QW1A 4FAPB 2KC3A 2FFHA 2Q9CA 2CGEA 3HLZA 2EPKX 2KYHA 4QI2A 4DRHB 4NY3A 1T6IA 4IJJA 4U5BE 4DOZA 2XL8A 2XLDA 4KNVA 3N0TA 3RYLA 2J7PA 2G62A 1VK5A 3FHDA 1HW2A 2GA0A 2HZ8A 4YL3A 1Q0KA 4D4NA 1H9GA 1TFOB 3EGXA 1E83A 5F5FA 3ABLC 3MYIA 4NC3A 2L9JA 3AJMA 2Q00A 5T3WA 5KYWB 1MMGA 2Y3HA 4N06A 5KYUA 2L6GA 3RIPA 2AU5A 3LUTB 2L6FA 3EGXB 4D4XA 1I4ZA 4IARA 1O87A 3RFYA 3T6JA 1YYJA 1WWPA 2A0BA 3U5SA 2HJMA 4E0HA 4EBBA 2R25A 3S84A 3IHUA 2MYSA 5K0IA 3AG4C 4JEAA 5BQIA 4K0DA 3BEHA 3EGDB 1K40A 2AWCA 1HMOA 2LD6A 2YHSA 3UMHA 5JLIA 3IQCA 1F1MA 2NPUA 4W8PA 4OIRF 3CSKA 3U2LA 5A6JA 4U5FE 1TFKB 1MNDA 3S27A 1OCOC 1XZQA 2DB4A 5DQZA 1NU9C 4PJJA 2G3VA 3ZDLA 1AUEA 5EHHA 4IWBA 4DXWA 2IXPA 1T6QA 1XWJA 5L0GA 3SXYA 1VMAA 3O39A 5DS4A 2ZXWC 5KYYA 5DQTA 3N24A 3T6BA 2CW0F 1Q0FA 1LE4A 3TK0A 2VB6A 4BJ6A 3TOMA 1BBHA 1EQ1A 2RD9A 3KYIA 3T4RA 1RKEA 3LLKA 5AGFA 4LLEA 4E7SA 2Q9BA 3K1IC 3K33A 3C8GB 2CCYA 4N6CA 4YN0B 1FR0A 2VASA 3FAPB 3LS1A 3EH1A 1M56C 2YKZA 4YWQA 1M2VA 1J8YF 4EWCA 3X1OA 2AP3A 3FOPA 3ZQYA 1MQVA 4FESA 1WTYA 1TWGA 2QNLA 1CPQA 3M4CA 2A68F 3Q6MA 3ZC4A 5AC5A 1LVKA 1A7VA 4GQHA 4EBJA 2BE5F 3RKOF 4F4BA 1YYXA 3B9QA 5L3VA 4MVZA 2OEVA 4U9EA 3C63A 1O3UA 2VH3A 1LI5A 1AEPA 2HMZA 4OIQF 1OKKD 2OJED 3K6BA 1BDJB 5A6AA 5DVWA 5FZTA 3FOOA 1YAUO 4EKWA 4ZLCA 2YL3A 4CSAC 2W45A 2W9YA 1O5HA 2LP4A 2R9RB 1QLEC 4JJFA 4JJGA 4LDQA 4MVQA 4U5EE 5L3QA 4XEFA 1ZW2A 3O10A 4K7BA 2IBFA 2TMVP 2A6EF 2M4EA 4Z9IA 4XTKA 4N6HA 3DKAA 3WHNA 3F47A 2UUIA 2DYRC 1GGQA 2NUPB 2DI3A 3E70C 4FX5A 1EI7A 1U6HA 5BQGA 1CGOA 3LESA 4G7OF 2W4MA 2AWYA 1WASA 4DJ9A 4WABA 4AE4A 4QI0A 2B0HA 2L81A 4PFPA 3PDMP 2ZPAA 1G5ZA 1ZHZA 2J9VA 4MTGA 2BL2A 4XWJA 4LDRA 4CS9A 2R7TA 3UGOA 3SEOA 1CGNA 5EK0A 2ZD9A 5JSLA 1J8MF 3O6XA 5D91A 2XRHA 3L8IA 3NYLA 1LM3B 3US6A 3V7OA 1YDIA 4IGGA 3QW0A 1FTSA 4HEAJ 4CS7A 1WOLA 1CPRA 3VF0A 3EG9A 1JMWA 1Y6DA 3U0CA 3DD7A 3EJNA 3OEOA 4MTFA 4LERA 1ZHXA 2P0NA 3KH2A 2IXMA 3L8JA 1NSGB 1Z6AA 2LIGA 2DYSC 3EG9B 3UMKA 2YVKA 5JP7A 4BG0A 3AGTA 3B71A 3M15A 2HV7A 2R7RA 1D1CA 2I15A 5IY5C 2OCCC 4YL0A 3HJCA 4BJ5C 3EHMA 2DGJA 3G4ZA 1NU7D 2A0UA 3IEEA 4NCQA 3C8GD 1PCXA 1ZU5A 2HJ3A 2KNHA 4OD5A 4DBQA 5AC4A 4YJWA 3LNMB 3A11A 3NMJA 3GWLA 1ZYRF 4EBKA 2RSEB 1Q0MA 3ASOC 4MVUA 4DVYP 5JS5A 2WVNA 1EKYA 2L7AA 1QVXA 1FMWA 2XL6A 4G78A 5HV9A 3HNJA 3JZ0A 4HFKB 2M64A 3UGPA 4O7GA 2J0WA 1A41A 1C03A 3KPHA 4MQ9F 4U9DA 2OEXA 2NUTA 3M4BA 4JTDB 2XM0A 4U5DE 2UUHA 2OKUA 2KJGA 5E33A 2J9UA 4O6NA 2OJQA 1FFTC 3S9OA 3LJBA 1NZEA 4BPMA 4R32A 1JR8A 3DWWA 5B1BC 3M1CB 2AVKA 2YL1A 1T5OA 3ZG1A 2R7XA 4YT5A 3QMKA 1PD1A 3HNLA 1LI7A 3H65A 2OU6A 1D0XA 3JSZA 3IPMO 3C62A 3I5QA 1YA9A 1Z23A 2QUPA 1C02A 3K7DA 3WG7C 4MW8A 4ANJA 4CJOA 2GFHA 3PCVA 4AX2A 1CGME 3QVZA 2OG2A 2VC9A 3ZTZA 4WJ0A 2MHRA 1QKRA 3VAYA 3SYNA 2KW3C 2YWAA 4I1MA 4LDKA 4JCZA 3DM5A 3HNKA 5KYUB 1IW7F 3EZHA 4J30B 4P6IC 3S28A 3C18A 4GYTA 1SZIA 2J0XA 3FAJA 5COFA 4DVZA 2X0CA 4KNWA 4JCHA 1ZHTA 1YJGA 3GODA 2HSQA 5BUOA 2EIMC 3A9CA 1G4US 4EHPA 1MMNA 3GM1A 4YT8A 1EA8A 2WVQA 5COMA 5B3IA 2YRFA 1TQGA 3DAGA 4NQFA 3WODF 1M2OA 1LE2A 2XLEA 1RJ9A 4P9FA 2YLDA 2XLHA 2XS8A 4ULWA 4YL1A 3AG2C 5JT4A 3GEHA 3MFNA 5F5HA 1QZXA 4JW1A 2XLVA 4MNDA 4G0HA 2ICWG 2VCCA 5A6KA
chains in the Genus database with same CATH topology
2IXNA 1WGWA 5E3CA 2V26A 2CNWD 4RBNA 4JURI 2X51A 5KYYB 2PX0A 3JRTA 3K1HA 4U5GA 4XLPF 4YT2A 3B0VC 3JYHA 4C7OA 4KBLA 5CI8A 1S7ZA 2Y39A 5CI9A 4OINF 3LAYA 2H7BA 4DBRA 1M2VB 4G7HF 3JT1A 1G8XA 3TD7A 3UNGC 3NDBB 2H7VC 2WB7A 5T1DB 1D1AA 2XXAA 2Q9AA 2IOQA 5KYNA 1V54C 3SNHA 5DLJA 3FDQA 1OCCC 4A2NB 2EIKC 5HSWA 1TWHA 2R7VA 4GEHA 2Z15A 2J7PD 3DJNB 3N2ZB 4O6MA 3AG3C 2EINC 2WVOA 2E87A 4CS8A 2PFDA 3KL4A 3FVYA 4Q4ZF 1TWAA 2D5RB 3EFOA 4BEJA 3AQBA 4CSAA 2NG1A 2FGYA 4AE4B 4HFFB 2ZXPA 2J46A 4X0RA 5KYXA 4CIHA 3QZCA 3DZAA 2EIJC 2R7OA 2J45A 1N1CA 2XL4A 3L0IA 4YT4A 2EILC 1SF8A 5KYXB 5DS6A 4LACB 3CQZA 3LS0A 2P7VA 2Y69C 2ZXRA 4HE8D 2C03A 4CBEA 5T3TA 2A1DD 3LEVA 3JCUQ 2A69F 1OCZC 4M63A 1FMVA 2Y3GA 3EPVA 3ZIBA 1ST6A 3LLIA 4LLCA 1Z63A 2YZSA 2Y3BA 3AG1C 1BR2A 3KKBA 3DJUB 4RDAA 1BR4A 3K66A 4C3EA 3W8IA 2NUTB 3E9VA 2QTVA 4Q5SF 3L34A 1OKKA 2C04A 3F46A 3MX3A 2HV6A 1BR1A 1MMAA 5B1AC 1PD0A 3ABKC 4PJLA 3ASNC 3UMIA 4C3BA 2Q3TA 3NYMA 5EGYA 2P6VA 3POVA 3SP1A 3B0PA 5KYWA 4JVSA 5E2QA 2WZGA 4PK4A 4AK9A 3EHNA 3S0XA 3NYJA 4J32B 4ZLDA 3ZSUA 4Q7CA 4KI2A 1LS1A 2KQ9A 4IAOA 2J9WA 2LSEA 4U5HA 1ZHYA 3EGDA 1ZHWA 3Q7LA 1M57C 3NKEA 1RJ9B 1Z5ZA 1TR2A 3KMIA 3X2QC 2R7WA 4XLNF 3W2WA 1TKNA 3I5PA 4JZAA 4BJ6C 3ABMC 1MMDA 5DS5A 3RH3A 4I1OB 3EH2A 2WZLA 1D0YA 2WZFA 4B6IA 3OWTA 4PJMA 2I8BA 3NRHA 4PJNA 3EZIA 3CZ6A 1LKXA 2H7OA 1KU2A 2B0JA 4C7OB 2PX3A 1VYKA 3EQLF 3GANA 3W8HA 2R7QA 2W4BA 1VOMA 3ECSA 1IZMA 2IXOA 3MLGA 1D0ZA 2XXAB 1FFHA 1JPNA 1VYIA 3LNRA 4BJTA 4I44A 3DXJF 3PHF2 2O9XA 2PF4E 4C3DA 4BJ1A 2R7UA 2QY9A 2G3KA 4KC9A 1ZU4A 3B0UX 4CS8C 3UR3C 3DAFA 3ITFA 1Z3IX 1V55C 3ZVRA 4PFOA 2KGOA 4CS9C 2NUPA 3Q6NA 4O79A 4OIOF 3EFOB 2WL8A 3DM9B 3PMRA 1OCRC 1TWCA 4I3MA 5D92A 4FWVA 1SMYF 3OA1A 1NG1A 1JPJA 2YEVA 5FCLA 4QDLA 3NKDA 2PP4A 3DMDA 4G7ZF 1MNEA 4O6YA 2CNWA 2V3CC 5B3SC 4IRUA 4OIPF 4H4KC 2XSEA 3Q7GA 4OD4A 4BJ5A 5E3AA 3I4UA 4E7ZA 3AQCA 1D1BA 4RD9A 3SZRA 2JD3A 2CDQA 2A6HF 3S29A 2Y3DA 3NG1A 3W2VA 2MWQA 1W2WA 2R7SA 3VYWA 3HTKC 4W8KA 2ZXOA 4U5CE 2IYLD 2FFHA 2Q9CA 2CGEA 3HLZA 4QI2A 4NY3A 4IJJA 4U5BE 4DOZA 4KNVA 3N0TA 3RYLA 2J7PA 2G62A 1VK5A 3FHDA 3EGXA 5F5FA 3ABLC 2L9JA 5T3WA 5KYWB 1MMGA 2Y3HA 4N06A 5KYUA 3RIPA 3EGXB 1O87A 3RFYA 3T6JA 4EBBA 2MYSA 3AG4C 4K0DA 3EGDB 2YHSA 3UMHA 4OIRF 3CSKA 4U5FE 1MNDA 3S27A 1OCOC 5DQZA 1NU9C 4PJJA 2G3VA 5EHHA 4IWBA 2IXPA 1VMAA 3O39A 5DS4A 2ZXWC 5KYYA 5DQTA 3N24A 3T6BA 2CW0F 2VB6A 4BJ6A 3T4RA 3LLKA 4E7SA 4LLEA 2Q9BA 3K1IC 3K33A 4YN0B 2VASA 3LS1A 3EH1A 1M56C 4YWQA 1M2VA 1J8YF 4EWCA 3X1OA 4FESA 1TWGA 2A68F 3Q6MA 3ZC4A 1LVKA 2BE5F 3RKOF 4F4BA 5L3VA 3B9QA 2VH3A 4OIQF 1OKKD 3K6BA 5DVWA 4ZLCA 4CSAC 2W45A 2W9YA 1O5HA 4JJFA 4JJGA 1QLEC 5L3QA 4U5EE 4K7BA 2A6EF 2M4EA 4XTKA 3F47A 2DYRC 2NUPB 3E70C 4FX5A 3LESA 4G7OF 2W4MA 4AE4A 4QI0A 2L81A 4PFPA 2ZPAA 1ZHZA 2J9VA 2R7TA 4CS9A 4XWJA 3UGOA 3SEOA 1J8MF 3O6XA 5D91A 2XRHA 3NYLA 3V7OA 1FTSA 4HEAJ 4CS7A 3EG9A 3DD7A 3EJNA 3OEOA 4LERA 1ZHXA 3KH2A 2IXMA 1Z6AA 2DYSC 3EG9B 3UMKA 4BG0A 2HV7A 2R7RA 1D1CA 5IY5C 2OCCC 3HJCA 4BJ5C 3EHMA 2DGJA 1NU7D 3IEEA 4OD5A 1PCXA 1ZU5A 2KNHA 4DBQA 4YJWA 1ZYRF 3ASOC 4DVYP 2WVNA 1FMWA 4HFKB 3UGPA 4O7GA 2J0WA 4MQ9F 2NUTA 4U5DE 2KJGA 5E33A 2J9UA 4O6NA 1FFTC 3LJBA 1NZEA 5B1BC 3ZG1A 2R7XA 3M1CB 4YT5A 3QMKA 1PD1A 3H65A 3JSZA 1D0XA 3I5QA 1Z23A 3K7DA 3WG7C 4ANJA 2GFHA 4AX2A 2OG2A 4WJ0A 3VAYA 3SYNA 2KW3C 4I1MA 3DM5A 5KYUB 1IW7F 3EZHA 4J30B 4P6IC 3S28A 4GYTA 1SZIA 2J0XA 3FAJA 4DVZA 4KNWA 4JCHA 1ZHTA 3GODA 5BUOA 2EIMC 1MMNA 4YT8A 2WVQA 3DAGA 1M2OA 3WODF 1RJ9A 4ULWA 3AG2C 5F5HA 1QZXA 4JW1A 4MNDA 4G0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AE4 B;  4AE4 A; 
#chains in the Genus database with same CATH topology
 4N4W A;  2IXN A;  1VLS A;  2YL0 A;  1WGW A;  1OXK A;  3H2V A;  2V26 A;  2CNW D;  4RBN A;  5E3C A;  4JUR I;  1L7C A;  5A6B A;  1YVI A;  2X51 A;  4MS2 A;  5KYY B;  2PX0 A;  3JRT A;  2J8W A;  3ZWI A;  2XLM A;  3K1H A;  4ONS A;  4U5G A;  3U9J A;  3S90 A;  1H9T A;  4XLP F;  5A69 A;  3ZTM A;  1ZVZ A;  4YT2 A;  3B0V C;  3JYH A;  3GEI A;  3U9M A;  4C7O A;  4KBL A;  5CI8 A;  1S7Z A;  1RKE B;  2Y39 A;  3G4X A;  3MYF A;  1T6U A;  5CI9 A;  2QE9 A;  3GWN A;  5JVE A;  3CEX A;  2BC5 A;  4OIN F;  3LAY A;  2H7B A;  4DRI B;  2HMQ A;  1G4W R;  5CIV A;  4DBR A;  2LCH A;  1M2V B;  4UDV A;  1R5I D;  1XZP A;  3JT1 A;  4G7H F;  5L0F A;  1G8X A;  3TD7 A;  3U3B A;  3UNG C;  3NDB B;  2H7V C;  1Y4C A;  2WB7 A;  1D1A A;  3AOU A;  5T1D B;  1YLM A;  1E85 A;  2XXA A;  2Q9A A;  2IOQ A;  1GQA A;  4A4A A;  1V54 C;  1ZZP A;  1HW1 A;  1H7I A;  3SNH A;  5KYN A;  3JRM O;  5DLJ A;  3KYJ A;  1OCC C;  4CDY A;  4A2N B;  3FDQ A;  2EIK C;  4E0I A;  3GM2 A;  2EPO A;  1TWH A;  5HSW A;  4GEH A;  2YLG A;  1FNT c;  1UFB A;  2R7V A;  3TJ6 A;  2Z15 A;  2J7P D;  3DJN B;  3V5Z A;  2LFF A;  3N2Z B;  2P61 A;  4O6M A;  3AG3 C;  1YZC A;  2EIN C;  5COG A;  2WVO A;  2E87 A;  4CS8 A;  2PFD A;  1B68 A;  3KL4 A;  3FVY A;  4JTA B;  3VRC A;  4Q4Z F;  1TWA A;  2D5R B;  3EFO A;  2GDC A;  4BEJ A;  3AQB A;  4CSA A;  2NG1 A;  2FGY A;  5F28 E;  1YZA A;  2LK4 A;  1Q0G A;  2PNO A;  4HFF B;  4AE4 B;  4JKV A;  2ZXP A;  1A7E A;  3M79 A;  4NTF A;  1VLT A;  2J46 A;  4X0R A;  1C17 M;  3NMK A;  5KYX A;  4CIH A;  3QZC A;  4PAC A;  3DZA A;  1JRA A;  2EIJ C;  1OXB A;  1WAT A;  2R7O A;  1E86 A;  2J45 A;  1N1C A;  1YAR O;  2XL4 A;  3L0I A;  4YT4 A;  2EIL C;  1H6G A;  1SF8 A;  2H8A A;  4XQ1 A;  5KYX B;  5L0H A;  1GM5 A;  5DS6 A;  4LAC B;  3CQZ A;  3LS0 A;  2P7V A;  2Y69 C;  2ZXR A;  5BQH A;  4HE8 D;  2Q7R A;  5JUA A;  2R05 A;  3MBG A;  2C03 A;  4CBE A;  5T3T A;  1I5N A;  2A1D D;  3LEV A;  3JCU Q;  2F22 A;  4EUK B;  4CJG A;  2A69 F;  3TJ5 A;  1HE9 A;  1OCZ C;  3QVY A;  1E2X A;  4JEB A;  4M63 A;  1FMV A;  1A7D A;  5JRA A;  2EPN A;  1SYQ A;  2GAQ A;  2Y3G A;  3EPV A;  3H2U A;  1GS9 A;  3ZIB A;  1ST6 A;  1UG7 A;  3LLI A;  3J06 A;  3JSE O;  3B29 A;  3C8Z A;  1QQ3 A;  3ZQV A;  4LLC A;  2HUJ A;  1Z63 A;  2YZS A;  4MTO A;  2Y3B A;  2KK1 A;  4BEM J;  3JTL O;  3AG1 C;  1BR2 A;  3KKB A;  1RCP A;  3DJU B;  4E18 A;  4RDA A;  1OW8 A;  1RXQ A;  1BR4 A;  3K66 A;  1HE1 A;  4C3E A;  4J7T A;  4MVO A;  3V5X A;  3W8I A;  1ORS C;  2JPU A;  2NUT B;  1LS4 A;  3WAQ A;  1V4A A;  3E9V A;  3W4Y A;  2QTV A;  3GEE A;  4Q5S F;  1K04 A;  3L34 A;  1OKK A;  3RQE A;  2C04 A;  3F46 A;  3MX3 A;  2HV6 A;  4P9T A;  3R7C A;  1E84 A;  1DOW A;  1BR1 A;  2FAP B;  3SXZ A;  1MMA A;  5B1A C;  1PD0 A;  1RMV A;  3ABK C;  4PJL A;  3DI5 A;  3ASN C;  3UMI A;  4C3B A;  1SR2 A;  2Q3T A;  3RVY A;  3NYM A;  5EGY A;  4MW3 A;  2P6V A;  3POV A;  3SP1 A;  3VM6 A;  2EPM X;  3B0P A;  5KYW A;  4JVS A;  3GM3 A;  5E2Q A;  2WZG A;  4PK4 A;  4AK9 A;  3EHN A;  3S0X A;  2XLO A;  4CDA A;  1K05 A;  2NSF A;  3NYJ A;  3R2P A;  4J32 B;  4ZLD A;  3ZSU A;  4Q7C A;  4KI2 A;  1LS1 A;  2KQ9 A;  4IAO A;  3RF3 A;  4AL1 A;  3FMS A;  2QLA A;  2J9W A;  2LSE A;  4U5H A;  1NFN A;  3U3F A;  4EIY A;  1ZHY A;  3TOL A;  3EGD A;  4E17 A;  1APC A;  1ZHW A;  4IB4 A;  3Q7L A;  2XS1 A;  1M57 C;  2Q4F A;  3NKE A;  1LIH A;  3RQG A;  1RJ9 B;  3HKK A;  1Z5Z A;  1TR2 A;  3KMI A;  3X2Q C;  2R7W A;  2IM8 A;  4XLN F;  1TKN A;  3W2W A;  3I5P A;  4JZA A;  1OQC A;  4BJ6 C;  3ABM C;  1MMD A;  5DS5 A;  1QSP A;  1JOG A;  3RH3 A;  1VB5 A;  4I1O B;  3EH2 A;  2WZL A;  1D0Y A;  2LFD A;  1R4T A;  2WZF A;  4JIO A;  3CAX A;  2J9B A;  4B6I A;  4MVS A;  1DOV A;  3OWT A;  4H54 A;  3C7J A;  1WN0 A;  4CDV A;  1M6T A;  4PJM A;  3TUL A;  1QPU A;  256B A;  2I8B A;  3NRH A;  4JE9 A;  4PJN A;  3EZI A;  3ATP A;  3CZ6 A;  1LKX A;  4MVM A;  2H7O A;  1KU2 A;  2B0J A;  4C7O B;  2NSG A;  1VYK A;  2PX3 A;  3C8G A;  2HSB A;  3EQL F;  1VTM P;  1KTM A;  3TQO A;  2HKV A;  1PV3 A;  2XM4 A;  3L1M A;  1BZ4 A;  3K1I A;  4WGZ A;  3GAN A;  4Z9J A;  3RW0 A;  4YK5 A;  1HY5 A;  3W8H A;  4L6R A;  2R7Q A;  4PR9 A;  2W4B A;  3DE8 A;  3QTH A;  3RQF A;  1VOM A;  1OW6 A;  2OOC A;  1RKC A;  2YQY A;  3ECS A;  1T9K A;  4J7Y A;  1IZM A;  2IXO A;  3MLG A;  3O55 A;  1NBB A;  1D0Z A;  5L0D A;  1S05 A;  2CYD A;  2HFI A;  1FFH A;  1JPN A;  4XEK A;  2XXA B;  1JAF A;  1VYI A;  1ORJ A;  3LNR A;  4BJT A;  4I44 A;  4Z9H A;  4XEV A;  3DXJ F;  3PHF 2;  2O9X A;  2PF4 E;  4C3D A;  4BJ1 A;  4XPW A;  2R7U A;  2QY9 A;  1L3P A;  2G3K A;  4KC9 A;  2ETS A;  1V74 B;  2VCB A;  4AL0 A;  1ZU4 A;  2R02 A;  4CIP A;  3B0U X;  3DE9 A;  4CS8 C;  1YA7 O;  2P1A A;  3NMI A;  3UR3 C;  3DAF A;  3ITF A;  4K1O A;  1ORY A;  1V55 C;  1Z3I X;  4ER9 A;  5L0I A;  1Z7Q c;  2ASR A;  3ZVR A;  4PFO A;  2KGO A;  5GPG B;  4CS9 C;  2NUP A;  3Q6N A;  5L0J A;  2GWW A;  4O79 A;  3EFO B;  4OIO F;  2WL8 A;  3DM9 B;  3PMR A;  2D4U A;  5L0C A;  1OCR C;  1LPE A;  1TWC A;  3FXH A;  4I3M A;  5D92 A;  4WGY A;  1I4Y A;  4FWV A;  4JTC B;  1SMY F;  1Q0D A;  3OA1 A;  2JX0 A;  3IQ5 A;  1A0B A;  2VCA A;  4IAQ A;  1NG1 A;  3T6G B;  4XPX A;  1OR3 A;  1T01 A;  1JPJ A;  2YEV A;  3LEO A;  5FCL A;  3G50 A;  4QDL A;  2R03 A;  3NKD A;  3U8P A;  2EPL X;  2PP4 A;  1NLX A;  4JRZ A;  3RVZ A;  4CX9 A;  3IQT A;  3SXM A;  3DMD A;  3JYY A;  4G7Z F;  1FAP B;  1MNE A;  2XLW A;  2CNW A;  2PBE A;  3GOR A;  4O6Y A;  3SXK A;  5A6B D;  2V3C C;  4JC7 A;  4ULV A;  5B3S C;  4IRU A;  4OIP F;  1U89 A;  4NTA A;  1KNY A;  4H4K C;  4MVR A;  1AVO B;  3AGU A;  2XSE A;  3Q7G A;  2YLI A;  4DRJ B;  4OD4 A;  2LQG A;  4BJ5 A;  2OQM A;  1U0B B;  4NTB A;  5TJ5 E;  1ZW3 A;  3I4U A;  5E3A A;  3T9O A;  1HMD A;  3U8V A;  3AQC A;  4E7Z A;  1NFO A;  4XPY A;  1D1B A;  2YL7 A;  4RD9 A;  3SZR A;  2JD3 A;  2CDQ A;  2A6H F;  2L6H A;  3S29 A;  2Y3D A;  3NG1 A;  3W2V A;  2MWQ A;  3BRJ A;  1W2W A;  2R7S A;  2KSF A;  3VYW A;  1OR2 A;  3U2M A;  3HTK C;  1OW7 A;  2HS5 A;  3HNI A;  3V5Y A;  4W8K A;  2ZXO A;  4U5C E;  3IQ6 A;  2IYL D;  3QW1 A;  4FAP B;  2KC3 A;  2FFH A;  2Q9C A;  2CGE A;  3HLZ A;  2EPK X;  2KYH A;  4QI2 A;  4DRH B;  4NY3 A;  1T6I A;  4IJJ A;  4U5B E;  4DOZ A;  2XL8 A;  2XLD A;  4KNV A;  3N0T A;  3RYL A;  2J7P A;  2G62 A;  1VK5 A;  3FHD A;  1HW2 A;  2GA0 A;  2HZ8 A;  4YL3 A;  1Q0K A;  4D4N A;  1H9G A;  1TFO B;  3EGX A;  1E83 A;  5F5F A;  3ABL C;  3MYI A;  4NC3 A;  2L9J A;  3AJM A;  2Q00 A;  5T3W A;  5KYW B;  1MMG A;  2Y3H A;  4N06 A;  5KYU A;  2L6G A;  3RIP A;  2AU5 A;  3LUT B;  2L6F A;  3EGX B;  4D4X A;  1I4Z A;  4IAR A;  1O87 A;  3RFY A;  3T6J A;  1YYJ A;  1WWP A;  2A0B A;  3U5S A;  2HJM A;  4E0H A;  4EBB A;  2R25 A;  3S84 A;  3IHU A;  2MYS A;  5K0I A;  3AG4 C;  4JEA A;  5BQI A;  4K0D A;  3BEH A;  3EGD B;  1K40 A;  2AWC A;  1HMO A;  2LD6 A;  2YHS A;  3UMH A;  5JLI A;  3IQC A;  1F1M A;  2NPU A;  4W8P A;  4OIR F;  3CSK A;  3U2L A;  5A6J A;  4U5F E;  1TFK B;  1MND A;  3S27 A;  1OCO C;  1XZQ A;  2DB4 A;  5DQZ A;  1NU9 C;  4PJJ A;  2G3V A;  3ZDL A;  1AUE A;  5EHH A;  4IWB A;  4DXW A;  2IXP A;  1T6Q A;  1XWJ A;  5L0G A;  3SXY A;  1VMA A;  3O39 A;  5DS4 A;  2ZXW C;  5KYY A;  5DQT A;  3N24 A;  3T6B A;  2CW0 F;  1Q0F A;  1LE4 A;  3TK0 A;  2VB6 A;  4BJ6 A;  3TOM A;  1BBH A;  1EQ1 A;  2RD9 A;  3KYI A;  3T4R A;  1RKE A;  3LLK A;  5AGF A;  4LLE A;  4E7S A;  2Q9B A;  3K1I C;  3K33 A;  3C8G B;  2CCY A;  4N6C A;  4YN0 B;  1FR0 A;  2VAS A;  3FAP B;  3LS1 A;  3EH1 A;  1M56 C;  2YKZ A;  4YWQ A;  1M2V A;  1J8Y F;  4EWC A;  3X1O A;  2AP3 A;  3FOP A;  3ZQY A;  1MQV A;  4FES A;  1WTY A;  1TWG A;  2QNL A;  1CPQ A;  3M4C A;  2A68 F;  3Q6M A;  3ZC4 A;  5AC5 A;  1LVK A;  1A7V A;  4GQH A;  4EBJ A;  2BE5 F;  3RKO F;  4F4B A;  1YYX A;  3B9Q A;  5L3V A;  4MVZ A;  2OEV A;  4U9E A;  3C63 A;  1O3U A;  2VH3 A;  1LI5 A;  1AEP A;  2HMZ A;  4OIQ F;  1OKK D;  2OJE D;  3K6B A;  1BDJ B;  5A6A A;  5DVW A;  5FZT A;  3FOO A;  1YAU O;  4EKW A;  4ZLC A;  2YL3 A;  4CSA C;  2W45 A;  2W9Y A;  1O5H A;  2LP4 A;  2R9R B;  1QLE C;  4JJF A;  4JJG A;  4LDQ A;  4MVQ A;  4U5E E;  5L3Q A;  4XEF A;  1ZW2 A;  3O10 A;  4K7B A;  2IBF A;  2TMV P;  2A6E F;  2M4E A;  4Z9I A;  4XTK A;  4N6H A;  3DKA A;  3WHN A;  3F47 A;  2UUI A;  2DYR C;  1GGQ A;  2NUP B;  2DI3 A;  3E70 C;  4FX5 A;  1EI7 A;  1U6H A;  5BQG A;  1CGO A;  3LES A;  4G7O F;  2W4M A;  2AWY A;  1WAS A;  4DJ9 A;  4WAB A;  4AE4 A;  4QI0 A;  2B0H A;  2L81 A;  4PFP A;  3PDM P;  2ZPA A;  1G5Z A;  1ZHZ A;  2J9V A;  4MTG A;  2BL2 A;  4XWJ A;  4LDR A;  4CS9 A;  2R7T A;  3UGO A;  3SEO A;  1CGN A;  5EK0 A;  2ZD9 A;  5JSL A;  1J8M F;  3O6X A;  5D91 A;  2XRH A;  3L8I A;  3NYL A;  1LM3 B;  3US6 A;  3V7O A;  1YDI A;  4IGG A;  3QW0 A;  1FTS A;  4HEA J;  4CS7 A;  1WOL A;  1CPR A;  3VF0 A;  3EG9 A;  1JMW A;  1Y6D A;  3U0C A;  3DD7 A;  3EJN A;  3OEO A;  4MTF A;  4LER A;  1ZHX A;  2P0N A;  3KH2 A;  2IXM A;  3L8J A;  1NSG B;  1Z6A A;  2LIG A;  2DYS C;  3EG9 B;  3UMK A;  2YVK A;  5JP7 A;  4BG0 A;  3AGT A;  3B71 A;  3M15 A;  2HV7 A;  2R7R A;  1D1C A;  2I15 A;  5IY5 C;  2OCC C;  4YL0 A;  3HJC A;  4BJ5 C;  3EHM A;  2DGJ A;  3G4Z A;  1NU7 D;  2A0U A;  3IEE A;  4NCQ A;  3C8G D;  1PCX A;  1ZU5 A;  2HJ3 A;  2KNH A;  4OD5 A;  4DBQ A;  5AC4 A;  4YJW A;  3LNM B;  3A11 A;  3NMJ A;  3GWL A;  1ZYR F;  4EBK A;  2RSE B;  1Q0M A;  3ASO C;  4MVU A;  4DVY P;  5JS5 A;  2WVN A;  1EKY A;  2L7A A;  1QVX A;  1FMW A;  2XL6 A;  4G78 A;  5HV9 A;  3HNJ A;  3JZ0 A;  4HFK B;  2M64 A;  3UGP A;  4O7G A;  2J0W A;  1A41 A;  1C03 A;  3KPH A;  4MQ9 F;  4U9D A;  2OEX A;  2NUT A;  3M4B A;  4JTD B;  2XM0 A;  4U5D E;  2UUH A;  2OKU A;  2KJG A;  5E33 A;  2J9U A;  4O6N A;  2OJQ A;  1FFT C;  3S9O A;  3LJB A;  1NZE A;  4BPM A;  4R32 A;  1JR8 A;  3DWW A;  5B1B C;  3M1C B;  2AVK A;  2YL1 A;  1T5O A;  3ZG1 A;  2R7X A;  4YT5 A;  3QMK A;  1PD1 A;  3HNL A;  1LI7 A;  3H65 A;  2OU6 A;  1D0X A;  3JSZ A;  3IPM O;  3C62 A;  3I5Q A;  1YA9 A;  1Z23 A;  2QUP A;  1C02 A;  3K7D A;  3WG7 C;  4MW8 A;  4ANJ A;  4CJO A;  2GFH A;  3PCV A;  4AX2 A;  1CGM E;  3QVZ A;  2OG2 A;  2VC9 A;  3ZTZ A;  4WJ0 A;  2MHR A;  1QKR A;  3VAY A;  3SYN A;  2KW3 C;  2YWA A;  4I1M A;  4LDK A;  4JCZ A;  3DM5 A;  3HNK A;  5KYU B;  1IW7 F;  3EZH A;  4J30 B;  4P6I C;  3S28 A;  3C18 A;  4GYT A;  1SZI A;  2J0X A;  3FAJ A;  5COF A;  4DVZ A;  2X0C A;  4KNW A;  4JCH A;  1ZHT A;  1YJG A;  3GOD A;  2HSQ A;  5BUO A;  2EIM C;  3A9C A;  1G4U S;  4EHP A;  1MMN A;  3GM1 A;  4YT8 A;  1EA8 A;  2WVQ A;  5COM A;  5B3I A;  2YRF A;  1TQG A;  3DAG A;  4NQF A;  3WOD F;  1M2O A;  1LE2 A;  2XLE A;  1RJ9 A;  4P9F A;  2YLD A;  2XLH A;  2XS8 A;  4ULW A;  4YL1 A;  3AG2 C;  5JT4 A;  3GEH A;  3MFN A;  5F5H A;  1QZX A;  4JW1 A;  2XLV A;  4MND A;  4G0H A;  2ICW G;  2VCC A;  5A6K A; 
#chains in the Genus database with same CATH homology
 2IXN A;  1WGW A;  5E3C A;  2V26 A;  2CNW D;  4RBN A;  4JUR I;  2X51 A;  5KYY B;  2PX0 A;  3JRT A;  3K1H A;  4U5G A;  4XLP F;  4YT2 A;  3B0V C;  3JYH A;  4C7O A;  4KBL A;  5CI8 A;  1S7Z A;  2Y39 A;  5CI9 A;  4OIN F;  3LAY A;  2H7B A;  4DBR A;  1M2V B;  4G7H F;  3JT1 A;  1G8X A;  3TD7 A;  3UNG C;  3NDB B;  2H7V C;  2WB7 A;  5T1D B;  1D1A A;  2XXA A;  2Q9A A;  2IOQ A;  5KYN A;  1V54 C;  3SNH A;  5DLJ A;  3FDQ A;  1OCC C;  4A2N B;  2EIK C;  5HSW A;  1TWH A;  2R7V A;  4GEH A;  2Z15 A;  2J7P D;  3DJN B;  3N2Z B;  4O6M A;  3AG3 C;  2EIN C;  2WVO A;  2E87 A;  4CS8 A;  2PFD A;  3KL4 A;  3FVY A;  4Q4Z F;  1TWA A;  2D5R B;  3EFO A;  4BEJ A;  3AQB A;  4CSA A;  2NG1 A;  2FGY A;  4AE4 B;  4HFF B;  2ZXP A;  2J46 A;  4X0R A;  5KYX A;  4CIH A;  3QZC A;  3DZA A;  2EIJ C;  2R7O A;  2J45 A;  1N1C A;  2XL4 A;  3L0I A;  4YT4 A;  2EIL C;  1SF8 A;  5KYX B;  5DS6 A;  4LAC B;  3CQZ A;  3LS0 A;  2P7V A;  2Y69 C;  2ZXR A;  4HE8 D;  2C03 A;  4CBE A;  5T3T A;  2A1D D;  3LEV A;  3JCU Q;  2A69 F;  1OCZ C;  4M63 A;  1FMV A;  2Y3G A;  3EPV A;  3ZIB A;  1ST6 A;  3LLI A;  4LLC A;  1Z63 A;  2YZS A;  2Y3B A;  3AG1 C;  1BR2 A;  3KKB A;  3DJU B;  4RDA A;  1BR4 A;  3K66 A;  4C3E A;  3W8I A;  2NUT B;  3E9V A;  2QTV A;  4Q5S F;  3L34 A;  1OKK A;  2C04 A;  3F46 A;  3MX3 A;  2HV6 A;  1BR1 A;  1MMA A;  5B1A C;  1PD0 A;  3ABK C;  4PJL A;  3ASN C;  3UMI A;  4C3B A;  2Q3T A;  3NYM A;  5EGY A;  2P6V A;  3POV A;  3SP1 A;  3B0P A;  5KYW A;  4JVS A;  5E2Q A;  2WZG A;  4PK4 A;  4AK9 A;  3EHN A;  3S0X A;  3NYJ A;  4J32 B;  4ZLD A;  3ZSU A;  4Q7C A;  4KI2 A;  1LS1 A;  2KQ9 A;  4IAO A;  2J9W A;  2LSE A;  4U5H A;  1ZHY A;  3EGD A;  1ZHW A;  3Q7L A;  1M57 C;  3NKE A;  1RJ9 B;  1Z5Z A;  1TR2 A;  3KMI A;  3X2Q C;  2R7W A;  4XLN F;  3W2W A;  1TKN A;  3I5P A;  4JZA A;  4BJ6 C;  3ABM C;  1MMD A;  5DS5 A;  3RH3 A;  4I1O B;  3EH2 A;  2WZL A;  1D0Y A;  2WZF A;  4B6I A;  3OWT A;  4PJM A;  2I8B A;  3NRH A;  4PJN A;  3EZI A;  3CZ6 A;  1LKX A;  2H7O A;  1KU2 A;  2B0J A;  4C7O B;  2PX3 A;  1VYK A;  3EQL F;  3GAN A;  3W8H A;  2R7Q A;  2W4B A;  1VOM A;  3ECS A;  1IZM A;  2IXO A;  3MLG A;  1D0Z A;  2XXA B;  1FFH A;  1JPN A;  1VYI A;  3LNR A;  4BJT A;  4I44 A;  3DXJ F;  3PHF 2;  2O9X A;  2PF4 E;  4C3D A;  4BJ1 A;  2R7U A;  2QY9 A;  2G3K A;  4KC9 A;  1ZU4 A;  3B0U X;  4CS8 C;  3UR3 C;  3DAF A;  3ITF A;  1Z3I X;  1V55 C;  3ZVR A;  4PFO A;  2KGO A;  4CS9 C;  2NUP A;  3Q6N A;  4O79 A;  4OIO F;  3EFO B;  2WL8 A;  3DM9 B;  3PMR A;  1OCR C;  1TWC A;  4I3M A;  5D92 A;  4FWV A;  1SMY F;  3OA1 A;  1NG1 A;  1JPJ A;  2YEV A;  5FCL A;  4QDL A;  3NKD A;  2PP4 A;  3DMD A;  4G7Z F;  1MNE A;  4O6Y A;  2CNW A;  2V3C C;  5B3S C;  4IRU A;  4OIP F;  4H4K C;  2XSE A;  3Q7G A;  4OD4 A;  4BJ5 A;  5E3A A;  3I4U A;  4E7Z A;  3AQC A;  1D1B A;  4RD9 A;  3SZR A;  2JD3 A;  2CDQ A;  2A6H F;  3S29 A;  2Y3D A;  3NG1 A;  3W2V A;  2MWQ A;  1W2W A;  2R7S A;  3VYW A;  3HTK C;  4W8K A;  2ZXO A;  4U5C E;  2IYL D;  2FFH A;  2Q9C A;  2CGE A;  3HLZ A;  4QI2 A;  4NY3 A;  4IJJ A;  4U5B E;  4DOZ A;  4KNV A;  3N0T A;  3RYL A;  2J7P A;  2G62 A;  1VK5 A;  3FHD A;  3EGX A;  5F5F A;  3ABL C;  2L9J A;  5T3W A;  5KYW B;  1MMG A;  2Y3H A;  4N06 A;  5KYU A;  3RIP A;  3EGX B;  1O87 A;  3RFY A;  3T6J A;  4EBB A;  2MYS A;  3AG4 C;  4K0D A;  3EGD B;  2YHS A;  3UMH A;  4OIR F;  3CSK A;  4U5F E;  1MND A;  3S27 A;  1OCO C;  5DQZ A;  1NU9 C;  4PJJ A;  2G3V A;  5EHH A;  4IWB A;  2IXP A;  1VMA A;  3O39 A;  5DS4 A;  2ZXW C;  5KYY A;  5DQT A;  3N24 A;  3T6B A;  2CW0 F;  2VB6 A;  4BJ6 A;  3T4R A;  3LLK A;  4E7S A;  4LLE A;  2Q9B A;  3K1I C;  3K33 A;  4YN0 B;  2VAS A;  3LS1 A;  3EH1 A;  1M56 C;  4YWQ A;  1M2V A;  1J8Y F;  4EWC A;  3X1O A;  4FES A;  1TWG A;  2A68 F;  3Q6M A;  3ZC4 A;  1LVK A;  2BE5 F;  3RKO F;  4F4B A;  5L3V A;  3B9Q A;  2VH3 A;  4OIQ F;  1OKK D;  3K6B A;  5DVW A;  4ZLC A;  4CSA C;  2W45 A;  2W9Y A;  1O5H A;  4JJF A;  4JJG A;  1QLE C;  5L3Q A;  4U5E E;  4K7B A;  2A6E F;  2M4E A;  4XTK A;  3F47 A;  2DYR C;  2NUP B;  3E70 C;  4FX5 A;  3LES A;  4G7O F;  2W4M A;  4AE4 A;  4QI0 A;  2L81 A;  4PFP A;  2ZPA A;  1ZHZ A;  2J9V A;  2R7T A;  4CS9 A;  4XWJ A;  3UGO A;  3SEO A;  1J8M F;  3O6X A;  5D91 A;  2XRH A;  3NYL A;  3V7O A;  1FTS A;  4HEA J;  4CS7 A;  3EG9 A;  3DD7 A;  3EJN A;  3OEO A;  4LER A;  1ZHX A;  3KH2 A;  2IXM A;  1Z6A A;  2DYS C;  3EG9 B;  3UMK A;  4BG0 A;  2HV7 A;  2R7R A;  1D1C A;  5IY5 C;  2OCC C;  3HJC A;  4BJ5 C;  3EHM A;  2DGJ A;  1NU7 D;  3IEE A;  4OD5 A;  1PCX A;  1ZU5 A;  2KNH A;  4DBQ A;  4YJW A;  1ZYR F;  3ASO C;  4DVY P;  2WVN A;  1FMW A;  4HFK B;  3UGP A;  4O7G A;  2J0W A;  4MQ9 F;  2NUT A;  4U5D E;  2KJG A;  5E33 A;  2J9U A;  4O6N A;  1FFT C;  3LJB A;  1NZE A;  5B1B C;  3ZG1 A;  2R7X A;  3M1C B;  4YT5 A;  3QMK A;  1PD1 A;  3H65 A;  3JSZ A;  1D0X A;  3I5Q A;  1Z23 A;  3K7D A;  3WG7 C;  4ANJ A;  2GFH A;  4AX2 A;  2OG2 A;  4WJ0 A;  3VAY A;  3SYN A;  2KW3 C;  4I1M A;  3DM5 A;  5KYU B;  1IW7 F;  3EZH A;  4J30 B;  4P6I C;  3S28 A;  4GYT A;  1SZI A;  2J0X A;  3FAJ A;  4DVZ A;  4KNW A;  4JCH A;  1ZHT A;  3GOD A;  5BUO A;  2EIM C;  1MMN A;  4YT8 A;  2WVQ A;  3DAG A;  1M2O A;  3WOD F;  1RJ9 A;  4ULW A;  3AG2 C;  5F5H A;  1QZX A;  4JW1 A;  4MND A;  4G0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...