4AE4B

The ubap1 subunit of escrt-i interacts with ubiquitin via a novel souba domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
113
Chain Sequence
SHMSPSERQCVETVVNGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVEEALEHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords UBIQUITIN-ASSOCIATED PROTEIN 1
total genus 32
structure length 113
sequence length 115
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ae4B00
4AE4B 4AE4A
chains in the Genus database with same CATH superfamily
3H2UA 3TK0A 4BJTA 3SEOA 4CS9A 1OKKA 1ZW2A 1K40A 5A69A 1Q0FA 3M79A 1DOVA 3LUTB 3POVA 1A7VA 1HY5A 2G3KA 2UUHA 3DM9B 4O7GA 5EGYA 1JAFA 4N6CA 2MHRA 2LCHA 4HE8D 1S05A 3HTKC 5T3WA 3VRCA 1E86A 4P9FA 2KW3C 3IPMO 3TQOA 3W2WA 3DMDA 4P9TA 3RH3A 5DQZA 5KYYA 1ORYA 3NMKA 5E33A 3ZTMA 3T6JA 3RQFA 4CBEA 2OKUA 4YT5A 4PK4A 4RDAA 3DM5A 3MFNA 5E2QA 1NFNA 3W8IA 3H2VA 4CIPA 4XEVA 5JUAA 2KQ9A 3ASNC 4I1MA 3T4RA 4JVSA 4OIOF 4OD4A 1VK5A 3DXJF 2HUJA 3EZIA 1HMDA 1OW8A 4ZLDA 2Q00A 2ZXOA 4A2NB 3S84A 3KPHA 5B3IA 4O79A 3IQ6A 3RFYA 2IXNA 1AVOB 1K04A 1WTYA 1M2OA 4H4KC 2VCAA 4NC3A 5HV9A 3AOUA 2J7PA 3NYLA 1LE4A 1RJ9B 1D1BA 1Z7Qc 2ZXWC 2EILC 4XLNF 1I5NA 2WZFA 5D92A 4C3DA 4U5CE 2Y3GA 1OCZC 4CSAC 4AE4B 1NG1A 2Y39A 1H9GA 2LD6A 4LDRA 2NUTB 2MYSA 3V5XA 3X1OA 4DBQA 1FFHA 3AG4C 2YL3A 4N6HA 2VH3A 1NZEA 3CSKA 2PF4E 3FAPB 3QVZA 3W4YA 3B29A 4YT2A 1MMGA 5AC5A 1UG7A 1U0BB 3EH1A 3TOLA 2L6FA 3IQTA 2DB4A 3C63A 3KYIA 1NFOA 1LS1A 3EFOB 2KNHA 2PP4A 3N24A 1D0XA 3L8JA 5B1BC 3B0VC 1Z63A 2GFHA 3MX3A 2OEVA 5HSWA 1Q0KA 2YHSA 5AGFA 1ORJA 4NY3A 4EHPA 3ASOC 3GWNA 3RQEA 2WZGA 3WG7C 5DQTA 1BBHA 2XLOA 2J9WA 1Q0DA 3FXHA 4ONSA 3LAYA 3K33A 4U9DA 4WGYA 1SMYF 3K7DA 5A6BA 1IZMA 3Q7GA 2LIGA 2FGYA 4I1OB 3DJUB 3JRMO 3IQ5A 1G4US 1QVXA 1I4ZA 2Q9AA 2HMZA 3NRHA 1JOGA 1A7EA 3ABMC 5IY5C 4EUKB 1OCCC 1OR2A 3FOPA 1JRAA 4NTFA 2R7VA 1VLSA 2PX0A 3FHDA 4PFOA 5B1AC 3LEOA 3SXMA 3CAXA 1OQCA 3QW0A 3U5SA 5A6JA 4EBJA 2YLIA 4E17A 1H9TA 4CS9C 2XM0A 1OW6A 1AEPA 2Y3HA 4U5FE 2H7OA 2OJQA 2W4MA 1JPJA 1YA9A 2NSGA 2XLDA 2XLEA 1HW2A 2YLGA 3SXKA 2IYLD 2HV7A 1OXBA 3J06A 1RXQA 3VAYA 1NU7D 2ICWG 2YWAA 4XWJA 1MMAA 4BG0A 1VMAA 4H54A 3WODF 3ZG1A 3GWLA 4YT8A 4JURI 2LSEA 3KYJA 1PD1A 2DYSC 1KU2A 2J7PD 4CDVA 3DE8A 1H6GA 5KYNA 3RKOF 256BA 1OXKA 1VB5A 2XLVA 2DGJA 4A4AA 4XPWA 3C18A 2OU6A 1EI7A 2EPOA 3C8ZA 3U2LA 3U8PA 1WGWA 2KSFA 1K05A 1RKCA 2P1AA 2WZLA 2J45A 4IAOA 4ZLCA 4ANJA 3GEHA 2EPNA 3LNRA 1YYXA 4GEHA 1Y4CA 1UFBA 1TWCA 4P6IC 2DYRC 1M2VA 3SXZA 4U5BE 5DS4A 2EPMX 3ZWIA 4UDVA 5D91A 1YJGA 2J0WA 3K1IA 2R7QA 2XM4A 5JT4A 5L3VA 1WASA 1MQVA 3TULA 3MYFA 3QTHA 2A68F 1EQ1A 2Q3TA 3EGDB 4DVYP 2OJED 4Z9JA 3GORA 2KYHA 1MNDA 3RVYA 3BEHA 5KYXA 1YYJA 3X2QC 4WGZA 4E0IA 4AL0A 2QY9A 3LNMB 2OOCA 4AL1A 3JZ0A 4XEFA 3HJCA 4XQ1A 4KI2A 4C7OB 4G7OF 3EG9B 4N4WA 4YWQA 1LM3B 2HKVA 3IHUA 4JEBA 2GAQA 3G50A 4JCZA 1U89A 3LEVA 2XS1A 3C7JA 5F5HA 1YDIA 4NQFA 3U2MA 1TFOB 3UMIA 1ZZPA 3M1CB 2VCCA 3HLZA 4HFFB 2EPLX 3IQCA 4MVOA 3SNHA 4FESA 5KYWA 2LQGA 3E70C 1F1MA 1SR2A 2HSBA 2R9RB 1L3PA 2NUTA 1TR2A 3JCUQ 1J8YF 2IXPA 1TFKB 2CGEA 1IW7F 1SZIA 2ZXPA 1QPUA 2HMQA 4JZAA 4WABA 4C3EA 3Q7LA 3RIPA 2L81A 4YL1A 4BJ6A 1YVIA 1ZYRF 5L0FA 2LFDA 3GM2A 2R7WA 3FMSA 3K1IC 4CIHA 2I8BA 4JW1A 4PJNA 1VYIA 3GM1A 1OKKD 2FAPB 2R7RA 2P61A 3JTLO 2DI3A 3C8GD 3NKDA 1FMWA 3KMIA 5T1DB 5COFA 2NUPA 3ZQYA 2C04A 2J8WA 2YLDA 2D4UA 4D4NA 1G4WR 3T9OA 1GQAA 1E83A 1TWHA 3TJ5A 3AG2C 1CPQA 3I4UA 3SYNA 1R4TA 1ZW3A 2NG1A 1RKEB 3LLIA 4B6IA 2A6HF 3CEXA 4JTDB 4PFPA 4CS8C 4EBKA 1GM5A 3GEIA 3W8HA 4XPXA 4IB4A 3DE9A 2A0UA 2JD3A 2ZD9A 3U3BA 2J9BA 4YT4A 4OIPF 2A1DD 1ZHXA 2V3CC 2LK4A 3G4XA 2CCYA 3EG9A 3EH2A 1T6QA 1ZHZA 2UUIA 4O6NA 4OINF 1DOWA 2KC3A 2NPUA 1EKYA 4MVMA 1A0BA 2JX0A 3UR3C 3LS1A 5AC4A 3HNIA 4PR9A 3WAQA 5BUOA 1D1CA 3V7OA 4Z9HA 5L3QA 1Z23A 2R02A 2IBFA 1YLMA 2J46A 2OEXA 2Q9BA 4JTAB 1M56C 2Q7RA 1T9KA 3S29A 4GYTA 3ABLC 4FWVA 1PCXA 3UNGC 4JEAA 4AK9A 4PJMA 4IJJA 2Q9CA 4MTOA 2L6GA 2XS8A 3UMHA 5L0GA 3QW1A 3Q6NA 4AX2A 4BJ5C 4O6MA 3E9VA 3FDQA 4QI2A 3EGXB 1M2VB 1U6HA 3M15A 1TQGA 2CDQA 1BZ4A 1RCPA 4MVZA 2A0BA 4F4BA 1C03A 5JLIA 2LFFA 2G3VA 4EKWA 3RW0A 2PFDA 3I5PA 3DWWA 1E84A 5L0JA 2VB6A 2QNLA 3NDBB 1M57C 4BJ5A 4XTKA 4RD9A 2LP4A 4JJFA 4BEMJ 5BQHA 2L6HA 3DZAA 5EHHA 3DI5A 1ZHYA 2RSEB 4Z9IA 3ZIBA 1OR3A 3N2ZB 4U9EA 1OW7A 4U5EE 1KTMA 5COGA 3A9CA 3DJNB 4OIRF 4MTFA 4DRIB 1NU9C 4MS2A 2O9XA 2VASA 5A6AA 3VYWA 4KC9A 1ORSC 3EHNA 1ST6A 2JPUA 3FAJA 4LACB 2Y3BA 4CSAA 3KKBA 2AWYA 3DAGA 3W2VA 1QQ3A 2EIMC 1T5OA 1VTMP 5F5FA 5JRAA 1H7IA 4K7BA 4PJLA 2IXOA 3FVYA 3RQGA 1WOLA 4K1OA 3UMKA 5JVEA 3NMIA 3RVZA 1HW1A 2D5RB 4NTBA 2R7XA 4KNVA 1APCA 1L7CA 2XL8A 3CZ6A 3LJBA 4R32A 1MMNA 1MMDA 1R5ID 4NCQA 1YA7O 3TOMA 4AE4A 5DLJA 2WVOA 4CS8A 1XZQA 3JSEO 1FFTC 1TWAA 1KNYA 3AQBA 1Y6DA 4MQ9F 2R03A 4U5DE 3S27A 3ZDLA 4CDYA 1D1AA 4IWBA 4PJJA 1N1CA 4JCHA 1WWPA 5DS6A 5CIVA 2AVKA 3SZRA 1LI5A 4HFKB 4J7TA 2HFIA 5FCLA 5KYWB 3G4ZA 2ETSA 3QVYA 4OIQF 3TD7A 2Z15A 2CNWD 2PNOA 2B0JA 1Z5ZA 2ZXRA 3GM3A 1QSPA 1ZU4A 2NSFA 1BR2A 2YRFA 4LERA 4MVRA 2AU5A 3EZHA 4DRHB 5BQIA 3U8VA 3OA1A 2J9VA 4EIYA 2Y69C 3LESA 4JTCB 3PHF2 1CGOA 3EHMA 2GA0A 1JR8A 2H7BA 2HZ8A 1O3UA 2HV6A 3NMJA 2CW0F 2P6VA 4MVQA 2XRHA 3F46A 3NG1A 1E85A 3IEEA 1ZHTA 3B9QA 2V26A 4MNDA 3LS0A 3T6GB 3ECSA 1RJ9A 2IXMA 2XSEA 3EFOA 4J7YA 5BQGA 3T6BA 1B68A 4JE9A 2QLAA 4DVZA 1VLTA 1Z6AA 2R7TA 1I4YA 3ZQVA 3AQCA 3WHNA 4DJ9A 4JC7A 2YKZA 3K66A 3MYIA 5L0DA 1CPRA 1D0YA 3ZTZA 4DXWA 3OEOA 3B71A 2BL2A 2QE9A 4MVUA 4BEJA 4K0DA 3SP1A 1BDJB 1S7ZA 4IAQA 2WVNA 3DAFA 3L8IA 3RYLA 4E7SA 4XLPF 2PX3A 5GPGB 1Q0MA 1GGQA 3O39A 3U3FA 5E3AA 2P7VA 3V5ZA 3EJNA 1CGME 2CNWA 4M63A 1V54C 2X51A 3O55A 1O5HA 3KH2A 5KYYB 2KJGA 1LE2A 3L34A 3K1HA 3S9OA 3U9MA 4QI0A 2P0NA 2R7OA 2R7UA 3V5YA 1LIHA 2WB7A 3MLGA 4BJ6C 2EIKC 1GS9A 2Y3DA 2GWWA 1LI7A 2HSQA 2KGOA 3AG1C 4I3MA 4G7ZF 3QMKA 2R05A 4W8KA 2W45A 4KBLA 3ITFA 2G62A 3BRJA 2XLHA 4WJ0A 2M4EA 2FFHA 3PCVA 5F28E 2IM8A 1CGNA 1E2XA 1T6UA 2H7VC 3DD7A 1RMVA 4G78A 5CI8A 4DOZA 4DBRA 2EPKX 5KYUA 4CX9A 4G0HA 2EINC 2M64A 4OD5A 2AP3A 1M6TA 3JSZA 2EIJC 1PV3A 3JYYA 1FAPB 1YZAA 3SXYA 1HE1A 4JRZA 1C02A 1D0ZA 2YZSA 3LLKA 4BPMA 2R7SA 1G5ZA 5TJ5E 2IOQA 3C8GA 2YL7A 3EQLF 3ZSUA 3C62A 2HS5A 4QDLA 3RF3A 3U9JA 4CDAA 3UGOA 3JRTA 1FMVA 2F22A 3JT1A 5JS5A 1V74B 2XXAA 2J0XA 3B0UX 5A6BD 4XPYA 2YEVA 3A11A 1TWGA 3JYHA 5JP7A 1BR1A 2HJ3A 1A41A 4C3BA 1EA8A 4IRUA 4ULWA 4DRJB 1AUEA 1QKRA 1ZVZA 4L6RA 3KL4A 5JSLA 4GQHA 2WVQA 1T6IA 2R25A 3MBGA 3EGDA 5CI9A 1NSGB 3PMRA 4EWCA 1O87A 1A7DA 4ULVA 5EK0A 3DKAA 4JKVA 1QLEC 5COMA 1NBBA 4HEAJ 4MW8A 4X0RA 3US6A 4BJ1A 4CS7A 1PD0A 2VC9A 3H65A 4FAPB 2XL6A 5K0IA 2ASRA 4CJOA 2YL0A 3K6BA 2QUPA 4XEKA 1RKEA 1G8XA 2OCCC 2W4BA 4Q7CA 2GDCA 4Q4ZF 2OG2A 1MNEA 2RD9A 5L0CA 2XXAB 3L0IA 1J8MF 2OQMA 3AGUA 3FOOA 1LVKA 3CQZA 1YARO 3B0PA 3HNKA 4LDQA 5E3CA 1Q0GA 3F47A 3S0XA 1OCRC 2ZPAA 1QZXA 4W8PA 3GANA 5DVWA 4LLEA 2YVKA 1ZHWA 2HJMA 2W9YA 4C7OA 3EPVA 4FX5A 3AG3C 3M4CA 4Q5SF 1OCOC 4JIOA 2I15A 4U5GA 3Q6MA 1SYQA 1WATA 2L9JA 3N0TA 4RBNA 4LDKA 1HE9A 2AWCA 1XZPA 4CJGA 3HNJA 2KK1A 5B3SC 1JPNA 4J30B 2XLMA 4MVSA 4YL3A 5DS5A 3UGPA 3HNLA 2YQYA 3ABKC 4NTAA 2J9UA 3R7CA 3ZC4A 1V4AA 4MTGA 3VF0A 3QZCA 5T3TA 4J32B 3S90A 4LLCA 1XWJA 2CYDA 5KYXB 1LPEA 1C17M 4G7HF 2MWQA 1VOMA 4ER9A 3O6XA 4I44A 1Z3IX 2A69F 4YJWA 3L1MA 1BR4A 3C8GB 5FZTA 4EBBA 3R2PA 2PBEA 1HMOA 3S28A 1ZU5A 1T01A 3U0CA 1YAUO 4MW3A 2QTVA 2BC5A 4PACA 1FTSA 1LKXA 1FR0A 3ATPA 2YL1A 3AJMA 5L0IA 3ZVRA 4E7ZA 3VM6A 3EGXA 4E0HA 5L0HA 4KNWA 4IGGA 4JJGA 3GEEA 2E87A 3AGTA 1WN0A 1V55C 4YN0B 1W2WA 2B0HA 2X0CA 3I5QA 1SF8A 3NKEA 4D4XA 2WL8A 1JMWA 1LS4A 3PDMP 4YL0A 2C03A 4U5HA 3M4BA 4YK5A 4O6YA 4E18A 2TMVP 1TKNA 2Q4FA 3TJ6A 1YZCA 1FNTc 5A6KA 4N06A 2XL4A 2XLWA 2A6EF 1NLXA 1VYKA 3NYJA 2BE5F 3HKKA 5KYUB 3OWTA 4IARA 2L7AA 3GODA 3O10A 3NYMA 2H8AA 2VCBA 2NUPB
chains in the Genus database with same CATH topology
4BJTA 3SEOA 4CS9A 1OKKA 3POVA 3DM9B 2G3KA 4O7GA 5EGYA 4HE8D 3HTKC 5T3WA 2KW3C 3W2WA 3DMDA 3RH3A 5DQZA 5KYYA 5E33A 3T6JA 4CBEA 4YT5A 4PK4A 4RDAA 3DM5A 5E2QA 3W8IA 2KQ9A 3ASNC 4I1MA 3T4RA 4JVSA 4OIOF 4OD4A 1VK5A 3DXJF 3EZIA 4ZLDA 2ZXOA 4A2NB 4O79A 3RFYA 2IXNA 1M2OA 4H4KC 3NYLA 2J7PA 1RJ9B 1D1BA 2ZXWC 2EILC 4XLNF 2WZFA 5D92A 4C3DA 4U5CE 2Y3GA 1OCZC 4CSAC 4AE4B 1NG1A 2Y39A 3X1OA 2NUTB 2MYSA 4DBQA 1FFHA 3AG4C 2VH3A 1NZEA 3CSKA 2PF4E 4YT2A 1MMGA 3EH1A 3EFOB 1LS1A 3B0VC 2KNHA 2PP4A 3N24A 1D0XA 5B1BC 1Z63A 2GFHA 3MX3A 5HSWA 2YHSA 4NY3A 3ASOC 3WG7C 2WZGA 5DQTA 2J9WA 3LAYA 3K33A 1SMYF 3K7DA 1IZMA 3Q7GA 4I1OB 2FGYA 3DJUB 2Q9AA 3NRHA 5IY5C 3ABMC 1OCCC 2R7VA 2PX0A 3FHDA 4PFOA 5B1AC 4CS9C 2Y3HA 4U5FE 2H7OA 2W4MA 1JPJA 2IYLD 2HV7A 3VAYA 1NU7D 4XWJA 1MMAA 4BG0A 1VMAA 3WODF 3ZG1A 4JURI 2LSEA 1PD1A 2DYSC 1KU2A 2J7PD 5KYNA 3RKOF 2DGJA 1WGWA 4ZLCA 2WZLA 2J45A 4IAOA 4ANJA 3LNRA 4GEHA 1TWCA 4P6IC 2DYRC 1M2VA 4U5BE 5DS4A 5D91A 2J0WA 5L3VA 2R7QA 2A68F 2Q3TA 3EGDB 4DVYP 1MNDA 5KYXA 3X2QC 2QY9A 3HJCA 4KI2A 4C7OB 4G7OF 3EG9B 4YWQA 3LEVA 3UMIA 5F5HA 3M1CB 4HFFB 3HLZA 3SNHA 4FESA 5KYWA 3E70C 2NUTA 1TR2A 3JCUQ 1J8YF 2IXPA 2CGEA 1IW7F 1SZIA 2ZXPA 4JZAA 4C3EA 3Q7LA 3RIPA 2L81A 4BJ6A 1ZYRF 2R7WA 3K1IC 4CIHA 2I8BA 4JW1A 4PJNA 1VYIA 1OKKD 2R7RA 3NKDA 5T1DB 1FMWA 3KMIA 2NUPA 2C04A 1TWHA 3AG2C 3I4UA 3SYNA 2NG1A 3LLIA 4B6IA 2A6HF 4PFPA 4CS8C 3W8HA 2JD3A 4YT4A 4OIPF 2A1DD 1ZHXA 2V3CC 3EG9A 3EH2A 1ZHZA 4O6NA 4OINF 3UR3C 3LS1A 5BUOA 1D1CA 3V7OA 5L3QA 1Z23A 2J46A 2Q9BA 1M56C 3S29A 4GYTA 4FWVA 1PCXA 3UNGC 4AK9A 4PJMA 4IJJA 2Q9CA 3UMHA 3Q6NA 4AX2A 4BJ5C 4O6MA 3E9VA 3FDQA 4QI2A 3EGXB 1M2VB 2CDQA 4F4BA 2G3VA 2PFDA 3I5PA 2VB6A 3NDBB 1M57C 4BJ5A 4XTKA 4RD9A 4JJFA 3DZAA 5EHHA 1ZHYA 3ZIBA 3N2ZB 4U5EE 4OIRF 3DJNB 1NU9C 2O9XA 2VASA 3VYWA 4KC9A 3EHNA 1ST6A 3FAJA 4LACB 2Y3BA 4CSAA 3KKBA 3DAGA 3W2VA 2EIMC 4K7BA 4PJLA 2IXOA 3FVYA 3UMKA 2D5RB 2R7XA 4KNVA 3CZ6A 3LJBA 1MMNA 1MMDA 5DLJA 4AE4A 2WVOA 4CS8A 1FFTC 1TWAA 3AQBA 4MQ9F 4U5DE 3S27A 1D1AA 4IWBA 4PJJA 1N1CA 4JCHA 5DS6A 3SZRA 4HFKB 5FCLA 5KYWB 4OIQF 3TD7A 2Z15A 2CNWD 2ZXRA 2B0JA 1Z5ZA 4LERA 5F5FA 1ZU4A 1BR2A 3EZHA 3OA1A 2J9VA 2Y69C 3LESA 3PHF2 3EHMA 2H7BA 2HV6A 2CW0F 2P6VA 2XRHA 3F46A 3NG1A 3IEEA 1ZHTA 3B9QA 2V26A 4MNDA 3LS0A 3ECSA 1RJ9A 2IXMA 2XSEA 3EFOA 3T6BA 4DVZA 1Z6AA 2R7TA 3AQCA 3K66A 1D0YA 3OEOA 4BEJA 4K0DA 3SP1A 1S7ZA 2WVNA 3DAFA 4E7SA 3RYLA 4XLPF 2PX3A 3O39A 5E3AA 2P7VA 3EJNA 2CNWA 4M63A 1V54C 2X51A 1O5HA 3KH2A 5KYYB 2KJGA 3L34A 3K1HA 4QI0A 2R7OA 2R7UA 2WB7A 3MLGA 4BJ6C 2EIKC 2Y3DA 2KGOA 3AG1C 4I3MA 4G7ZF 3QMKA 4W8KA 2W45A 4KBLA 3ITFA 2G62A 4WJ0A 2M4EA 2FFHA 2H7VC 3DD7A 5CI8A 4DOZA 4DBRA 5KYUA 4G0HA 2EINC 4OD5A 3JSZA 2EIJC 1D0ZA 2YZSA 3LLKA 2R7SA 2IOQA 3EQLF 3ZSUA 4QDLA 3UGOA 3JRTA 1FMVA 3JT1A 2XXAA 2J0XA 3B0UX 2YEVA 1TWGA 3JYHA 1BR1A 4C3BA 4IRUA 4ULWA 3KL4A 2WVQA 3EGDA 5CI9A 4EWCA 3PMRA 1O87A 1QLEC 4BJ1A 4CS7A 4HEAJ 4X0RA 1PD0A 3H65A 3K6BA 1G8XA 2OCCC 2W4BA 4Q7CA 4Q4ZF 2XXAB 2OG2A 1MNEA 3L0IA 1J8MF 3CQZA 4Q5SF 1LVKA 5E3CA 3B0PA 3F47A 3S0XA 1OCRC 2ZPAA 1QZXA 5DVWA 3GANA 4LLEA 1ZHWA 2W9YA 4C7OA 3EPVA 4FX5A 3AG3C 1OCOC 4U5GA 3Q6MA 2L9JA 3N0TA 4RBNA 5B3SC 1JPNA 4J30B 5DS5A 3UGPA 3ABKC 2J9UA 3ZC4A 3QZCA 5T3TA 4J32B 4LLCA 5KYXB 4G7HF 2MWQA 1VOMA 3O6XA 4I44A 1Z3IX 2A69F 4YJWA 1BR4A 4EBBA 3S28A 1ZU5A 2QTVA 1FTSA 1LKXA 3ZVRA 4E7ZA 3EGXA 4KNWA 4JJGA 2E87A 1V55C 4YN0B 1W2WA 3I5QA 1SF8A 3NKEA 2WL8A 2C03A 4U5HA 4O6YA 1TKNA 4N06A 2XL4A 2A6EF 3NYJA 1VYKA 2BE5F 5KYUB 3OWTA 3GODA 3NYMA 3ABLC 4YT8A 2NUPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AE4 B;  4AE4 A; 
#chains in the Genus database with same CATH topology
 3H2U A;  3TK0 A;  4BJT A;  3SEO A;  4CS9 A;  1OKK A;  1ZW2 A;  1K40 A;  5A69 A;  1Q0F A;  3M79 A;  1DOV A;  3LUT B;  3POV A;  1A7V A;  1HY5 A;  2G3K A;  2UUH A;  3DM9 B;  4O7G A;  5EGY A;  1JAF A;  4N6C A;  2MHR A;  2LCH A;  4HE8 D;  1S05 A;  3HTK C;  5T3W A;  3VRC A;  1E86 A;  4P9F A;  2KW3 C;  3IPM O;  3TQO A;  3W2W A;  3DMD A;  4P9T A;  3RH3 A;  5DQZ A;  5KYY A;  1ORY A;  3NMK A;  5E33 A;  3ZTM A;  3T6J A;  3RQF A;  4CBE A;  2OKU A;  4YT5 A;  4PK4 A;  4RDA A;  3DM5 A;  3MFN A;  5E2Q A;  1NFN A;  3W8I A;  3H2V A;  4CIP A;  4XEV A;  5JUA A;  2KQ9 A;  3ASN C;  4I1M A;  3T4R A;  4JVS A;  4OIO F;  4OD4 A;  1VK5 A;  3DXJ F;  2HUJ A;  3EZI A;  1HMD A;  1OW8 A;  4ZLD A;  2Q00 A;  2ZXO A;  4A2N B;  3S84 A;  3KPH A;  5B3I A;  4O79 A;  3IQ6 A;  3RFY A;  2IXN A;  1AVO B;  1K04 A;  1WTY A;  1M2O A;  4H4K C;  2VCA A;  4NC3 A;  5HV9 A;  3AOU A;  2J7P A;  3NYL A;  1LE4 A;  1RJ9 B;  1D1B A;  1Z7Q c;  2ZXW C;  2EIL C;  4XLN F;  1I5N A;  2WZF A;  5D92 A;  4C3D A;  4U5C E;  2Y3G A;  1OCZ C;  4CSA C;  4AE4 B;  1NG1 A;  2Y39 A;  1H9G A;  2LD6 A;  4LDR A;  2NUT B;  2MYS A;  3V5X A;  3X1O A;  4DBQ A;  1FFH A;  3AG4 C;  2YL3 A;  4N6H A;  2VH3 A;  1NZE A;  3CSK A;  2PF4 E;  3FAP B;  3QVZ A;  3W4Y A;  3B29 A;  4YT2 A;  1MMG A;  5AC5 A;  1UG7 A;  1U0B B;  3EH1 A;  3TOL A;  2L6F A;  3IQT A;  2DB4 A;  3C63 A;  3KYI A;  1NFO A;  1LS1 A;  3EFO B;  2KNH A;  2PP4 A;  3N24 A;  1D0X A;  3L8J A;  5B1B C;  3B0V C;  1Z63 A;  2GFH A;  3MX3 A;  2OEV A;  5HSW A;  1Q0K A;  2YHS A;  5AGF A;  1ORJ A;  4NY3 A;  4EHP A;  3ASO C;  3GWN A;  3RQE A;  2WZG A;  3WG7 C;  5DQT A;  1BBH A;  2XLO A;  2J9W A;  1Q0D A;  3FXH A;  4ONS A;  3LAY A;  3K33 A;  4U9D A;  4WGY A;  1SMY F;  3K7D A;  5A6B A;  1IZM A;  3Q7G A;  2LIG A;  2FGY A;  4I1O B;  3DJU B;  3JRM O;  3IQ5 A;  1G4U S;  1QVX A;  1I4Z A;  2Q9A A;  2HMZ A;  3NRH A;  1JOG A;  1A7E A;  3ABM C;  5IY5 C;  4EUK B;  1OCC C;  1OR2 A;  3FOP A;  1JRA A;  4NTF A;  2R7V A;  1VLS A;  2PX0 A;  3FHD A;  4PFO A;  5B1A C;  3LEO A;  3SXM A;  3CAX A;  1OQC A;  3QW0 A;  3U5S A;  5A6J A;  4EBJ A;  2YLI A;  4E17 A;  1H9T A;  4CS9 C;  2XM0 A;  1OW6 A;  1AEP A;  2Y3H A;  4U5F E;  2H7O A;  2OJQ A;  2W4M A;  1JPJ A;  1YA9 A;  2NSG A;  2XLD A;  2XLE A;  1HW2 A;  2YLG A;  3SXK A;  2IYL D;  2HV7 A;  1OXB A;  3J06 A;  1RXQ A;  3VAY A;  1NU7 D;  2ICW G;  2YWA A;  4XWJ A;  1MMA A;  4BG0 A;  1VMA A;  4H54 A;  3WOD F;  3ZG1 A;  3GWL A;  4YT8 A;  4JUR I;  2LSE A;  3KYJ A;  1PD1 A;  2DYS C;  1KU2 A;  2J7P D;  4CDV A;  3DE8 A;  1H6G A;  5KYN A;  3RKO F;  256B A;  1OXK A;  1VB5 A;  2XLV A;  2DGJ A;  4A4A A;  4XPW A;  3C18 A;  2OU6 A;  1EI7 A;  2EPO A;  3C8Z A;  3U2L A;  3U8P A;  1WGW A;  2KSF A;  1K05 A;  1RKC A;  2P1A A;  2WZL A;  2J45 A;  4IAO A;  4ZLC A;  4ANJ A;  3GEH A;  2EPN A;  3LNR A;  1YYX A;  4GEH A;  1Y4C A;  1UFB A;  1TWC A;  4P6I C;  2DYR C;  1M2V A;  3SXZ A;  4U5B E;  5DS4 A;  2EPM X;  3ZWI A;  4UDV A;  5D91 A;  1YJG A;  2J0W A;  3K1I A;  2R7Q A;  2XM4 A;  5JT4 A;  5L3V A;  1WAS A;  1MQV A;  3TUL A;  3MYF A;  3QTH A;  2A68 F;  1EQ1 A;  2Q3T A;  3EGD B;  4DVY P;  2OJE D;  4Z9J A;  3GOR A;  2KYH A;  1MND A;  3RVY A;  3BEH A;  5KYX A;  1YYJ A;  3X2Q C;  4WGZ A;  4E0I A;  4AL0 A;  2QY9 A;  3LNM B;  2OOC A;  4AL1 A;  3JZ0 A;  4XEF A;  3HJC A;  4XQ1 A;  4KI2 A;  4C7O B;  4G7O F;  3EG9 B;  4N4W A;  4YWQ A;  1LM3 B;  2HKV A;  3IHU A;  4JEB A;  2GAQ A;  3G50 A;  4JCZ A;  1U89 A;  3LEV A;  2XS1 A;  3C7J A;  5F5H A;  1YDI A;  4NQF A;  3U2M A;  1TFO B;  3UMI A;  1ZZP A;  3M1C B;  2VCC A;  3HLZ A;  4HFF B;  2EPL X;  3IQC A;  4MVO A;  3SNH A;  4FES A;  5KYW A;  2LQG A;  3E70 C;  1F1M A;  1SR2 A;  2HSB A;  2R9R B;  1L3P A;  2NUT A;  1TR2 A;  3JCU Q;  1J8Y F;  2IXP A;  1TFK B;  2CGE A;  1IW7 F;  1SZI A;  2ZXP A;  1QPU A;  2HMQ A;  4JZA A;  4WAB A;  4C3E A;  3Q7L A;  3RIP A;  2L81 A;  4YL1 A;  4BJ6 A;  1YVI A;  1ZYR F;  5L0F A;  2LFD A;  3GM2 A;  2R7W A;  3FMS A;  3K1I C;  4CIH A;  2I8B A;  4JW1 A;  4PJN A;  1VYI A;  3GM1 A;  1OKK D;  2FAP B;  2R7R A;  2P61 A;  3JTL O;  2DI3 A;  3C8G D;  3NKD A;  1FMW A;  3KMI A;  5T1D B;  5COF A;  2NUP A;  3ZQY A;  2C04 A;  2J8W A;  2YLD A;  2D4U A;  4D4N A;  1G4W R;  3T9O A;  1GQA A;  1E83 A;  1TWH A;  3TJ5 A;  3AG2 C;  1CPQ A;  3I4U A;  3SYN A;  1R4T A;  1ZW3 A;  2NG1 A;  1RKE B;  3LLI A;  4B6I A;  2A6H F;  3CEX A;  4JTD B;  4PFP A;  4CS8 C;  4EBK A;  1GM5 A;  3GEI A;  3W8H A;  4XPX A;  4IB4 A;  3DE9 A;  2A0U A;  2JD3 A;  2ZD9 A;  3U3B A;  2J9B A;  4YT4 A;  4OIP F;  2A1D D;  1ZHX A;  2V3C C;  2LK4 A;  3G4X A;  2CCY A;  3EG9 A;  3EH2 A;  1T6Q A;  1ZHZ A;  2UUI A;  4O6N A;  4OIN F;  1DOW A;  2KC3 A;  2NPU A;  1EKY A;  4MVM A;  1A0B A;  2JX0 A;  3UR3 C;  3LS1 A;  5AC4 A;  3HNI A;  4PR9 A;  3WAQ A;  5BUO A;  1D1C A;  3V7O A;  4Z9H A;  5L3Q A;  1Z23 A;  2R02 A;  2IBF A;  1YLM A;  2J46 A;  2OEX A;  2Q9B A;  4JTA B;  1M56 C;  2Q7R A;  1T9K A;  3S29 A;  4GYT A;  3ABL C;  4FWV A;  1PCX A;  3UNG C;  4JEA A;  4AK9 A;  4PJM A;  4IJJ A;  2Q9C A;  4MTO A;  2L6G A;  2XS8 A;  3UMH A;  5L0G A;  3QW1 A;  3Q6N A;  4AX2 A;  4BJ5 C;  4O6M A;  3E9V A;  3FDQ A;  4QI2 A;  3EGX B;  1M2V B;  1U6H A;  3M15 A;  1TQG A;  2CDQ A;  1BZ4 A;  1RCP A;  4MVZ A;  2A0B A;  4F4B A;  1C03 A;  5JLI A;  2LFF A;  2G3V A;  4EKW A;  3RW0 A;  2PFD A;  3I5P A;  3DWW A;  1E84 A;  5L0J A;  2VB6 A;  2QNL A;  3NDB B;  1M57 C;  4BJ5 A;  4XTK A;  4RD9 A;  2LP4 A;  4JJF A;  4BEM J;  5BQH A;  2L6H A;  3DZA A;  5EHH A;  3DI5 A;  1ZHY A;  2RSE B;  4Z9I A;  3ZIB A;  1OR3 A;  3N2Z B;  4U9E A;  1OW7 A;  4U5E E;  1KTM A;  5COG A;  3A9C A;  3DJN B;  4OIR F;  4MTF A;  4DRI B;  1NU9 C;  4MS2 A;  2O9X A;  2VAS A;  5A6A A;  3VYW A;  4KC9 A;  1ORS C;  3EHN A;  1ST6 A;  2JPU A;  3FAJ A;  4LAC B;  2Y3B A;  4CSA A;  3KKB A;  2AWY A;  3DAG A;  3W2V A;  1QQ3 A;  2EIM C;  1T5O A;  1VTM P;  5F5F A;  5JRA A;  1H7I A;  4K7B A;  4PJL A;  2IXO A;  3FVY A;  3RQG A;  1WOL A;  4K1O A;  3UMK A;  5JVE A;  3NMI A;  3RVZ A;  1HW1 A;  2D5R B;  4NTB A;  2R7X A;  4KNV A;  1APC A;  1L7C A;  2XL8 A;  3CZ6 A;  3LJB A;  4R32 A;  1MMN A;  1MMD A;  1R5I D;  4NCQ A;  1YA7 O;  3TOM A;  4AE4 A;  5DLJ A;  2WVO A;  4CS8 A;  1XZQ A;  3JSE O;  1FFT C;  1TWA A;  1KNY A;  3AQB A;  1Y6D A;  4MQ9 F;  2R03 A;  4U5D E;  3S27 A;  3ZDL A;  4CDY A;  1D1A A;  4IWB A;  4PJJ A;  1N1C A;  4JCH A;  1WWP A;  5DS6 A;  5CIV A;  2AVK A;  3SZR A;  1LI5 A;  4HFK B;  4J7T A;  2HFI A;  5FCL A;  5KYW B;  3G4Z A;  2ETS A;  3QVY A;  4OIQ F;  3TD7 A;  2Z15 A;  2CNW D;  2PNO A;  2B0J A;  1Z5Z A;  2ZXR A;  3GM3 A;  1QSP A;  1ZU4 A;  2NSF A;  1BR2 A;  2YRF A;  4LER A;  4MVR A;  2AU5 A;  3EZH A;  4DRH B;  5BQI A;  3U8V A;  3OA1 A;  2J9V A;  4EIY A;  2Y69 C;  3LES A;  4JTC B;  3PHF 2;  1CGO A;  3EHM A;  2GA0 A;  1JR8 A;  2H7B A;  2HZ8 A;  1O3U A;  2HV6 A;  3NMJ A;  2CW0 F;  2P6V A;  4MVQ A;  2XRH A;  3F46 A;  3NG1 A;  1E85 A;  3IEE A;  1ZHT A;  3B9Q A;  2V26 A;  4MND A;  3LS0 A;  3T6G B;  3ECS A;  1RJ9 A;  2IXM A;  2XSE A;  3EFO A;  4J7Y A;  5BQG A;  3T6B A;  1B68 A;  4JE9 A;  2QLA A;  4DVZ A;  1VLT A;  1Z6A A;  2R7T A;  1I4Y A;  3ZQV A;  3AQC A;  3WHN A;  4DJ9 A;  4JC7 A;  2YKZ A;  3K66 A;  3MYI A;  5L0D A;  1CPR A;  1D0Y A;  3ZTZ A;  4DXW A;  3OEO A;  3B71 A;  2BL2 A;  2QE9 A;  4MVU A;  4BEJ A;  4K0D A;  3SP1 A;  1BDJ B;  1S7Z A;  4IAQ A;  2WVN A;  3DAF A;  3L8I A;  3RYL A;  4E7S A;  4XLP F;  2PX3 A;  5GPG B;  1Q0M A;  1GGQ A;  3O39 A;  3U3F A;  5E3A A;  2P7V A;  3V5Z A;  3EJN A;  1CGM E;  2CNW A;  4M63 A;  1V54 C;  2X51 A;  3O55 A;  1O5H A;  3KH2 A;  5KYY B;  2KJG A;  1LE2 A;  3L34 A;  3K1H A;  3S9O A;  3U9M A;  4QI0 A;  2P0N A;  2R7O A;  2R7U A;  3V5Y A;  1LIH A;  2WB7 A;  3MLG A;  4BJ6 C;  2EIK C;  1GS9 A;  2Y3D A;  2GWW A;  1LI7 A;  2HSQ A;  2KGO A;  3AG1 C;  4I3M A;  4G7Z F;  3QMK A;  2R05 A;  4W8K A;  2W45 A;  4KBL A;  3ITF A;  2G62 A;  3BRJ A;  2XLH A;  4WJ0 A;  2M4E A;  2FFH A;  3PCV A;  5F28 E;  2IM8 A;  1CGN A;  1E2X A;  1T6U A;  2H7V C;  3DD7 A;  1RMV A;  4G78 A;  5CI8 A;  4DOZ A;  4DBR A;  2EPK X;  5KYU A;  4CX9 A;  4G0H A;  2EIN C;  2M64 A;  4OD5 A;  2AP3 A;  1M6T A;  3JSZ A;  2EIJ C;  1PV3 A;  3JYY A;  1FAP B;  1YZA A;  3SXY A;  1HE1 A;  4JRZ A;  1C02 A;  1D0Z A;  2YZS A;  3LLK A;  4BPM A;  2R7S A;  1G5Z A;  5TJ5 E;  2IOQ A;  3C8G A;  2YL7 A;  3EQL F;  3ZSU A;  3C62 A;  2HS5 A;  4QDL A;  3RF3 A;  3U9J A;  4CDA A;  3UGO A;  3JRT A;  1FMV A;  2F22 A;  3JT1 A;  5JS5 A;  1V74 B;  2XXA A;  2J0X A;  3B0U X;  5A6B D;  4XPY A;  2YEV A;  3A11 A;  1TWG A;  3JYH A;  5JP7 A;  1BR1 A;  2HJ3 A;  1A41 A;  4C3B A;  1EA8 A;  4IRU A;  4ULW A;  4DRJ B;  1AUE A;  1QKR A;  1ZVZ A;  4L6R A;  3KL4 A;  5JSL A;  4GQH A;  2WVQ A;  1T6I A;  2R25 A;  3MBG A;  3EGD A;  5CI9 A;  1NSG B;  3PMR A;  4EWC A;  1O87 A;  1A7D A;  4ULV A;  5EK0 A;  3DKA A;  4JKV A;  1QLE C;  5COM A;  1NBB A;  4HEA J;  4MW8 A;  4X0R A;  3US6 A;  4BJ1 A;  4CS7 A;  1PD0 A;  2VC9 A;  3H65 A;  4FAP B;  2XL6 A;  5K0I A;  2ASR A;  4CJO A;  2YL0 A;  3K6B A;  2QUP A;  4XEK A;  1RKE A;  1G8X A;  2OCC C;  2W4B A;  4Q7C A;  2GDC A;  4Q4Z F;  2OG2 A;  1MNE A;  2RD9 A;  5L0C A;  2XXA B;  3L0I A;  1J8M F;  2OQM A;  3AGU A;  3FOO A;  1LVK A;  3CQZ A;  1YAR O;  3B0P A;  3HNK A;  4LDQ A;  5E3C A;  1Q0G A;  3F47 A;  3S0X A;  1OCR C;  2ZPA A;  1QZX A;  4W8P A;  3GAN A;  5DVW A;  4LLE A;  2YVK A;  1ZHW A;  2HJM A;  2W9Y A;  4C7O A;  3EPV A;  4FX5 A;  3AG3 C;  3M4C A;  4Q5S F;  1OCO C;  4JIO A;  2I15 A;  4U5G A;  3Q6M A;  1SYQ A;  1WAT A;  2L9J A;  3N0T A;  4RBN A;  4LDK A;  1HE9 A;  2AWC A;  1XZP A;  4CJG A;  3HNJ A;  2KK1 A;  5B3S C;  1JPN A;  4J30 B;  2XLM A;  4MVS A;  4YL3 A;  5DS5 A;  3UGP A;  3HNL A;  2YQY A;  3ABK C;  4NTA A;  2J9U A;  3R7C A;  3ZC4 A;  1V4A A;  4MTG A;  3VF0 A;  3QZC A;  5T3T A;  4J32 B;  3S90 A;  4LLC A;  1XWJ A;  2CYD A;  5KYX B;  1LPE A;  1C17 M;  4G7H F;  2MWQ A;  1VOM A;  4ER9 A;  3O6X A;  4I44 A;  1Z3I X;  2A69 F;  4YJW A;  3L1M A;  1BR4 A;  3C8G B;  5FZT A;  4EBB A;  3R2P A;  2PBE A;  1HMO A;  3S28 A;  1ZU5 A;  1T01 A;  3U0C A;  1YAU O;  4MW3 A;  2QTV A;  2BC5 A;  4PAC A;  1FTS A;  1LKX A;  1FR0 A;  3ATP A;  2YL1 A;  3AJM A;  5L0I A;  3ZVR A;  4E7Z A;  3VM6 A;  3EGX A;  4E0H A;  5L0H A;  4KNW A;  4IGG A;  4JJG A;  3GEE A;  2E87 A;  3AGT A;  1WN0 A;  1V55 C;  4YN0 B;  1W2W A;  2B0H A;  2X0C A;  3I5Q A;  1SF8 A;  3NKE A;  4D4X A;  2WL8 A;  1JMW A;  1LS4 A;  3PDM P;  4YL0 A;  2C03 A;  4U5H A;  3M4B A;  4YK5 A;  4O6Y A;  4E18 A;  2TMV P;  1TKN A;  2Q4F A;  3TJ6 A;  1YZC A;  1FNT c;  5A6K A;  4N06 A;  2XL4 A;  2XLW A;  2A6E F;  1NLX A;  1VYK A;  3NYJ A;  2BE5 F;  3HKK A;  5KYU B;  3OWT A;  4IAR A;  2L7A A;  3GOD A;  3O10 A;  3NYM A;  2H8A A;  2VCB A;  2NUP B; 
#chains in the Genus database with same CATH homology
 4BJT A;  3SEO A;  4CS9 A;  1OKK A;  3POV A;  3DM9 B;  2G3K A;  4O7G A;  5EGY A;  4HE8 D;  3HTK C;  5T3W A;  2KW3 C;  3W2W A;  3DMD A;  3RH3 A;  5DQZ A;  5KYY A;  5E33 A;  3T6J A;  4CBE A;  4YT5 A;  4PK4 A;  4RDA A;  3DM5 A;  5E2Q A;  3W8I A;  2KQ9 A;  3ASN C;  4I1M A;  3T4R A;  4JVS A;  4OIO F;  4OD4 A;  1VK5 A;  3DXJ F;  3EZI A;  4ZLD A;  2ZXO A;  4A2N B;  4O79 A;  3RFY A;  2IXN A;  1M2O A;  4H4K C;  3NYL A;  2J7P A;  1RJ9 B;  1D1B A;  2ZXW C;  2EIL C;  4XLN F;  2WZF A;  5D92 A;  4C3D A;  4U5C E;  2Y3G A;  1OCZ C;  4CSA C;  4AE4 B;  1NG1 A;  2Y39 A;  3X1O A;  2NUT B;  2MYS A;  4DBQ A;  1FFH A;  3AG4 C;  2VH3 A;  1NZE A;  3CSK A;  2PF4 E;  4YT2 A;  1MMG A;  3EH1 A;  3EFO B;  1LS1 A;  3B0V C;  2KNH A;  2PP4 A;  3N24 A;  1D0X A;  5B1B C;  1Z63 A;  2GFH A;  3MX3 A;  5HSW A;  2YHS A;  4NY3 A;  3ASO C;  3WG7 C;  2WZG A;  5DQT A;  2J9W A;  3LAY A;  3K33 A;  1SMY F;  3K7D A;  1IZM A;  3Q7G A;  4I1O B;  2FGY A;  3DJU B;  2Q9A A;  3NRH A;  5IY5 C;  3ABM C;  1OCC C;  2R7V A;  2PX0 A;  3FHD A;  4PFO A;  5B1A C;  4CS9 C;  2Y3H A;  4U5F E;  2H7O A;  2W4M A;  1JPJ A;  2IYL D;  2HV7 A;  3VAY A;  1NU7 D;  4XWJ A;  1MMA A;  4BG0 A;  1VMA A;  3WOD F;  3ZG1 A;  4JUR I;  2LSE A;  1PD1 A;  2DYS C;  1KU2 A;  2J7P D;  5KYN A;  3RKO F;  2DGJ A;  1WGW A;  4ZLC A;  2WZL A;  2J45 A;  4IAO A;  4ANJ A;  3LNR A;  4GEH A;  1TWC A;  4P6I C;  2DYR C;  1M2V A;  4U5B E;  5DS4 A;  5D91 A;  2J0W A;  5L3V A;  2R7Q A;  2A68 F;  2Q3T A;  3EGD B;  4DVY P;  1MND A;  5KYX A;  3X2Q C;  2QY9 A;  3HJC A;  4KI2 A;  4C7O B;  4G7O F;  3EG9 B;  4YWQ A;  3LEV A;  3UMI A;  5F5H A;  3M1C B;  4HFF B;  3HLZ A;  3SNH A;  4FES A;  5KYW A;  3E70 C;  2NUT A;  1TR2 A;  3JCU Q;  1J8Y F;  2IXP A;  2CGE A;  1IW7 F;  1SZI A;  2ZXP A;  4JZA A;  4C3E A;  3Q7L A;  3RIP A;  2L81 A;  4BJ6 A;  1ZYR F;  2R7W A;  3K1I C;  4CIH A;  2I8B A;  4JW1 A;  4PJN A;  1VYI A;  1OKK D;  2R7R A;  3NKD A;  5T1D B;  1FMW A;  3KMI A;  2NUP A;  2C04 A;  1TWH A;  3AG2 C;  3I4U A;  3SYN A;  2NG1 A;  3LLI A;  4B6I A;  2A6H F;  4PFP A;  4CS8 C;  3W8H A;  2JD3 A;  4YT4 A;  4OIP F;  2A1D D;  1ZHX A;  2V3C C;  3EG9 A;  3EH2 A;  1ZHZ A;  4O6N A;  4OIN F;  3UR3 C;  3LS1 A;  5BUO A;  1D1C A;  3V7O A;  5L3Q A;  1Z23 A;  2J46 A;  2Q9B A;  1M56 C;  3S29 A;  4GYT A;  4FWV A;  1PCX A;  3UNG C;  4AK9 A;  4PJM A;  4IJJ A;  2Q9C A;  3UMH A;  3Q6N A;  4AX2 A;  4BJ5 C;  4O6M A;  3E9V A;  3FDQ A;  4QI2 A;  3EGX B;  1M2V B;  2CDQ A;  4F4B A;  2G3V A;  2PFD A;  3I5P A;  2VB6 A;  3NDB B;  1M57 C;  4BJ5 A;  4XTK A;  4RD9 A;  4JJF A;  3DZA A;  5EHH A;  1ZHY A;  3ZIB A;  3N2Z B;  4U5E E;  4OIR F;  3DJN B;  1NU9 C;  2O9X A;  2VAS A;  3VYW A;  4KC9 A;  3EHN A;  1ST6 A;  3FAJ A;  4LAC B;  2Y3B A;  4CSA A;  3KKB A;  3DAG A;  3W2V A;  2EIM C;  4K7B A;  4PJL A;  2IXO A;  3FVY A;  3UMK A;  2D5R B;  2R7X A;  4KNV A;  3CZ6 A;  3LJB A;  1MMN A;  1MMD A;  5DLJ A;  4AE4 A;  2WVO A;  4CS8 A;  1FFT C;  1TWA A;  3AQB A;  4MQ9 F;  4U5D E;  3S27 A;  1D1A A;  4IWB A;  4PJJ A;  1N1C A;  4JCH A;  5DS6 A;  3SZR A;  4HFK B;  5FCL A;  5KYW B;  4OIQ F;  3TD7 A;  2Z15 A;  2CNW D;  2ZXR A;  2B0J A;  1Z5Z A;  4LER A;  5F5F A;  1ZU4 A;  1BR2 A;  3EZH A;  3OA1 A;  2J9V A;  2Y69 C;  3LES A;  3PHF 2;  3EHM A;  2H7B A;  2HV6 A;  2CW0 F;  2P6V A;  2XRH A;  3F46 A;  3NG1 A;  3IEE A;  1ZHT A;  3B9Q A;  2V26 A;  4MND A;  3LS0 A;  3ECS A;  1RJ9 A;  2IXM A;  2XSE A;  3EFO A;  3T6B A;  4DVZ A;  1Z6A A;  2R7T A;  3AQC A;  3K66 A;  1D0Y A;  3OEO A;  4BEJ A;  4K0D A;  3SP1 A;  1S7Z A;  2WVN A;  3DAF A;  4E7S A;  3RYL A;  4XLP F;  2PX3 A;  3O39 A;  5E3A A;  2P7V A;  3EJN A;  2CNW A;  4M63 A;  1V54 C;  2X51 A;  1O5H A;  3KH2 A;  5KYY B;  2KJG A;  3L34 A;  3K1H A;  4QI0 A;  2R7O A;  2R7U A;  2WB7 A;  3MLG A;  4BJ6 C;  2EIK C;  2Y3D A;  2KGO A;  3AG1 C;  4I3M A;  4G7Z F;  3QMK A;  4W8K A;  2W45 A;  4KBL A;  3ITF A;  2G62 A;  4WJ0 A;  2M4E A;  2FFH A;  2H7V C;  3DD7 A;  5CI8 A;  4DOZ A;  4DBR A;  5KYU A;  4G0H A;  2EIN C;  4OD5 A;  3JSZ A;  2EIJ C;  1D0Z A;  2YZS A;  3LLK A;  2R7S A;  2IOQ A;  3EQL F;  3ZSU A;  4QDL A;  3UGO A;  3JRT A;  1FMV A;  3JT1 A;  2XXA A;  2J0X A;  3B0U X;  2YEV A;  1TWG A;  3JYH A;  1BR1 A;  4C3B A;  4IRU A;  4ULW A;  3KL4 A;  2WVQ A;  3EGD A;  5CI9 A;  4EWC A;  3PMR A;  1O87 A;  1QLE C;  4BJ1 A;  4CS7 A;  4HEA J;  4X0R A;  1PD0 A;  3H65 A;  3K6B A;  1G8X A;  2OCC C;  2W4B A;  4Q7C A;  4Q4Z F;  2XXA B;  2OG2 A;  1MNE A;  3L0I A;  1J8M F;  3CQZ A;  4Q5S F;  1LVK A;  5E3C A;  3B0P A;  3F47 A;  3S0X A;  1OCR C;  2ZPA A;  1QZX A;  5DVW A;  3GAN A;  4LLE A;  1ZHW A;  2W9Y A;  4C7O A;  3EPV A;  4FX5 A;  3AG3 C;  1OCO C;  4U5G A;  3Q6M A;  2L9J A;  3N0T A;  4RBN A;  5B3S C;  1JPN A;  4J30 B;  5DS5 A;  3UGP A;  3ABK C;  2J9U A;  3ZC4 A;  3QZC A;  5T3T A;  4J32 B;  4LLC A;  5KYX B;  4G7H F;  2MWQ A;  1VOM A;  3O6X A;  4I44 A;  1Z3I X;  2A69 F;  4YJW A;  1BR4 A;  4EBB A;  3S28 A;  1ZU5 A;  2QTV A;  1FTS A;  1LKX A;  3ZVR A;  4E7Z A;  3EGX A;  4KNW A;  4JJG A;  2E87 A;  1V55 C;  4YN0 B;  1W2W A;  3I5Q A;  1SF8 A;  3NKE A;  2WL8 A;  2C03 A;  4U5H A;  4O6Y A;  1TKN A;  4N06 A;  2XL4 A;  2A6E F;  3NYJ A;  1VYK A;  2BE5 F;  5KYU B;  3OWT A;  3GOD A;  3NYM A;  3ABL C;  4YT8 A;  2NUP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...