4AE4B

The ubap1 subunit of escrt-i interacts with ubiquitin via a novel souba domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
113
Chain Sequence
SHMSPSERQCVETVVNGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVEEALEHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-ASSOCIATED PROTEIN 1
publication title The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 32
structure length 113
sequence length 115
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ae4B00
4AE4A 4AE4B
chains in the Genus database with same CATH superfamily
1OQCA 3ECSA 1BR1A 4ER9A 1ZVZA 3GWLA 3B0VC 1G5ZA 1RKCA 4JEAA 5IY5C 1T6IA 3AGTA 2YVKA 4E7ZA 1LS1A 4JEBA 3KYJA 2QUPA 2GA0A 4NQFA 3TJ5A 1HMDA 3RFYA 5AGFA 1AVOB 4MTGA 3GODA 4U5EE 5COGA 5DS4A 3G50A 4Z9JA 5CI8A 2EILC 2Y3BA 2J9UA 3U9MA 1ZHWA 2IXNA 4K0DA 1FR0A 4C3EA 2XSEA 4LLCA 3SZRA 2UUHA 1VK5A 3JZ0A 2Z15A 4J30B 3FVYA 4RBNA 2DI3A 4ANJA 2KW3C 4ZLCA 4JCHA 2GDCA 1T6UA 1YVIA 1FFHA 2KK1A 4PJNA 1ST6A 3QVYA 1CGOA 3A11A 1PCXA 5L0CA 2X51A 2DYRC 4CS7A 1RKEB 1OW6A 3SEOA 4EIYA 3W2VA 4MVQA 3JCUQ 4O79A 4U5GA 1Q0FA 2XL8A 4EHPA 4EBKA 1WATA 2IM8A 2YEVA 4JKVA 4XWJA 1LIHA 3T6JA 3RYLA 4I1MA 3UGPA 2GWWA 3ZTZA 3E70C 3NKEA 4IRUA 2EIMC 4DJ9A 1BBHA 1RKEA 3A9CA 5B1AC 3S27A 4DXWA 2MWQA 1LM3B 1OCCC 1YA7O 1YDIA 1Z6AA 3FMSA 3QZCA 3PCVA 4JTAB 1M6TA 2EIJC 1DOVA 2OG2A 3JRTA 5B1BC 3J06A 1C17M 3M15A 1XZPA 1ZHXA 1FMVA 3GWNA 1XWJA 1L7CA 3K33A 2CGEA 3MLGA 2NUTA 4B6IA 4F4BA 3RVYA 3TJ6A 3EHNA 3WHNA 3RW0A 4CS9A 2WZFA 4YL0A 4IGGA 1Z63A 2XM4A 1QKRA 1AUEA 1LE2A 3DXJF 3DM5A 2XLHA 4ULVA 3U3BA 4N4WA 1OR3A 5A69A 2VCBA 3IEEA 3ZTMA 2PFDA 3NMIA 3C7JA 4PFOA 2WVNA 4OINF 3SXKA 1KNYA 2XLOA 2KQ9A 4AK9A 1IZMA 5A6BD 2HMZA 3NYMA 4CS9C 3CZ6A 5JP7A 1LS4A 2CCYA 3K7DA 2H7BA 1ORSC 2EPNA 2VCAA 2WB7A 1BZ4A 3O39A 1VB5A 4JTCB 1VOMA 3N24A 4G7ZF 2GAQA 5L0HA 3M79A 2VCCA 4XPXA 1YAUO 3IQ6A 4N06A 3C8ZA 2ZXPA 3DJNB 1A7EA 3PMRA 4JTDB 3JSZA 2NPUA 4N6CA 2VB6A 4XEVA 2CW0F 5A6AA 3W4YA 2D5RB 4OD5A 1TWHA 2XS1A 3JYYA 5T3WA 2CYDA 2XLDA 4XQ1A 4A2NB 3BRJA 3DAFA 1OXKA 2A1DD 3LNRA 5DQTA 3B0UX 2Q7RA 2IXMA 1H9GA 1D0ZA 3C63A 3LESA 1JRAA 4FAPB 4NY3A 4C7OB 2G3VA 2AWCA 3FXHA 3GEHA 3X1OA 4EUKB 4CJOA 3B71A 3DE8A 4UDVA 4Z9HA 1QQ3A 3E9VA 3GEEA 1HY5A 4GEHA 1MMNA 2LSEA 2HUJA 1FAPB 3SYNA 1RXQA 2KJGA 3O55A 2C03A 1ZHYA 2AP3A 2R7OA 3WG7C 3ABMC 4A4AA 4IAOA 5JUAA 5F5FA 3UGOA 4H54A 1YYJA 4GQHA 1Q0GA 2Q3TA 5BQIA 4DVYP 2KNHA 3LLIA 4JC7A 4DOZA 1O87A 2JX0A 4Q4ZF 1VYKA 1E84A 1RJ9A 1GGQA 5COFA 4EWCA 5L0GA 3NG1A 1YARO 2FFHA 3KMIA 1SZIA 1K04A 2IXOA 2YHSA 3GM3A 2EPKX 4MW3A 1L3PA 2YWAA 4G7OF 2R7WA 4K1OA 3T4RA 1BR4A 2I15A 1PD0A 5KYUB 2Y69C 4PJMA 1O3UA 2A0UA 5AC4A 5F28E 2W45A 3UNGC 3MFNA 2I8BA 3OA1A 1LKXA 3Q7GA 1M2OA 2ETSA 2QE9A 2WZGA 2PNOA 4PFPA 3N0TA 4JJFA 2NSGA 2DYSC 3EG9A 3C18A 4JJGA 5KYUA 2RSEB 5JVEA 3T6BA 4CSAC 2DB4A 2XLVA 1OXBA 3QW1A 3B9QA 3JYHA 3EH2A 4JVSA 3IQTA 4E7SA 2WZLA 1OW8A 1LI5A 3SXMA 4CDYA 2L81A 2UUIA 2CNWA 2X0CA 1Z23A 4BEJA 5E3AA 4MVRA 2Y3GA 3RQEA 4BG0A 2B0HA 4OIOF 3U8PA 4D4XA 1HW1A 2R7QA 1G4WR 1VYIA 2NG1A 4Z9IA 3KH2A 1A7VA 2H7VC 4PJJA 4YT5A 3EH1A 4R32A 1H7IA 1R4TA 1OKKA 1MMAA 2G62A 4KBLA 2L9JA 1E83A 1Y6DA 3S29A 4U5DE 3ZC4A 4BPMA 1UG7A 2C04A 2EPMX 2V3CC 3FDQA 5KYYB 3IQCA 3Q6NA 2XS8A 3DD7A 1LPEA 3MYIA 2A68F 1H6GA 2LFDA 4XPYA 4CDAA 1UFBA 2A6EF 1FTSA 5L3VA 1NFNA 4PJLA 2XM0A 3F46A 2NUTB 4MVSA 2R7UA 2R7TA 5KYYA 3U2LA 3VYWA 3K1HA 1YYXA 1V74B 2R25A 2YL0A 2YL3A 3HTKC 1Z3IX 1TWGA 4QI0A 3V5YA 4CDVA 2HJ3A 5JRAA 1F1MA 2P6VA 2L6GA 3I5QA 4G7HF 1EA8A 3U5SA 3CEXA 3TOMA 3U2MA 3L8IA 1WN0A 1V54C 4K7BA 3UMKA 3EGXA 1Q0DA 2AWYA 1OCOC 3FAPB 3LJBA 4P9FA 3NYLA 1ZU5A 4U9EA 2TMVP 1YZCA 2OJQA 4LDKA 1N1CA 3L8JA 1MMDA 3BEHA 3TD7A 1SMYF 4HEAJ 4NTAA 4OD4A 2J7PA 5JS5A 1OR2A 2HJMA 1NLXA 1OKKD 2LCHA 2Q9BA 4BJ6C 4FWVA 4U5BE 2Q00A 3MYFA 5B3SC 4MTOA 1MQVA 1C03A 2J8WA 2W4BA 1WGWA 1G4US 1LVKA 1BDJB 2LK4A 3NDBB 4FX5A 4OIRF 2R7SA 1JMWA 1WWPA 3WAQA 3W8HA 2KC3A 3X2QC 1I5NA 1GS9A 5KYNA 4XPWA 2NUPB 1ZZPA 2YKZA 3AG3C 3T6GB 4DBRA 2A6HF 2J9WA 4U5HA 1EQ1A 3O10A 2M4EA 4O6YA 4PACA 4CJGA 2H7OA 4YT8A 3U0CA 3S0XA 3AJMA 1JPNA 1TFOB 2KSFA 5CI9A 3SP1A 1U6HA 4PK4A 2DGJA 3I4UA 2XLMA 2XRHA 1ORYA 2NUPA 3S28A 4CX9A 4E18A 4YN0B 4MQ9F 4J7TA 2VH3A 1M57C 2WVOA 4X0RA 4JCZA 1SF8A 5FZTA 1A7DA 3ZVRA 5JSLA 4C3DA 1RCPA 4N6HA 3GEIA 2XXAA 1A41A 3FAJA 5F5HA 2Q9AA 2L7AA 3VM6A 3B0PA 1JOGA 2J46A 4OIPF 1PV3A 5FCLA 1CGNA 5KYWB 4YJWA 4C7OA 3DJUB 1JAFA 4HFFB 5T3TA 3VAYA 1PD1A 4EKWA 4DRIB 3JT1A 1RJ9B 2JPUA 3JSEO 1D0XA 4Q5SF 2HKVA 1J8MF 3KKBA 4J32B 1Y4CA 2R02A 3M4CA 4MVMA 4G78A 4KNVA 4O6NA 2R7RA 4LDQA 4CBEA 3LUTB 5KYWA 4LDRA 4XTKA 3ASOC 1TKNA 3ATPA 4MVZA 1NFOA 1ZW2A 2HSQA 4P6IC 1YJGA 5KYXB 3UMHA 3ZG1A 3DZAA 1SYQA 1G8XA 3B29A 2CDQA 3QMKA 5HSWA 1KTMA 2P0NA 3C8GB 1QSPA 4MVUA 4CSAA 3EG9B 3G4ZA 3W8IA 3L1MA 4HE8D 1YLMA 2PX0A 3H2VA 3EHMA 1MNEA 4DBQA 5KYXA 2J45A 3EPVA 4FESA 5B3IA 2HV6A 5EGYA 5DVWA 1CPQA 3AGUA 2JD3A 2GFHA 3C8GA 2OEXA 3FHDA 3HNJA 3AG4C 3K66A 2M64A 3TQOA 2KGOA 2PP4A 3HNIA 2XL4A 4NTFA 4JE9A 4NC3A 4I44A 2HZ8A 2PF4E 1D1AA 1NZEA 1XZQA 2LFFA 3L34A 4O6MA 3NMJA 4EBJA 4IWBA 1VLSA 2Q9CA 2EPLX 3US6A 2L6FA 3V7OA 3KYIA 4PR9A 2O9XA 1MNDA 4W8PA 3SNHA 3TOLA 3V5XA 4AE4B 2AVKA 2PBEA 3LLKA 3WODF 4IARA 3N2ZB 3S84A 4CIHA 5DS5A 4AL1A 2AU5A 2J0XA 4EBBA 2HSBA 2B0JA 2Y3DA 4LERA 2YL7A 4M63A 1ZHTA 3LS1A 5CIVA 4JIOA 4AE4A 1S05A 3K1IC 4WGZA 4NCQA 2G3KA 3RF3A 4XEKA 4E0HA 2PX3A 3GM1A 3K6BA 4GYTA 4W8KA 3H65A 2WL8A 2YLIA 4KI2A 4ZLDA 3I5PA 2OOCA 5E3CA 2OQMA 4WJ0A 1VLTA 3VF0A 3CAXA 4YT4A 2E87A 2EIKC 3HNLA 5D91A 2OEVA 1WOLA 4BJ5C 1Q0MA 1C02A 1VMAA 4ONSA 1CPRA 1YZAA 5E2QA 4D4NA 3DI5A 3FOPA 3EJNA 5K0IA 4DVZA 4LACB 3MX3A 3C8GD 3RIPA 3ITFA 3ZWIA 2R9RB 1OW7A 1W2WA 1ZYRF 4NTBA 2HFIA 4MVOA 3EQLF 1OCRC 3AQBA 2YRFA 3EFOB 2VASA 4YK5A 2H8AA 2L6HA 1WASA 2HMQA 5JT4A 3PDMP 1A0BA 3EGXB 1T01A 5E33A 1R5ID 1KU2A 3JRMO 1D1CA 1NU9C 3ZIBA 3S90A 1RMVA 4BJ6A 4QI2A 1D1BA 1ORJA 4L6RA 5A6BA 2CNWD 1HE9A 3EFOA 1I4YA 3ZDLA 3QTHA 3M4BA 3RVZA 2FGYA 5DLJA 1MMGA 1GQAA 3IHUA 3M1CB 4MNDA 3SXYA 2YLGA 2XL6A 1ZU4A 2EINC 2Y3HA 4DRJB 3KPHA 5L0IA 1TFKB 2MHRA 2RD9A 4LLEA 4E17A 1E2XA 3U3FA 1E85A 1VTMP 3RKOF 5DS6A 1HE1A 3LAYA 5A6JA 3EZHA 4RD9A 2R05A 2BL2A 4JURI 3DMDA 4O7GA 1HW2A 5L3QA 3TK0A 4MW8A 1U0BB 1E86A 1ZW3A 4BJTA 1AEPA 1BR2A 3JTLO 1Z7Qc 1TQGA 3HLZA 2QTVA 1EI7A 1HMOA 2W4MA 3OEOA 1EKYA 3DWWA 1FFTC 1SR2A 1T5OA 2LD6A 3CQZA 1U89A 1J8YF 4AL0A 3EGDB 4BEMJ 1O5HA 5EHHA 1D0YA 2QNLA 4H4KC 4MTFA 3U9JA 5HV9A 2XXAB 2Y39A 3VRCA 3QW0A 1WTYA 4U9DA 5L0FA 3CSKA 3MBGA 4WGYA 3V5ZA 3T9OA 1V4AA 3W2WA 1JPJA 1OCZC 1QPUA 2HV7A 2LIGA 4KC9A 5BQGA 4AX2A 2R7XA 4J7YA 3IQ5A 1NG1A 3ZSUA 2IOQA 3EGDA 2YQYA 3G4XA 3GM2A 4XLNF 3RQFA 3SXZA 2XLEA 2P61A 1QZXA 3KL4A 3R2PA 4WABA 5L0DA 2IYLD 4U5CE 3ZQYA 5A6KA 3EZIA 3R7CA 2YZSA 4E0IA 1FMWA 4JRZA 5COMA 3U8VA 2J9BA 3ASNC 2J7PD 3FOOA 2BE5F 2ZD9A 3HKKA 1K40A 1M56C 2KYHA 3NRHA 3O6XA 3OWTA 2YLDA 3QVZA 4G0HA 4HFKB 4I1OB 4KNWA 5JLIA 1B68A 2ICWG 1TR2A 2XLWA 2J9VA 4BJ1A 2R03A 2ZPAA 3ABKC 3LEVA 5L0JA 3DE9A 3S9OA 2BC5A 2OJED 2EPOA 2P1AA 3GANA 2ZXRA 4Q7CA 3TULA 2P7VA 2YL1A 1CGME 2WVQA 1S7ZA 3AQCA 4RDAA 1NBBA 4IJJA 1NSGB 2QLAA 3L0IA 2OU6A 4U5FE 4YT2A 3ZQVA 2J0WA 5BQHA 4XLPF 3NMKA 3HJCA 3NYJA 4XEFA 4YL1A 1TWCA 2FAPB 1H9TA 2V26A 3HNKA 1QLEC 1K05A 1YA9A 3H2UA 1IW7F 3POVA 3AG1C 1APCA 2LQGA 1LE4A 4DRHB 3LEOA 5EK0A 3AOUA 2ZXWC 3DM9B 4MS2A 4CS8A 4JZAA 3LS0A 1V55C 1LI7A 3RH3A 4IB4A 3DKAA 1NU7D 3NKDA 3K1IA 5AC5A 2LP4A 3IPMO 5GPGB 4CIPA 2OKUA 2A0BA 1M2VB 1DOWA 4ULWA 3AG2C 1FNTc 4OIQF 4IAQA 3UMIA 3Q7LA 4YWQA 1ZHZA 2VC9A 1JR8A 2W9YA 2OCCC 5TJ5E 3ABLC 3PHF2 2R7VA 1Q0KA 2F22A 1Z5ZA 1QVXA 2ZXOA 3F47A 4CS8C 2ASRA 4BJ5A 3LNMB 3C62A 2NSFA 1TWAA 2MYSA 5D92A 1T6QA 3RQGA 2IBFA 4I3MA 1M2VA 5DQZA 2A69F 3DAGA 4JW1A 2QY9A 2Q4FA 2HS5A 4QDLA 4P9TA 4YL3A 5BUOA 4C3BA 5T1DB 256BA 1GM5A 3UR3C 1T9KA 2D4UA 3Q6MA 1I4ZA 3GORA 2IXPA
chains in the Genus database with same CATH topology
3ECSA 1BR1A 3B0VC 5IY5C 4E7ZA 1LS1A 3RFYA 5DS4A 3GODA 4U5EE 5CI8A 2EILC 2Y3BA 2J9UA 1ZHWA 2IXNA 4K0DA 4C3EA 2XSEA 4LLCA 3SZRA 1VK5A 2Z15A 4J30B 3FVYA 4RBNA 4ANJA 2KW3C 4ZLCA 4JCHA 1FFHA 4PJNA 1ST6A 1PCXA 2X51A 2DYRC 4CS7A 3SEOA 3W2VA 3JCUQ 4O79A 4U5GA 2YEVA 4XWJA 3UGPA 3T6JA 3RYLA 4I1MA 3E70C 3NKEA 4IRUA 2EIMC 3S27A 5B1AC 2MWQA 1OCCC 1Z6AA 3QZCA 2EIJC 2OG2A 3JRTA 5B1BC 1ZHXA 2NUTA 1FMVA 3K33A 3MLGA 4B6IA 2CGEA 4F4BA 3EHNA 4CS9A 2WZFA 1Z63A 3DXJF 3DM5A 3IEEA 2PFDA 4PFOA 2WVNA 4OINF 4AK9A 2KQ9A 1IZMA 3NYMA 4CS9C 3CZ6A 3K7DA 2H7BA 2WB7A 3O39A 1VOMA 3N24A 4G7ZF 4N06A 2ZXPA 3DJNB 3PMRA 3JSZA 2VB6A 2CW0F 2D5RB 4OD5A 1TWHA 5T3WA 4A2NB 3DAFA 3LNRA 2A1DD 5DQTA 3B0UX 2IXMA 1D0ZA 3LESA 4NY3A 2G3VA 3X1OA 3E9VA 4GEHA 1MMNA 2LSEA 3SYNA 2KJGA 2C03A 1ZHYA 3WG7C 2R7OA 3ABMC 5F5FA 4IAOA 3UGOA 2Q3TA 4DVYP 3LLIA 2KNHA 4DOZA 1O87A 4Q4ZF 1VYKA 1RJ9A 4EWCA 3NG1A 2FFHA 3KMIA 1SZIA 2IXOA 2YHSA 4G7OF 2R7WA 3T4RA 1BR4A 1PD0A 5KYUB 2Y69C 4PJMA 2W45A 3UNGC 2I8BA 3OA1A 1LKXA 3Q7GA 1M2OA 2WZGA 4PFPA 3N0TA 4JJFA 2DYSC 3EG9A 4JJGA 5KYUA 3T6BA 4CSAC 3B9QA 3JYHA 3EH2A 4JVSA 4E7SA 2WZLA 2L81A 2CNWA 1Z23A 4BEJA 5E3AA 2Y3GA 4BG0A 4OIOF 2R7QA 1VYIA 2NG1A 3KH2A 2H7VC 4PJJA 4YT5A 3EH1A 3S29A 4KBLA 2G62A 1OKKA 1MMAA 2L9JA 4U5DE 3ZC4A 2V3CC 2C04A 3FDQA 5KYYB 3Q6NA 3DD7A 2A68F 2A6EF 1FTSA 5L3VA 4PJLA 3F46A 2R7UA 2NUTB 2R7TA 5KYYA 3VYWA 3K1HA 4QI0A 3HTKC 1Z3IX 1TWGA 2P6VA 3I5QA 4G7HF 1V54C 4K7BA 3UMKA 3EGXA 3LJBA 1OCOC 3NYLA 1ZU5A 1N1CA 1MMDA 3TD7A 1SMYF 4HEAJ 4OD4A 2J7PA 1OKKD 2Q9BA 4BJ6C 4FWVA 5B3SC 2W4BA 1WGWA 1LVKA 3NDBB 4FX5A 4OIRF 2R7SA 3W8HA 3X2QC 5KYNA 2NUPB 3AG3C 4DBRA 2A6HF 2J9WA 4U5HA 2M4EA 4O6YA 2H7OA 4YT8A 3S0XA 1JPNA 5CI9A 3SP1A 4PK4A 2DGJA 3I4UA 3S28A 2XRHA 5FCLA 2NUPA 4YN0B 4MQ9F 2VH3A 1M57C 2WVOA 4X0RA 1SF8A 3ZVRA 2XXAA 5F5HA 3FAJA 2Q9AA 3B0PA 2J46A 4OIPF 5KYWB 4C7OA 4YJWA 3DJUB 4HFFB 5T3TA 3VAYA 1PD1A 3JT1A 1RJ9B 1D0XA 4Q5SF 1J8MF 3KKBA 4J32B 2R7RA 4KNVA 4CBEA 5KYWA 4XTKA 3ASOC 1TKNA 4P6IC 5KYXB 3UMHA 3ZG1A 3DZAA 1G8XA 2CDQA 3QMKA 5HSWA 4CSAA 3EG9B 3W8IA 4HE8D 2PX0A 3EHMA 1MNEA 4DBQA 5KYXA 2J45A 3EPVA 4FESA 2HV6A 5EGYA 5DVWA 2JD3A 2GFHA 3FHDA 3AG4C 3K66A 2KGOA 2PP4A 2XL4A 4I44A 2PF4E 1D1AA 1NZEA 4O6MA 3L34A 4IWBA 2Q9CA 3V7OA 4AE4B 2O9XA 1MNDA 3SNHA 3LLKA 3WODF 5DS5A 3N2ZB 4CIHA 2J0XA 4EBBA 2B0JA 2Y3DA 4LERA 4M63A 1ZHTA 3LS1A 4AE4A 3K1IC 2G3KA 2PX3A 3K6BA 4GYTA 4W8KA 3H65A 2WL8A 4KI2A 4ZLDA 3I5PA 5E3CA 4WJ0A 4YT4A 2E87A 2EIKC 4BJ5C 5D91A 1VMAA 5E2QA 3EJNA 4DVZA 4LACB 3MX3A 3RIPA 3ITFA 1W2WA 1ZYRF 3EQLF 1OCRC 3AQBA 3EFOB 2VASA 3EGXB 5E33A 1KU2A 1D1CA 1NU9C 3ZIBA 4BJ6A 4QI2A 1D1BA 2CNWD 3EFOA 2FGYA 5DLJA 1MMGA 3M1CB 4MNDA 1ZU4A 2EINC 2Y3HA 4LLEA 3RKOF 3LAYA 3EZHA 4RD9A 4JURI 3DMDA 4O7GA 5L3QA 4BJTA 1BR2A 3HLZA 2QTVA 2W4MA 3OEOA 1FFTC 3CQZA 1J8YF 3EGDB 1O5HA 5EHHA 1D0YA 4H4KC 2XXAB 2Y39A 3CSKA 4C3DA 3W2WA 4C7OB 1JPJA 1OCZC 2HV7A 4KC9A 2R7XA 4AX2A 1NG1A 3ZSUA 2IOQA 3EGDA 4XLNF 5DS6A 1QZXA 3KL4A 2IYLD 4U5CE 3EZIA 2YZSA 1FMWA 3ASNC 2J7PD 4U5BE 2BE5F 4O6NA 3O6XA 3NRHA 1M56C 3OWTA 4G0HA 4KNWA 4HFKB 4I1OB 1TR2A 2J9VA 4BJ1A 2ZPAA 3ABKC 3LEVA 3GANA 2ZXRA 4Q7CA 2P7VA 2WVQA 1S7ZA 3AQCA 4RDAA 4IJJA 4U5FE 3L0IA 4YT2A 4XLPF 2J0WA 3HJCA 3NYJA 1TWCA 2V26A 1QLEC 1IW7F 3POVA 3AG1C 2ZXWC 3DM9B 4CS8A 4JZAA 3LS0A 1V55C 3RH3A 1NU7D 3NKDA 1M2VB 4ULWA 3AG2C 4OIQF 3UMIA 4YWQA 3Q7LA 1ZHZA 2W9YA 2OCCC 3PHF2 3ABLC 2R7VA 1Z5ZA 2ZXOA 3F47A 4CS8C 4BJ5A 2MYSA 1TWAA 5D92A 4I3MA 1M2VA 5DQZA 2A69F 3DAGA 4JW1A 2QY9A 4QDLA 5BUOA 4C3BA 5T1DB 3UR3C 3Q6MA 2IXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AE4 A;  4AE4 B; 
#chains in the Genus database with same CATH topology
 1OQC A;  3ECS A;  1BR1 A;  4ER9 A;  1ZVZ A;  3GWL A;  3B0V C;  1G5Z A;  1RKC A;  4JEA A;  5IY5 C;  1T6I A;  3AGT A;  2YVK A;  4E7Z A;  1LS1 A;  4JEB A;  3KYJ A;  2QUP A;  2GA0 A;  4NQF A;  3TJ5 A;  1HMD A;  3RFY A;  5AGF A;  1AVO B;  4MTG A;  3GOD A;  4U5E E;  5COG A;  5DS4 A;  3G50 A;  4Z9J A;  5CI8 A;  2EIL C;  2Y3B A;  2J9U A;  3U9M A;  1ZHW A;  2IXN A;  4K0D A;  1FR0 A;  4C3E A;  2XSE A;  4LLC A;  3SZR A;  2UUH A;  1VK5 A;  3JZ0 A;  2Z15 A;  4J30 B;  3FVY A;  4RBN A;  2DI3 A;  4ANJ A;  2KW3 C;  4ZLC A;  4JCH A;  2GDC A;  1T6U A;  1YVI A;  1FFH A;  2KK1 A;  4PJN A;  1ST6 A;  3QVY A;  1CGO A;  3A11 A;  1PCX A;  5L0C A;  2X51 A;  2DYR C;  4CS7 A;  1RKE B;  1OW6 A;  3SEO A;  4EIY A;  3W2V A;  4MVQ A;  3JCU Q;  4O79 A;  4U5G A;  1Q0F A;  2XL8 A;  4EHP A;  4EBK A;  1WAT A;  2IM8 A;  2YEV A;  4JKV A;  4XWJ A;  1LIH A;  3T6J A;  3RYL A;  4I1M A;  3UGP A;  2GWW A;  3ZTZ A;  3E70 C;  3NKE A;  4IRU A;  2EIM C;  4DJ9 A;  1BBH A;  1RKE A;  3A9C A;  5B1A C;  3S27 A;  4DXW A;  2MWQ A;  1LM3 B;  1OCC C;  1YA7 O;  1YDI A;  1Z6A A;  3FMS A;  3QZC A;  3PCV A;  4JTA B;  1M6T A;  2EIJ C;  1DOV A;  2OG2 A;  3JRT A;  5B1B C;  3J06 A;  1C17 M;  3M15 A;  1XZP A;  1ZHX A;  1FMV A;  3GWN A;  1XWJ A;  1L7C A;  3K33 A;  2CGE A;  3MLG A;  2NUT A;  4B6I A;  4F4B A;  3RVY A;  3TJ6 A;  3EHN A;  3WHN A;  3RW0 A;  4CS9 A;  2WZF A;  4YL0 A;  4IGG A;  1Z63 A;  2XM4 A;  1QKR A;  1AUE A;  1LE2 A;  3DXJ F;  3DM5 A;  2XLH A;  4ULV A;  3U3B A;  4N4W A;  1OR3 A;  5A69 A;  2VCB A;  3IEE A;  3ZTM A;  2PFD A;  3NMI A;  3C7J A;  4PFO A;  2WVN A;  4OIN F;  3SXK A;  1KNY A;  2XLO A;  2KQ9 A;  4AK9 A;  1IZM A;  5A6B D;  2HMZ A;  3NYM A;  4CS9 C;  3CZ6 A;  5JP7 A;  1LS4 A;  2CCY A;  3K7D A;  2H7B A;  1ORS C;  2EPN A;  2VCA A;  2WB7 A;  1BZ4 A;  3O39 A;  1VB5 A;  4JTC B;  1VOM A;  3N24 A;  4G7Z F;  2GAQ A;  5L0H A;  3M79 A;  2VCC A;  4XPX A;  1YAU O;  3IQ6 A;  4N06 A;  3C8Z A;  2ZXP A;  3DJN B;  1A7E A;  3PMR A;  4JTD B;  3JSZ A;  2NPU A;  4N6C A;  2VB6 A;  4XEV A;  2CW0 F;  5A6A A;  3W4Y A;  2D5R B;  4OD5 A;  1TWH A;  2XS1 A;  3JYY A;  5T3W A;  2CYD A;  2XLD A;  4XQ1 A;  4A2N B;  3BRJ A;  3DAF A;  1OXK A;  2A1D D;  3LNR A;  5DQT A;  3B0U X;  2Q7R A;  2IXM A;  1H9G A;  1D0Z A;  3C63 A;  3LES A;  1JRA A;  4FAP B;  4NY3 A;  4C7O B;  2G3V A;  2AWC A;  3FXH A;  3GEH A;  3X1O A;  4EUK B;  4CJO A;  3B71 A;  3DE8 A;  4UDV A;  4Z9H A;  1QQ3 A;  3E9V A;  3GEE A;  1HY5 A;  4GEH A;  1MMN A;  2LSE A;  2HUJ A;  1FAP B;  3SYN A;  1RXQ A;  2KJG A;  3O55 A;  2C03 A;  1ZHY A;  2AP3 A;  2R7O A;  3WG7 C;  3ABM C;  4A4A A;  4IAO A;  5JUA A;  5F5F A;  3UGO A;  4H54 A;  1YYJ A;  4GQH A;  1Q0G A;  2Q3T A;  5BQI A;  4DVY P;  2KNH A;  3LLI A;  4JC7 A;  4DOZ A;  1O87 A;  2JX0 A;  4Q4Z F;  1VYK A;  1E84 A;  1RJ9 A;  1GGQ A;  5COF A;  4EWC A;  5L0G A;  3NG1 A;  1YAR O;  2FFH A;  3KMI A;  1SZI A;  1K04 A;  2IXO A;  2YHS A;  3GM3 A;  2EPK X;  4MW3 A;  1L3P A;  2YWA A;  4G7O F;  2R7W A;  4K1O A;  3T4R A;  1BR4 A;  2I15 A;  1PD0 A;  5KYU B;  2Y69 C;  4PJM A;  1O3U A;  2A0U A;  5AC4 A;  5F28 E;  2W45 A;  3UNG C;  3MFN A;  2I8B A;  3OA1 A;  1LKX A;  3Q7G A;  1M2O A;  2ETS A;  2QE9 A;  2WZG A;  2PNO A;  4PFP A;  3N0T A;  4JJF A;  2NSG A;  2DYS C;  3EG9 A;  3C18 A;  4JJG A;  5KYU A;  2RSE B;  5JVE A;  3T6B A;  4CSA C;  2DB4 A;  2XLV A;  1OXB A;  3QW1 A;  3B9Q A;  3JYH A;  3EH2 A;  4JVS A;  3IQT A;  4E7S A;  2WZL A;  1OW8 A;  1LI5 A;  3SXM A;  4CDY A;  2L81 A;  2UUI A;  2CNW A;  2X0C A;  1Z23 A;  4BEJ A;  5E3A A;  4MVR A;  2Y3G A;  3RQE A;  4BG0 A;  2B0H A;  4OIO F;  3U8P A;  4D4X A;  1HW1 A;  2R7Q A;  1G4W R;  1VYI A;  2NG1 A;  4Z9I A;  3KH2 A;  1A7V A;  2H7V C;  4PJJ A;  4YT5 A;  3EH1 A;  4R32 A;  1H7I A;  1R4T A;  1OKK A;  1MMA A;  2G62 A;  4KBL A;  2L9J A;  1E83 A;  1Y6D A;  3S29 A;  4U5D E;  3ZC4 A;  4BPM A;  1UG7 A;  2C04 A;  2EPM X;  2V3C C;  3FDQ A;  5KYY B;  3IQC A;  3Q6N A;  2XS8 A;  3DD7 A;  1LPE A;  3MYI A;  2A68 F;  1H6G A;  2LFD A;  4XPY A;  4CDA A;  1UFB A;  2A6E F;  1FTS A;  5L3V A;  1NFN A;  4PJL A;  2XM0 A;  3F46 A;  2NUT B;  4MVS A;  2R7U A;  2R7T A;  5KYY A;  3U2L A;  3VYW A;  3K1H A;  1YYX A;  1V74 B;  2R25 A;  2YL0 A;  2YL3 A;  3HTK C;  1Z3I X;  1TWG A;  4QI0 A;  3V5Y A;  4CDV A;  2HJ3 A;  5JRA A;  1F1M A;  2P6V A;  2L6G A;  3I5Q A;  4G7H F;  1EA8 A;  3U5S A;  3CEX A;  3TOM A;  3U2M A;  3L8I A;  1WN0 A;  1V54 C;  4K7B A;  3UMK A;  3EGX A;  1Q0D A;  2AWY A;  1OCO C;  3FAP B;  3LJB A;  4P9F A;  3NYL A;  1ZU5 A;  4U9E A;  2TMV P;  1YZC A;  2OJQ A;  4LDK A;  1N1C A;  3L8J A;  1MMD A;  3BEH A;  3TD7 A;  1SMY F;  4HEA J;  4NTA A;  4OD4 A;  2J7P A;  5JS5 A;  1OR2 A;  2HJM A;  1NLX A;  1OKK D;  2LCH A;  2Q9B A;  4BJ6 C;  4FWV A;  4U5B E;  2Q00 A;  3MYF A;  5B3S C;  4MTO A;  1MQV A;  1C03 A;  2J8W A;  2W4B A;  1WGW A;  1G4U S;  1LVK A;  1BDJ B;  2LK4 A;  3NDB B;  4FX5 A;  4OIR F;  2R7S A;  1JMW A;  1WWP A;  3WAQ A;  3W8H A;  2KC3 A;  3X2Q C;  1I5N A;  1GS9 A;  5KYN A;  4XPW A;  2NUP B;  1ZZP A;  2YKZ A;  3AG3 C;  3T6G B;  4DBR A;  2A6H F;  2J9W A;  4U5H A;  1EQ1 A;  3O10 A;  2M4E A;  4O6Y A;  4PAC A;  4CJG A;  2H7O A;  4YT8 A;  3U0C A;  3S0X A;  3AJM A;  1JPN A;  1TFO B;  2KSF A;  5CI9 A;  3SP1 A;  1U6H A;  4PK4 A;  2DGJ A;  3I4U A;  2XLM A;  2XRH A;  1ORY A;  2NUP A;  3S28 A;  4CX9 A;  4E18 A;  4YN0 B;  4MQ9 F;  4J7T A;  2VH3 A;  1M57 C;  2WVO A;  4X0R A;  4JCZ A;  1SF8 A;  5FZT A;  1A7D A;  3ZVR A;  5JSL A;  4C3D A;  1RCP A;  4N6H A;  3GEI A;  2XXA A;  1A41 A;  3FAJ A;  5F5H A;  2Q9A A;  2L7A A;  3VM6 A;  3B0P A;  1JOG A;  2J46 A;  4OIP F;  1PV3 A;  5FCL A;  1CGN A;  5KYW B;  4YJW A;  4C7O A;  3DJU B;  1JAF A;  4HFF B;  5T3T A;  3VAY A;  1PD1 A;  4EKW A;  4DRI B;  3JT1 A;  1RJ9 B;  2JPU A;  3JSE O;  1D0X A;  4Q5S F;  2HKV A;  1J8M F;  3KKB A;  4J32 B;  1Y4C A;  2R02 A;  3M4C A;  4MVM A;  4G78 A;  4KNV A;  4O6N A;  2R7R A;  4LDQ A;  4CBE A;  3LUT B;  5KYW A;  4LDR A;  4XTK A;  3ASO C;  1TKN A;  3ATP A;  4MVZ A;  1NFO A;  1ZW2 A;  2HSQ A;  4P6I C;  1YJG A;  5KYX B;  3UMH A;  3ZG1 A;  3DZA A;  1SYQ A;  1G8X A;  3B29 A;  2CDQ A;  3QMK A;  5HSW A;  1KTM A;  2P0N A;  3C8G B;  1QSP A;  4MVU A;  4CSA A;  3EG9 B;  3G4Z A;  3W8I A;  3L1M A;  4HE8 D;  1YLM A;  2PX0 A;  3H2V A;  3EHM A;  1MNE A;  4DBQ A;  5KYX A;  2J45 A;  3EPV A;  4FES A;  5B3I A;  2HV6 A;  5EGY A;  5DVW A;  1CPQ A;  3AGU A;  2JD3 A;  2GFH A;  3C8G A;  2OEX A;  3FHD A;  3HNJ A;  3AG4 C;  3K66 A;  2M64 A;  3TQO A;  2KGO A;  2PP4 A;  3HNI A;  2XL4 A;  4NTF A;  4JE9 A;  4NC3 A;  4I44 A;  2HZ8 A;  2PF4 E;  1D1A A;  1NZE A;  1XZQ A;  2LFF A;  3L34 A;  4O6M A;  3NMJ A;  4EBJ A;  4IWB A;  1VLS A;  2Q9C A;  2EPL X;  3US6 A;  2L6F A;  3V7O A;  3KYI A;  4PR9 A;  2O9X A;  1MND A;  4W8P A;  3SNH A;  3TOL A;  3V5X A;  4AE4 B;  2AVK A;  2PBE A;  3LLK A;  3WOD F;  4IAR A;  3N2Z B;  3S84 A;  4CIH A;  5DS5 A;  4AL1 A;  2AU5 A;  2J0X A;  4EBB A;  2HSB A;  2B0J A;  2Y3D A;  4LER A;  2YL7 A;  4M63 A;  1ZHT A;  3LS1 A;  5CIV A;  4JIO A;  4AE4 A;  1S05 A;  3K1I C;  4WGZ A;  4NCQ A;  2G3K A;  3RF3 A;  4XEK A;  4E0H A;  2PX3 A;  3GM1 A;  3K6B A;  4GYT A;  4W8K A;  3H65 A;  2WL8 A;  2YLI A;  4KI2 A;  4ZLD A;  3I5P A;  2OOC A;  5E3C A;  2OQM A;  4WJ0 A;  1VLT A;  3VF0 A;  3CAX A;  4YT4 A;  2E87 A;  2EIK C;  3HNL A;  5D91 A;  2OEV A;  1WOL A;  4BJ5 C;  1Q0M A;  1C02 A;  1VMA A;  4ONS A;  1CPR A;  1YZA A;  5E2Q A;  4D4N A;  3DI5 A;  3FOP A;  3EJN A;  5K0I A;  4DVZ A;  4LAC B;  3MX3 A;  3C8G D;  3RIP A;  3ITF A;  3ZWI A;  2R9R B;  1OW7 A;  1W2W A;  1ZYR F;  4NTB A;  2HFI A;  4MVO A;  3EQL F;  1OCR C;  3AQB A;  2YRF A;  3EFO B;  2VAS A;  4YK5 A;  2H8A A;  2L6H A;  1WAS A;  2HMQ A;  5JT4 A;  3PDM P;  1A0B A;  3EGX B;  1T01 A;  5E33 A;  1R5I D;  1KU2 A;  3JRM O;  1D1C A;  1NU9 C;  3ZIB A;  3S90 A;  1RMV A;  4BJ6 A;  4QI2 A;  1D1B A;  1ORJ A;  4L6R A;  5A6B A;  2CNW D;  1HE9 A;  3EFO A;  1I4Y A;  3ZDL A;  3QTH A;  3M4B A;  3RVZ A;  2FGY A;  5DLJ A;  1MMG A;  1GQA A;  3IHU A;  3M1C B;  4MND A;  3SXY A;  2YLG A;  2XL6 A;  1ZU4 A;  2EIN C;  2Y3H A;  4DRJ B;  3KPH A;  5L0I A;  1TFK B;  2MHR A;  2RD9 A;  4LLE A;  4E17 A;  1E2X A;  3U3F A;  1E85 A;  1VTM P;  3RKO F;  5DS6 A;  1HE1 A;  3LAY A;  5A6J A;  3EZH A;  4RD9 A;  2R05 A;  2BL2 A;  4JUR I;  3DMD A;  4O7G A;  1HW2 A;  5L3Q A;  3TK0 A;  4MW8 A;  1U0B B;  1E86 A;  1ZW3 A;  4BJT A;  1AEP A;  1BR2 A;  3JTL O;  1Z7Q c;  1TQG A;  3HLZ A;  2QTV A;  1EI7 A;  1HMO A;  2W4M A;  3OEO A;  1EKY A;  3DWW A;  1FFT C;  1SR2 A;  1T5O A;  2LD6 A;  3CQZ A;  1U89 A;  1J8Y F;  4AL0 A;  3EGD B;  4BEM J;  1O5H A;  5EHH A;  1D0Y A;  2QNL A;  4H4K C;  4MTF A;  3U9J A;  5HV9 A;  2XXA B;  2Y39 A;  3VRC A;  3QW0 A;  1WTY A;  4U9D A;  5L0F A;  3CSK A;  3MBG A;  4WGY A;  3V5Z A;  3T9O A;  1V4A A;  3W2W A;  1JPJ A;  1OCZ C;  1QPU A;  2HV7 A;  2LIG A;  4KC9 A;  5BQG A;  4AX2 A;  2R7X A;  4J7Y A;  3IQ5 A;  1NG1 A;  3ZSU A;  2IOQ A;  3EGD A;  2YQY A;  3G4X A;  3GM2 A;  4XLN F;  3RQF A;  3SXZ A;  2XLE A;  2P61 A;  1QZX A;  3KL4 A;  3R2P A;  4WAB A;  5L0D A;  2IYL D;  4U5C E;  3ZQY A;  5A6K A;  3EZI A;  3R7C A;  2YZS A;  4E0I A;  1FMW A;  4JRZ A;  5COM A;  3U8V A;  2J9B A;  3ASN C;  2J7P D;  3FOO A;  2BE5 F;  2ZD9 A;  3HKK A;  1K40 A;  1M56 C;  2KYH A;  3NRH A;  3O6X A;  3OWT A;  2YLD A;  3QVZ A;  4G0H A;  4HFK B;  4I1O B;  4KNW A;  5JLI A;  1B68 A;  2ICW G;  1TR2 A;  2XLW A;  2J9V A;  4BJ1 A;  2R03 A;  2ZPA A;  3ABK C;  3LEV A;  5L0J A;  3DE9 A;  3S9O A;  2BC5 A;  2OJE D;  2EPO A;  2P1A A;  3GAN A;  2ZXR A;  4Q7C A;  3TUL A;  2P7V A;  2YL1 A;  1CGM E;  2WVQ A;  1S7Z A;  3AQC A;  4RDA A;  1NBB A;  4IJJ A;  1NSG B;  2QLA A;  3L0I A;  2OU6 A;  4U5F E;  4YT2 A;  3ZQV A;  2J0W A;  5BQH A;  4XLP F;  3NMK A;  3HJC A;  3NYJ A;  4XEF A;  4YL1 A;  1TWC A;  2FAP B;  1H9T A;  2V26 A;  3HNK A;  1QLE C;  1K05 A;  1YA9 A;  3H2U A;  1IW7 F;  3POV A;  3AG1 C;  1APC A;  2LQG A;  1LE4 A;  4DRH B;  3LEO A;  5EK0 A;  3AOU A;  2ZXW C;  3DM9 B;  4MS2 A;  4CS8 A;  4JZA A;  3LS0 A;  1V55 C;  1LI7 A;  3RH3 A;  4IB4 A;  3DKA A;  1NU7 D;  3NKD A;  3K1I A;  5AC5 A;  2LP4 A;  3IPM O;  5GPG B;  4CIP A;  2OKU A;  2A0B A;  1M2V B;  1DOW A;  4ULW A;  3AG2 C;  1FNT c;  4OIQ F;  4IAQ A;  3UMI A;  3Q7L A;  4YWQ A;  1ZHZ A;  2VC9 A;  1JR8 A;  2W9Y A;  2OCC C;  5TJ5 E;  3ABL C;  3PHF 2;  2R7V A;  1Q0K A;  2F22 A;  1Z5Z A;  1QVX A;  2ZXO A;  3F47 A;  4CS8 C;  2ASR A;  4BJ5 A;  3LNM B;  3C62 A;  2NSF A;  1TWA A;  2MYS A;  5D92 A;  1T6Q A;  3RQG A;  2IBF A;  4I3M A;  1M2V A;  5DQZ A;  2A69 F;  3DAG A;  4JW1 A;  2QY9 A;  2Q4F A;  2HS5 A;  4QDL A;  4P9T A;  4YL3 A;  5BUO A;  4C3B A;  5T1D B;  256B A;  1GM5 A;  3UR3 C;  1T9K A;  2D4U A;  3Q6M A;  1I4Z A;  3GOR A;  2IXP A; 
#chains in the Genus database with same CATH homology
 3ECS A;  1BR1 A;  3B0V C;  5IY5 C;  4E7Z A;  1LS1 A;  3RFY A;  5DS4 A;  3GOD A;  4U5E E;  5CI8 A;  2EIL C;  2Y3B A;  2J9U A;  1ZHW A;  2IXN A;  4K0D A;  4C3E A;  2XSE A;  4LLC A;  3SZR A;  1VK5 A;  2Z15 A;  4J30 B;  3FVY A;  4RBN A;  4ANJ A;  2KW3 C;  4ZLC A;  4JCH A;  1FFH A;  4PJN A;  1ST6 A;  1PCX A;  2X51 A;  2DYR C;  4CS7 A;  3SEO A;  3W2V A;  3JCU Q;  4O79 A;  4U5G A;  2YEV A;  4XWJ A;  3UGP A;  3T6J A;  3RYL A;  4I1M A;  3E70 C;  3NKE A;  4IRU A;  2EIM C;  3S27 A;  5B1A C;  2MWQ A;  1OCC C;  1Z6A A;  3QZC A;  2EIJ C;  2OG2 A;  3JRT A;  5B1B C;  1ZHX A;  2NUT A;  1FMV A;  3K33 A;  3MLG A;  4B6I A;  2CGE A;  4F4B A;  3EHN A;  4CS9 A;  2WZF A;  1Z63 A;  3DXJ F;  3DM5 A;  3IEE A;  2PFD A;  4PFO A;  2WVN A;  4OIN F;  4AK9 A;  2KQ9 A;  1IZM A;  3NYM A;  4CS9 C;  3CZ6 A;  3K7D A;  2H7B A;  2WB7 A;  3O39 A;  1VOM A;  3N24 A;  4G7Z F;  4N06 A;  2ZXP A;  3DJN B;  3PMR A;  3JSZ A;  2VB6 A;  2CW0 F;  2D5R B;  4OD5 A;  1TWH A;  5T3W A;  4A2N B;  3DAF A;  3LNR A;  2A1D D;  5DQT A;  3B0U X;  2IXM A;  1D0Z A;  3LES A;  4NY3 A;  2G3V A;  3X1O A;  3E9V A;  4GEH A;  1MMN A;  2LSE A;  3SYN A;  2KJG A;  2C03 A;  1ZHY A;  3WG7 C;  2R7O A;  3ABM C;  5F5F A;  4IAO A;  3UGO A;  2Q3T A;  4DVY P;  3LLI A;  2KNH A;  4DOZ A;  1O87 A;  4Q4Z F;  1VYK A;  1RJ9 A;  4EWC A;  3NG1 A;  2FFH A;  3KMI A;  1SZI A;  2IXO A;  2YHS A;  4G7O F;  2R7W A;  3T4R A;  1BR4 A;  1PD0 A;  5KYU B;  2Y69 C;  4PJM A;  2W45 A;  3UNG C;  2I8B A;  3OA1 A;  1LKX A;  3Q7G A;  1M2O A;  2WZG A;  4PFP A;  3N0T A;  4JJF A;  2DYS C;  3EG9 A;  4JJG A;  5KYU A;  3T6B A;  4CSA C;  3B9Q A;  3JYH A;  3EH2 A;  4JVS A;  4E7S A;  2WZL A;  2L81 A;  2CNW A;  1Z23 A;  4BEJ A;  5E3A A;  2Y3G A;  4BG0 A;  4OIO F;  2R7Q A;  1VYI A;  2NG1 A;  3KH2 A;  2H7V C;  4PJJ A;  4YT5 A;  3EH1 A;  3S29 A;  4KBL A;  2G62 A;  1OKK A;  1MMA A;  2L9J A;  4U5D E;  3ZC4 A;  2V3C C;  2C04 A;  3FDQ A;  5KYY B;  3Q6N A;  3DD7 A;  2A68 F;  2A6E F;  1FTS A;  5L3V A;  4PJL A;  3F46 A;  2R7U A;  2NUT B;  2R7T A;  5KYY A;  3VYW A;  3K1H A;  4QI0 A;  3HTK C;  1Z3I X;  1TWG A;  2P6V A;  3I5Q A;  4G7H F;  1V54 C;  4K7B A;  3UMK A;  3EGX A;  3LJB A;  1OCO C;  3NYL A;  1ZU5 A;  1N1C A;  1MMD A;  3TD7 A;  1SMY F;  4HEA J;  4OD4 A;  2J7P A;  1OKK D;  2Q9B A;  4BJ6 C;  4FWV A;  5B3S C;  2W4B A;  1WGW A;  1LVK A;  3NDB B;  4FX5 A;  4OIR F;  2R7S A;  3W8H A;  3X2Q C;  5KYN A;  2NUP B;  3AG3 C;  4DBR A;  2A6H F;  2J9W A;  4U5H A;  2M4E A;  4O6Y A;  2H7O A;  4YT8 A;  3S0X A;  1JPN A;  5CI9 A;  3SP1 A;  4PK4 A;  2DGJ A;  3I4U A;  3S28 A;  2XRH A;  5FCL A;  2NUP A;  4YN0 B;  4MQ9 F;  2VH3 A;  1M57 C;  2WVO A;  4X0R A;  1SF8 A;  3ZVR A;  2XXA A;  5F5H A;  3FAJ A;  2Q9A A;  3B0P A;  2J46 A;  4OIP F;  5KYW B;  4C7O A;  4YJW A;  3DJU B;  4HFF B;  5T3T A;  3VAY A;  1PD1 A;  3JT1 A;  1RJ9 B;  1D0X A;  4Q5S F;  1J8M F;  3KKB A;  4J32 B;  2R7R A;  4KNV A;  4CBE A;  5KYW A;  4XTK A;  3ASO C;  1TKN A;  4P6I C;  5KYX B;  3UMH A;  3ZG1 A;  3DZA A;  1G8X A;  2CDQ A;  3QMK A;  5HSW A;  4CSA A;  3EG9 B;  3W8I A;  4HE8 D;  2PX0 A;  3EHM A;  1MNE A;  4DBQ A;  5KYX A;  2J45 A;  3EPV A;  4FES A;  2HV6 A;  5EGY A;  5DVW A;  2JD3 A;  2GFH A;  3FHD A;  3AG4 C;  3K66 A;  2KGO A;  2PP4 A;  2XL4 A;  4I44 A;  2PF4 E;  1D1A A;  1NZE A;  4O6M A;  3L34 A;  4IWB A;  2Q9C A;  3V7O A;  4AE4 B;  2O9X A;  1MND A;  3SNH A;  3LLK A;  3WOD F;  5DS5 A;  3N2Z B;  4CIH A;  2J0X A;  4EBB A;  2B0J A;  2Y3D A;  4LER A;  4M63 A;  1ZHT A;  3LS1 A;  4AE4 A;  3K1I C;  2G3K A;  2PX3 A;  3K6B A;  4GYT A;  4W8K A;  3H65 A;  2WL8 A;  4KI2 A;  4ZLD A;  3I5P A;  5E3C A;  4WJ0 A;  4YT4 A;  2E87 A;  2EIK C;  4BJ5 C;  5D91 A;  1VMA A;  5E2Q A;  3EJN A;  4DVZ A;  4LAC B;  3MX3 A;  3RIP A;  3ITF A;  1W2W A;  1ZYR F;  3EQL F;  1OCR C;  3AQB A;  3EFO B;  2VAS A;  3EGX B;  5E33 A;  1KU2 A;  1D1C A;  1NU9 C;  3ZIB A;  4BJ6 A;  4QI2 A;  1D1B A;  2CNW D;  3EFO A;  2FGY A;  5DLJ A;  1MMG A;  3M1C B;  4MND A;  1ZU4 A;  2EIN C;  2Y3H A;  4LLE A;  3RKO F;  3LAY A;  3EZH A;  4RD9 A;  4JUR I;  3DMD A;  4O7G A;  5L3Q A;  4BJT A;  1BR2 A;  3HLZ A;  2QTV A;  2W4M A;  3OEO A;  1FFT C;  3CQZ A;  1J8Y F;  3EGD B;  1O5H A;  5EHH A;  1D0Y A;  4H4K C;  2XXA B;  2Y39 A;  3CSK A;  4C3D A;  3W2W A;  4C7O B;  1JPJ A;  1OCZ C;  2HV7 A;  4KC9 A;  2R7X A;  4AX2 A;  1NG1 A;  3ZSU A;  2IOQ A;  3EGD A;  4XLN F;  5DS6 A;  1QZX A;  3KL4 A;  2IYL D;  4U5C E;  3EZI A;  2YZS A;  1FMW A;  3ASN C;  2J7P D;  4U5B E;  2BE5 F;  4O6N A;  3O6X A;  3NRH A;  1M56 C;  3OWT A;  4G0H A;  4KNW A;  4HFK B;  4I1O B;  1TR2 A;  2J9V A;  4BJ1 A;  2ZPA A;  3ABK C;  3LEV A;  3GAN A;  2ZXR A;  4Q7C A;  2P7V A;  2WVQ A;  1S7Z A;  3AQC A;  4RDA A;  4IJJ A;  4U5F E;  3L0I A;  4YT2 A;  4XLP F;  2J0W A;  3HJC A;  3NYJ A;  1TWC A;  2V26 A;  1QLE C;  1IW7 F;  3POV A;  3AG1 C;  2ZXW C;  3DM9 B;  4CS8 A;  4JZA A;  3LS0 A;  1V55 C;  3RH3 A;  1NU7 D;  3NKD A;  1M2V B;  4ULW A;  3AG2 C;  4OIQ F;  3UMI A;  4YWQ A;  3Q7L A;  1ZHZ A;  2W9Y A;  2OCC C;  3PHF 2;  3ABL C;  2R7V A;  1Z5Z A;  2ZXO A;  3F47 A;  4CS8 C;  4BJ5 A;  2MYS A;  1TWA A;  5D92 A;  4I3M A;  1M2V A;  5DQZ A;  2A69 F;  3DAG A;  4JW1 A;  2QY9 A;  4QDL A;  5BUO A;  4C3B A;  5T1D B;  3UR3 C;  3Q6M A;  2IXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...