2UUIA

Crystal structure of human leukotriene c4 synthase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
155
structure length
155
Chain Sequence
MHHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords LEUKOTRIENE C4 SYNTHASE
publication title Structural Basis for Synthesis of Inflammatory Mediators by Human Leukotriene C4 Synthase.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 155
sequence length 155
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2uuiA00
4NTFA 4YL1A 5K0IA 4BPMA 4NTAA 2UUHA 4J7TA 4JRZA 4YL3A 2PNOA 3DWWA 3PCVA 2Q7RA 5HV9A 3LEOA 4JC7A 4JCZA 3HKKA 4NTBA 4AL0A 3B29A 5BQIA 4YL0A 2H8AA 4J7YA 4AL1A 2UUIA 4WABA 4YK5A 5BQGA 5BQHA
chains in the Genus database with same CATH superfamily
2HV6A 4YL1A 2Y3GA 2XLEA 2DYSC 5A6BA 4CS7A 4E0HA 1JAFA 5A69A 1QKRA 2QE9A 5JUAA 1AUEA 2XM4A 4DXWA 3DJUB 4BJ5A 3K1IA 4OIPF 2ZXRA 3UGPA 2MHRA 1V54C 2J7PA 3S28A 3EGXA 1A7DA 2L9JA 4W8PA 4BEJA 3FOPA 4JZAA 1FFHA 3IHUA 3B29A 3ZTZA 3RQFA 3NKDA 3Q6MA 4YL0A 3LS1A 3SXKA 3CQZA 3GANA 4CS8C 4EHPA 1WGWA 4YWQA 1LS4A 2WB7A 3LEVA 2YL7A 4YK5A 1QLEC 5A6BD 2CDQA 4XQ1A 5BQHA 1Z6AA 1D1CA 3U3FA 2ICWG 3O39A 2QTVA 1OCZC 4PK4A 3C8GB 3H65A 4CJGA 4DRIB 4IRUA 3K7DA 3RVYA 4I3MA 3FDQA 2ZXOA 1OW7A 2HV7A 2R7WA 2J7PD 3EQLF 1GS9A 2G3KA 5EHHA 1H9GA 1MMDA 1VMAA 4N4WA 3IQTA 1Z7Qc 3T6BA 4CS8A 3ZC4A 2LD6A 4CS9C 3GM3A 1ZZPA 1HY5A 2NUPA 2PX0A 2ZD9A 3EG9A 5CI8A 1Z3IX 1M6TA 4F4BA 3V5ZA 3RFYA 4C7OA 2P7VA 4J32B 2J9WA 4JCHA 4E0IA 1RXQA 3UMHA 3DD7A 5DS4A 2DYRC 4K0DA 2OEXA 2J9UA 3K1HA 5KYXB 4MQ9F 3IQ6A 3IPMO 4U5BE 1G8XA 2R02A 2V3CC 3C63A 2MYSA 1J8MF 1R4TA 2A0UA 2KSFA 3VYWA 2NPUA 3SXZA 1PD1A 3EH1A 3UNGC 3JYHA 3WG7C 5KYYA 2R7UA 2G62A 1OCOC 2W4MA 4MVRA 1DOVA 1BZ4A 2XS8A 2EINC 2XLWA 3KH2A 4NY3A 2J0XA 2RD9A 4HEAJ 5F28E 2L7AA 1RKCA 2VCCA 3IQCA 4CJOA 1E86A 2LFFA 3LLIA 3JRMO 3ABKC 4JEBA 4JTCB 4CDVA 1D1BA 4C3EA 4EUKB 3QTHA 4YT5A 3S90A 4JE9A 5DQZA 2Y3DA 2V26A 3ABLC 2EIKC 3C7JA 2CGEA 3MLGA 1ZW2A 3C8ZA 5HSWA 2CNWA 1PCXA 1OQCA 3DJNB 4WABA 4DRHB 2YVKA 4E18A 3QVZA 4WGZA 4D4NA 2VASA 3EGXB 1CGME 2XLOA 2L6FA 2M64A 2Q4FA 3H2VA 4N6HA 5K0IA 4EBKA 3JT1A 3ZQYA 3GORA 2HMQA 1D1AA 2J8WA 2NSFA 1FFTC 4MS2A 3NYLA 4O6NA 1TFKB 4KC9A 1TR2A 4J7TA 2ZXPA 1VLSA 2WVQA 1ZVZA 2PNOA 3G50A 1YAUO 4LDKA 5E2QA 1VK5A 4PJMA 3V5XA 5BUOA 1OKKA 1YZCA 4CBEA 4L6RA 2Y3BA 5KYWA 4Z9JA 2Q7RA 2EPOA 1ZHYA 5T3TA 5AC5A 2CNWD 2XL8A 5FZTA 1PV3A 1ZHWA 2HKVA 5DVWA 3E9VA 3UMKA 1BR4A 2NUTA 3FAPB 3U8VA 1ORYA 3EZHA 1XZPA 3HJCA 4XLPF 1K40A 4Q7CA 4P6IC 2KW3C 2D4UA 3C62A 4PJLA 1ZU4A 2NUPB 2AVKA 5COFA 5L0HA 2EIMC 2B0HA 3ECSA 3FOOA 3I5QA 2P61A 2W9YA 1ZW3A 3DMDA 3U9MA 2H7OA 4JW1A 1S05A 1OKKD 1QZXA 5CI9A 2OOCA 2OU6A 3RQGA 3S29A 5A6JA 2HJ3A 3RIPA 3JZ0A 2JPUA 2W45A 1CPRA 1XZQA 2R05A 1JPJA 2ZXWC 1I5NA 1XWJA 2NG1A 3A11A 1Z63A 1NU9C 5KYYB 3C18A 3HKKA 4XWJA 2XLVA 1M2VA 4OD4A 3FVYA 2EIJC 2QUPA 5COMA 4JVSA 1YJGA 1EQ1A 4CSAC 4O6MA 3KKBA 1YYJA 2A1DD 2BE5F 3HTKC 3KYJA 2Q9BA 3US6A 1H9TA 4U9DA 3T9OA 1L7CA 1Q0FA 2CYDA 2IOQA 4ONSA 1SYQA 2GFHA 2R03A 2YRFA 4GEHA 5B3IA 1E83A 1HW1A 1I4ZA 1T6QA 2KNHA 4FX5A 4HE8D 4C3BA 4E7ZA 1HW2A 2RSEB 4PR9A 2DI3A 3U2LA 4JRZA 4KNVA 4XPWA 3B0UX 3DAGA 2LP4A 4JJGA 4Q5SF 3HNIA 4U5CE 3SEOA 4XPXA 2XXAA 4EWCA 3ZWIA 4EBBA 5L0GA 4U5HA 3FXHA 5B3SC 1A7EA 1T01A 4IAQA 1VYKA 3T6GB 4I44A 5KYUA 2LFDA 3LESA 2VC9A 1NG1A 1SF8A 1S7ZA 4B6IA 3SNHA 1RJ9A 3ZTMA 1LI5A 2LK4A 3AGUA 3T6JA 2YLGA 1SZIA 3G4XA 2XRHA 4X0RA 5KYWB 3CSKA 5GPGB 3H2UA 4BJ6C 3LNRA 1E84A 2I15A 1OW6A 4CIPA 2A69F 3GWLA 1WATA 1YLMA 1ZYRF 1LVKA 4CDAA 3AG4C 1WWPA 4CX9A 2NUTB 3Q7GA 1BR2A 1KNYA 4PFPA 3MBGA 5T3WA 3OWTA 3SYNA 3QW0A 2L6HA 3FMSA 1D0ZA 3R2PA 4H54A 4Z9IA 3UMIA 3POVA 2KC3A 4NTBA 2GDCA 4YN0B 3AG2C 1JRAA 4BJ6A 3DE8A 1LPEA 3O10A 1NSGB 2J9VA 2HSQA 4MTOA 4AL1A 3L8JA 3ZSUA 2HJMA 2PBEA 4CIHA 2D5RB 1T9KA 1WTYA 2HFIA 4CS9A 2J0WA 2KYHA 2J46A 3QVYA 3WAQA 3ZQVA 2TMVP 2FAPB 3K6BA 5JS5A 2BL2A 2IBFA 3U3BA 4BJTA 4XEFA 5E3CA 1Q0KA 2R7QA 1A41A 3AGTA 3FAJA 4MVMA 1GGQA 5D91A 2J9BA 3EZIA 5L0IA 3FHDA 2R7TA 1M2VB 1Q0MA 3A9CA 1K05A 2R25A 1UFBA 4FAPB 1FNTc 1TWHA 1EI7A 3M79A 1YA7O 2OG2A 2KQ9A 2QY9A 4JC7A 4OD5A 4MVZA 1YZAA 2IYLD 3LLKA 1V4AA 2R9RB 1DOWA 4NQFA 2LQGA 2YL3A 2EPMX 3PHF2 5E33A 2UUIA 1G5ZA 2Q9CA 3LJBA 4YJWA 5L3VA 3AJMA 2VCBA 3K66A 2R7XA 4BEMJ 4IGGA 4U9EA 1YA9A 1QPUA 1OR2A 5DS6A 4DOZA 2F22A 3CZ6A 1D0YA 1JR8A 3AQBA 2XXAB 3DE9A 4D4XA 3UR3C 3NDBB 1NFOA 2UUHA 3KL4A 3VM6A 4KI2A 3CAXA 4ER9A 1LE4A 1FMWA 2EPNA 3L8IA 3M15A 4G78A 5KYUB 1HE9A 3G4ZA 1M57C 2DGJA 2X0CA 2KGOA 4PFOA 1RJ9B 2YZSA 3ZVRA 4NCQA 1TFOB 1H6GA 1HE1A 2G3VA 2XL6A 3F47A 3MYFA 5IY5C 4RDAA 2EPKX 3L0IA 4EBJA 1JOGA 3B0VC 3ZIBA 2E87A 5COGA 1YVIA 2R7OA 1U89A 3N0TA 2H7VC 4LERA 3W2VA 4AE4A 3UGOA 3SXMA 3QW1A 3HLZA 5JLIA 1IW7F 3RH3A 1VTMP 3NYJA 1FMVA 2HS5A 1Y4CA 1WOLA 4PJJA 4MVSA 4FESA 5DLJA 1W2WA 1N1CA 3GODA 4MTFA 1YDIA 1YYXA 1O3UA 1VLTA 1OXKA 2C04A 3DXJF 3IQ5A 4BJ1A 1I4YA 4DVYP 3F46A 3PCVA 4MVQA 3SZRA 2IM8A 1OXBA 5B1BC 3GEIA 4JJFA 3DI5A 4IARA 3VRCA 5BQIA 5FCLA 2Y69C 5JSLA 3JRTA 3JYYA 4N06A 1QSPA 2HSBA 3ZG1A 1L3PA 4DBQA 3LNMB 4WJ0A 2X51A 3EFOB 4U5EE 2A0BA 3TJ6A 1APCA 3VAYA 4H4KC 5JVEA 4QI0A 1D0XA 4LDRA 1C02A 4GQHA 1NLXA 3BEHA 4BPMA 4NTAA 5L0DA 3N24A 3OEOA 5DS5A 1M2OA 2H7BA 3AG1C 3Q7LA 1EKYA 1U6HA 3CEXA 2YWAA 4XEVA 1Z23A 4MVUA 4E17A 1QVXA 4OIRF 4YL3A 3DAFA 3EGDA 3LUTB 4PJNA 4CSAA 4YT2A 4JIOA 1NU7D 2KJGA 2NSGA 3QMKA 2CCYA 3EHNA 2OEVA 3W8IA 3W8HA 4UDVA 1FAPB 5KYNA 2GA0A 2Q3TA 3L1MA 1ST6A 3EJNA 2ETSA 1YARO 2OCCC 3EPVA 2XLHA 3O55A 4M63A 4OIOF 1M56C 1TQGA 1TWGA 2H8AA 4G7OF 1LKXA 2EPLX 2XL4A 1BBHA 1KTMA 1G4WR 3DKAA 2L6GA 3MYIA 4O79A 5F5FA 2P0NA 4ULVA 3JSZA 2IXPA 3TOMA 3DM9B 1C03A 1A0BA 2M4EA 2WVOA 4O6YA 2R7SA 1E2XA 3S84A 2R7RA 3TD7A 4E7SA 2ASRA 4ANJA 4ZLDA 3GM2A 3K33A 2WZLA 2Z15A 3RVZA 3ASOC 3IEEA 1R5ID 3NMJA 3HNLA 1Q0DA 3SP1A 4C3DA 4MW3A 3AQCA 4XPYA 3U9JA 2PP4A 3NMKA 3ATPA 5TJ5E 4IJJA 2CW0F 4LDQA 3S27A 4OIQF 4LLCA 1OR3A 2LIGA 4LACB 1NBBA 2AP3A 1NZEA 3MFNA 5T1DB 3N2ZB 4OINF 4XLNF 1V74B 4AE4B 1JMWA 1V55C 1TWCA 3E70C 4AK9A 5L0JA 1HMOA 2YL0A 2AWCA 2Y39A 1TWAA 3J06A 3NRHA 1RKEA 2OKUA 2C03A 4NC3A 1F1MA 2XLMA 1JPNA 1ORSC 1OCCC 2XM0A 2QNLA 1O5HA 3OA1A 3VF0A 2Q00A 1Y6DA 4I1MA 1T5OA 4U5FE 4P9TA 1PD0A 1SMYF 2XLDA 5D92A 2KK1A 4BG0A 1AVOB 3WODF 2YQYA 4MNDA 2A68F 3X1OA 3WHNA 2GAQA 2XS1A 4HFFB 3SXYA 1WASA 3EFOA 4G7HF 3ABMC 3L34A 2B0JA 2FFHA 4IB4A 3HNJA 4ZLCA 1B68A 1Z5ZA 3M4BA 4GYTA 4HFKB 2VB6A 3NG1A 1FR0A 1T6IA 2PF4E 1U0BB 2Y3HA 2WL8A 4O7GA 4A4AA 1A7VA 2OJQA 4AL0A 5EGYA 3W4YA 1MMGA 2HUJA 3KPHA 2A6EF 3V5YA 1GM5A 2YKZA 2QLAA 1MMNA 1GQAA 1LM3B 3BRJA 1VOMA 3B0PA 3TJ5A 2PX3A 3KMIA 3I4UA 4IWBA 3AOUA 3EGDB 3LAYA 3TULA 4YT4A 3Q6NA 3TQOA 3U8PA 5L0FA 3TK0A 1LS1A 2YLDA 1RCPA 2HMZA 1LI7A 3R7CA 3HNKA 3B71A 2IXMA 1QQ3A 4JURI 3GM1A 3RYLA 4JKVA 4G7ZF 2LCHA 1C17M 3KYIA 3U5SA 4RBNA 2PFDA 3X2QC 5A6KA 1LE2A 2P6VA 1J8YF 1BDJB 4U5DE 1MNEA 1VB5A 1VYIA 4JCZA 3RF3A 2WZFA 5AC4A 1ZHXA 2J45A 4J30B 4Z9HA 4J7YA 3ZDLA 1MQVA 1ZHZA 2BC5A 2AU5A 1SR2A 1LIHA 1EA8A 5EK0A 4R32A 5BQGA 3LS0A 4Q4ZF 2HZ8A 2Q9AA 1FTSA 2IXOA 3JCUQ 5L3QA 1Q0GA 1OCRC 1BR1A 2W4BA 4U5GA 3EH2A 3ITFA 2IXNA 4KBLA 4XTKA 4DJ9A 3I5PA 5JT4A 2I8BA 5B1AC 1KU2A 1OW8A 2A6HF 2YHSA 1ZHTA 3EHMA 2VH3A 4N6CA 3PDMP 1RMVA 3DZAA 3O6XA 256BA 1ZU5A 4IAOA 5JP7A 3RKOF 1CPQA 2WZGA 3V7OA 2JX0A 3DM5A 4K1OA 1RKEB 5AGFA 3DWWA 3C8GA 3U0CA 1CGOA 3B9QA 2GWWA 3W2WA 2YEVA 2VCAA 1WN0A 3LEOA 4KNWA 1IZMA 3RW0A 4MW8A 4MVOA 1K04A 3U2MA 4DRJB 2O9XA 3AG3C 3M1CB 4FWVA 4JTAB 4DBRA 3T4RA 5CIVA 4W8KA 3QZCA 1E85A 3S0XA 4K7BA 5F5HA 3GEHA 4YT8A 2P1AA 3EG9B 4EKWA 1O87A 5DQTA 4NTFA 4C7OB 3NKEA 5KYXA 2MWQA 1HMDA 5E3AA 2YL1A 4CDYA 4P9FA 1G4US 3NYMA 1MNDA 2L81A 3C8GD 1ORJA 4JTDB 5A6AA 3ASNC 4LLEA 2WVNA 2XSEA 1TKNA 4MTGA 2OQMA 4JEAA 3M4CA 2LSEA 4PACA 3GWNA 4RD9A 2FGYA 4XEKA 4A2NB 1CGNA 4QDLA 4G0HA 2EILC 1UG7A 5HV9A 2AWYA 3PMRA 4QI2A 3S9OA 4WGYA 4I1OB 4AX2A 1AEPA 3GEEA 4BJ5C 1NFNA 3K1IC 2R7VA 2DB4A 4DVZA 4EIYA 4ULWA 3JTLO 3MX3A 3NMIA 3JSEO 2JD3A 2OJED 5JRAA 1MMAA 3TOLA 5L0CA 1T6UA 1H7IA 3RQEA 2ZPAA 2YLIA
chains in the Genus database with same CATH topology
4NTFA 4YL1A 5K0IA 4BPMA 4NTAA 2UUHA 4J7TA 4JRZA 4YL3A 2PNOA 3DWWA 3PCVA 2Q7RA 5HV9A 3LEOA 4JC7A 4JCZA 3HKKA 4NTBA 4AL0A 3B29A 5BQIA 4YL0A 2H8AA 4J7YA 4AL1A 2UUIA 4WABA 4YK5A 5BQGA 5BQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTF A;  4YL1 A;  5K0I A;  4BPM A;  4NTA A;  2UUH A;  4J7T A;  4JRZ A;  4YL3 A;  2PNO A;  3DWW A;  3PCV A;  2Q7R A;  5HV9 A;  3LEO A;  4JC7 A;  4JCZ A;  3HKK A;  4NTB A;  4AL0 A;  3B29 A;  5BQI A;  4YL0 A;  2H8A A;  4J7Y A;  4AL1 A;  2UUI A;  4WAB A;  4YK5 A;  5BQG A;  5BQH A; 
#chains in the Genus database with same CATH topology
 2HV6 A;  4YL1 A;  2Y3G A;  2XLE A;  2DYS C;  5A6B A;  4CS7 A;  4E0H A;  1JAF A;  5A69 A;  1QKR A;  2QE9 A;  5JUA A;  1AUE A;  2XM4 A;  4DXW A;  3DJU B;  4BJ5 A;  3K1I A;  4OIP F;  2ZXR A;  3UGP A;  2MHR A;  1V54 C;  2J7P A;  3S28 A;  3EGX A;  1A7D A;  2L9J A;  4W8P A;  4BEJ A;  3FOP A;  4JZA A;  1FFH A;  3IHU A;  3B29 A;  3ZTZ A;  3RQF A;  3NKD A;  3Q6M A;  4YL0 A;  3LS1 A;  3SXK A;  3CQZ A;  3GAN A;  4CS8 C;  4EHP A;  1WGW A;  4YWQ A;  1LS4 A;  2WB7 A;  3LEV A;  2YL7 A;  4YK5 A;  1QLE C;  5A6B D;  2CDQ A;  4XQ1 A;  5BQH A;  1Z6A A;  1D1C A;  3U3F A;  2ICW G;  3O39 A;  2QTV A;  1OCZ C;  4PK4 A;  3C8G B;  3H65 A;  4CJG A;  4DRI B;  4IRU A;  3K7D A;  3RVY A;  4I3M A;  3FDQ A;  2ZXO A;  1OW7 A;  2HV7 A;  2R7W A;  2J7P D;  3EQL F;  1GS9 A;  2G3K A;  5EHH A;  1H9G A;  1MMD A;  1VMA A;  4N4W A;  3IQT A;  1Z7Q c;  3T6B A;  4CS8 A;  3ZC4 A;  2LD6 A;  4CS9 C;  3GM3 A;  1ZZP A;  1HY5 A;  2NUP A;  2PX0 A;  2ZD9 A;  3EG9 A;  5CI8 A;  1Z3I X;  1M6T A;  4F4B A;  3V5Z A;  3RFY A;  4C7O A;  2P7V A;  4J32 B;  2J9W A;  4JCH A;  4E0I A;  1RXQ A;  3UMH A;  3DD7 A;  5DS4 A;  2DYR C;  4K0D A;  2OEX A;  2J9U A;  3K1H A;  5KYX B;  4MQ9 F;  3IQ6 A;  3IPM O;  4U5B E;  1G8X A;  2R02 A;  2V3C C;  3C63 A;  2MYS A;  1J8M F;  1R4T A;  2A0U A;  2KSF A;  3VYW A;  2NPU A;  3SXZ A;  1PD1 A;  3EH1 A;  3UNG C;  3JYH A;  3WG7 C;  5KYY A;  2R7U A;  2G62 A;  1OCO C;  2W4M A;  4MVR A;  1DOV A;  1BZ4 A;  2XS8 A;  2EIN C;  2XLW A;  3KH2 A;  4NY3 A;  2J0X A;  2RD9 A;  4HEA J;  5F28 E;  2L7A A;  1RKC A;  2VCC A;  3IQC A;  4CJO A;  1E86 A;  2LFF A;  3LLI A;  3JRM O;  3ABK C;  4JEB A;  4JTC B;  4CDV A;  1D1B A;  4C3E A;  4EUK B;  3QTH A;  4YT5 A;  3S90 A;  4JE9 A;  5DQZ A;  2Y3D A;  2V26 A;  3ABL C;  2EIK C;  3C7J A;  2CGE A;  3MLG A;  1ZW2 A;  3C8Z A;  5HSW A;  2CNW A;  1PCX A;  1OQC A;  3DJN B;  4WAB A;  4DRH B;  2YVK A;  4E18 A;  3QVZ A;  4WGZ A;  4D4N A;  2VAS A;  3EGX B;  1CGM E;  2XLO A;  2L6F A;  2M64 A;  2Q4F A;  3H2V A;  4N6H A;  5K0I A;  4EBK A;  3JT1 A;  3ZQY A;  3GOR A;  2HMQ A;  1D1A A;  2J8W A;  2NSF A;  1FFT C;  4MS2 A;  3NYL A;  4O6N A;  1TFK B;  4KC9 A;  1TR2 A;  4J7T A;  2ZXP A;  1VLS A;  2WVQ A;  1ZVZ A;  2PNO A;  3G50 A;  1YAU O;  4LDK A;  5E2Q A;  1VK5 A;  4PJM A;  3V5X A;  5BUO A;  1OKK A;  1YZC A;  4CBE A;  4L6R A;  2Y3B A;  5KYW A;  4Z9J A;  2Q7R A;  2EPO A;  1ZHY A;  5T3T A;  5AC5 A;  2CNW D;  2XL8 A;  5FZT A;  1PV3 A;  1ZHW A;  2HKV A;  5DVW A;  3E9V A;  3UMK A;  1BR4 A;  2NUT A;  3FAP B;  3U8V A;  1ORY A;  3EZH A;  1XZP A;  3HJC A;  4XLP F;  1K40 A;  4Q7C A;  4P6I C;  2KW3 C;  2D4U A;  3C62 A;  4PJL A;  1ZU4 A;  2NUP B;  2AVK A;  5COF A;  5L0H A;  2EIM C;  2B0H A;  3ECS A;  3FOO A;  3I5Q A;  2P61 A;  2W9Y A;  1ZW3 A;  3DMD A;  3U9M A;  2H7O A;  4JW1 A;  1S05 A;  1OKK D;  1QZX A;  5CI9 A;  2OOC A;  2OU6 A;  3RQG A;  3S29 A;  5A6J A;  2HJ3 A;  3RIP A;  3JZ0 A;  2JPU A;  2W45 A;  1CPR A;  1XZQ A;  2R05 A;  1JPJ A;  2ZXW C;  1I5N A;  1XWJ A;  2NG1 A;  3A11 A;  1Z63 A;  1NU9 C;  5KYY B;  3C18 A;  3HKK A;  4XWJ A;  2XLV A;  1M2V A;  4OD4 A;  3FVY A;  2EIJ C;  2QUP A;  5COM A;  4JVS A;  1YJG A;  1EQ1 A;  4CSA C;  4O6M A;  3KKB A;  1YYJ A;  2A1D D;  2BE5 F;  3HTK C;  3KYJ A;  2Q9B A;  3US6 A;  1H9T A;  4U9D A;  3T9O A;  1L7C A;  1Q0F A;  2CYD A;  2IOQ A;  4ONS A;  1SYQ A;  2GFH A;  2R03 A;  2YRF A;  4GEH A;  5B3I A;  1E83 A;  1HW1 A;  1I4Z A;  1T6Q A;  2KNH A;  4FX5 A;  4HE8 D;  4C3B A;  4E7Z A;  1HW2 A;  2RSE B;  4PR9 A;  2DI3 A;  3U2L A;  4JRZ A;  4KNV A;  4XPW A;  3B0U X;  3DAG A;  2LP4 A;  4JJG A;  4Q5S F;  3HNI A;  4U5C E;  3SEO A;  4XPX A;  2XXA A;  4EWC A;  3ZWI A;  4EBB A;  5L0G A;  4U5H A;  3FXH A;  5B3S C;  1A7E A;  1T01 A;  4IAQ A;  1VYK A;  3T6G B;  4I44 A;  5KYU A;  2LFD A;  3LES A;  2VC9 A;  1NG1 A;  1SF8 A;  1S7Z A;  4B6I A;  3SNH A;  1RJ9 A;  3ZTM A;  1LI5 A;  2LK4 A;  3AGU A;  3T6J A;  2YLG A;  1SZI A;  3G4X A;  2XRH A;  4X0R A;  5KYW B;  3CSK A;  5GPG B;  3H2U A;  4BJ6 C;  3LNR A;  1E84 A;  2I15 A;  1OW6 A;  4CIP A;  2A69 F;  3GWL A;  1WAT A;  1YLM A;  1ZYR F;  1LVK A;  4CDA A;  3AG4 C;  1WWP A;  4CX9 A;  2NUT B;  3Q7G A;  1BR2 A;  1KNY A;  4PFP A;  3MBG A;  5T3W A;  3OWT A;  3SYN A;  3QW0 A;  2L6H A;  3FMS A;  1D0Z A;  3R2P A;  4H54 A;  4Z9I A;  3UMI A;  3POV A;  2KC3 A;  4NTB A;  2GDC A;  4YN0 B;  3AG2 C;  1JRA A;  4BJ6 A;  3DE8 A;  1LPE A;  3O10 A;  1NSG B;  2J9V A;  2HSQ A;  4MTO A;  4AL1 A;  3L8J A;  3ZSU A;  2HJM A;  2PBE A;  4CIH A;  2D5R B;  1T9K A;  1WTY A;  2HFI A;  4CS9 A;  2J0W A;  2KYH A;  2J46 A;  3QVY A;  3WAQ A;  3ZQV A;  2TMV P;  2FAP B;  3K6B A;  5JS5 A;  2BL2 A;  2IBF A;  3U3B A;  4BJT A;  4XEF A;  5E3C A;  1Q0K A;  2R7Q A;  1A41 A;  3AGT A;  3FAJ A;  4MVM A;  1GGQ A;  5D91 A;  2J9B A;  3EZI A;  5L0I A;  3FHD A;  2R7T A;  1M2V B;  1Q0M A;  3A9C A;  1K05 A;  2R25 A;  1UFB A;  4FAP B;  1FNT c;  1TWH A;  1EI7 A;  3M79 A;  1YA7 O;  2OG2 A;  2KQ9 A;  2QY9 A;  4JC7 A;  4OD5 A;  4MVZ A;  1YZA A;  2IYL D;  3LLK A;  1V4A A;  2R9R B;  1DOW A;  4NQF A;  2LQG A;  2YL3 A;  2EPM X;  3PHF 2;  5E33 A;  2UUI A;  1G5Z A;  2Q9C A;  3LJB A;  4YJW A;  5L3V A;  3AJM A;  2VCB A;  3K66 A;  2R7X A;  4BEM J;  4IGG A;  4U9E A;  1YA9 A;  1QPU A;  1OR2 A;  5DS6 A;  4DOZ A;  2F22 A;  3CZ6 A;  1D0Y A;  1JR8 A;  3AQB A;  2XXA B;  3DE9 A;  4D4X A;  3UR3 C;  3NDB B;  1NFO A;  2UUH A;  3KL4 A;  3VM6 A;  4KI2 A;  3CAX A;  4ER9 A;  1LE4 A;  1FMW A;  2EPN A;  3L8I A;  3M15 A;  4G78 A;  5KYU B;  1HE9 A;  3G4Z A;  1M57 C;  2DGJ A;  2X0C A;  2KGO A;  4PFO A;  1RJ9 B;  2YZS A;  3ZVR A;  4NCQ A;  1TFO B;  1H6G A;  1HE1 A;  2G3V A;  2XL6 A;  3F47 A;  3MYF A;  5IY5 C;  4RDA A;  2EPK X;  3L0I A;  4EBJ A;  1JOG A;  3B0V C;  3ZIB A;  2E87 A;  5COG A;  1YVI A;  2R7O A;  1U89 A;  3N0T A;  2H7V C;  4LER A;  3W2V A;  4AE4 A;  3UGO A;  3SXM A;  3QW1 A;  3HLZ A;  5JLI A;  1IW7 F;  3RH3 A;  1VTM P;  3NYJ A;  1FMV A;  2HS5 A;  1Y4C A;  1WOL A;  4PJJ A;  4MVS A;  4FES A;  5DLJ A;  1W2W A;  1N1C A;  3GOD A;  4MTF A;  1YDI A;  1YYX A;  1O3U A;  1VLT A;  1OXK A;  2C04 A;  3DXJ F;  3IQ5 A;  4BJ1 A;  1I4Y A;  4DVY P;  3F46 A;  3PCV A;  4MVQ A;  3SZR A;  2IM8 A;  1OXB A;  5B1B C;  3GEI A;  4JJF A;  3DI5 A;  4IAR A;  3VRC A;  5BQI A;  5FCL A;  2Y69 C;  5JSL A;  3JRT A;  3JYY A;  4N06 A;  1QSP A;  2HSB A;  3ZG1 A;  1L3P A;  4DBQ A;  3LNM B;  4WJ0 A;  2X51 A;  3EFO B;  4U5E E;  2A0B A;  3TJ6 A;  1APC A;  3VAY A;  4H4K C;  5JVE A;  4QI0 A;  1D0X A;  4LDR A;  1C02 A;  4GQH A;  1NLX A;  3BEH A;  4BPM A;  4NTA A;  5L0D A;  3N24 A;  3OEO A;  5DS5 A;  1M2O A;  2H7B A;  3AG1 C;  3Q7L A;  1EKY A;  1U6H A;  3CEX A;  2YWA A;  4XEV A;  1Z23 A;  4MVU A;  4E17 A;  1QVX A;  4OIR F;  4YL3 A;  3DAF A;  3EGD A;  3LUT B;  4PJN A;  4CSA A;  4YT2 A;  4JIO A;  1NU7 D;  2KJG A;  2NSG A;  3QMK A;  2CCY A;  3EHN A;  2OEV A;  3W8I A;  3W8H A;  4UDV A;  1FAP B;  5KYN A;  2GA0 A;  2Q3T A;  3L1M A;  1ST6 A;  3EJN A;  2ETS A;  1YAR O;  2OCC C;  3EPV A;  2XLH A;  3O55 A;  4M63 A;  4OIO F;  1M56 C;  1TQG A;  1TWG A;  2H8A A;  4G7O F;  1LKX A;  2EPL X;  2XL4 A;  1BBH A;  1KTM A;  1G4W R;  3DKA A;  2L6G A;  3MYI A;  4O79 A;  5F5F A;  2P0N A;  4ULV A;  3JSZ A;  2IXP A;  3TOM A;  3DM9 B;  1C03 A;  1A0B A;  2M4E A;  2WVO A;  4O6Y A;  2R7S A;  1E2X A;  3S84 A;  2R7R A;  3TD7 A;  4E7S A;  2ASR A;  4ANJ A;  4ZLD A;  3GM2 A;  3K33 A;  2WZL A;  2Z15 A;  3RVZ A;  3ASO C;  3IEE A;  1R5I D;  3NMJ A;  3HNL A;  1Q0D A;  3SP1 A;  4C3D A;  4MW3 A;  3AQC A;  4XPY A;  3U9J A;  2PP4 A;  3NMK A;  3ATP A;  5TJ5 E;  4IJJ A;  2CW0 F;  4LDQ A;  3S27 A;  4OIQ F;  4LLC A;  1OR3 A;  2LIG A;  4LAC B;  1NBB A;  2AP3 A;  1NZE A;  3MFN A;  5T1D B;  3N2Z B;  4OIN F;  4XLN F;  1V74 B;  4AE4 B;  1JMW A;  1V55 C;  1TWC A;  3E70 C;  4AK9 A;  5L0J A;  1HMO A;  2YL0 A;  2AWC A;  2Y39 A;  1TWA A;  3J06 A;  3NRH A;  1RKE A;  2OKU A;  2C03 A;  4NC3 A;  1F1M A;  2XLM A;  1JPN A;  1ORS C;  1OCC C;  2XM0 A;  2QNL A;  1O5H A;  3OA1 A;  3VF0 A;  2Q00 A;  1Y6D A;  4I1M A;  1T5O A;  4U5F E;  4P9T A;  1PD0 A;  1SMY F;  2XLD A;  5D92 A;  2KK1 A;  4BG0 A;  1AVO B;  3WOD F;  2YQY A;  4MND A;  2A68 F;  3X1O A;  3WHN A;  2GAQ A;  2XS1 A;  4HFF B;  3SXY A;  1WAS A;  3EFO A;  4G7H F;  3ABM C;  3L34 A;  2B0J A;  2FFH A;  4IB4 A;  3HNJ A;  4ZLC A;  1B68 A;  1Z5Z A;  3M4B A;  4GYT A;  4HFK B;  2VB6 A;  3NG1 A;  1FR0 A;  1T6I A;  2PF4 E;  1U0B B;  2Y3H A;  2WL8 A;  4O7G A;  4A4A A;  1A7V A;  2OJQ A;  4AL0 A;  5EGY A;  3W4Y A;  1MMG A;  2HUJ A;  3KPH A;  2A6E F;  3V5Y A;  1GM5 A;  2YKZ A;  2QLA A;  1MMN A;  1GQA A;  1LM3 B;  3BRJ A;  1VOM A;  3B0P A;  3TJ5 A;  2PX3 A;  3KMI A;  3I4U A;  4IWB A;  3AOU A;  3EGD B;  3LAY A;  3TUL A;  4YT4 A;  3Q6N A;  3TQO A;  3U8P A;  5L0F A;  3TK0 A;  1LS1 A;  2YLD A;  1RCP A;  2HMZ A;  1LI7 A;  3R7C A;  3HNK A;  3B71 A;  2IXM A;  1QQ3 A;  4JUR I;  3GM1 A;  3RYL A;  4JKV A;  4G7Z F;  2LCH A;  1C17 M;  3KYI A;  3U5S A;  4RBN A;  2PFD A;  3X2Q C;  5A6K A;  1LE2 A;  2P6V A;  1J8Y F;  1BDJ B;  4U5D E;  1MNE A;  1VB5 A;  1VYI A;  4JCZ A;  3RF3 A;  2WZF A;  5AC4 A;  1ZHX A;  2J45 A;  4J30 B;  4Z9H A;  4J7Y A;  3ZDL A;  1MQV A;  1ZHZ A;  2BC5 A;  2AU5 A;  1SR2 A;  1LIH A;  1EA8 A;  5EK0 A;  4R32 A;  5BQG A;  3LS0 A;  4Q4Z F;  2HZ8 A;  2Q9A A;  1FTS A;  2IXO A;  3JCU Q;  5L3Q A;  1Q0G A;  1OCR C;  1BR1 A;  2W4B A;  4U5G A;  3EH2 A;  3ITF A;  2IXN A;  4KBL A;  4XTK A;  4DJ9 A;  3I5P A;  5JT4 A;  2I8B A;  5B1A C;  1KU2 A;  1OW8 A;  2A6H F;  2YHS A;  1ZHT A;  3EHM A;  2VH3 A;  4N6C A;  3PDM P;  1RMV A;  3DZA A;  3O6X A;  256B A;  1ZU5 A;  4IAO A;  5JP7 A;  3RKO F;  1CPQ A;  2WZG A;  3V7O A;  2JX0 A;  3DM5 A;  4K1O A;  1RKE B;  5AGF A;  3DWW A;  3C8G A;  3U0C A;  1CGO A;  3B9Q A;  2GWW A;  3W2W A;  2YEV A;  2VCA A;  1WN0 A;  3LEO A;  4KNW A;  1IZM A;  3RW0 A;  4MW8 A;  4MVO A;  1K04 A;  3U2M A;  4DRJ B;  2O9X A;  3AG3 C;  3M1C B;  4FWV A;  4JTA B;  4DBR A;  3T4R A;  5CIV A;  4W8K A;  3QZC A;  1E85 A;  3S0X A;  4K7B A;  5F5H A;  3GEH A;  4YT8 A;  2P1A A;  3EG9 B;  4EKW A;  1O87 A;  5DQT A;  4NTF A;  4C7O B;  3NKE A;  5KYX A;  2MWQ A;  1HMD A;  5E3A A;  2YL1 A;  4CDY A;  4P9F A;  1G4U S;  3NYM A;  1MND A;  2L81 A;  3C8G D;  1ORJ A;  4JTD B;  5A6A A;  3ASN C;  4LLE A;  2WVN A;  2XSE A;  1TKN A;  4MTG A;  2OQM A;  4JEA A;  3M4C A;  2LSE A;  4PAC A;  3GWN A;  4RD9 A;  2FGY A;  4XEK A;  4A2N B;  1CGN A;  4QDL A;  4G0H A;  2EIL C;  1UG7 A;  5HV9 A;  2AWY A;  3PMR A;  4QI2 A;  3S9O A;  4WGY A;  4I1O B;  4AX2 A;  1AEP A;  3GEE A;  4BJ5 C;  1NFN A;  3K1I C;  2R7V A;  2DB4 A;  4DVZ A;  4EIY A;  4ULW A;  3JTL O;  3MX3 A;  3NMI A;  3JSE O;  2JD3 A;  2OJE D;  5JRA A;  1MMA A;  3TOL A;  5L0C A;  1T6U A;  1H7I A;  3RQE A;  2ZPA A;  2YLI A; 
#chains in the Genus database with same CATH homology
 4NTF A;  4YL1 A;  5K0I A;  4BPM A;  4NTA A;  2UUH A;  4J7T A;  4JRZ A;  4YL3 A;  2PNO A;  3DWW A;  3PCV A;  2Q7R A;  5HV9 A;  3LEO A;  4JC7 A;  4JCZ A;  3HKK A;  4NTB A;  4AL0 A;  3B29 A;  5BQI A;  4YL0 A;  2H8A A;  4J7Y A;  4AL1 A;  2UUI A;  4WAB A;  4YK5 A;  5BQG A;  5BQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...