2UUIA

Crystal structure of human leukotriene c4 synthase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
155
structure length
155
Chain Sequence
MHHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUKOTRIENE C4 SYNTHASE
publication title Structural Basis for Synthesis of Inflammatory Mediators by Human Leukotriene C4 Synthase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 60
structure length 155
sequence length 155
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2uuiA00
4NTBA 3DWWA 5BQIA 5K0IA 3HKKA 2UUIA 4JC7A 4AL1A 4AL0A 3LEOA 4NTAA 3PCVA 2H8AA 4YL3A 4BPMA 4YL0A 4J7YA 4YL1A 5BQGA 4JCZA 2UUHA 3B29A 5HV9A 2PNOA 4YK5A 4J7TA 4WABA 2Q7RA 4NTFA 5BQHA 4JRZA
chains in the Genus database with same CATH superfamily
2NSFA 3B0VC 2CGEA 2L6GA 4D4XA 2Q00A 1D0XA 3NMKA 1L3PA 4JCHA 4I44A 1MMDA 3OEOA 4Z9HA 4HFFB 5JLIA 4AL1A 4XEVA 1ZW2A 1TQGA 4G7HF 3JZ0A 1WOLA 2LP4A 1APCA 2BL2A 4RDAA 1SZIA 4MVMA 4Q5SF 4JURI 1EA8A 2EPNA 2HUJA 2L9JA 3O55A 1L7CA 2RSEB 3GODA 4JZAA 1GQAA 4XEKA 5BUOA 4YL0A 3DD7A 5GPGB 1TFOB 2A6HF 5L0DA 3AG4C 2J8WA 2XL4A 4XEFA 2FGYA 2H7VC 3AG2C 3EPVA 5A6KA 4OIPF 1NFNA 2XRHA 4N6CA 3S27A 4CDVA 1EKYA 1JRAA 4NTFA 2W45A 1N1CA 3G50A 4JVSA 4U9EA 4EBJA 2NUPB 3AJMA 4KBLA 1HY5A 2ZPAA 3U2MA 3GEEA 3X1OA 1E86A 1Q0DA 1PD1A 2DYSC 2J7PA 2RD9A 3W2VA 1O87A 3SXYA 3LESA 2WVOA 3C7JA 1LKXA 2R7UA 3DAGA 3M15A 1PD0A 3LNRA 2WZGA 1ZHTA 2A69F 2XLHA 2H8AA 1PV3A 2A0UA 4CDAA 3NG1A 3N24A 4B6IA 5KYUB 3JRTA 4MVRA 4CS9A 1ZVZA 3QTHA 1OCOC 3EG9A 1T6QA 4MS2A 1Z6AA 2OOCA 5T1DB 1OW6A 2A1DD 4FESA 4U9DA 1Z23A 5TJ5E 2XM4A 3I5PA 5AC4A 1A41A 2OU6A 4ZLDA 2J46A 2J7PD 1EI7A 1E83A 4JJGA 4YWQA 1EQ1A 2QUPA 2O9XA 1HE9A 2VC9A 4P6IC 4U5HA 3HTKC 5EK0A 3X2QC 3JYHA 1E85A 1Q0MA 2KJGA 3Q6NA 5KYXB 2G3KA 4BEJA 2LCHA 4IB4A 2WZLA 4KNWA 3RQFA 3US6A 3RQEA 1RKEB 1MNEA 1ORJA 3SXKA 4EKWA 3TK0A 1LE4A 2AWYA 1YAUO 1OCCC 3HNKA 4O6YA 3JSZA 5KYYA 4KC9A 4XPYA 3RKOF 2YL7A 4KI2A 3WODF 3W8HA 3S29A 1G8XA 2B0HA 2OQMA 1S7ZA 1D1AA 5DQZA 2NPUA 1DOWA 4K1OA 4EWCA 2XXAB 1DOVA 3EHMA 2XLOA 4LLCA 4MVUA 4F4BA 4LACB 4O7GA 4OIQF 1V74B 3GWLA 1H6GA 1Y6DA 2L6HA 3BRJA 3KMIA 5COFA 2L81A 2NSGA 4GYTA 1RJ9B 3IQTA 5F5FA 3FMSA 1TR2A 3DXJF 4JRZA 4MTOA 2FFHA 4WJ0A 4Z9IA 1F1MA 3U5SA 4ER9A 1C03A 2C04A 2WZFA 3LAYA 1HMDA 1QLEC 1RXQA 5A6BA 3SYNA 1CPQA 2CW0F 3EGXB 3H2VA 2UUIA 2XLWA 3K7DA 2IXMA 3ASNC 2OJED 1K40A 3NMJA 1S05A 4MTGA 4QI0A 4GQHA 2P7VA 3L8JA 4PJLA 3ZDLA 2XSEA 4LDKA 2G62A 4WGYA 1AVOB 3FAPB 1G4US 3U9MA 5AC5A 1NU9C 1D1CA 3L34A 5JSLA 3E70C 4P9FA 5E3AA 4MVSA 1MQVA 3SP1A 4Q4ZF 2YLDA 1LI5A 2YL3A 1ZU4A 2GFHA 4IAOA 1Z5ZA 3DJUB 3EGDB 4H4KC 1YYJA 4J32B 3FHDA 2EPKX 3NYMA 2R7VA 2HSBA 3UGPA 2BC5A 2J0XA 2IYLD 2KW3C 3KYJA 4J30B 5A6BD 1KTMA 1Z7Qc 1RKCA 4G7ZF 4PFPA 4OIOF 1HE1A 4E7ZA 2EILC 2LFFA 3UGOA 1UFBA 2Y3GA 3DWWA 2J0WA 2QNLA 3UMHA 2VCAA 3E9VA 5BQIA 1OCRC 5A6AA 2LQGA 1WASA 2AU5A 4I3MA 4U5CE 1JPNA 1YZAA 2EIMC 2MYSA 1T01A 2XL8A 1LS1A 1A7DA 1NZEA 4MTFA 3RIPA 1HMOA 1VLTA 3WG7C 2XS1A 4XPWA 1A0BA 3EH2A 4PJMA 2Q4FA 3NDBB 2EPLX 2Y39A 3LUTB 2ZD9A 5HV9A 1OW7A 5KYWB 1BBHA 3F47A 1QVXA 5L0CA 3AOUA 4C3EA 4LERA 4Q7CA 4LLEA 3U3BA 3ZTZA 5KYYB 2I8BA 1YYXA 2HS5A 3EH1A 3FXHA 3I5QA 3MFNA 3QW1A 4K7BA 1LS4A 1MNDA 1NLXA 5JP7A 3QVZA 1CGME 1FMVA 3RFYA 3SZRA 3W4YA 3T4RA 3PDMP 4AL0A 5IY5C 4C7OB 2HKVA 1TFKB 4M63A 1ZHXA 2B0JA 2BE5F 1R4TA 1GS9A 2HJMA 2Q3TA 3V5XA 4PFOA 4DVYP 2LD6A 3IQ6A 4HFKB 2D4UA 2HV6A 5F5HA 3QW0A 5E3CA 4DJ9A 2R7SA 1LVKA 1VK5A 1QQ3A 3G4XA 3LS0A 2J9UA 2IM8A 3B29A 3GM1A 4H54A 2PNOA 1W2WA 3SNHA 4IRUA 2QLAA 4NCQA 3B0PA 2VCCA 1VTMP 1UG7A 3CAXA 1OQCA 1BR4A 3M1CB 1OXBA 5DVWA 4DBRA 4FX5A 2R7TA 3W2WA 1U0BB 5L0IA 3TULA 3C8GB 1GGQA 3EFOB 3LEVA 3TOLA 2LIGA 2WVQA 3DZAA 2OKUA 3ZIBA 1H9GA 5D92A 1TKNA 2G3VA 1BZ4A 3B9QA 1XZQA 1QKRA 4EIYA 1C02A 4JIOA 3GWNA 2MHRA 5L3QA 2AVKA 4OD4A 3AQCA 4AE4B 4WABA 3K1IA 3L0IA 5KYNA 2OG2A 2KSFA 3U8VA 3UNGC 5A6JA 1BR2A 1D0ZA 1NU7D 3A11A 3KYIA 4P9TA 4BJTA 5K0IA 5E2QA 5FCLA 4XLPF 3SXZA 1AEPA 1FTSA 1YVIA 4A4AA 3HNIA 4CIHA 1M2OA 4CS9C 2IXPA 2KGOA 2R7QA 5JVEA 1AUEA 2X0CA 3ABKC 2NUTA 3K1IC 4JJFA 2V26A 2P6VA 4U5EE 3V7OA 2AP3A 4R32A 4HEAJ 3R7CA 4QDLA 3RVYA 1BDJB 5DS5A 4C3DA 3ATPA 3K66A 3T6GB 5A69A 3JSEO 2L6FA 2VASA 1YARO 3G4ZA 3V5YA 1ORSC 2DB4A 3N0TA 3FAJA 4UDVA 1FAPB 4U5DE 3GEHA 4G0HA 4JTAB 2R7XA 1LM3B 1M56C 1QSPA 2AWCA 3BEHA 3NMIA 1NBBA 1LIHA 2IOQA 3DJNB 1T5OA 3FOPA 3JT1A 1HW2A 2WL8A 1YLMA 1XZPA 3LLIA 1OR3A 2J9BA 4N06A 3ASOC 3MLGA 1KU2A 2Q9BA 3F46A 4ONSA 2QY9A 3EZHA 2J45A 2HSQA 1YDIA 2YLIA 2OEXA 1OW8A 3KL4A 3LNMB 4K0DA 1CGNA 4XQ1A 1NFOA 3GANA 3H2UA 3RVZA 4DBQA 3QZCA 2TMVP 1PCXA 2CDQA 2GWWA 5CI9A 4E17A 3IQCA 4CSAC 1JPJA 2X51A 5L0JA 1M2VA 2J9VA 3B0UX 2OCCC 3TJ5A 4FAPB 3R2PA 1TWHA 4IJJA 4CJOA 4JW1A 2VCBA 2Z15A 5CI8A 2L7AA 4OIRF 1A7VA 4IARA 1K04A 2LK4A 3W8IA 1VB5A 1VLSA 1YJGA 2YQYA 2Y69C 3SEOA 4ANJA 4RBNA 2R03A 2YZSA 4L6RA 4E7SA 3RYLA 3DAFA 3KKBA 2CYDA 4NTBA 3EQLF 1MMNA 4MVZA 3A9CA 4DXWA 4KNVA 4EHPA 4QI2A 3HKKA 3EG9B 3S9OA 1D0YA 3S84A 2R7RA 2YRFA 4YT5A 4W8PA 1T6UA 1OKKA 1V54C 1WATA 5COMA 3S90A 2YL0A 1IZMA 2HZ8A 2R02A 4JKVA 3VF0A 3ZQVA 3PCVA 1TWCA 3U2LA 3ZVRA 1H9TA 2IXOA 2HJ3A 3K33A 3U3FA 1ZZPA 2J9WA 4YT2A 3POVA 2VB6A 2HFIA 3KH2A 4XPXA 3I4UA 4BJ6A 3M4BA 2Q9AA 2NUTB 3GORA 1NG1A 4PR9A 4EBKA 4MQ9F 3HNLA 5JRAA 1O5HA 4MW3A 4CS8A 1GM5A 4LDQA 2W4BA 3TJ6A 1OKKD 2KYHA 1U6HA 2YKZA 1OXKA 1Z3IX 4U5GA 3TD7A 3C8ZA 3Q7GA 5KYUA 4RD9A 1RCPA 1I4YA 1XWJA 4N4WA 3O10A 4E0HA 5B3SC 4A2NB 4BJ6C 1T6IA 4YT4A 3T6JA 3IEEA 3EZIA 4ULWA 5DS4A 2ETSA 2JPUA 2H7BA 2XLMA 1M57C 5JT4A 4CS8C 3NYLA 4IWBA 1LPEA 2GDCA 2F22A 3QMKA 3ITFA 1FFTC 3C62A 1JMWA 2XL6A 3WAQA 5L3VA 2PX0A 3AGUA 1YA7O 2XM0A 4J7YA 2HV7A 4O79A 3SXMA 5KYXA 2UUHA 2Y3HA 3AG3C 5L0HA 2R9RB 2YEVA 2ZXOA 3N2ZB 4WGZA 4YK5A 1E84A 3GEIA 1Q0FA 1D1BA 1V4AA 5DQTA 3DE8A 3CSKA 2FAPB 4YT8A 3PMRA 1M2VB 4ULVA 1NSGB 1WWPA 2ZXRA 1O3UA 3FVYA 4OINF 2PFDA 4I1OB 2HMZA 4JE9A 1LE2A 2CNWA 1Q0GA 4GEHA 2PF4E 3IHUA 4MNDA 2A6EF 2XXAA 2PX3A 1TWAA 1WTYA 5CIVA 2EPOA 2Y3DA 1Q0KA 2PP4A 3C18A 4N6HA 4O6NA 4JEBA 2QE9A 3RF3A 5F28E 2DYRC 1RJ9A 4JTDB 4MVQA 3LJBA 2P0NA 2KC3A 1G5ZA 2W4MA 3M4CA 4AX2A 2H7OA 2XLDA 3CQZA 2EIJC 2Y3BA 5L0GA 2ZXPA 5BQGA 1FR0A 2OEVA 3EGXA 3DMDA 3DI5A 2R25A 1SMYF 2P61A 3KPHA 2CNWD 4J7TA 3O39A 2NG1A 3VYWA 3MYFA 2VH3A 3UMKA 3DKAA 4HE8D 3AQBA 3PHF2 1ZHZA 3NRHA 4YN0B 3EGDA 4PACA 3WHNA 1E2XA 2GAQA 4JC7A 2C03A 2MWQA 1IW7F 2EIKC 3ZQYA 3ZSUA 2DI3A 2W9YA 4CSAA 2YL1A 3CEXA 3DE9A 4NTAA 5D91A 3CZ6A 3UMIA 5JUAA 4BPMA 2PBEA 1Z63A 1SR2A 3RW0A 3ZWIA 1B68A 1KNYA 1ZYRF 1J8YF 2JD3A 1ZHWA 4IAQA 1M6TA 1T9KA 1VYKA 3MYIA 2EINC 4JTCB 1G4WR 3EJNA 4DRIB 4JEAA 4CDYA 1LI7A 2XLEA 1ZHYA 2YVKA 1V55C 4OD5A 2LSEA 4BJ5A 3L1MA 2ICWG 2P1AA 2KNHA 3OWTA 3JCUQ 5T3WA 3B71A 3ZC4A 3U0CA 1VOMA 3DM9B 3RQGA 3L8IA 2CCYA 2KK1A 2KQ9A 3ECSA 1MMAA 4U5FE 2IBFA 3GM2A 4EBBA 3LS1A 2YHSA 4Z9JA 3C63A 5KYWA 4BJ1A 2GA0A 2R7OA 1OCZC 4YJWA 2YWAA 5T3TA 1YZCA 3M79A 4BJ5C 2I15A 2OJQA 3TOMA 4O6MA 5DS6A 3LLKA 2A0BA 1QZXA 4AK9A 5B3IA 1I5NA 3AGTA 4BEMJ 2M4EA 3TQOA 4W8KA 1HW1A 1JAFA 2IXNA 3U8PA 4C7OA 1ZU5A 3O6XA 1JR8A 1OR2A 1YA9A 3OA1A 1J8MF 2Q7RA 4DOZA 3NYJA 4IGGA 3VAYA 1JOGA 3JTLO 2QTVA 1QPUA 5JS5A 4CIPA 3DM5A 4MVOA 4D4NA 3JYYA 1I4ZA 3AG1C 2A68F 3IQ5A 1K05A 2HMQA 256BA 2XS8A 4NC3A 4PJJA 3EHNA 4CJGA 5COGA 2Q9CA 1R5ID 1FFHA 3ABLC 4NY3A 3V5ZA 1MMGA 2WVNA 4X0RA 3LEOA 5AGFA 4CBEA 4E0IA 2R7WA 3S28A 3T6BA 1WN0A 3ZTMA 1VYIA 3HNJA 4G7OF 2E87A 3IPMO 3FOOA 4C3BA 4DVZA 4XWJA 1SYQA 2WB7A 4G78A 3NKDA 4XTKA 2NUPA 4ZLCA 2ASRA 5HSWA 2EPMX 1Y4CA 2LFDA 1FMWA 2D5RB 4EUKB 1VMAA 3C8GA 2XLVA 3EFOA 5DLJA 3GM3A 3K6BA 4MW8A 3U9JA 1ZW3A 2V3CC 3JRMO 1BR1A 5EHHA 5BQHA 3T9OA 5L0FA 4I1MA 1SF8A 1TWGA 2M64A 4XLNF 3ZG1A 3H65A 2JX0A 1U89A 5E33A 2ZXWC 4FWVA 4AE4A 4DRJB 1FNTc 1C17M 1RMVA 5B1AC 1ORYA 3C8GD 4PJNA 4PK4A 3NKEA 5B1BC 3FDQA 3MBGA 3UR3C 4CS7A 4BG0A 3Q7LA 3HLZA 4NQFA 5EGYA 4YL3A 4CX9A 1CPRA 3MX3A 3S0XA 5FZTA 4U5BE 4YL1A 4E18A 2DGJA 4JCZA 3QVYA 3VRCA 1A7EA 2R05A 3HJCA 3Q6MA 4LDRA 3VM6A 2YLGA 3K1HA 1H7IA 1RKEA 3J06A 3ABMC 1WGWA 1ST6A 1CGOA 3RH3A 4DRHB
chains in the Genus database with same CATH topology
4NTBA 3DWWA 5BQIA 5K0IA 3HKKA 2UUIA 4JC7A 4AL1A 4AL0A 3LEOA 4NTAA 3PCVA 2H8AA 4YL3A 4BPMA 4YL0A 4J7YA 4YL1A 5BQGA 4JCZA 2UUHA 3B29A 5HV9A 2PNOA 4YK5A 4J7TA 4WABA 2Q7RA 4NTFA 5BQHA 4JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTB A;  3DWW A;  5BQI A;  5K0I A;  3HKK A;  2UUI A;  4JC7 A;  4AL1 A;  4AL0 A;  3LEO A;  4NTA A;  3PCV A;  2H8A A;  4YL3 A;  4BPM A;  4YL0 A;  4J7Y A;  4YL1 A;  5BQG A;  4JCZ A;  2UUH A;  3B29 A;  5HV9 A;  2PNO A;  4YK5 A;  4J7T A;  4WAB A;  2Q7R A;  4NTF A;  5BQH A;  4JRZ A; 
#chains in the Genus database with same CATH topology
 2NSF A;  3B0V C;  2CGE A;  2L6G A;  4D4X A;  2Q00 A;  1D0X A;  3NMK A;  1L3P A;  4JCH A;  4I44 A;  1MMD A;  3OEO A;  4Z9H A;  4HFF B;  5JLI A;  4AL1 A;  4XEV A;  1ZW2 A;  1TQG A;  4G7H F;  3JZ0 A;  1WOL A;  2LP4 A;  1APC A;  2BL2 A;  4RDA A;  1SZI A;  4MVM A;  4Q5S F;  4JUR I;  1EA8 A;  2EPN A;  2HUJ A;  2L9J A;  3O55 A;  1L7C A;  2RSE B;  3GOD A;  4JZA A;  1GQA A;  4XEK A;  5BUO A;  4YL0 A;  3DD7 A;  5GPG B;  1TFO B;  2A6H F;  5L0D A;  3AG4 C;  2J8W A;  2XL4 A;  4XEF A;  2FGY A;  2H7V C;  3AG2 C;  3EPV A;  5A6K A;  4OIP F;  1NFN A;  2XRH A;  4N6C A;  3S27 A;  4CDV A;  1EKY A;  1JRA A;  4NTF A;  2W45 A;  1N1C A;  3G50 A;  4JVS A;  4U9E A;  4EBJ A;  2NUP B;  3AJM A;  4KBL A;  1HY5 A;  2ZPA A;  3U2M A;  3GEE A;  3X1O A;  1E86 A;  1Q0D A;  1PD1 A;  2DYS C;  2J7P A;  2RD9 A;  3W2V A;  1O87 A;  3SXY A;  3LES A;  2WVO A;  3C7J A;  1LKX A;  2R7U A;  3DAG A;  3M15 A;  1PD0 A;  3LNR A;  2WZG A;  1ZHT A;  2A69 F;  2XLH A;  2H8A A;  1PV3 A;  2A0U A;  4CDA A;  3NG1 A;  3N24 A;  4B6I A;  5KYU B;  3JRT A;  4MVR A;  4CS9 A;  1ZVZ A;  3QTH A;  1OCO C;  3EG9 A;  1T6Q A;  4MS2 A;  1Z6A A;  2OOC A;  5T1D B;  1OW6 A;  2A1D D;  4FES A;  4U9D A;  1Z23 A;  5TJ5 E;  2XM4 A;  3I5P A;  5AC4 A;  1A41 A;  2OU6 A;  4ZLD A;  2J46 A;  2J7P D;  1EI7 A;  1E83 A;  4JJG A;  4YWQ A;  1EQ1 A;  2QUP A;  2O9X A;  1HE9 A;  2VC9 A;  4P6I C;  4U5H A;  3HTK C;  5EK0 A;  3X2Q C;  3JYH A;  1E85 A;  1Q0M A;  2KJG A;  3Q6N A;  5KYX B;  2G3K A;  4BEJ A;  2LCH A;  4IB4 A;  2WZL A;  4KNW A;  3RQF A;  3US6 A;  3RQE A;  1RKE B;  1MNE A;  1ORJ A;  3SXK A;  4EKW A;  3TK0 A;  1LE4 A;  2AWY A;  1YAU O;  1OCC C;  3HNK A;  4O6Y A;  3JSZ A;  5KYY A;  4KC9 A;  4XPY A;  3RKO F;  2YL7 A;  4KI2 A;  3WOD F;  3W8H A;  3S29 A;  1G8X A;  2B0H A;  2OQM A;  1S7Z A;  1D1A A;  5DQZ A;  2NPU A;  1DOW A;  4K1O A;  4EWC A;  2XXA B;  1DOV A;  3EHM A;  2XLO A;  4LLC A;  4MVU A;  4F4B A;  4LAC B;  4O7G A;  4OIQ F;  1V74 B;  3GWL A;  1H6G A;  1Y6D A;  2L6H A;  3BRJ A;  3KMI A;  5COF A;  2L81 A;  2NSG A;  4GYT A;  1RJ9 B;  3IQT A;  5F5F A;  3FMS A;  1TR2 A;  3DXJ F;  4JRZ A;  4MTO A;  2FFH A;  4WJ0 A;  4Z9I A;  1F1M A;  3U5S A;  4ER9 A;  1C03 A;  2C04 A;  2WZF A;  3LAY A;  1HMD A;  1QLE C;  1RXQ A;  5A6B A;  3SYN A;  1CPQ A;  2CW0 F;  3EGX B;  3H2V A;  2UUI A;  2XLW A;  3K7D A;  2IXM A;  3ASN C;  2OJE D;  1K40 A;  3NMJ A;  1S05 A;  4MTG A;  4QI0 A;  4GQH A;  2P7V A;  3L8J A;  4PJL A;  3ZDL A;  2XSE A;  4LDK A;  2G62 A;  4WGY A;  1AVO B;  3FAP B;  1G4U S;  3U9M A;  5AC5 A;  1NU9 C;  1D1C A;  3L34 A;  5JSL A;  3E70 C;  4P9F A;  5E3A A;  4MVS A;  1MQV A;  3SP1 A;  4Q4Z F;  2YLD A;  1LI5 A;  2YL3 A;  1ZU4 A;  2GFH A;  4IAO A;  1Z5Z A;  3DJU B;  3EGD B;  4H4K C;  1YYJ A;  4J32 B;  3FHD A;  2EPK X;  3NYM A;  2R7V A;  2HSB A;  3UGP A;  2BC5 A;  2J0X A;  2IYL D;  2KW3 C;  3KYJ A;  4J30 B;  5A6B D;  1KTM A;  1Z7Q c;  1RKC A;  4G7Z F;  4PFP A;  4OIO F;  1HE1 A;  4E7Z A;  2EIL C;  2LFF A;  3UGO A;  1UFB A;  2Y3G A;  3DWW A;  2J0W A;  2QNL A;  3UMH A;  2VCA A;  3E9V A;  5BQI A;  1OCR C;  5A6A A;  2LQG A;  1WAS A;  2AU5 A;  4I3M A;  4U5C E;  1JPN A;  1YZA A;  2EIM C;  2MYS A;  1T01 A;  2XL8 A;  1LS1 A;  1A7D A;  1NZE A;  4MTF A;  3RIP A;  1HMO A;  1VLT A;  3WG7 C;  2XS1 A;  4XPW A;  1A0B A;  3EH2 A;  4PJM A;  2Q4F A;  3NDB B;  2EPL X;  2Y39 A;  3LUT B;  2ZD9 A;  5HV9 A;  1OW7 A;  5KYW B;  1BBH A;  3F47 A;  1QVX A;  5L0C A;  3AOU A;  4C3E A;  4LER A;  4Q7C A;  4LLE A;  3U3B A;  3ZTZ A;  5KYY B;  2I8B A;  1YYX A;  2HS5 A;  3EH1 A;  3FXH A;  3I5Q A;  3MFN A;  3QW1 A;  4K7B A;  1LS4 A;  1MND A;  1NLX A;  5JP7 A;  3QVZ A;  1CGM E;  1FMV A;  3RFY A;  3SZR A;  3W4Y A;  3T4R A;  3PDM P;  4AL0 A;  5IY5 C;  4C7O B;  2HKV A;  1TFK B;  4M63 A;  1ZHX A;  2B0J A;  2BE5 F;  1R4T A;  1GS9 A;  2HJM A;  2Q3T A;  3V5X A;  4PFO A;  4DVY P;  2LD6 A;  3IQ6 A;  4HFK B;  2D4U A;  2HV6 A;  5F5H A;  3QW0 A;  5E3C A;  4DJ9 A;  2R7S A;  1LVK A;  1VK5 A;  1QQ3 A;  3G4X A;  3LS0 A;  2J9U A;  2IM8 A;  3B29 A;  3GM1 A;  4H54 A;  2PNO A;  1W2W A;  3SNH A;  4IRU A;  2QLA A;  4NCQ A;  3B0P A;  2VCC A;  1VTM P;  1UG7 A;  3CAX A;  1OQC A;  1BR4 A;  3M1C B;  1OXB A;  5DVW A;  4DBR A;  4FX5 A;  2R7T A;  3W2W A;  1U0B B;  5L0I A;  3TUL A;  3C8G B;  1GGQ A;  3EFO B;  3LEV A;  3TOL A;  2LIG A;  2WVQ A;  3DZA A;  2OKU A;  3ZIB A;  1H9G A;  5D92 A;  1TKN A;  2G3V A;  1BZ4 A;  3B9Q A;  1XZQ A;  1QKR A;  4EIY A;  1C02 A;  4JIO A;  3GWN A;  2MHR A;  5L3Q A;  2AVK A;  4OD4 A;  3AQC A;  4AE4 B;  4WAB A;  3K1I A;  3L0I A;  5KYN A;  2OG2 A;  2KSF A;  3U8V A;  3UNG C;  5A6J A;  1BR2 A;  1D0Z A;  1NU7 D;  3A11 A;  3KYI A;  4P9T A;  4BJT A;  5K0I A;  5E2Q A;  5FCL A;  4XLP F;  3SXZ A;  1AEP A;  1FTS A;  1YVI A;  4A4A A;  3HNI A;  4CIH A;  1M2O A;  4CS9 C;  2IXP A;  2KGO A;  2R7Q A;  5JVE A;  1AUE A;  2X0C A;  3ABK C;  2NUT A;  3K1I C;  4JJF A;  2V26 A;  2P6V A;  4U5E E;  3V7O A;  2AP3 A;  4R32 A;  4HEA J;  3R7C A;  4QDL A;  3RVY A;  1BDJ B;  5DS5 A;  4C3D A;  3ATP A;  3K66 A;  3T6G B;  5A69 A;  3JSE O;  2L6F A;  2VAS A;  1YAR O;  3G4Z A;  3V5Y A;  1ORS C;  2DB4 A;  3N0T A;  3FAJ A;  4UDV A;  1FAP B;  4U5D E;  3GEH A;  4G0H A;  4JTA B;  2R7X A;  1LM3 B;  1M56 C;  1QSP A;  2AWC A;  3BEH A;  3NMI A;  1NBB A;  1LIH A;  2IOQ A;  3DJN B;  1T5O A;  3FOP A;  3JT1 A;  1HW2 A;  2WL8 A;  1YLM A;  1XZP A;  3LLI A;  1OR3 A;  2J9B A;  4N06 A;  3ASO C;  3MLG A;  1KU2 A;  2Q9B A;  3F46 A;  4ONS A;  2QY9 A;  3EZH A;  2J45 A;  2HSQ A;  1YDI A;  2YLI A;  2OEX A;  1OW8 A;  3KL4 A;  3LNM B;  4K0D A;  1CGN A;  4XQ1 A;  1NFO A;  3GAN A;  3H2U A;  3RVZ A;  4DBQ A;  3QZC A;  2TMV P;  1PCX A;  2CDQ A;  2GWW A;  5CI9 A;  4E17 A;  3IQC A;  4CSA C;  1JPJ A;  2X51 A;  5L0J A;  1M2V A;  2J9V A;  3B0U X;  2OCC C;  3TJ5 A;  4FAP B;  3R2P A;  1TWH A;  4IJJ A;  4CJO A;  4JW1 A;  2VCB A;  2Z15 A;  5CI8 A;  2L7A A;  4OIR F;  1A7V A;  4IAR A;  1K04 A;  2LK4 A;  3W8I A;  1VB5 A;  1VLS A;  1YJG A;  2YQY A;  2Y69 C;  3SEO A;  4ANJ A;  4RBN A;  2R03 A;  2YZS A;  4L6R A;  4E7S A;  3RYL A;  3DAF A;  3KKB A;  2CYD A;  4NTB A;  3EQL F;  1MMN A;  4MVZ A;  3A9C A;  4DXW A;  4KNV A;  4EHP A;  4QI2 A;  3HKK A;  3EG9 B;  3S9O A;  1D0Y A;  3S84 A;  2R7R A;  2YRF A;  4YT5 A;  4W8P A;  1T6U A;  1OKK A;  1V54 C;  1WAT A;  5COM A;  3S90 A;  2YL0 A;  1IZM A;  2HZ8 A;  2R02 A;  4JKV A;  3VF0 A;  3ZQV A;  3PCV A;  1TWC A;  3U2L A;  3ZVR A;  1H9T A;  2IXO A;  2HJ3 A;  3K33 A;  3U3F A;  1ZZP A;  2J9W A;  4YT2 A;  3POV A;  2VB6 A;  2HFI A;  3KH2 A;  4XPX A;  3I4U A;  4BJ6 A;  3M4B A;  2Q9A A;  2NUT B;  3GOR A;  1NG1 A;  4PR9 A;  4EBK A;  4MQ9 F;  3HNL A;  5JRA A;  1O5H A;  4MW3 A;  4CS8 A;  1GM5 A;  4LDQ A;  2W4B A;  3TJ6 A;  1OKK D;  2KYH A;  1U6H A;  2YKZ A;  1OXK A;  1Z3I X;  4U5G A;  3TD7 A;  3C8Z A;  3Q7G A;  5KYU A;  4RD9 A;  1RCP A;  1I4Y A;  1XWJ A;  4N4W A;  3O10 A;  4E0H A;  5B3S C;  4A2N B;  4BJ6 C;  1T6I A;  4YT4 A;  3T6J A;  3IEE A;  3EZI A;  4ULW A;  5DS4 A;  2ETS A;  2JPU A;  2H7B A;  2XLM A;  1M57 C;  5JT4 A;  4CS8 C;  3NYL A;  4IWB A;  1LPE A;  2GDC A;  2F22 A;  3QMK A;  3ITF A;  1FFT C;  3C62 A;  1JMW A;  2XL6 A;  3WAQ A;  5L3V A;  2PX0 A;  3AGU A;  1YA7 O;  2XM0 A;  4J7Y A;  2HV7 A;  4O79 A;  3SXM A;  5KYX A;  2UUH A;  2Y3H A;  3AG3 C;  5L0H A;  2R9R B;  2YEV A;  2ZXO A;  3N2Z B;  4WGZ A;  4YK5 A;  1E84 A;  3GEI A;  1Q0F A;  1D1B A;  1V4A A;  5DQT A;  3DE8 A;  3CSK A;  2FAP B;  4YT8 A;  3PMR A;  1M2V B;  4ULV A;  1NSG B;  1WWP A;  2ZXR A;  1O3U A;  3FVY A;  4OIN F;  2PFD A;  4I1O B;  2HMZ A;  4JE9 A;  1LE2 A;  2CNW A;  1Q0G A;  4GEH A;  2PF4 E;  3IHU A;  4MND A;  2A6E F;  2XXA A;  2PX3 A;  1TWA A;  1WTY A;  5CIV A;  2EPO A;  2Y3D A;  1Q0K A;  2PP4 A;  3C18 A;  4N6H A;  4O6N A;  4JEB A;  2QE9 A;  3RF3 A;  5F28 E;  2DYR C;  1RJ9 A;  4JTD B;  4MVQ A;  3LJB A;  2P0N A;  2KC3 A;  1G5Z A;  2W4M A;  3M4C A;  4AX2 A;  2H7O A;  2XLD A;  3CQZ A;  2EIJ C;  2Y3B A;  5L0G A;  2ZXP A;  5BQG A;  1FR0 A;  2OEV A;  3EGX A;  3DMD A;  3DI5 A;  2R25 A;  1SMY F;  2P61 A;  3KPH A;  2CNW D;  4J7T A;  3O39 A;  2NG1 A;  3VYW A;  3MYF A;  2VH3 A;  3UMK A;  3DKA A;  4HE8 D;  3AQB A;  3PHF 2;  1ZHZ A;  3NRH A;  4YN0 B;  3EGD A;  4PAC A;  3WHN A;  1E2X A;  2GAQ A;  4JC7 A;  2C03 A;  2MWQ A;  1IW7 F;  2EIK C;  3ZQY A;  3ZSU A;  2DI3 A;  2W9Y A;  4CSA A;  2YL1 A;  3CEX A;  3DE9 A;  4NTA A;  5D91 A;  3CZ6 A;  3UMI A;  5JUA A;  4BPM A;  2PBE A;  1Z63 A;  1SR2 A;  3RW0 A;  3ZWI A;  1B68 A;  1KNY A;  1ZYR F;  1J8Y F;  2JD3 A;  1ZHW A;  4IAQ A;  1M6T A;  1T9K A;  1VYK A;  3MYI A;  2EIN C;  4JTC B;  1G4W R;  3EJN A;  4DRI B;  4JEA A;  4CDY A;  1LI7 A;  2XLE A;  1ZHY A;  2YVK A;  1V55 C;  4OD5 A;  2LSE A;  4BJ5 A;  3L1M A;  2ICW G;  2P1A A;  2KNH A;  3OWT A;  3JCU Q;  5T3W A;  3B71 A;  3ZC4 A;  3U0C A;  1VOM A;  3DM9 B;  3RQG A;  3L8I A;  2CCY A;  2KK1 A;  2KQ9 A;  3ECS A;  1MMA A;  4U5F E;  2IBF A;  3GM2 A;  4EBB A;  3LS1 A;  2YHS A;  4Z9J A;  3C63 A;  5KYW A;  4BJ1 A;  2GA0 A;  2R7O A;  1OCZ C;  4YJW A;  2YWA A;  5T3T A;  1YZC A;  3M79 A;  4BJ5 C;  2I15 A;  2OJQ A;  3TOM A;  4O6M A;  5DS6 A;  3LLK A;  2A0B A;  1QZX A;  4AK9 A;  5B3I A;  1I5N A;  3AGT A;  4BEM J;  2M4E A;  3TQO A;  4W8K A;  1HW1 A;  1JAF A;  2IXN A;  3U8P A;  4C7O A;  1ZU5 A;  3O6X A;  1JR8 A;  1OR2 A;  1YA9 A;  3OA1 A;  1J8M F;  2Q7R A;  4DOZ A;  3NYJ A;  4IGG A;  3VAY A;  1JOG A;  3JTL O;  2QTV A;  1QPU A;  5JS5 A;  4CIP A;  3DM5 A;  4MVO A;  4D4N A;  3JYY A;  1I4Z A;  3AG1 C;  2A68 F;  3IQ5 A;  1K05 A;  2HMQ A;  256B A;  2XS8 A;  4NC3 A;  4PJJ A;  3EHN A;  4CJG A;  5COG A;  2Q9C A;  1R5I D;  1FFH A;  3ABL C;  4NY3 A;  3V5Z A;  1MMG A;  2WVN A;  4X0R A;  3LEO A;  5AGF A;  4CBE A;  4E0I A;  2R7W A;  3S28 A;  3T6B A;  1WN0 A;  3ZTM A;  1VYI A;  3HNJ A;  4G7O F;  2E87 A;  3IPM O;  3FOO A;  4C3B A;  4DVZ A;  4XWJ A;  1SYQ A;  2WB7 A;  4G78 A;  3NKD A;  4XTK A;  2NUP A;  4ZLC A;  2ASR A;  5HSW A;  2EPM X;  1Y4C A;  2LFD A;  1FMW A;  2D5R B;  4EUK B;  1VMA A;  3C8G A;  2XLV A;  3EFO A;  5DLJ A;  3GM3 A;  3K6B A;  4MW8 A;  3U9J A;  1ZW3 A;  2V3C C;  3JRM O;  1BR1 A;  5EHH A;  5BQH A;  3T9O A;  5L0F A;  4I1M A;  1SF8 A;  1TWG A;  2M64 A;  4XLN F;  3ZG1 A;  3H65 A;  2JX0 A;  1U89 A;  5E33 A;  2ZXW C;  4FWV A;  4AE4 A;  4DRJ B;  1FNT c;  1C17 M;  1RMV A;  5B1A C;  1ORY A;  3C8G D;  4PJN A;  4PK4 A;  3NKE A;  5B1B C;  3FDQ A;  3MBG A;  3UR3 C;  4CS7 A;  4BG0 A;  3Q7L A;  3HLZ A;  4NQF A;  5EGY A;  4YL3 A;  4CX9 A;  1CPR A;  3MX3 A;  3S0X A;  5FZT A;  4U5B E;  4YL1 A;  4E18 A;  2DGJ A;  4JCZ A;  3QVY A;  3VRC A;  1A7E A;  2R05 A;  3HJC A;  3Q6M A;  4LDR A;  3VM6 A;  2YLG A;  3K1H A;  1H7I A;  1RKE A;  3J06 A;  3ABM C;  1WGW A;  1ST6 A;  1CGO A;  3RH3 A;  4DRH B; 
#chains in the Genus database with same CATH homology
 4NTB A;  3DWW A;  5BQI A;  5K0I A;  3HKK A;  2UUI A;  4JC7 A;  4AL1 A;  4AL0 A;  3LEO A;  4NTA A;  3PCV A;  2H8A A;  4YL3 A;  4BPM A;  4YL0 A;  4J7Y A;  4YL1 A;  5BQG A;  4JCZ A;  2UUH A;  3B29 A;  5HV9 A;  2PNO A;  4YK5 A;  4J7T A;  4WAB A;  2Q7R A;  4NTF A;  5BQH A;  4JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...