2UUIA

Crystal structure of human leukotriene c4 synthase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
155
structure length
155
Chain Sequence
b'MHHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUKOTRIENE C4 SYNTHASE
publication title Structural Basis for Synthesis of Inflammatory Mediators by Human Leukotriene C4 Synthase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 60
structure length 155
sequence length 155
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2uuiA00
4YL0A 4J7TA 4JC7A 4AL1A 4YK5A 4WABA 4JRZA 4AL0A 4NTBA 3HKKA 5K0IA 4NTAA 4BPMA 2Q7RA 3LEOA 3B29A 2UUIA 4YL3A 2H8AA 3DWWA 5BQGA 4JCZA 4NTFA 3PCVA 5BQHA 2PNOA 5BQIA 4J7YA 5HV9A 4YL1A 2UUHA
chains in the Genus database with same CATH superfamily
2HSQA 4K1OA 5E33A 3M4CA 1M6TA 4MTFA 3ATPA 3U3FA 4DXWA 1KTMA 1MMAA 1TFKB 1T6IA 2CNWD 2GWWA 2YL0A 3SXKA 1VLSA 2KW3C 3LEOA 5DS6A 2HMZA 4DJ9A 5L0JA 4DRHB 3CZ6A 3EJNA 3IQ6A 2A0UA 5BUOA 3ASOC 4JCZA 2YRFA 3RVYA 2XM0A 4EIYA 4C7OA 1I4ZA 1E2XA 1SYQA 2L81A 1LS1A 1PD0A 5BQHA 5KYYA 4LDQA 4U9DA 2R7OA 2IBFA 4O6NA 1PCXA 5L0IA 5L3QA 1LE2A 2B0HA 2KYHA 3KKBA 3GM2A 5F5HA 1E83A 3C18A 3QW1A 3ECSA 4JC7A 3TJ5A 2VB6A 3U9JA 4YK5A 2ZD9A 4JIOA 1QLEC 4KC9A 4X0RA 2CYDA 2OOCA 3S29A 3X2QC 1D1AA 1VLTA 2OQMA 4XPWA 3QMKA 1B68A 2XLMA 4DRJB 3A9CA 3JYYA 4N6HA 4OD5A 1WATA 1D0YA 3DE9A 1NSGB 1NU7D 1FFTC 4EBBA 5L3VA 3RIPA 3TULA 1OW7A 2XLWA 1OR2A 4EUKB 2VH3A 4XEVA 2HV7A 1YYJA 2EPNA 5COFA 1RKEA 2NG1A 2Y3HA 4ZLCA 2L6FA 3EFOB 4QI0A 1U89A 1NFOA 3GEIA 256BA 2J0WA 3I4UA 4E7SA 1JRAA 3U2LA 2YVKA 4LDKA 3VF0A 1NG1A 4JRZA 3RQFA 2I15A 3AJMA 3U8PA 4CS9A 3LLIA 4UDVA 3I5QA 3OEOA 1NFNA 3V5ZA 1ZW3A 2J46A 4M63A 4OD4A 3NYJA 1K40A 2BE5F 5A6BD 3FOPA 2EPLX 4KBLA 1QVXA 2FAPB 3W8HA 5HSWA 4QI2A 4U5BE 1K04A 3U9MA 3ZG1A 4CS9C 4PJNA 1FR0A 1O87A 2OU6A 1J8YF 2QLAA 2W45A 2ZXWC 3JTLO 3DJUB 3S90A 1OCZC 4N6CA 1LE4A 4CX9A 4BJ6C 2TMVP 3E9VA 1A7EA 2XSEA 2YL7A 1BBHA 3EH2A 2E87A 2MHRA 3NYMA 4G78A 4NQFA 3SXYA 5COGA 5KYWA 1HW2A 2R7UA 1YYXA 2NUTB 3RKOF 4CSAA 1L3PA 4YL0A 3JCUQ 3LJBA 1FTSA 1G5ZA 1GS9A 3PMRA 4MVQA 4J32B 4F4BA 5D91A 2EIKC 3GWNA 2LD6A 2XRHA 3C7JA 1Y4CA 1G4US 3EGXA 3EZIA 1CGOA 1QSPA 2P7VA 5D92A 3SNHA 4BEJA 1Z63A 4CSAC 1VK5A 5GPGB 3NKEA 4XTKA 2Y3BA 4U5EE 2GAQA 3N24A 1LKXA 3SXZA 4HEAJ 4JURI 2LQGA 4YJWA 2A6EF 3AQCA 1GGQA 2A69F 2OJED 1RKCA 1ZHWA 3WAQA 1PV3A 1C17M 4LLEA 2XLHA 3G4XA 3F46A 1AUEA 1OKKD 4XQ1A 4CS8A 2R7VA 2KJGA 1Q0MA 1LIHA 2RSEB 4ONSA 1YZAA 1H9GA 2J45A 1OCRC 1QPUA 3W2WA 3O55A 4PJMA 2V3CC 5A6AA 2D4UA 1FMWA 1M2VB 3E70C 3LESA 2IXMA 1M2OA 2VCCA 3CQZA 3IHUA 4I1OB 3DM9B 3RYLA 3HNLA 1MMGA 3TK0A 4D4XA 3ZC4A 1DOWA 4YT8A 1G4WR 3GM1A 3V5XA 4BJ1A 2QY9A 4ULWA 4W8KA 3RQGA 1V4AA 2MWQA 3FAJA 1R4TA 3WG7C 5L0HA 3C63A 4EWCA 3DM5A 1H7IA 2LIGA 3AG3C 4U5CE 3V7OA 3ZQVA 4A2NB 4YT4A 2FGYA 5B3IA 4EHPA 1H6GA 1PD1A 2PF4E 2X0CA 4JKVA 4G7OF 5E3AA 3ZVRA 4NC3A 2LCHA 2DYRC 1T01A 3S9OA 2GDCA 2YZSA 4BEMJ 1TR2A 3NMJA 5A6KA 5DQZA 5L0DA 4W8PA 3W2VA 1YZCA 4YL1A 3EQLF 2YWAA 4XWJA 1VYIA 4U5DE 1U0BB 4JE9A 2J9WA 4DVYP 1HMDA 3N2ZB 1JPJA 3DMDA 3DAGA 3N0TA 4WGZA 3EZHA 3DD7A 3GM3A 4U9EA 1R5ID 2YL1A 3G50A 3JSZA 4NTAA 4CJOA 2P1AA 1N1CA 2VASA 3BRJA 3EH1A 3RW0A 1WOLA 4GYTA 3WODF 1WGWA 3SYNA 2XLEA 3C62A 4L6RA 3B0VC 4JTCB 4C7OB 2WVOA 1AEPA 3KMIA 3PHF2 5KYYB 2XXAA 4RBNA 3OA1A 4PK4A 1JAFA 1T6QA 3VAYA 4E0IA 1VYKA 1YAUO 4BJ5C 2J8WA 1I5NA 1OCOC 3AQBA 4FAPB 5KYUA 4G7HF 2KGOA 3JT1A 3QW0A 1ST6A 3DJNB 1NLXA 4C3EA 4ANJA 5JVEA 3KYIA 1ZU5A 3NRHA 2VCBA 1BDJB 4CDYA 3UMKA 4YT5A 2P0NA 5B1AC 2AVKA 5KYXA 4JCHA 1A7DA 1JPNA 3AG2C 3FXHA 3NYLA 3U8VA 3ABKC 3CSKA 4HE8D 1RJ9A 3HTKC 1TWCA 3X1OA 2IM8A 1OXBA 3HNKA 5KYNA 3IEEA 2XL8A 3K7DA 3AG4C 4YL3A 4C3BA 2HSBA 3VYWA 4ER9A 4QDLA 5DLJA 5CIVA 2H7BA 3T6JA 1D0ZA 2WL8A 3DWWA 2XS1A 3V5YA 3S28A 1MNEA 1Z23A 2R02A 2W4MA 5F5FA 3EPVA 3QZCA 1JMWA 4Z9HA 2M64A 2WVNA 1RKEB 4GQHA 2JD3A 3U2MA 3PDMP 1VB5A 2MYSA 2A0BA 1S7ZA 3MYFA 4ULVA 4EBJA 1LI5A 4K7BA 3T6GB 1MMNA 3KYJA 4J30B 1E84A 3R2PA 3TOMA 2Q4FA 4KNVA 2VC9A 3AOUA 2G62A 1G8XA 4NTBA 3DE8A 1UG7A 4CIPA 3B71A 4XLPF 3RFYA 3BEHA 3HLZA 3M79A 5FCLA 4IB4A 5COMA 4O79A 1OR3A 2H8AA 2Y3DA 4BJ6A 1SF8A 1L7CA 3VM6A 3H2UA 3LLKA 3UMIA 3FAPB 4P9TA 3Q6MA 4KI2A 3M15A 3AGTA 4I44A 1K05A 4H4KC 1FNTc 2R7WA 1T6UA 3UGPA 4IGGA 2OJQA 2J7PA 2PX0A 5KYWB 1SZIA 3U3BA 2HJ3A 5HV9A 4YT2A 5T3WA 2J9VA 4CJGA 4I1MA 1CPQA 3EFOA 4MVRA 2Y39A 3B9QA 3Q6NA 2DGJA 1XZQA 3HNJA 1GM5A 3Q7LA 3EGDB 3ASNC 2Q9CA 1LS4A 3M1CB 4FESA 4DRIB 2H7VC 1WWPA 2L6GA 2ZXOA 3EGXB 4O6YA 1XWJA 4PACA 2C04A 2A6HF 2JX0A 3C8GA 2J0XA 1TWHA 3KH2A 3RH3A 2EIMC 1M57C 5F28E 3SP1A 2LK4A 1A7VA 1O3UA 5T3TA 4K0DA 2W4BA 2R9RB 2F22A 2WZFA 3FVYA 2KSFA 4Z9JA 3TOLA 3JZ0A 2BC5A 3LUTB 1HMOA 1OQCA 4AE4A 2R05A 2V26A 3T4RA 2EPKX 2XM4A 3DXJF 5TJ5E 1Z3IX 3LS0A 1YJGA 2OEVA 2ZXPA 2XLOA 4PR9A 1C02A 3EG9A 1H9TA 2L7AA 3GODA 3POVA 1A41A 2WVQA 4OIRF 2NUPB 2R7QA 2Q00A 1OXKA 4JEBA 3U0CA 1APCA 2YEVA 4AL0A 3DAFA 4GEHA 1BR1A 3H2VA 3OWTA 5AC5A 2R7RA 2DB4A 2UUIA 2DI3A 5CI8A 3RQEA 1DOVA 2KK1A 3DZAA 3L8IA 2XLDA 1ORSC 3GANA 1LM3B 2ETSA 2PX3A 1W2WA 3UGOA 4ZLDA 1V55C 4IAOA 1T5OA 1ZYRF 4C3DA 3NG1A 1D0XA 1HW1A 2KQ9A 4MW3A 4XPXA 5DVWA 4Q5SF 2QE9A 3LEVA 3MBGA 5DQTA 3QTHA 5BQIA 3C8ZA 2L9JA 1E85A 2CNWA 2YKZA 2Q9AA 3B0UX 4OIQF 4H54A 2X51A 3K66A 4JW1A 3HJCA 1TFOB 2EPOA 4R32A 4Q4ZF 1ZHYA 1SMYF 2AWYA 1V74B 4MVOA 4MQ9F 3WHNA 4PFOA 1D1BA 2HMQA 2IXOA 3MLGA 1FAPB 1M56C 1YVIA 4O6MA 1T9KA 4Z9IA 2Q7RA 2H7OA 5EK0A 3SZRA 1Z6AA 3ZDLA 1LPEA 3GEEA 5FZTA 1VOMA 3UMHA 4JZAA 4BJ5A 4LLCA 5EHHA 2B0JA 3LNRA 4MVSA 5BQGA 1ZU4A 3NMKA 2XXAB 1RXQA 5A69A 1OCCC 3W4YA 4PJJA 1I4YA 2OKUA 3IPMO 4G0HA 4JVSA 4MNDA 1TQGA 3SEOA 4DBRA 3VRCA 1EKYA 4U5FE 2DYSC 2QTVA 4XEKA 5KYUB 3FMSA 3EHMA 1Y6DA 1S05A 2ZPAA 2CCYA 2PFDA 4LDRA 2KNHA 5K0IA 3CAXA 4LACB 3EHNA 1AVOB 1ZHXA 2LP4A 2HJMA 2A1DD 2P61A 3CEXA 3K33A 2R25A 3DI5A 1RCPA 3KL4A 4KNWA 4Q7CA 1TWGA 4DVZA 1Q0GA 2R7TA 1RJ9B 1WN0A 3W8IA 4JTAB 2EPMX 2IXPA 4E7ZA 3LNMB 1OW6A 1BR2A 2RD9A 1WTYA 2EILC 5E2QA 1A0BA 1SR2A 2GFHA 4E17A 1OW8A 1EQ1A 1BZ4A 3L0IA 2D5RB 3O10A 2LSEA 5JT4A 1CGME 2CDQA 5IY5C 1KU2A 2OG2A 1Z5ZA 4U5GA 1JR8A 1C03A 1YARO 4NCQA 3O6XA 5L0GA 1MQVA 3HNIA 2AU5A 1U6HA 4JEAA 3UR3C 4XLNF 2R7SA 1Q0FA 4EKWA 2QUPA 5B3SC 4OIPF 5JUAA 3GEHA 2EINC 3S0XA 1IW7F 3B0PA 3L34A 4RD9A 1O5HA 2WB7A 2XLVA 2YLDA 3IQ5A 2A68F 4U5HA 3IQCA 4WABA 3T9OA 2O9XA 2OEXA 3LS1A 3Q7GA 1YA7O 3AG1C 2G3KA 2YLGA 2R03A 2YHSA 1TKNA 4E0HA 1NBBA 1JOGA 2KC3A 2YL3A 5A6BA 2M4EA 3O39A 4CS8C 1NZEA 3S84A 1TWAA 4XEFA 4XPYA 1F1MA 3G4ZA 4NTFA 5T1DB 4B6IA 1WASA 2XL4A 2C03A 5JP7A 2P6VA 3MX3A 3F47A 5JLIA 4J7YA 3S27A 4CBEA 2UUHA 3RVZA 2I8BA 4BG0A 3MYIA 1XZPA 3DKAA 3I5PA 4J7TA 2HFIA 4AL1A 3QVZA 1ORJA 3TJ6A 3JYHA 3US6A 4DOZA 4E18A 1QZXA 3C8GB 2XL6A 2AWCA 4CS7A 3FDQA 2YLIA 4MW8A 1RMVA 2ICWG 2NSGA 3K1HA 5DS5A 1HE1A 2L6HA 2J9UA 2W9YA 1OKKA 2GA0A 2Y3GA 3JSEO 4AE4B 1ZW2A 1LI7A 1EI7A 1YA9A 1CPRA 1ZVZA 5EGYA 4YWQA 1V54C 1FMVA 2Z15A 3M4BA 3PCVA 5JSLA 1YDIA 1ZHTA 2LFDA 2WZLA 4FX5A 1QKRA 4N06A 2PNOA 3LAYA 1HE9A 3EG9B 4DBQA 2IXNA 4JJFA 3L8JA 2CGEA 2EIJC 3K1IA 4FWVA 2Y69C 5KYXB 3ABLC 4N4WA 2NUTA 2R7XA 3AGUA 3GWLA 3L1MA 2J7PD 3EGDA 4AK9A 3T6BA 2Q9BA 3JRMO 3RF3A 4MTGA 5JRAA 3R7CA 4YN0B 4MS2A 2AP3A 1Q0KA 1ZHZA 2HUJA 2QNLA 1GQAA 3IQTA 4IWBA 2Q3TA 3FOOA 3B29A 2WZGA 1D1CA 2LFFA 3K6BA 3J06A 3K1IC 1HY5A 5B1BC 2BL2A 5AC4A 4OINF 2OCCC 1IZMA 1CGNA 2HV6A 4WJ0A 2NSFA 1LVKA 4MVZA 1NU9C 3C8GD 3NKDA 5E3CA 2ASRA 4MVUA 3ZSUA 4BJTA 4G7ZF 2HS5A 4IRUA 3H65A 3NDBB 3MFNA 2HKVA 2YQYA 1ZZPA 1BR4A 2IYLD 4JJGA 4CDVA 4P9FA 2JPUA 3ZWIA 4LERA 4HFFB 4P6IC 4O7GA 3ZTMA 1FFHA 2ZXRA 1UFBA 2XS8A 4IJJA 5DS4A 1KNYA 2NUPA 1VMAA 3ITFA 2HZ8A 3QVYA 4CIHA 3SXMA 3HKKA 1EA8A 4I3MA 1M2VA 2IOQA 4IAQA 1YLMA 3GORA 4BPMA 1MMDA 4EBKA 3TQOA 1VTMP 4PJLA 4A4AA 3ZIBA 3ZQYA 4D4NA 1QQ3A 2CW0F 4MVMA 2NPUA 1ORYA 2J9BA 3ABMC 4IARA 1MNDA 4MTOA 4PFPA 3TD7A 1E86A 3FHDA 2FFHA 3JRTA 5CI9A 2VCAA 5A6JA 3A11A 4WGYA 5AGFA 2G3VA 3U5SA 5L0FA 1Q0DA 3ZTZA 4NY3A 1Z7Qc 4JTDB 4RDAA 5JS5A 4CDAA 3KPHA 1J8MF 4AX2A 5L0CA 3NMIA 3UNGC 2PBEA 4OIOF 4HFKB 2PP4A
chains in the Genus database with same CATH topology
4YL0A 4J7TA 4JC7A 4AL1A 4YK5A 4WABA 4JRZA 4AL0A 4NTBA 3HKKA 5K0IA 4NTAA 4BPMA 2Q7RA 3LEOA 3B29A 2UUIA 4YL3A 2H8AA 3DWWA 5BQGA 4JCZA 4NTFA 3PCVA 5BQHA 2PNOA 5BQIA 4J7YA 5HV9A 4YL1A 2UUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL0 A;  4J7T A;  4JC7 A;  4AL1 A;  4YK5 A;  4WAB A;  4JRZ A;  4AL0 A;  4NTB A;  3HKK A;  5K0I A;  4NTA A;  4BPM A;  2Q7R A;  3LEO A;  3B29 A;  2UUI A;  4YL3 A;  2H8A A;  3DWW A;  5BQG A;  4JCZ A;  4NTF A;  3PCV A;  5BQH A;  2PNO A;  5BQI A;  4J7Y A;  5HV9 A;  4YL1 A;  2UUH A; 
#chains in the Genus database with same CATH topology
 2HSQ A;  4K1O A;  5E33 A;  3M4C A;  1M6T A;  4MTF A;  3ATP A;  3U3F A;  4DXW A;  1KTM A;  1MMA A;  1TFK B;  1T6I A;  2CNW D;  2GWW A;  2YL0 A;  3SXK A;  1VLS A;  2KW3 C;  3LEO A;  5DS6 A;  2HMZ A;  4DJ9 A;  5L0J A;  4DRH B;  3CZ6 A;  3EJN A;  3IQ6 A;  2A0U A;  5BUO A;  3ASO C;  4JCZ A;  2YRF A;  3RVY A;  2XM0 A;  4EIY A;  4C7O A;  1I4Z A;  1E2X A;  1SYQ A;  2L81 A;  1LS1 A;  1PD0 A;  5BQH A;  5KYY A;  4LDQ A;  4U9D A;  2R7O A;  2IBF A;  4O6N A;  1PCX A;  5L0I A;  5L3Q A;  1LE2 A;  2B0H A;  2KYH A;  3KKB A;  3GM2 A;  5F5H A;  1E83 A;  3C18 A;  3QW1 A;  3ECS A;  4JC7 A;  3TJ5 A;  2VB6 A;  3U9J A;  4YK5 A;  2ZD9 A;  4JIO A;  1QLE C;  4KC9 A;  4X0R A;  2CYD A;  2OOC A;  3S29 A;  3X2Q C;  1D1A A;  1VLT A;  2OQM A;  4XPW A;  3QMK A;  1B68 A;  2XLM A;  4DRJ B;  3A9C A;  3JYY A;  4N6H A;  4OD5 A;  1WAT A;  1D0Y A;  3DE9 A;  1NSG B;  1NU7 D;  1FFT C;  4EBB A;  5L3V A;  3RIP A;  3TUL A;  1OW7 A;  2XLW A;  1OR2 A;  4EUK B;  2VH3 A;  4XEV A;  2HV7 A;  1YYJ A;  2EPN A;  5COF A;  1RKE A;  2NG1 A;  2Y3H A;  4ZLC A;  2L6F A;  3EFO B;  4QI0 A;  1U89 A;  1NFO A;  3GEI A;  256B A;  2J0W A;  3I4U A;  4E7S A;  1JRA A;  3U2L A;  2YVK A;  4LDK A;  3VF0 A;  1NG1 A;  4JRZ A;  3RQF A;  2I15 A;  3AJM A;  3U8P A;  4CS9 A;  3LLI A;  4UDV A;  3I5Q A;  3OEO A;  1NFN A;  3V5Z A;  1ZW3 A;  2J46 A;  4M63 A;  4OD4 A;  3NYJ A;  1K40 A;  2BE5 F;  5A6B D;  3FOP A;  2EPL X;  4KBL A;  1QVX A;  2FAP B;  3W8H A;  5HSW A;  4QI2 A;  4U5B E;  1K04 A;  3U9M A;  3ZG1 A;  4CS9 C;  4PJN A;  1FR0 A;  1O87 A;  2OU6 A;  1J8Y F;  2QLA A;  2W45 A;  2ZXW C;  3JTL O;  3DJU B;  3S90 A;  1OCZ C;  4N6C A;  1LE4 A;  4CX9 A;  4BJ6 C;  2TMV P;  3E9V A;  1A7E A;  2XSE A;  2YL7 A;  1BBH A;  3EH2 A;  2E87 A;  2MHR A;  3NYM A;  4G78 A;  4NQF A;  3SXY A;  5COG A;  5KYW A;  1HW2 A;  2R7U A;  1YYX A;  2NUT B;  3RKO F;  4CSA A;  1L3P A;  4YL0 A;  3JCU Q;  3LJB A;  1FTS A;  1G5Z A;  1GS9 A;  3PMR A;  4MVQ A;  4J32 B;  4F4B A;  5D91 A;  2EIK C;  3GWN A;  2LD6 A;  2XRH A;  3C7J A;  1Y4C A;  1G4U S;  3EGX A;  3EZI A;  1CGO A;  1QSP A;  2P7V A;  5D92 A;  3SNH A;  4BEJ A;  1Z63 A;  4CSA C;  1VK5 A;  5GPG B;  3NKE A;  4XTK A;  2Y3B A;  4U5E E;  2GAQ A;  3N24 A;  1LKX A;  3SXZ A;  4HEA J;  4JUR I;  2LQG A;  4YJW A;  2A6E F;  3AQC A;  1GGQ A;  2A69 F;  2OJE D;  1RKC A;  1ZHW A;  3WAQ A;  1PV3 A;  1C17 M;  4LLE A;  2XLH A;  3G4X A;  3F46 A;  1AUE A;  1OKK D;  4XQ1 A;  4CS8 A;  2R7V A;  2KJG A;  1Q0M A;  1LIH A;  2RSE B;  4ONS A;  1YZA A;  1H9G A;  2J45 A;  1OCR C;  1QPU A;  3W2W A;  3O55 A;  4PJM A;  2V3C C;  5A6A A;  2D4U A;  1FMW A;  1M2V B;  3E70 C;  3LES A;  2IXM A;  1M2O A;  2VCC A;  3CQZ A;  3IHU A;  4I1O B;  3DM9 B;  3RYL A;  3HNL A;  1MMG A;  3TK0 A;  4D4X A;  3ZC4 A;  1DOW A;  4YT8 A;  1G4W R;  3GM1 A;  3V5X A;  4BJ1 A;  2QY9 A;  4ULW A;  4W8K A;  3RQG A;  1V4A A;  2MWQ A;  3FAJ A;  1R4T A;  3WG7 C;  5L0H A;  3C63 A;  4EWC A;  3DM5 A;  1H7I A;  2LIG A;  3AG3 C;  4U5C E;  3V7O A;  3ZQV A;  4A2N B;  4YT4 A;  2FGY A;  5B3I A;  4EHP A;  1H6G A;  1PD1 A;  2PF4 E;  2X0C A;  4JKV A;  4G7O F;  5E3A A;  3ZVR A;  4NC3 A;  2LCH A;  2DYR C;  1T01 A;  3S9O A;  2GDC A;  2YZS A;  4BEM J;  1TR2 A;  3NMJ A;  5A6K A;  5DQZ A;  5L0D A;  4W8P A;  3W2V A;  1YZC A;  4YL1 A;  3EQL F;  2YWA A;  4XWJ A;  1VYI A;  4U5D E;  1U0B B;  4JE9 A;  2J9W A;  4DVY P;  1HMD A;  3N2Z B;  1JPJ A;  3DMD A;  3DAG A;  3N0T A;  4WGZ A;  3EZH A;  3DD7 A;  3GM3 A;  4U9E A;  1R5I D;  2YL1 A;  3G50 A;  3JSZ A;  4NTA A;  4CJO A;  2P1A A;  1N1C A;  2VAS A;  3BRJ A;  3EH1 A;  3RW0 A;  1WOL A;  4GYT A;  3WOD F;  1WGW A;  3SYN A;  2XLE A;  3C62 A;  4L6R A;  3B0V C;  4JTC B;  4C7O B;  2WVO A;  1AEP A;  3KMI A;  3PHF 2;  5KYY B;  2XXA A;  4RBN A;  3OA1 A;  4PK4 A;  1JAF A;  1T6Q A;  3VAY A;  4E0I A;  1VYK A;  1YAU O;  4BJ5 C;  2J8W A;  1I5N A;  1OCO C;  3AQB A;  4FAP B;  5KYU A;  4G7H F;  2KGO A;  3JT1 A;  3QW0 A;  1ST6 A;  3DJN B;  1NLX A;  4C3E A;  4ANJ A;  5JVE A;  3KYI A;  1ZU5 A;  3NRH A;  2VCB A;  1BDJ B;  4CDY A;  3UMK A;  4YT5 A;  2P0N A;  5B1A C;  2AVK A;  5KYX A;  4JCH A;  1A7D A;  1JPN A;  3AG2 C;  3FXH A;  3NYL A;  3U8V A;  3ABK C;  3CSK A;  4HE8 D;  1RJ9 A;  3HTK C;  1TWC A;  3X1O A;  2IM8 A;  1OXB A;  3HNK A;  5KYN A;  3IEE A;  2XL8 A;  3K7D A;  3AG4 C;  4YL3 A;  4C3B A;  2HSB A;  3VYW A;  4ER9 A;  4QDL A;  5DLJ A;  5CIV A;  2H7B A;  3T6J A;  1D0Z A;  2WL8 A;  3DWW A;  2XS1 A;  3V5Y A;  3S28 A;  1MNE A;  1Z23 A;  2R02 A;  2W4M A;  5F5F A;  3EPV A;  3QZC A;  1JMW A;  4Z9H A;  2M64 A;  2WVN A;  1RKE B;  4GQH A;  2JD3 A;  3U2M A;  3PDM P;  1VB5 A;  2MYS A;  2A0B A;  1S7Z A;  3MYF A;  4ULV A;  4EBJ A;  1LI5 A;  4K7B A;  3T6G B;  1MMN A;  3KYJ A;  4J30 B;  1E84 A;  3R2P A;  3TOM A;  2Q4F A;  4KNV A;  2VC9 A;  3AOU A;  2G62 A;  1G8X A;  4NTB A;  3DE8 A;  1UG7 A;  4CIP A;  3B71 A;  4XLP F;  3RFY A;  3BEH A;  3HLZ A;  3M79 A;  5FCL A;  4IB4 A;  5COM A;  4O79 A;  1OR3 A;  2H8A A;  2Y3D A;  4BJ6 A;  1SF8 A;  1L7C A;  3VM6 A;  3H2U A;  3LLK A;  3UMI A;  3FAP B;  4P9T A;  3Q6M A;  4KI2 A;  3M15 A;  3AGT A;  4I44 A;  1K05 A;  4H4K C;  1FNT c;  2R7W A;  1T6U A;  3UGP A;  4IGG A;  2OJQ A;  2J7P A;  2PX0 A;  5KYW B;  1SZI A;  3U3B A;  2HJ3 A;  5HV9 A;  4YT2 A;  5T3W A;  2J9V A;  4CJG A;  4I1M A;  1CPQ A;  3EFO A;  4MVR A;  2Y39 A;  3B9Q A;  3Q6N A;  2DGJ A;  1XZQ A;  3HNJ A;  1GM5 A;  3Q7L A;  3EGD B;  3ASN C;  2Q9C A;  1LS4 A;  3M1C B;  4FES A;  4DRI B;  2H7V C;  1WWP A;  2L6G A;  2ZXO A;  3EGX B;  4O6Y A;  1XWJ A;  4PAC A;  2C04 A;  2A6H F;  2JX0 A;  3C8G A;  2J0X A;  1TWH A;  3KH2 A;  3RH3 A;  2EIM C;  1M57 C;  5F28 E;  3SP1 A;  2LK4 A;  1A7V A;  1O3U A;  5T3T A;  4K0D A;  2W4B A;  2R9R B;  2F22 A;  2WZF A;  3FVY A;  2KSF A;  4Z9J A;  3TOL A;  3JZ0 A;  2BC5 A;  3LUT B;  1HMO A;  1OQC A;  4AE4 A;  2R05 A;  2V26 A;  3T4R A;  2EPK X;  2XM4 A;  3DXJ F;  5TJ5 E;  1Z3I X;  3LS0 A;  1YJG A;  2OEV A;  2ZXP A;  2XLO A;  4PR9 A;  1C02 A;  3EG9 A;  1H9T A;  2L7A A;  3GOD A;  3POV A;  1A41 A;  2WVQ A;  4OIR F;  2NUP B;  2R7Q A;  2Q00 A;  1OXK A;  4JEB A;  3U0C A;  1APC A;  2YEV A;  4AL0 A;  3DAF A;  4GEH A;  1BR1 A;  3H2V A;  3OWT A;  5AC5 A;  2R7R A;  2DB4 A;  2UUI A;  2DI3 A;  5CI8 A;  3RQE A;  1DOV A;  2KK1 A;  3DZA A;  3L8I A;  2XLD A;  1ORS C;  3GAN A;  1LM3 B;  2ETS A;  2PX3 A;  1W2W A;  3UGO A;  4ZLD A;  1V55 C;  4IAO A;  1T5O A;  1ZYR F;  4C3D A;  3NG1 A;  1D0X A;  1HW1 A;  2KQ9 A;  4MW3 A;  4XPX A;  5DVW A;  4Q5S F;  2QE9 A;  3LEV A;  3MBG A;  5DQT A;  3QTH A;  5BQI A;  3C8Z A;  2L9J A;  1E85 A;  2CNW A;  2YKZ A;  2Q9A A;  3B0U X;  4OIQ F;  4H54 A;  2X51 A;  3K66 A;  4JW1 A;  3HJC A;  1TFO B;  2EPO A;  4R32 A;  4Q4Z F;  1ZHY A;  1SMY F;  2AWY A;  1V74 B;  4MVO A;  4MQ9 F;  3WHN A;  4PFO A;  1D1B A;  2HMQ A;  2IXO A;  3MLG A;  1FAP B;  1M56 C;  1YVI A;  4O6M A;  1T9K A;  4Z9I A;  2Q7R A;  2H7O A;  5EK0 A;  3SZR A;  1Z6A A;  3ZDL A;  1LPE A;  3GEE A;  5FZT A;  1VOM A;  3UMH A;  4JZA A;  4BJ5 A;  4LLC A;  5EHH A;  2B0J A;  3LNR A;  4MVS A;  5BQG A;  1ZU4 A;  3NMK A;  2XXA B;  1RXQ A;  5A69 A;  1OCC C;  3W4Y A;  4PJJ A;  1I4Y A;  2OKU A;  3IPM O;  4G0H A;  4JVS A;  4MND A;  1TQG A;  3SEO A;  4DBR A;  3VRC A;  1EKY A;  4U5F E;  2DYS C;  2QTV A;  4XEK A;  5KYU B;  3FMS A;  3EHM A;  1Y6D A;  1S05 A;  2ZPA A;  2CCY A;  2PFD A;  4LDR A;  2KNH A;  5K0I A;  3CAX A;  4LAC B;  3EHN A;  1AVO B;  1ZHX A;  2LP4 A;  2HJM A;  2A1D D;  2P61 A;  3CEX A;  3K33 A;  2R25 A;  3DI5 A;  1RCP A;  3KL4 A;  4KNW A;  4Q7C A;  1TWG A;  4DVZ A;  1Q0G A;  2R7T A;  1RJ9 B;  1WN0 A;  3W8I A;  4JTA B;  2EPM X;  2IXP A;  4E7Z A;  3LNM B;  1OW6 A;  1BR2 A;  2RD9 A;  1WTY A;  2EIL C;  5E2Q A;  1A0B A;  1SR2 A;  2GFH A;  4E17 A;  1OW8 A;  1EQ1 A;  1BZ4 A;  3L0I A;  2D5R B;  3O10 A;  2LSE A;  5JT4 A;  1CGM E;  2CDQ A;  5IY5 C;  1KU2 A;  2OG2 A;  1Z5Z A;  4U5G A;  1JR8 A;  1C03 A;  1YAR O;  4NCQ A;  3O6X A;  5L0G A;  1MQV A;  3HNI A;  2AU5 A;  1U6H A;  4JEA A;  3UR3 C;  4XLN F;  2R7S A;  1Q0F A;  4EKW A;  2QUP A;  5B3S C;  4OIP F;  5JUA A;  3GEH A;  2EIN C;  3S0X A;  1IW7 F;  3B0P A;  3L34 A;  4RD9 A;  1O5H A;  2WB7 A;  2XLV A;  2YLD A;  3IQ5 A;  2A68 F;  4U5H A;  3IQC A;  4WAB A;  3T9O A;  2O9X A;  2OEX A;  3LS1 A;  3Q7G A;  1YA7 O;  3AG1 C;  2G3K A;  2YLG A;  2R03 A;  2YHS A;  1TKN A;  4E0H A;  1NBB A;  1JOG A;  2KC3 A;  2YL3 A;  5A6B A;  2M4E A;  3O39 A;  4CS8 C;  1NZE A;  3S84 A;  1TWA A;  4XEF A;  4XPY A;  1F1M A;  3G4Z A;  4NTF A;  5T1D B;  4B6I A;  1WAS A;  2XL4 A;  2C03 A;  5JP7 A;  2P6V A;  3MX3 A;  3F47 A;  5JLI A;  4J7Y A;  3S27 A;  4CBE A;  2UUH A;  3RVZ A;  2I8B A;  4BG0 A;  3MYI A;  1XZP A;  3DKA A;  3I5P A;  4J7T A;  2HFI A;  4AL1 A;  3QVZ A;  1ORJ A;  3TJ6 A;  3JYH A;  3US6 A;  4DOZ A;  4E18 A;  1QZX A;  3C8G B;  2XL6 A;  2AWC A;  4CS7 A;  3FDQ A;  2YLI A;  4MW8 A;  1RMV A;  2ICW G;  2NSG A;  3K1H A;  5DS5 A;  1HE1 A;  2L6H A;  2J9U A;  2W9Y A;  1OKK A;  2GA0 A;  2Y3G A;  3JSE O;  4AE4 B;  1ZW2 A;  1LI7 A;  1EI7 A;  1YA9 A;  1CPR A;  1ZVZ A;  5EGY A;  4YWQ A;  1V54 C;  1FMV A;  2Z15 A;  3M4B A;  3PCV A;  5JSL A;  1YDI A;  1ZHT A;  2LFD A;  2WZL A;  4FX5 A;  1QKR A;  4N06 A;  2PNO A;  3LAY A;  1HE9 A;  3EG9 B;  4DBQ A;  2IXN A;  4JJF A;  3L8J A;  2CGE A;  2EIJ C;  3K1I A;  4FWV A;  2Y69 C;  5KYX B;  3ABL C;  4N4W A;  2NUT A;  2R7X A;  3AGU A;  3GWL A;  3L1M A;  2J7P D;  3EGD A;  4AK9 A;  3T6B A;  2Q9B A;  3JRM O;  3RF3 A;  4MTG A;  5JRA A;  3R7C A;  4YN0 B;  4MS2 A;  2AP3 A;  1Q0K A;  1ZHZ A;  2HUJ A;  2QNL A;  1GQA A;  3IQT A;  4IWB A;  2Q3T A;  3FOO A;  3B29 A;  2WZG A;  1D1C A;  2LFF A;  3K6B A;  3J06 A;  3K1I C;  1HY5 A;  5B1B C;  2BL2 A;  5AC4 A;  4OIN F;  2OCC C;  1IZM A;  1CGN A;  2HV6 A;  4WJ0 A;  2NSF A;  1LVK A;  4MVZ A;  1NU9 C;  3C8G D;  3NKD A;  5E3C A;  2ASR A;  4MVU A;  3ZSU A;  4BJT A;  4G7Z F;  2HS5 A;  4IRU A;  3H65 A;  3NDB B;  3MFN A;  2HKV A;  2YQY A;  1ZZP A;  1BR4 A;  2IYL D;  4JJG A;  4CDV A;  4P9F A;  2JPU A;  3ZWI A;  4LER A;  4HFF B;  4P6I C;  4O7G A;  3ZTM A;  1FFH A;  2ZXR A;  1UFB A;  2XS8 A;  4IJJ A;  5DS4 A;  1KNY A;  2NUP A;  1VMA A;  3ITF A;  2HZ8 A;  3QVY A;  4CIH A;  3SXM A;  3HKK A;  1EA8 A;  4I3M A;  1M2V A;  2IOQ A;  4IAQ A;  1YLM A;  3GOR A;  4BPM A;  1MMD A;  4EBK A;  3TQO A;  1VTM P;  4PJL A;  4A4A A;  3ZIB A;  3ZQY A;  4D4N A;  1QQ3 A;  2CW0 F;  4MVM A;  2NPU A;  1ORY A;  2J9B A;  3ABM C;  4IAR A;  1MND A;  4MTO A;  4PFP A;  3TD7 A;  1E86 A;  3FHD A;  2FFH A;  3JRT A;  5CI9 A;  2VCA A;  5A6J A;  3A11 A;  4WGY A;  5AGF A;  2G3V A;  3U5S A;  5L0F A;  1Q0D A;  3ZTZ A;  4NY3 A;  1Z7Q c;  4JTD B;  4RDA A;  5JS5 A;  4CDA A;  3KPH A;  1J8M F;  4AX2 A;  5L0C A;  3NMI A;  3UNG C;  2PBE A;  4OIO F;  4HFK B;  2PP4 A; 
#chains in the Genus database with same CATH homology
 4YL0 A;  4J7T A;  4JC7 A;  4AL1 A;  4YK5 A;  4WAB A;  4JRZ A;  4AL0 A;  4NTB A;  3HKK A;  5K0I A;  4NTA A;  4BPM A;  2Q7R A;  3LEO A;  3B29 A;  2UUI A;  4YL3 A;  2H8A A;  3DWW A;  5BQG A;  4JCZ A;  4NTF A;  3PCV A;  5BQH A;  2PNO A;  5BQI A;  4J7Y A;  5HV9 A;  4YL1 A;  2UUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...