2UUIA

Crystal structure of human leukotriene c4 synthase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
155
structure length
155
Chain Sequence
MHHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Synthesis of Inflammatory Mediators by Human Leukotriene C4 Synthase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords LEUKOTRIENE C4 SYNTHASE
total genus 60
structure length 155
sequence length 155
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2uuiA00
4WABA 4YL1A 3B29A 3LEOA 2H8AA 4NTFA 4J7TA 4JCZA 4AL0A 4JRZA 5BQIA 5BQHA 4BPMA 4NTAA 2UUHA 4YK5A 3DWWA 3PCVA 4AL1A 4YL0A 4JC7A 5K0IA 4J7YA 3HKKA 5BQGA 2PNOA 2UUIA 4NTBA 4YL3A 2Q7RA 5HV9A
chains in the Genus database with same CATH superfamily
3GWLA 2XLOA 4CS9C 4C3EA 2HV6A 5A6JA 2OKUA 4OIPF 1WATA 3SYNA 1ORYA 4YT5A 4IARA 2KC3A 2ICWG 4ONSA 4C3DA 2Y3BA 3EPVA 4JCZA 4MVOA 4YWQA 1YZAA 1SZIA 3AGUA 4NTAA 2P0NA 2B0JA 2CGEA 5CI9A 1C17M 4YT4A 1FFHA 1YYJA 3CQZA 4RDAA 4DXWA 2FGYA 3S0XA 1GM5A 1BR2A 4PJJA 1FTSA 5T3WA 4NQFA 3GM1A 3LNMB 1K05A 2DGJA 2IM8A 3RIPA 3MX3A 3WHNA 2Q9AA 4FAPB 2XXAB 3ZQYA 3EGXA 4FX5A 2EIKC 3L0IA 3M4BA 2YL1A 1SR2A 2GA0A 3O6XA 4IRUA 3HNKA 3LS0A 4U9DA 3OEOA 3LNRA 4Q7CA 4U9EA 2YZSA 3CSKA 3RVYA 1EQ1A 3RQGA 2PX0A 3VYWA 1LPEA 4YK5A 4BJ5A 1TWAA 3PDMP 1HW2A 4CSAC 1VYIA 2VB6A 4A2NB 5HSWA 4OIRF 3EGDA 3U2MA 5BQIA 3IEEA 1CPQA 2QUPA 2XLVA 3K1IC 3U2LA 4BJ1A 2WVOA 4PACA 1LS1A 3C62A 3QTHA 4E0HA 4CJGA 1U0BB 2Y3HA 5D91A 4P9TA 3TD7A 2P1AA 4RBNA 2R7TA 3BRJA 1A7VA 1OKKD 4F4BA 1R5ID 1RJ9B 1V4AA 3GWNA 4BG0A 5L3VA 3NRHA 4EBJA 4YT2A 1JOGA 3HNIA 2AU5A 1J8MF 5HV9A 3Q6NA 1I4ZA 4PJLA 3SXKA 3FXHA 3LLIA 1R4TA 3SEOA 3KYIA 3KYJA 5DQTA 5KYXA 1ZHYA 3KMIA 2R7OA 4H4KC 1WASA 3NKEA 3OWTA 2ASRA 4K0DA 3DD7A 4IGGA 4JRZA 3EFOB 1T5OA 3CEXA 3G4ZA 4BJTA 1Z63A 1ST6A 3QMKA 2J7PA 3JSEO 2V26A 4JJFA 3H2VA 5JRAA 4IWBA 3VRCA 4KNVA 5GPGB 1NG1A 3AJMA 3VAYA 4MVUA 3U5SA 4G7OF 3TOMA 5D92A 1DOVA 3M15A 3X1OA 4BJ6C 4EHPA 1V74B 3LAYA 2YWAA 1OR3A 4AX2A 4XLPF 5A6KA 2XLEA 1TFKB 2XXAA 4LDKA 3K1IA 4MQ9F 3JCUQ 2W45A 2CNWD 3DKAA 5L0GA 1L3PA 4U5FE 3HLZA 3N24A 2BE5F 2XL8A 4O6MA 1QVXA 4CSAA 1JAFA 5F5FA 3ATPA 1Z23A 4WABA 2W9YA 4O79A 2A6HF 2MWQA 2YEVA 2GAQA 4ZLCA 4AK9A 2Z15A 3LEOA 1GGQA 4MTOA 4G0HA 4Z9HA 2EPMX 4Q4ZF 4XPYA 4NC3A 1ZHWA 1NZEA 2KK1A 3ZTMA 2KYHA 2M64A 3BEHA 2L6HA 4YN0B 2UUHA 4H54A 1JR8A 2F22A 4I3MA 1O87A 2YRFA 4XLNF 5JT4A 4ANJA 3ZG1A 2V3CC 2L6GA 3L1MA 1HMDA 2ETSA 3ECSA 4IAOA 3X2QC 3LUTB 5K0IA 3UGOA 1QQ3A 4JVSA 5L0JA 1RJ9A 2KGOA 2XLDA 4MVMA 3V7OA 4CS7A 3H65A 2NSGA 2NSFA 2RD9A 4NY3A 1K04A 2EPKX 4LDRA 4PFOA 1ZHTA 2LP4A 2IXPA 3DMDA 1S7ZA 4W8PA 5A69A 2OOCA 2Q9BA 3NYJA 3GM2A 1ORJA 1A41A 1EA8A 1FR0A 1NFOA 1D0ZA 3C7JA 4JJGA 2AWYA 3RW0A 3T4RA 3E70C 2QNLA 4CIPA 4KI2A 1AEPA 1YYXA 1MNDA 4CS8C 5BQHA 1CPRA 2A6EF 2YL3A 4MVQA 1M6TA 3N2ZB 3ZWIA 3SXYA 4DJ9A 2I15A 4JZAA 1HY5A 1MMNA 2LK4A 4JE9A 3T6BA 4JKVA 2L9JA 3DI5A 4EIYA 2OG2A 5COMA 1D0YA 1S05A 1KTMA 5E3AA 2OJED 5DS5A 1VLTA 5AC5A 3GANA 1BR4A 4OIOF 2YKZA 2J0WA 4U5BE 1LS4A 2HZ8A 4BJ6A 2DI3A 2EINC 1MMDA 2VCBA 2LFDA 2LFFA 2YHSA 3H2UA 1YZCA 2Y3GA 3DAFA 3I5QA 2O9XA 2UUIA 3ITFA 3NYLA 4N6CA 3FOPA 4XTKA 2R7UA 2X51A 4E18A 5A6AA 4NCQA 5JLIA 1BZ4A 2HSQA 3SNHA 2G3KA 2HS5A 3B29A 1T9KA 2H8AA 1E2XA 1FMWA 3EH1A 4NTFA 3W8IA 3JRMO 2W4BA 4RD9A 2HJMA 3VM6A 4GYTA 5FZTA 3LJBA 1J8YF 2CDQA 1U89A 4ZLDA 1OXKA 1K40A 1C02A 5L0CA 2YL0A 2NUPA 1M2OA 2PF4E 3ABKC 3B9QA 4WGYA 5DQZA 3GEIA 3UMIA 5T3TA 4U5GA 3TK0A 3UMHA 4OINF 1HW1A 1PCXA 3DAGA 4G7HF 256BA 3ABLC 5KYYB 2NG1A 3ABMC 1HE1A 1QKRA 2R7QA 3C8GB 3EH2A 2WZGA 3EJNA 5KYUB 1CGME 3N0TA 2OCCC 4PJNA 4ULVA 5JSLA 2FFHA 4JEAA 2NUPB 2OEVA 1E83A 1LVKA 4KC9A 3I5PA 2A68F 3MFNA 4J7TA 1G4WR 3HNJA 1LE4A 3JYYA 3DZAA 2ZXWC 4X0RA 4B6IA 1ORSC 1YJGA 1D0XA 2PX3A 1VK5A 3AG4C 3EGXB 4R32A 2CW0F 3JT1A 1T6QA 3TOLA 2X0CA 3U9JA 2A0UA 4IB4A 3WODF 4C7OB 3Q6MA 3PCVA 1Z5ZA 4JTCB 1T6UA 4IJJA 5JVEA 2LQGA 3U8VA 1FAPB 3F46A 3DE9A 2IXOA 1YLMA 2VCCA 2QY9A 1QLEC 4MVSA 4P9FA 1IW7F 2XS8A 2VASA 1G8XA 2XM0A 2XS1A 2JPUA 3R2PA 4LACB 4PJMA 4DRIB 4DRHB 1SMYF 4CS9A 4KNWA 2W4MA 4JURI 3EHNA 4DVZA 4AL0A 3WG7C 1APCA 4XQ1A 4KBLA 1WTYA 1XWJA 4OD5A 3ZSUA 4ULWA 1VB5A 3W2WA 3QZCA 5COGA 2DYRC 1HMOA 1NLXA 1OKKA 4GEHA 1Q0MA 2CCYA 1JPNA 3DWWA 3K1HA 4HFFB 2L6FA 2YLIA 4AL1A 2ZPAA 3M4CA 4PR9A 1EKYA 2GFHA 1TQGA 1FMVA 1A7DA 5JP7A 2Q00A 1A7EA 5JUAA 1FFTC 1PD1A 4MNDA 1JPJA 4K7BA 3C8GA 4I1OB 1RKEB 2PFDA 3EFOA 4HEAJ 5L0HA 2R05A 2VH3A 1Q0DA 2QLAA 2XL4A 3V5XA 4CJOA 3U0CA 2XSEA 4U5HA 4U5EE 1GS9A 1E86A 3MBGA 4EKWA 1MMAA 3FDQA 4QDLA 1TWGA 2Y39A 1HE9A 1XZPA 3AGTA 4QI2A 2R02A 3E9VA 1ZU5A 1ZYRF 3UR3C 3W8HA 1M2VB 3NYMA 2IBFA 5COFA 4XPXA 1T01A 2LSEA 1PD0A 1PV3A 2CNWA 1C03A 2OEXA 1RKEA 4M63A 4N4WA 3DXJF 2J45A 4U5DE 1ZU4A 2LD6A 1TFOB 4CDYA 3C8GD 4DVYP 2PBEA 4J32B 4HE8D 2Q9CA 4JC7A 3V5ZA 5B1AC 1VYKA 3B0PA 1H6GA 1G5ZA 2A1DD 2IXMA 3KL4A 3K6BA 5KYNA 2JX0A 2DB4A 2XRHA 1M2VA 1Z7Qc 3S29A 2Q7RA 1AUEA 1D1AA 1V54C 3OA1A 2J9VA 1TWHA 3JZ0A 3EHMA 5L0FA 5TJ5E 2J7PD 1M56C 3M79A 1XZQA 2C03A 2DYSC 4W8KA 2HKVA 1MQVA 1Y6DA 5CI8A 3UNGC 3T6GB 4Z9IA 4O6YA 2AP3A 3W4YA 3MYIA 2B0HA 1Q0FA 2KQ9A 2L81A 2E87A 2Y69C 3DJUB 3KH2A 4LDQA 4YJWA 1VTMP 3RFYA 2J9WA 1I5NA 5JS5A 4G7ZF 3ASNC 3O55A 4LERA 4AE4A 3JTLO 3PHF2 1VLSA 1KU2A 1VOMA 3HJCA 4N06A 3HKKA 2HMQA 4MW3A 2GDCA 3A11A 5E33A 2EIJC 4E0IA 4JCHA 3Q7LA 4NTBA 1V55C 1Y4CA 3JYHA 2QTVA 5KYYA 3RYLA 2H7BA 4FESA 2EPOA 2ZXPA 3AQBA 2A0BA 2EPLX 1WWPA 2YQYA 4IAQA 1U6HA 1Q0GA 2HSBA 1ZW3A 1WOLA 2M4EA 3KKBA 3UMKA 1LIHA 4XEVA 2XL6A 4JW1A 2P7VA 3B71A 3ZQVA 3ZDLA 4Z9JA 1I4YA 1L7CA 2ZD9A 2BC5A 4N6HA 1LE2A 1WGWA 1OCOC 2AWCA 1BBHA 2P6VA 3DJNB 3QW1A 4BEJA 5IY5C 3L8IA 1CGNA 1EI7A 4E17A 1T6IA 4MW8A 1NFNA 1W2WA 3GORA 2R9RB 1D1BA 3TQOA 3AG1C 3FVYA 4P6IC 4WGZA 3DM5A 3RVZA 4UDVA 1OR2A 3AOUA 2IXNA 3NMKA 3O10A 1RMVA 2H7OA 3I4UA 3SZRA 1YA7O 4U5CE 4YL3A 3US6A 5EK0A 1QSPA 2R25A 3R7CA 1NU9C 2J46A 1A0BA 2LIGA 1RKCA 2R03A 4YL1A 5DVWA 5FCLA 3T9OA 2ZXRA 4ER9A 4EBKA 2KJGA 4EWCA 3FOOA 3NG1A 2Q4FA 1OQCA 3EG9B 3JRTA 4BPMA 3G4XA 3QW0A 2QE9A 3J06A 3Q7GA 1O5HA 1B68A 2OJQA 4K1OA 3F47A 1YA9A 4DBQA 3SP1A 3QVYA 3VF0A 4EUKB 5KYUA 2HV7A 4MTFA 4YT8A 4FWVA 3EZHA 3FAPB 3ZIBA 3IQTA 2YLDA 2JD3A 4OIQF 5A6BA 1QPUA 1YDIA 4LLEA 5BQGA 2R7XA 3EG9A 4JEBA 1OCCC 4E7ZA 2WVQA 4A4AA 3POVA 1H7IA 3TJ6A 1OXBA 3FMSA 3SXMA 3TJ5A 2VC9A 4MVZA 5B3SC 2D5RB 2A69F 1Z3IX 3DE8A 2YVKA 2XLHA 3C8ZA 4HFKB 3U3BA 4C7OA 2ZXOA 3WAQA 4DOZA 1QZXA 2YLGA 3K66A 1MMGA 2OQMA 3ZTZA 1G4US 3HTKC 3NDBB 2Y3DA 4MTGA 1ZZPA 2HFIA 2WB7A 5EHHA 3ASOC 1LI5A 1WN0A 1RXQA 4LLCA 2BL2A 4PK4A 5L3QA 2KSFA 4O7GA 3IQ5A 4O6NA 5T1DB 3RQFA 2J8WA 2MHRA 3ZC4A 1IZMA 2WZFA 4XPWA 3S27A 3S9OA 2IOQA 5L0DA 5L0IA 1VMAA 2P61A 4J7YA 4JTDB 3LEVA 2J9UA 3RKOF 3EQLF 2R7VA 2R7WA 2PP4A 2MYSA 3IQCA 3K7DA 4CDAA 4PFPA 3C18A 2XLWA 3GODA 4BJ5C 1Q0KA 1ZHXA 2HMZA 2IYLD 3LESA 3FHDA 2XLMA 1O3UA 3FAJA 5EGYA 2EILC 2RSEB 2WVNA 4CIHA 1FNTc 2G62A 3CZ6A 1SYQA 3S28A 3U3FA 3L8JA 4CX9A 4DRJB 3S90A 5KYWA 2G3VA 2L7AA 4YL0A 2VCAA 3RQEA 3JSZA 1TR2A 4AE4B 5DS6A 1CGOA 2D4UA 3IPMO 1E84A 2LCHA 3AQCA 3IHUA 4GQHA 2J9BA 1LI7A 2NPUA 4OD4A 4BEMJ 5KYXB 3IQ6A 2AVKA 2XM4A 2NUTA 3T6JA 5F5HA 5A6BD 3NKDA 4I44A 3MLGA 5F28E 4MS2A 3CAXA 5KYWB 2J0XA 3NMIA 1OW7A 2GWWA 3C63A 4I1MA 3L34A 1F1MA 2YL7A 3A9CA 3UGPA 3G50A 1Z6AA 4Q5SF 4D4XA 1SF8A 1UFBA 2EPNA 1BDJB 3U8PA 5E3CA 1KNYA 3MYFA 4QI0A 4XEFA 1N1CA 3LS1A 1E85A 2HJ3A 2OU6A 3U9MA 5AC4A 2NUTB 5AGFA 1TKNA 1UG7A 1TWCA 2I8BA 3GEHA 1GQAA 4DBRA 1ZW2A 1OCZC 1H9TA 3B0UX 1BR1A 1LM3B 2Q3TA 2HUJA 3SXZA 1NU7D 1OW6A 2FAPB 2H7VC 1JRAA 3GM3A 3M1CB 1RCPA 3KPHA 3QVZA 5DS4A 5DLJA 1NBBA 1YAUO 4WJ0A 3B0VC 1DOWA 3DM9B 4MVRA 3W2VA 3PMRA 2R7RA 4D4NA 1M57C 3EZIA 5BUOA 1YVIA 2EIMC 5CIVA 1AVOB 5B1BC 3EGDB 4CDVA 1OW8A 2KW3C 3RF3A 3ZVRA 2C04A 1ZVZA 1NSGB 3TULA 2KNHA 1D1CA 3K33A 4XWJA 4C3BA 4E7SA 1LKXA 2WZLA 3S84A 2R7SA 1MNEA 3NMJA 3V5YA 4G78A 4EBBA 2TMVP 2WL8A 1YARO 3RH3A 3O39A 4J30B 3GEEA 4JIOA 1JMWA 4XEKA 5B3IA 1H9GA 3LLKA 3AG2C 1ZHZA 2PNOA 2CYDA 1OCRC 5E2QA 4CS8A 3AG3C 4L6RA 4CBEA 4JTAB 3HNLA
chains in the Genus database with same CATH topology
4WABA 4YL1A 3B29A 3LEOA 2H8AA 4NTFA 4J7TA 4JCZA 4AL0A 4JRZA 5BQIA 5BQHA 4BPMA 4NTAA 2UUHA 4YK5A 3DWWA 3PCVA 4AL1A 4YL0A 4JC7A 5K0IA 4J7YA 3HKKA 5BQGA 2PNOA 2UUIA 4NTBA 4YL3A 2Q7RA 5HV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WAB A;  4YL1 A;  3B29 A;  3LEO A;  2H8A A;  4NTF A;  4J7T A;  4JCZ A;  4AL0 A;  4JRZ A;  5BQI A;  5BQH A;  4BPM A;  4NTA A;  2UUH A;  4YK5 A;  3DWW A;  3PCV A;  4AL1 A;  4YL0 A;  4JC7 A;  5K0I A;  4J7Y A;  3HKK A;  5BQG A;  2PNO A;  2UUI A;  4NTB A;  4YL3 A;  2Q7R A;  5HV9 A; 
#chains in the Genus database with same CATH topology
 3GWL A;  2XLO A;  4CS9 C;  4C3E A;  2HV6 A;  5A6J A;  2OKU A;  4OIP F;  1WAT A;  3SYN A;  1ORY A;  4YT5 A;  4IAR A;  2KC3 A;  2ICW G;  4ONS A;  4C3D A;  2Y3B A;  3EPV A;  4JCZ A;  4MVO A;  4YWQ A;  1YZA A;  1SZI A;  3AGU A;  4NTA A;  2P0N A;  2B0J A;  2CGE A;  5CI9 A;  1C17 M;  4YT4 A;  1FFH A;  1YYJ A;  3CQZ A;  4RDA A;  4DXW A;  2FGY A;  3S0X A;  1GM5 A;  1BR2 A;  4PJJ A;  1FTS A;  5T3W A;  4NQF A;  3GM1 A;  3LNM B;  1K05 A;  2DGJ A;  2IM8 A;  3RIP A;  3MX3 A;  3WHN A;  2Q9A A;  4FAP B;  2XXA B;  3ZQY A;  3EGX A;  4FX5 A;  2EIK C;  3L0I A;  3M4B A;  2YL1 A;  1SR2 A;  2GA0 A;  3O6X A;  4IRU A;  3HNK A;  3LS0 A;  4U9D A;  3OEO A;  3LNR A;  4Q7C A;  4U9E A;  2YZS A;  3CSK A;  3RVY A;  1EQ1 A;  3RQG A;  2PX0 A;  3VYW A;  1LPE A;  4YK5 A;  4BJ5 A;  1TWA A;  3PDM P;  1HW2 A;  4CSA C;  1VYI A;  2VB6 A;  4A2N B;  5HSW A;  4OIR F;  3EGD A;  3U2M A;  5BQI A;  3IEE A;  1CPQ A;  2QUP A;  2XLV A;  3K1I C;  3U2L A;  4BJ1 A;  2WVO A;  4PAC A;  1LS1 A;  3C62 A;  3QTH A;  4E0H A;  4CJG A;  1U0B B;  2Y3H A;  5D91 A;  4P9T A;  3TD7 A;  2P1A A;  4RBN A;  2R7T A;  3BRJ A;  1A7V A;  1OKK D;  4F4B A;  1R5I D;  1RJ9 B;  1V4A A;  3GWN A;  4BG0 A;  5L3V A;  3NRH A;  4EBJ A;  4YT2 A;  1JOG A;  3HNI A;  2AU5 A;  1J8M F;  5HV9 A;  3Q6N A;  1I4Z A;  4PJL A;  3SXK A;  3FXH A;  3LLI A;  1R4T A;  3SEO A;  3KYI A;  3KYJ A;  5DQT A;  5KYX A;  1ZHY A;  3KMI A;  2R7O A;  4H4K C;  1WAS A;  3NKE A;  3OWT A;  2ASR A;  4K0D A;  3DD7 A;  4IGG A;  4JRZ A;  3EFO B;  1T5O A;  3CEX A;  3G4Z A;  4BJT A;  1Z63 A;  1ST6 A;  3QMK A;  2J7P A;  3JSE O;  2V26 A;  4JJF A;  3H2V A;  5JRA A;  4IWB A;  3VRC A;  4KNV A;  5GPG B;  1NG1 A;  3AJM A;  3VAY A;  4MVU A;  3U5S A;  4G7O F;  3TOM A;  5D92 A;  1DOV A;  3M15 A;  3X1O A;  4BJ6 C;  4EHP A;  1V74 B;  3LAY A;  2YWA A;  1OR3 A;  4AX2 A;  4XLP F;  5A6K A;  2XLE A;  1TFK B;  2XXA A;  4LDK A;  3K1I A;  4MQ9 F;  3JCU Q;  2W45 A;  2CNW D;  3DKA A;  5L0G A;  1L3P A;  4U5F E;  3HLZ A;  3N24 A;  2BE5 F;  2XL8 A;  4O6M A;  1QVX A;  4CSA A;  1JAF A;  5F5F A;  3ATP A;  1Z23 A;  4WAB A;  2W9Y A;  4O79 A;  2A6H F;  2MWQ A;  2YEV A;  2GAQ A;  4ZLC A;  4AK9 A;  2Z15 A;  3LEO A;  1GGQ A;  4MTO A;  4G0H A;  4Z9H A;  2EPM X;  4Q4Z F;  4XPY A;  4NC3 A;  1ZHW A;  1NZE A;  2KK1 A;  3ZTM A;  2KYH A;  2M64 A;  3BEH A;  2L6H A;  4YN0 B;  2UUH A;  4H54 A;  1JR8 A;  2F22 A;  4I3M A;  1O87 A;  2YRF A;  4XLN F;  5JT4 A;  4ANJ A;  3ZG1 A;  2V3C C;  2L6G A;  3L1M A;  1HMD A;  2ETS A;  3ECS A;  4IAO A;  3X2Q C;  3LUT B;  5K0I A;  3UGO A;  1QQ3 A;  4JVS A;  5L0J A;  1RJ9 A;  2KGO A;  2XLD A;  4MVM A;  3V7O A;  4CS7 A;  3H65 A;  2NSG A;  2NSF A;  2RD9 A;  4NY3 A;  1K04 A;  2EPK X;  4LDR A;  4PFO A;  1ZHT A;  2LP4 A;  2IXP A;  3DMD A;  1S7Z A;  4W8P A;  5A69 A;  2OOC A;  2Q9B A;  3NYJ A;  3GM2 A;  1ORJ A;  1A41 A;  1EA8 A;  1FR0 A;  1NFO A;  1D0Z A;  3C7J A;  4JJG A;  2AWY A;  3RW0 A;  3T4R A;  3E70 C;  2QNL A;  4CIP A;  4KI2 A;  1AEP A;  1YYX A;  1MND A;  4CS8 C;  5BQH A;  1CPR A;  2A6E F;  2YL3 A;  4MVQ A;  1M6T A;  3N2Z B;  3ZWI A;  3SXY A;  4DJ9 A;  2I15 A;  4JZA A;  1HY5 A;  1MMN A;  2LK4 A;  4JE9 A;  3T6B A;  4JKV A;  2L9J A;  3DI5 A;  4EIY A;  2OG2 A;  5COM A;  1D0Y A;  1S05 A;  1KTM A;  5E3A A;  2OJE D;  5DS5 A;  1VLT A;  5AC5 A;  3GAN A;  1BR4 A;  4OIO F;  2YKZ A;  2J0W A;  4U5B E;  1LS4 A;  2HZ8 A;  4BJ6 A;  2DI3 A;  2EIN C;  1MMD A;  2VCB A;  2LFD A;  2LFF A;  2YHS A;  3H2U A;  1YZC A;  2Y3G A;  3DAF A;  3I5Q A;  2O9X A;  2UUI A;  3ITF A;  3NYL A;  4N6C A;  3FOP A;  4XTK A;  2R7U A;  2X51 A;  4E18 A;  5A6A A;  4NCQ A;  5JLI A;  1BZ4 A;  2HSQ A;  3SNH A;  2G3K A;  2HS5 A;  3B29 A;  1T9K A;  2H8A A;  1E2X A;  1FMW A;  3EH1 A;  4NTF A;  3W8I A;  3JRM O;  2W4B A;  4RD9 A;  2HJM A;  3VM6 A;  4GYT A;  5FZT A;  3LJB A;  1J8Y F;  2CDQ A;  1U89 A;  4ZLD A;  1OXK A;  1K40 A;  1C02 A;  5L0C A;  2YL0 A;  2NUP A;  1M2O A;  2PF4 E;  3ABK C;  3B9Q A;  4WGY A;  5DQZ A;  3GEI A;  3UMI A;  5T3T A;  4U5G A;  3TK0 A;  3UMH A;  4OIN F;  1HW1 A;  1PCX A;  3DAG A;  4G7H F;  256B A;  3ABL C;  5KYY B;  2NG1 A;  3ABM C;  1HE1 A;  1QKR A;  2R7Q A;  3C8G B;  3EH2 A;  2WZG A;  3EJN A;  5KYU B;  1CGM E;  3N0T A;  2OCC C;  4PJN A;  4ULV A;  5JSL A;  2FFH A;  4JEA A;  2NUP B;  2OEV A;  1E83 A;  1LVK A;  4KC9 A;  3I5P A;  2A68 F;  3MFN A;  4J7T A;  1G4W R;  3HNJ A;  1LE4 A;  3JYY A;  3DZA A;  2ZXW C;  4X0R A;  4B6I A;  1ORS C;  1YJG A;  1D0X A;  2PX3 A;  1VK5 A;  3AG4 C;  3EGX B;  4R32 A;  2CW0 F;  3JT1 A;  1T6Q A;  3TOL A;  2X0C A;  3U9J A;  2A0U A;  4IB4 A;  3WOD F;  4C7O B;  3Q6M A;  3PCV A;  1Z5Z A;  4JTC B;  1T6U A;  4IJJ A;  5JVE A;  2LQG A;  3U8V A;  1FAP B;  3F46 A;  3DE9 A;  2IXO A;  1YLM A;  2VCC A;  2QY9 A;  1QLE C;  4MVS A;  4P9F A;  1IW7 F;  2XS8 A;  2VAS A;  1G8X A;  2XM0 A;  2XS1 A;  2JPU A;  3R2P A;  4LAC B;  4PJM A;  4DRI B;  4DRH B;  1SMY F;  4CS9 A;  4KNW A;  2W4M A;  4JUR I;  3EHN A;  4DVZ A;  4AL0 A;  3WG7 C;  1APC A;  4XQ1 A;  4KBL A;  1WTY A;  1XWJ A;  4OD5 A;  3ZSU A;  4ULW A;  1VB5 A;  3W2W A;  3QZC A;  5COG A;  2DYR C;  1HMO A;  1NLX A;  1OKK A;  4GEH A;  1Q0M A;  2CCY A;  1JPN A;  3DWW A;  3K1H A;  4HFF B;  2L6F A;  2YLI A;  4AL1 A;  2ZPA A;  3M4C A;  4PR9 A;  1EKY A;  2GFH A;  1TQG A;  1FMV A;  1A7D A;  5JP7 A;  2Q00 A;  1A7E A;  5JUA A;  1FFT C;  1PD1 A;  4MND A;  1JPJ A;  4K7B A;  3C8G A;  4I1O B;  1RKE B;  2PFD A;  3EFO A;  4HEA J;  5L0H A;  2R05 A;  2VH3 A;  1Q0D A;  2QLA A;  2XL4 A;  3V5X A;  4CJO A;  3U0C A;  2XSE A;  4U5H A;  4U5E E;  1GS9 A;  1E86 A;  3MBG A;  4EKW A;  1MMA A;  3FDQ A;  4QDL A;  1TWG A;  2Y39 A;  1HE9 A;  1XZP A;  3AGT A;  4QI2 A;  2R02 A;  3E9V A;  1ZU5 A;  1ZYR F;  3UR3 C;  3W8H A;  1M2V B;  3NYM A;  2IBF A;  5COF A;  4XPX A;  1T01 A;  2LSE A;  1PD0 A;  1PV3 A;  2CNW A;  1C03 A;  2OEX A;  1RKE A;  4M63 A;  4N4W A;  3DXJ F;  2J45 A;  4U5D E;  1ZU4 A;  2LD6 A;  1TFO B;  4CDY A;  3C8G D;  4DVY P;  2PBE A;  4J32 B;  4HE8 D;  2Q9C A;  4JC7 A;  3V5Z A;  5B1A C;  1VYK A;  3B0P A;  1H6G A;  1G5Z A;  2A1D D;  2IXM A;  3KL4 A;  3K6B A;  5KYN A;  2JX0 A;  2DB4 A;  2XRH A;  1M2V A;  1Z7Q c;  3S29 A;  2Q7R A;  1AUE A;  1D1A A;  1V54 C;  3OA1 A;  2J9V A;  1TWH A;  3JZ0 A;  3EHM A;  5L0F A;  5TJ5 E;  2J7P D;  1M56 C;  3M79 A;  1XZQ A;  2C03 A;  2DYS C;  4W8K A;  2HKV A;  1MQV A;  1Y6D A;  5CI8 A;  3UNG C;  3T6G B;  4Z9I A;  4O6Y A;  2AP3 A;  3W4Y A;  3MYI A;  2B0H A;  1Q0F A;  2KQ9 A;  2L81 A;  2E87 A;  2Y69 C;  3DJU B;  3KH2 A;  4LDQ A;  4YJW A;  1VTM P;  3RFY A;  2J9W A;  1I5N A;  5JS5 A;  4G7Z F;  3ASN C;  3O55 A;  4LER A;  4AE4 A;  3JTL O;  3PHF 2;  1VLS A;  1KU2 A;  1VOM A;  3HJC A;  4N06 A;  3HKK A;  2HMQ A;  4MW3 A;  2GDC A;  3A11 A;  5E33 A;  2EIJ C;  4E0I A;  4JCH A;  3Q7L A;  4NTB A;  1V55 C;  1Y4C A;  3JYH A;  2QTV A;  5KYY A;  3RYL A;  2H7B A;  4FES A;  2EPO A;  2ZXP A;  3AQB A;  2A0B A;  2EPL X;  1WWP A;  2YQY A;  4IAQ A;  1U6H A;  1Q0G A;  2HSB A;  1ZW3 A;  1WOL A;  2M4E A;  3KKB A;  3UMK A;  1LIH A;  4XEV A;  2XL6 A;  4JW1 A;  2P7V A;  3B71 A;  3ZQV A;  3ZDL A;  4Z9J A;  1I4Y A;  1L7C A;  2ZD9 A;  2BC5 A;  4N6H A;  1LE2 A;  1WGW A;  1OCO C;  2AWC A;  1BBH A;  2P6V A;  3DJN B;  3QW1 A;  4BEJ A;  5IY5 C;  3L8I A;  1CGN A;  1EI7 A;  4E17 A;  1T6I A;  4MW8 A;  1NFN A;  1W2W A;  3GOR A;  2R9R B;  1D1B A;  3TQO A;  3AG1 C;  3FVY A;  4P6I C;  4WGZ A;  3DM5 A;  3RVZ A;  4UDV A;  1OR2 A;  3AOU A;  2IXN A;  3NMK A;  3O10 A;  1RMV A;  2H7O A;  3I4U A;  3SZR A;  1YA7 O;  4U5C E;  4YL3 A;  3US6 A;  5EK0 A;  1QSP A;  2R25 A;  3R7C A;  1NU9 C;  2J46 A;  1A0B A;  2LIG A;  1RKC A;  2R03 A;  4YL1 A;  5DVW A;  5FCL A;  3T9O A;  2ZXR A;  4ER9 A;  4EBK A;  2KJG A;  4EWC A;  3FOO A;  3NG1 A;  2Q4F A;  1OQC A;  3EG9 B;  3JRT A;  4BPM A;  3G4X A;  3QW0 A;  2QE9 A;  3J06 A;  3Q7G A;  1O5H A;  1B68 A;  2OJQ A;  4K1O A;  3F47 A;  1YA9 A;  4DBQ A;  3SP1 A;  3QVY A;  3VF0 A;  4EUK B;  5KYU A;  2HV7 A;  4MTF A;  4YT8 A;  4FWV A;  3EZH A;  3FAP B;  3ZIB A;  3IQT A;  2YLD A;  2JD3 A;  4OIQ F;  5A6B A;  1QPU A;  1YDI A;  4LLE A;  5BQG A;  2R7X A;  3EG9 A;  4JEB A;  1OCC C;  4E7Z A;  2WVQ A;  4A4A A;  3POV A;  1H7I A;  3TJ6 A;  1OXB A;  3FMS A;  3SXM A;  3TJ5 A;  2VC9 A;  4MVZ A;  5B3S C;  2D5R B;  2A69 F;  1Z3I X;  3DE8 A;  2YVK A;  2XLH A;  3C8Z A;  4HFK B;  3U3B A;  4C7O A;  2ZXO A;  3WAQ A;  4DOZ A;  1QZX A;  2YLG A;  3K66 A;  1MMG A;  2OQM A;  3ZTZ A;  1G4U S;  3HTK C;  3NDB B;  2Y3D A;  4MTG A;  1ZZP A;  2HFI A;  2WB7 A;  5EHH A;  3ASO C;  1LI5 A;  1WN0 A;  1RXQ A;  4LLC A;  2BL2 A;  4PK4 A;  5L3Q A;  2KSF A;  4O7G A;  3IQ5 A;  4O6N A;  5T1D B;  3RQF A;  2J8W A;  2MHR A;  3ZC4 A;  1IZM A;  2WZF A;  4XPW A;  3S27 A;  3S9O A;  2IOQ A;  5L0D A;  5L0I A;  1VMA A;  2P61 A;  4J7Y A;  4JTD B;  3LEV A;  2J9U A;  3RKO F;  3EQL F;  2R7V A;  2R7W A;  2PP4 A;  2MYS A;  3IQC A;  3K7D A;  4CDA A;  4PFP A;  3C18 A;  2XLW A;  3GOD A;  4BJ5 C;  1Q0K A;  1ZHX A;  2HMZ A;  2IYL D;  3LES A;  3FHD A;  2XLM A;  1O3U A;  3FAJ A;  5EGY A;  2EIL C;  2RSE B;  2WVN A;  4CIH A;  1FNT c;  2G62 A;  3CZ6 A;  1SYQ A;  3S28 A;  3U3F A;  3L8J A;  4CX9 A;  4DRJ B;  3S90 A;  5KYW A;  2G3V A;  2L7A A;  4YL0 A;  2VCA A;  3RQE A;  3JSZ A;  1TR2 A;  4AE4 B;  5DS6 A;  1CGO A;  2D4U A;  3IPM O;  1E84 A;  2LCH A;  3AQC A;  3IHU A;  4GQH A;  2J9B A;  1LI7 A;  2NPU A;  4OD4 A;  4BEM J;  5KYX B;  3IQ6 A;  2AVK A;  2XM4 A;  2NUT A;  3T6J A;  5F5H A;  5A6B D;  3NKD A;  4I44 A;  3MLG A;  5F28 E;  4MS2 A;  3CAX A;  5KYW B;  2J0X A;  3NMI A;  1OW7 A;  2GWW A;  3C63 A;  4I1M A;  3L34 A;  1F1M A;  2YL7 A;  3A9C A;  3UGP A;  3G50 A;  1Z6A A;  4Q5S F;  4D4X A;  1SF8 A;  1UFB A;  2EPN A;  1BDJ B;  3U8P A;  5E3C A;  1KNY A;  3MYF A;  4QI0 A;  4XEF A;  1N1C A;  3LS1 A;  1E85 A;  2HJ3 A;  2OU6 A;  3U9M A;  5AC4 A;  2NUT B;  5AGF A;  1TKN A;  1UG7 A;  1TWC A;  2I8B A;  3GEH A;  1GQA A;  4DBR A;  1ZW2 A;  1OCZ C;  1H9T A;  3B0U X;  1BR1 A;  1LM3 B;  2Q3T A;  2HUJ A;  3SXZ A;  1NU7 D;  1OW6 A;  2FAP B;  2H7V C;  1JRA A;  3GM3 A;  3M1C B;  1RCP A;  3KPH A;  3QVZ A;  5DS4 A;  5DLJ A;  1NBB A;  1YAU O;  4WJ0 A;  3B0V C;  1DOW A;  3DM9 B;  4MVR A;  3W2V A;  3PMR A;  2R7R A;  4D4N A;  1M57 C;  3EZI A;  5BUO A;  1YVI A;  2EIM C;  5CIV A;  1AVO B;  5B1B C;  3EGD B;  4CDV A;  1OW8 A;  2KW3 C;  3RF3 A;  3ZVR A;  2C04 A;  1ZVZ A;  1NSG B;  3TUL A;  2KNH A;  1D1C A;  3K33 A;  4XWJ A;  4C3B A;  4E7S A;  1LKX A;  2WZL A;  3S84 A;  2R7S A;  1MNE A;  3NMJ A;  3V5Y A;  4G78 A;  4EBB A;  2TMV P;  2WL8 A;  1YAR O;  3RH3 A;  3O39 A;  4J30 B;  3GEE A;  4JIO A;  1JMW A;  4XEK A;  5B3I A;  1H9G A;  3LLK A;  3AG2 C;  1ZHZ A;  2PNO A;  2CYD A;  1OCR C;  5E2Q A;  4CS8 A;  3AG3 C;  4L6R A;  4CBE A;  4JTA B;  3HNL A; 
#chains in the Genus database with same CATH homology
 4WAB A;  4YL1 A;  3B29 A;  3LEO A;  2H8A A;  4NTF A;  4J7T A;  4JCZ A;  4AL0 A;  4JRZ A;  5BQI A;  5BQH A;  4BPM A;  4NTA A;  2UUH A;  4YK5 A;  3DWW A;  3PCV A;  4AL1 A;  4YL0 A;  4JC7 A;  5K0I A;  4J7Y A;  3HKK A;  5BQG A;  2PNO A;  2UUI A;  4NTB A;  4YL3 A;  2Q7R A;  5HV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...