2O9XA

Crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
RENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Reductase, assembly protein
publication title An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 51
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02613 Nitrate_red_del Nitrate reductase delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4070.10 Mainly Alpha Orthogonal Bundle putative redox-enzyme maturation protein fold putative redox-enzyme maturation protein domain 2o9xA02
1.20.120.700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2o9xA01
2O9XA
chains in the Genus database with same CATH superfamily
3UNGC 1E85A 4M63A 4C3EA 3B0VC 1S05A 3GM2A 3TQOA 2LD6A 1JPJA 4G78A 4EIYA 3FAPB 5E2QA 3QMKA 1Q0FA 1T9KA 3DI5A 3KYJA 2MWQA 4QDLA 5JP7A 4DJ9A 2FFHA 2WB7A 4OIRF 1OW6A 3VYWA 3WG7C 2DI3A 4YT4A 4XEKA 5AC5A 2XL8A 2J45A 2I8BA 2P7VA 3PMRA 4JVSA 2YLGA 3DM9B 1K40A 3N24A 4PJMA 1NFOA 3IHUA 4MVQA 3GWLA 2H7BA 2J8WA 2NUPA 5JLIA 2AWCA 1LM3B 2H7VC 5HSWA 4XLNF 5A6BD 1T5OA 4DBRA 2KYHA 2J9UA 2XLWA 3VRCA 4CS8C 1Q0KA 4ZLDA 1QVXA 5CI9A 1EQ1A 3EHNA 1D0XA 4O79A 2XXAA 2C03A 3S90A 3C8ZA 3SXMA 4MVZA 5A6AA 2LQGA 4MTGA 1LIHA 3SP1A 4P9FA 2JD3A 4W8KA 1AEPA 2KC3A 3DD7A 3B29A 3HNLA 4N6HA 4O6NA 4BJ1A 2B0JA 2YHSA 1G4US 1SYQA 4XPYA 3IQ6A 3C8GD 3OEOA 4BEMJ 3DJNB 2WL8A 2YQYA 1I4YA 2GA0A 3A11A 3EH1A 4IRUA 2P1AA 4NQFA 5L0HA 2X0CA 4YT2A 4FAPB 3TULA 2YLIA 4JTDB 2Q3TA 5BQIA 3A9CA 3JCUQ 3NG1A 3U2LA 2JPUA 3DKAA 4K1OA 3GM1A 3RVYA 2PF4E 4EKWA 5KYYB 3K66A 1PD0A 4PFPA 2CYDA 3AG1C 3U2MA 2UUHA 2Y69C 4BJ6A 4EBKA 4ER9A 1GM5A 4CJGA 2HZ8A 4AE4A 3RIPA 1FFHA 2CW0F 3EHMA 4Q7CA 3AQCA 5JVEA 1I4ZA 2KJGA 1BBHA 2DB4A 2VCCA 2WVOA 4JCHA 2XRHA 2XS8A 2LSEA 3RQEA 5DQTA 1RMVA 2L6HA 1WGWA 2PNOA 4EHPA 3LUTB 1A0BA 1T6IA 1ZW2A 1ZVZA 2DGJA 3JZ0A 3KMIA 3NYMA 4XPWA 4IB4A 1V4AA 2B0HA 4EWCA 3LLKA 4JE9A 4DBQA 5EGYA 2H8AA 1LS4A 1DOVA 1M57C 1QQ3A 4L6RA 4DRJB 5L3QA 3EGDB 1FNTc 2R7RA 4MVSA 3POVA 3LLIA 3AJMA 3Q6MA 1YA9A 1NSGB 2A6HF 2HMZA 4KNWA 2EINC 3AGUA 4U5BE 4D4NA 3HKKA 1NZEA 1H9GA 3NYJA 2Q9CA 4EBBA 2EILC 2L81A 2OOCA 3C62A 3LNRA 4PJNA 3J06A 3UMKA 1TWGA 1ZHYA 3U5SA 4KNVA 3SYNA 4HFKB 3B71A 3R2PA 4JEBA 2BE5F 2R03A 4DXWA 4FWVA 1YJGA 3SXKA 2E87A 2GFHA 4PR9A 5B3IA 1PV3A 1H7IA 1E86A 3Q7LA 5A6BA 1ZU4A 2OQMA 3LS1A 3KPHA 1HE1A 1BDJB 1Q0GA 1CGNA 1MMAA 2W45A 4KBLA 4LDQA 4BJ5A 1H9TA 5DS5A 1JR8A 2XXAB 2Q4FA 1SF8A 2XL6A 4U5CE 3WHNA 4EUKB 2AU5A 3C63A 3EZHA 3QW0A 3O6XA 3X1OA 4J32B 2QTVA 3LJBA 4LERA 1JPNA 1OCOC 4OD5A 3TJ5A 2R7QA 1ZYRF 2C04A 2D4UA 3SNHA 2RSEB 1B68A 4MTFA 4YJWA 4DVYP 3R7CA 4ULWA 3MFNA 3T9OA 3ZQVA 1YA7O 3H2VA 1AUEA 1TFOB 5L0GA 2AVKA 2UUIA 4AL1A 2XLHA 3X2QC 2VC9A 4DOZA 3QVYA 4RD9A 3JT1A 1NLXA 3M15A 4CSAA 1T6UA 1O3UA 2LFFA 4JURI 3G4ZA 3Q7GA 4U5FE 2W4MA 4IAQA 2J7PD 4U5GA 2CDQA 2EIKC 2VCAA 2ZD9A 4HE8D 4RDAA 4YK5A 4P9TA 3RVZA 1YAUO 3ITFA 2XLMA 1WASA 4LLCA 4N6CA 3UMHA 4DRIB 4AE4B 1OR2A 4JTCB 3TK0A 3ZG1A 1ST6A 2YVKA 1J8MF 1Q0DA 3O39A 1JAFA 3K1IA 1MQVA 4JJFA 5B1BC 2HUJA 4FESA 4JKVA 5JSLA 1NG1A 3US6A 3RW0A 3F46A 1TWHA 1TWAA 2J0XA 4BPMA 2J9VA 2VASA 5BQGA 2AP3A 3I5PA 2MHRA 3Q6NA 4KC9A 4IGGA 4Z9JA 4EBJA 3ZIBA 5CIVA 1Z3IX 4XTKA 2HS5A 4MVMA 4G0HA 4G7ZF 3U0CA 2KNHA 4U5DE 2QNLA 1D1AA 1J8YF 1W2WA 2G62A 2ETSA 1YLMA 1MNDA 1KU2A 1RKEB 4YT5A 1FMVA 5E33A 3VF0A 4AL0A 5DLJA 4C7OA 1QSPA 2P6VA 4O6YA 3TOMA 3W2VA 2W9YA 2GWWA 5F5FA 1OCRC 1DOWA 3QW1A 1I5NA 3B0UX 5D91A 4CX9A 3FOPA 1E84A 2XS1A 1YZAA 3M1CB 4J30B 4JEAA 3ZQYA 2ICWG 1VTMP 4K0DA 4E18A 5T1DB 1ZW3A 4JRZA 5BQHA 1M56C 2YKZA 4YL3A 1SMYF 2P61A 4GQHA 2O9XA 2J46A 4MW3A 4NTBA 1XWJA 3E9VA 4IAOA 2WZLA 3IQCA 2PX0A 1A41A 2KK1A 1L3PA 3S27A 4E17A 3GWNA 4QI2A 4XWJA 3JRMO 1PCXA 3GEHA 5GPGB 3FXHA 1TFKB 4XEFA 1V54C 2HJMA 3AQBA 2I15A 5COGA 2R7VA 3ABKC 1AVOB 2YEVA 4IWBA 5EK0A 1CPQA 1MNEA 2R7UA 4JZAA 2A0BA 5F5HA 2Y3GA 4HEAJ 4BJ6C 3V5ZA 3S84A 1RCPA 1QPUA 2PX3A 2Q9AA 4I44A 1YARO 4O7GA 1L7CA 2CGEA 1OR3A 3AG2C 2PBEA 5KYXB 4OD4A 5L3VA 2OEXA 3MYFA 1LPEA 1PD1A 3NMKA 2LCHA 4MW8A 1JMWA 4UDVA 2HSQA 2NPUA 3KKBA 2AWYA 1U89A 3MX3A 2QE9A 3SEOA 5L0DA 4A4AA 2R9RB 4WGYA 4I1OB 2J9WA 3ZWIA 4J7TA 2Y3HA 2Q9BA 2KQ9A 3NKDA 1WATA 2CNWA 3RQGA 3EQLF 3KH2A 1OW8A 3CEXA 5L0CA 2A68F 5K0IA 3EFOB 1GQAA 4B6IA 5KYUB 1C02A 2GDCA 3ABMC 2EPNA 4MS2A 4ANJA 5FZTA 2R7SA 2MYSA 3GM3A 5A6JA 5KYNA 1OCZC 1RKEA 1XZPA 2G3VA 3RKOF 1Y4CA 1HY5A 3AOUA 3T6JA 5B3SC 1ZU5A 3IQ5A 4XEVA 2LFDA 5COFA 3WODF 1OKKA 4MVOA 4DRHB 1Q0MA 2PP4A 4RBNA 3U9JA 1WTYA 2DYSC 1CGOA 4IARA 4E0IA 2J0WA 2L9JA 2PFDA 4GYTA 4CIHA 2VH3A 1K05A 2QLAA 2YL3A 4U9DA 3SXZA 4ONSA 3JYHA 5F28E 1TKNA 2LIGA 5BUOA 4BJTA 1FR0A 4C7OB 1NU7D 5IY5C 256BA 4GEHA 4PJLA 4BJ5C 5EHHA 2WVQA 2ZPAA 1C03A 3IPMO 1HE9A 1Y6DA 2R05A 4R32A 4CJOA 1R5ID 5DQZA 2YZSA 3W4YA 5JT4A 3EGXA 3ZTZA 4NTFA 2R7XA 5L0FA 2XLDA 2IYLD 3DAGA 1ZZPA 2ZXWC 1HW2A 2BL2A 3BRJA 1ORJA 2HSBA 3LS0A 4WJ0A 3NRHA 4OIQF 1U0BB 1EKYA 4CBEA 4ULVA 5DVWA 5D92A 2XM4A 3T6GB 3MLGA 1M2VB 3H65A 3TJ6A 4DVZA 4NC3A 1O5HA 1LVKA 5KYXA 1CPRA 3AG4C 3I4UA 1IZMA 2W4BA 5FCLA 3EH2A 4CSAC 3S28A 1EI7A 5A6KA 1YVIA 2R7TA 5COMA 5T3WA 2DYRC 5KYWB 4KI2A 3DM5A 5T3TA 2J9BA 2OJED 1TQGA 1KTMA 1T6QA 2IOQA 3EFOA 2OJQA 5KYUA 4CS9A 4CDYA 2R7WA 1YZCA 3K1IC 3OWTA 5AGFA 4CS7A 2HJ3A 3C7JA 3V5YA 1OKKD 2Y3DA 2JX0A 2NSFA 3NMIA 3AGTA 4MVRA 1FFTC 2XSEA 3GANA 1JOGA 1D0YA 3C8GA 3ZVRA 1JRAA 3NDBB 3N0TA 3LEOA 1G4WR 1VLTA 2ZXRA 3GEIA 2XLEA 4NCQA 3M4CA 3BEHA 1Z23A 3PCVA 4N06A 4ZLCA 2EPKX 3WAQA 3T4RA 4BEJA 2IM8A 3CQZA 1LKXA 2HV6A 1TWCA 4MVUA 2KGOA 3ASOC 3SZRA 1RJ9A 4E0HA 3RQFA 2M4EA 3CZ6A 1HMDA 2ZXOA 2HV7A 2GAQA 2NUTB 2QUPA 2VB6A 1VB5A 4QI0A 4PFOA 3O10A 4Z9HA 1VYKA 3FDQA 3EG9B 1MMGA 4N4WA 1D1BA 2L6FA 1Z63A 3LESA 4YT8A 4K7BA 1UFBA 4FX5A 2V3CC 1BR4A 2IXOA 1ZHTA 2WZFA 3ZC4A 3AG3C 3JTLO 4G7OF 1ZHWA 5B1AC 3K1HA 2YRFA 3DZAA 3MBGA 3GODA 4U5HA 2A0UA 3G50A 3HNJA 1LI5A 5L0JA 1H6GA 1Z5ZA 1APCA 2XM0A 4X0RA 2IBFA 3ABLC 4HFFB 1SZIA 3TD7A 3UMIA 1M2VA 3K33A 4F4BA 3QVZA 3EGXB 1E2XA 1MMNA 5A69A 3ASNC 2Z15A 3E70C 4BG0A 3C18A 1XZQA 4JW1A 2ASRA 2OU6A 4LDKA 3V7OA 1Z6AA 3B9QA 4PK4A 1A7DA 1VMAA 4WGZA 1QZXA 1E83A 3JSEO 3QZCA 2EPLX 4CS8A 3CSKA 3U3BA 3W8IA 1SR2A 1MMDA 3DXJF 1VK5A 1HW1A 3DMDA 3LNMB 4U9EA 4CDVA 3VAYA 5KYWA 2RD9A 3DWWA 4JTAB 3UGPA 4YL1A 3H2UA 1ORYA 2M64A 3FMSA 3L1MA 4XPXA 1KNYA 1T01A 1VOMA 4Z9IA 2EPMX 3SXYA 1IW7F 3W8HA 3L8IA 1WN0A 2XLVA 1VYIA 4W8PA 3L8JA 4OINF 3HJCA 4YN0B 3TOLA 1OQCA 3QTHA 2WVNA 3FAJA 2X51A 2L7AA 3EZIA 1NFNA 1NU9C 2NG1A 2FGYA 3GORA 4G7HF 2YLDA 3RYLA 3UR3C 3ZDLA 2A6EF 3IQTA 3DE8A 1G5ZA 2YWAA 2NUTA 1BR2A 1OXKA 4XLPF 4PJJA 4WABA 1ORSC 3RF3A 3K7DA 3EG9A 3C8GB 3LEVA 1NBBA 1Z7Qc 3FOOA 1M6TA 3JSZA 4OIPF 1D0ZA 4E7ZA 3OA1A 1A7EA 2YL7A 3G4XA 4OIOF 4NY3A 3CAXA 2A1DD 2LK4A 2IXMA 2R02A 3ATPA 3L0IA 3MYIA 4I1MA 4JIOA 4MTOA 1CGME 1D1CA 3KL4A 1RJ9B 3L34A 3RH3A 3V5XA 4AX2A 4CIPA 4Q4ZF 1A7VA 1LE4A 2Y39A 4NTAA 3T6BA 1OW7A 5TJ5E 2J7PA 3DJUB 3FHDA 3NMJA 3IEEA 4YL0A 4U5EE 1M2OA 3U8PA 1EA8A 4C3DA 2F22A 4H54A 3M79A 2WZGA 1V55C 4P6IC 1GGQA 1UG7A 3DAFA 1QLEC 3ZTMA 4PACA 1C17M 3F47A 4LDRA 3RFYA 1FTSA 3ZSUA 2Q7RA 2OG2A 3U9MA 2G3KA 1OXBA 4H4KC 3EPVA 2OCCC 1QKRA 5AC4A 2VCBA 2YL0A 1YDIA 1S7ZA 4XQ1A 2OEVA 3FVYA 1RKCA 3JYYA 1RXQA 3JRTA 2R25A 2LP4A 4A2NB 4IJJA 2NUPB 1F1MA 2A69F 1FMWA 1V74B 3UGOA 1GS9A 2FAPB 3HNKA 3W2WA 1ZHZA 4D4XA 2V26A 2CNWD 3M4BA 1BZ4A 2XL4A 2P0NA 3N2ZB 4LLEA 5E3CA 4JJGA 1VLSA 1YYJA 1WWPA 4JC7A 1U6HA 2BC5A 1TR2A 4CS9C 3K6BA 4C3BA 3PHF2 1ZHXA 4MQ9F 4JCZA 1K04A 5KYYA 2IXPA 3B0PA 1G8XA 2CCYA 2NSGA 5L0IA 5DS4A 5CI8A 3U8VA 2HFIA 4MNDA 1O87A 2KW3C 2OKUA 2R7OA 2ZXPA 3I5QA 5JUAA 1R4TA 3ECSA 2D5RB 2HMQA 5HV9A 2HKVA 2KSFA 2H7OA 3DE9A 3VM6A 4AK9A 1N1CA 2Y3BA 1LI7A 4I3MA 4J7YA 2YL1A 3U3FA 3S0XA 3EJNA 5JS5A 1LE2A 1WOLA 3KYIA 2XLOA 2Q00A 1LS1A 2EIJC 3NKEA 3O55A 3HNIA 3S29A 2TMVP 1HMOA 1FAPB 2EIMC 2L6GA 3LAYA 5E3AA 2IXNA 3HTKC 4Q5SF 1YYXA 2QY9A 3GEEA 5DS6A 3PDMP 1BR1A 3NYLA 3S9OA 1OCCC 3HLZA 2EPOA 4CDAA 4O6MA 4YWQA 5JRAA 3EGDA 4E7SA 4LACB
chains in the Genus database with same CATH topology
3UNGC 4M63A 4C3EA 3B0VC 1JPJA 5E2QA 3QMKA 4QDLA 2MWQA 2FFHA 2WB7A 4OIRF 3WG7C 3VYWA 2J45A 2I8BA 2P7VA 3PMRA 4JVSA 3DM9B 3N24A 4PJMA 2H7BA 2NUPA 2H7VC 5HSWA 4XLNF 4DBRA 2J9UA 4CS8C 4ZLDA 5CI9A 3EHNA 1D0XA 4O79A 2XXAA 2C03A 3SP1A 2JD3A 4W8KA 3DD7A 4O6NA 4BJ1A 2B0JA 2YHSA 3OEOA 3DJNB 2WL8A 4IRUA 3EH1A 4YT2A 2Q3TA 3JCUQ 3NG1A 2PF4E 5KYYB 3K66A 1PD0A 4PFPA 3AG1C 2Y69C 4BJ6A 4AE4A 3RIPA 1FFHA 2CW0F 3EHMA 4Q7CA 3AQCA 2KJGA 2WVOA 4JCHA 2XRHA 2LSEA 5DQTA 1WGWA 3NYMA 2DGJA 3KMIA 4EWCA 3LLKA 4DBQA 5EGYA 5L3QA 1M57C 3EGDB 2R7RA 3POVA 3LLIA 3Q6MA 2A6HF 4KNWA 2EINC 4U5BE 1NZEA 3NYJA 2Q9CA 4EBBA 2EILC 2L81A 3LNRA 4PJNA 3UMKA 1TWGA 1ZHYA 4KNVA 3SYNA 4HFKB 2BE5F 4FWVA 2E87A 2GFHA 3Q7LA 1ZU4A 3LS1A 4BJ5A 1MMAA 2W45A 4KBLA 5DS5A 2XXAB 1SF8A 4U5CE 3EZHA 3O6XA 3X1OA 4J32B 2QTVA 3LJBA 4LERA 1JPNA 1OCOC 4OD5A 2R7QA 1ZYRF 2C04A 3SNHA 4DVYP 4YJWA 4ULWA 3X2QC 4DOZA 4RD9A 3JT1A 4CSAA 4JURI 3Q7GA 4U5FE 2W4MA 2J7PD 4U5GA 2CDQA 2EIKC 4HE8D 4RDAA 3ITFA 4LLCA 3UMHA 4AE4B 3ZG1A 1ST6A 1J8MF 3O39A 4JJFA 5B1BC 4FESA 1NG1A 3F46A 1TWHA 1TWAA 2J0XA 2J9VA 2VASA 3I5PA 3Q6NA 4KC9A 3ZIBA 1Z3IX 4XTKA 4G7ZF 4G0HA 2KNHA 4U5DE 1D1AA 1J8YF 1W2WA 2G62A 5E33A 5DLJA 1MNDA 1KU2A 4YT5A 1FMVA 4C7OA 2P6VA 4O6YA 3W2VA 2W9YA 5F5FA 1OCRC 3B0UX 5D91A 4J30B 3M1CB 4K0DA 5T1DB 1M56C 1SMYF 2O9XA 2J46A 3E9VA 4IAOA 2WZLA 2PX0A 3S27A 4QI2A 4XWJA 1PCXA 1V54C 3AQBA 2R7VA 3ABKC 4IWBA 2YEVA 1MNEA 2R7UA 4JZAA 5F5HA 2Y3GA 4HEAJ 4BJ6C 2PX3A 2Q9AA 4I44A 4O7GA 2CGEA 3AG2C 5KYXB 4OD4A 5L3VA 1PD1A 3KKBA 3MX3A 3SEOA 4I1OB 2J9WA 3NKDA 2Q9BA 2KQ9A 2Y3HA 2CNWA 3EQLF 3KH2A 2A68F 3EFOB 4B6IA 5KYUB 3ABMC 4ANJA 2R7SA 2MYSA 5KYNA 1OCZC 2G3VA 3RKOF 3T6JA 5B3SC 1ZU5A 3WODF 1OKKA 2PP4A 4RBNA 2DYSC 2J0WA 2L9JA 2PFDA 4GYTA 4CIHA 2VH3A 5BUOA 3JYHA 1TKNA 4BJTA 4C7OB 1NU7D 5IY5C 4GEHA 4PJLA 4BJ5C 5EHHA 2WVQA 2ZPAA 5DQZA 2YZSA 3EGXA 2R7XA 3DAGA 2IYLD 2ZXWC 4WJ0A 3LS0A 3NRHA 4OIQF 4CBEA 5DVWA 5D92A 3MLGA 1M2VB 3H65A 4DVZA 1O5HA 1LVKA 5KYXA 3AG4C 3I4UA 1IZMA 2W4BA 5FCLA 3EH2A 4CSAC 3S28A 2R7TA 5T3WA 2DYRC 5KYWB 4KI2A 3DM5A 5T3TA 2IOQA 3EFOA 5KYUA 4CS9A 3K1IC 3OWTA 4CS7A 1OKKD 2Y3DA 1FFTC 2XSEA 3GANA 1D0YA 3ZVRA 3NDBB 3N0TA 2ZXRA 4ZLCA 1Z23A 4N06A 3T4RA 4BEJA 3CQZA 1LKXA 2HV6A 1TWCA 2KGOA 3ASOC 3SZRA 1RJ9A 2M4EA 3CZ6A 2ZXOA 2HV7A 2NUTB 2VB6A 4QI0A 4PFOA 1VYKA 3FDQA 3EG9B 1MMGA 1D1BA 1Z63A 3LESA 4YT8A 4K7BA 4FX5A 2V3CC 1BR4A 2IXOA 1ZHTA 2WZFA 3ZC4A 3AG3C 4G7OF 1ZHWA 5B1AC 3K1HA 3DZAA 3GODA 4U5HA 1Z5ZA 4YT4A 4X0RA 3TD7A 3UMIA 3ABLC 4F4BA 4HFFB 1SZIA 2R7WA 1M2VA 3K33A 3EGXB 1MMNA 3ASNC 2Z15A 3E70C 4BG0A 4JW1A 3V7OA 1Z6AA 3B9QA 4PK4A 1VMAA 1QZXA 3QZCA 4CS8A 3CSKA 3W8IA 1MMDA 3DXJF 1VK5A 3DMDA 5KYWA 3VAYA 3UGPA 1VOMA 1IW7F 3W8HA 1VYIA 4OINF 3HJCA 4YN0B 2WVNA 3FAJA 2X51A 3EZIA 1NU9C 2NG1A 2FGYA 4G7HF 3RYLA 3UR3C 2A6EF 2NUTA 1BR2A 4XLPF 4PJJA 3K7DA 3EG9A 3LEVA 3JSZA 4OIPF 1D0ZA 4E7ZA 3OA1A 4OIOF 4NY3A 2A1DD 3L0IA 2IXMA 4I1MA 1D1CA 3KL4A 1RJ9B 3L34A 3RH3A 4AX2A 4Q4ZF 2Y39A 3T6BA 2J7PA 3DJUB 3FHDA 3IEEA 4U5EE 1M2OA 4C3DA 2WZGA 1V55C 4P6IC 3DAFA 1QLEC 3F47A 3RFYA 1FTSA 3ZSUA 2OG2A 2G3KA 4H4KC 3EPVA 2OCCC 1S7ZA 3FVYA 3JRTA 4A2NB 4IJJA 2NUPB 2A69F 1FMWA 3UGOA 3W2WA 1ZHZA 2V26A 2CNWD 2XL4A 3N2ZB 4LLEA 5E3CA 4JJGA 1TR2A 4CS9C 3K6BA 4C3BA 3PHF2 1ZHXA 4MQ9F 5KYYA 2IXPA 3B0PA 1G8XA 5DS4A 5CI8A 4MNDA 1O87A 2KW3C 2R7OA 3I5QA 2ZXPA 3ECSA 2D5RB 2H7OA 4AK9A 1N1CA 2Y3BA 4I3MA 3S0XA 3EJNA 1LS1A 2EIJC 3NKEA 3S29A 3LAYA 2EIMC 5E3AA 2IXNA 3HTKC 4Q5SF 2QY9A 5DS6A 1BR1A 3NYLA 1OCCC 3HLZA 4YWQA 4O6MA 3EGDA 4E7SA 4LACB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9X A; 
#chains in the Genus database with same CATH topology
 3UNG C;  1E85 A;  4M63 A;  4C3E A;  3B0V C;  1S05 A;  3GM2 A;  3TQO A;  2LD6 A;  1JPJ A;  4G78 A;  4EIY A;  3FAP B;  5E2Q A;  3QMK A;  1Q0F A;  1T9K A;  3DI5 A;  3KYJ A;  2MWQ A;  4QDL A;  5JP7 A;  4DJ9 A;  2FFH A;  2WB7 A;  4OIR F;  1OW6 A;  3VYW A;  3WG7 C;  2DI3 A;  4YT4 A;  4XEK A;  5AC5 A;  2XL8 A;  2J45 A;  2I8B A;  2P7V A;  3PMR A;  4JVS A;  2YLG A;  3DM9 B;  1K40 A;  3N24 A;  4PJM A;  1NFO A;  3IHU A;  4MVQ A;  3GWL A;  2H7B A;  2J8W A;  2NUP A;  5JLI A;  2AWC A;  1LM3 B;  2H7V C;  5HSW A;  4XLN F;  5A6B D;  1T5O A;  4DBR A;  2KYH A;  2J9U A;  2XLW A;  3VRC A;  4CS8 C;  1Q0K A;  4ZLD A;  1QVX A;  5CI9 A;  1EQ1 A;  3EHN A;  1D0X A;  4O79 A;  2XXA A;  2C03 A;  3S90 A;  3C8Z A;  3SXM A;  4MVZ A;  5A6A A;  2LQG A;  4MTG A;  1LIH A;  3SP1 A;  4P9F A;  2JD3 A;  4W8K A;  1AEP A;  2KC3 A;  3DD7 A;  3B29 A;  3HNL A;  4N6H A;  4O6N A;  4BJ1 A;  2B0J A;  2YHS A;  1G4U S;  1SYQ A;  4XPY A;  3IQ6 A;  3C8G D;  3OEO A;  4BEM J;  3DJN B;  2WL8 A;  2YQY A;  1I4Y A;  2GA0 A;  3A11 A;  3EH1 A;  4IRU A;  2P1A A;  4NQF A;  5L0H A;  2X0C A;  4YT2 A;  4FAP B;  3TUL A;  2YLI A;  4JTD B;  2Q3T A;  5BQI A;  3A9C A;  3JCU Q;  3NG1 A;  3U2L A;  2JPU A;  3DKA A;  4K1O A;  3GM1 A;  3RVY A;  2PF4 E;  4EKW A;  5KYY B;  3K66 A;  1PD0 A;  4PFP A;  2CYD A;  3AG1 C;  3U2M A;  2UUH A;  2Y69 C;  4BJ6 A;  4EBK A;  4ER9 A;  1GM5 A;  4CJG A;  2HZ8 A;  4AE4 A;  3RIP A;  1FFH A;  2CW0 F;  3EHM A;  4Q7C A;  3AQC A;  5JVE A;  1I4Z A;  2KJG A;  1BBH A;  2DB4 A;  2VCC A;  2WVO A;  4JCH A;  2XRH A;  2XS8 A;  2LSE A;  3RQE A;  5DQT A;  1RMV A;  2L6H A;  1WGW A;  2PNO A;  4EHP A;  3LUT B;  1A0B A;  1T6I A;  1ZW2 A;  1ZVZ A;  2DGJ A;  3JZ0 A;  3KMI A;  3NYM A;  4XPW A;  4IB4 A;  1V4A A;  2B0H A;  4EWC A;  3LLK A;  4JE9 A;  4DBQ A;  5EGY A;  2H8A A;  1LS4 A;  1DOV A;  1M57 C;  1QQ3 A;  4L6R A;  4DRJ B;  5L3Q A;  3EGD B;  1FNT c;  2R7R A;  4MVS A;  3POV A;  3LLI A;  3AJM A;  3Q6M A;  1YA9 A;  1NSG B;  2A6H F;  2HMZ A;  4KNW A;  2EIN C;  3AGU A;  4U5B E;  4D4N A;  3HKK A;  1NZE A;  1H9G A;  3NYJ A;  2Q9C A;  4EBB A;  2EIL C;  2L81 A;  2OOC A;  3C62 A;  3LNR A;  4PJN A;  3J06 A;  3UMK A;  1TWG A;  1ZHY A;  3U5S A;  4KNV A;  3SYN A;  4HFK B;  3B71 A;  3R2P A;  4JEB A;  2BE5 F;  2R03 A;  4DXW A;  4FWV A;  1YJG A;  3SXK A;  2E87 A;  2GFH A;  4PR9 A;  5B3I A;  1PV3 A;  1H7I A;  1E86 A;  3Q7L A;  5A6B A;  1ZU4 A;  2OQM A;  3LS1 A;  3KPH A;  1HE1 A;  1BDJ B;  1Q0G A;  1CGN A;  1MMA A;  2W45 A;  4KBL A;  4LDQ A;  4BJ5 A;  1H9T A;  5DS5 A;  1JR8 A;  2XXA B;  2Q4F A;  1SF8 A;  2XL6 A;  4U5C E;  3WHN A;  4EUK B;  2AU5 A;  3C63 A;  3EZH A;  3QW0 A;  3O6X A;  3X1O A;  4J32 B;  2QTV A;  3LJB A;  4LER A;  1JPN A;  1OCO C;  4OD5 A;  3TJ5 A;  2R7Q A;  1ZYR F;  2C04 A;  2D4U A;  3SNH A;  2RSE B;  1B68 A;  4MTF A;  4YJW A;  4DVY P;  3R7C A;  4ULW A;  3MFN A;  3T9O A;  3ZQV A;  1YA7 O;  3H2V A;  1AUE A;  1TFO B;  5L0G A;  2AVK A;  2UUI A;  4AL1 A;  2XLH A;  3X2Q C;  2VC9 A;  4DOZ A;  3QVY A;  4RD9 A;  3JT1 A;  1NLX A;  3M15 A;  4CSA A;  1T6U A;  1O3U A;  2LFF A;  4JUR I;  3G4Z A;  3Q7G A;  4U5F E;  2W4M A;  4IAQ A;  2J7P D;  4U5G A;  2CDQ A;  2EIK C;  2VCA A;  2ZD9 A;  4HE8 D;  4RDA A;  4YK5 A;  4P9T A;  3RVZ A;  1YAU O;  3ITF A;  2XLM A;  1WAS A;  4LLC A;  4N6C A;  3UMH A;  4DRI B;  4AE4 B;  1OR2 A;  4JTC B;  3TK0 A;  3ZG1 A;  1ST6 A;  2YVK A;  1J8M F;  1Q0D A;  3O39 A;  1JAF A;  3K1I A;  1MQV A;  4JJF A;  5B1B C;  2HUJ A;  4FES A;  4JKV A;  5JSL A;  1NG1 A;  3US6 A;  3RW0 A;  3F46 A;  1TWH A;  1TWA A;  2J0X A;  4BPM A;  2J9V A;  2VAS A;  5BQG A;  2AP3 A;  3I5P A;  2MHR A;  3Q6N A;  4KC9 A;  4IGG A;  4Z9J A;  4EBJ A;  3ZIB A;  5CIV A;  1Z3I X;  4XTK A;  2HS5 A;  4MVM A;  4G0H A;  4G7Z F;  3U0C A;  2KNH A;  4U5D E;  2QNL A;  1D1A A;  1J8Y F;  1W2W A;  2G62 A;  2ETS A;  1YLM A;  1MND A;  1KU2 A;  1RKE B;  4YT5 A;  1FMV A;  5E33 A;  3VF0 A;  4AL0 A;  5DLJ A;  4C7O A;  1QSP A;  2P6V A;  4O6Y A;  3TOM A;  3W2V A;  2W9Y A;  2GWW A;  5F5F A;  1OCR C;  1DOW A;  3QW1 A;  1I5N A;  3B0U X;  5D91 A;  4CX9 A;  3FOP A;  1E84 A;  2XS1 A;  1YZA A;  3M1C B;  4J30 B;  4JEA A;  3ZQY A;  2ICW G;  1VTM P;  4K0D A;  4E18 A;  5T1D B;  1ZW3 A;  4JRZ A;  5BQH A;  1M56 C;  2YKZ A;  4YL3 A;  1SMY F;  2P61 A;  4GQH A;  2O9X A;  2J46 A;  4MW3 A;  4NTB A;  1XWJ A;  3E9V A;  4IAO A;  2WZL A;  3IQC A;  2PX0 A;  1A41 A;  2KK1 A;  1L3P A;  3S27 A;  4E17 A;  3GWN A;  4QI2 A;  4XWJ A;  3JRM O;  1PCX A;  3GEH A;  5GPG B;  3FXH A;  1TFK B;  4XEF A;  1V54 C;  2HJM A;  3AQB A;  2I15 A;  5COG A;  2R7V A;  3ABK C;  1AVO B;  2YEV A;  4IWB A;  5EK0 A;  1CPQ A;  1MNE A;  2R7U A;  4JZA A;  2A0B A;  5F5H A;  2Y3G A;  4HEA J;  4BJ6 C;  3V5Z A;  3S84 A;  1RCP A;  1QPU A;  2PX3 A;  2Q9A A;  4I44 A;  1YAR O;  4O7G A;  1L7C A;  2CGE A;  1OR3 A;  3AG2 C;  2PBE A;  5KYX B;  4OD4 A;  5L3V A;  2OEX A;  3MYF A;  1LPE A;  1PD1 A;  3NMK A;  2LCH A;  4MW8 A;  1JMW A;  4UDV A;  2HSQ A;  2NPU A;  3KKB A;  2AWY A;  1U89 A;  3MX3 A;  2QE9 A;  3SEO A;  5L0D A;  4A4A A;  2R9R B;  4WGY A;  4I1O B;  2J9W A;  3ZWI A;  4J7T A;  2Y3H A;  2Q9B A;  2KQ9 A;  3NKD A;  1WAT A;  2CNW A;  3RQG A;  3EQL F;  3KH2 A;  1OW8 A;  3CEX A;  5L0C A;  2A68 F;  5K0I A;  3EFO B;  1GQA A;  4B6I A;  5KYU B;  1C02 A;  2GDC A;  3ABM C;  2EPN A;  4MS2 A;  4ANJ A;  5FZT A;  2R7S A;  2MYS A;  3GM3 A;  5A6J A;  5KYN A;  1OCZ C;  1RKE A;  1XZP A;  2G3V A;  3RKO F;  1Y4C A;  1HY5 A;  3AOU A;  3T6J A;  5B3S C;  1ZU5 A;  3IQ5 A;  4XEV A;  2LFD A;  5COF A;  3WOD F;  1OKK A;  4MVO A;  4DRH B;  1Q0M A;  2PP4 A;  4RBN A;  3U9J A;  1WTY A;  2DYS C;  1CGO A;  4IAR A;  4E0I A;  2J0W A;  2L9J A;  2PFD A;  4GYT A;  4CIH A;  2VH3 A;  1K05 A;  2QLA A;  2YL3 A;  4U9D A;  3SXZ A;  4ONS A;  3JYH A;  5F28 E;  1TKN A;  2LIG A;  5BUO A;  4BJT A;  1FR0 A;  4C7O B;  1NU7 D;  5IY5 C;  256B A;  4GEH A;  4PJL A;  4BJ5 C;  5EHH A;  2WVQ A;  2ZPA A;  1C03 A;  3IPM O;  1HE9 A;  1Y6D A;  2R05 A;  4R32 A;  4CJO A;  1R5I D;  5DQZ A;  2YZS A;  3W4Y A;  5JT4 A;  3EGX A;  3ZTZ A;  4NTF A;  2R7X A;  5L0F A;  2XLD A;  2IYL D;  3DAG A;  1ZZP A;  2ZXW C;  1HW2 A;  2BL2 A;  3BRJ A;  1ORJ A;  2HSB A;  3LS0 A;  4WJ0 A;  3NRH A;  4OIQ F;  1U0B B;  1EKY A;  4CBE A;  4ULV A;  5DVW A;  5D92 A;  2XM4 A;  3T6G B;  3MLG A;  1M2V B;  3H65 A;  3TJ6 A;  4DVZ A;  4NC3 A;  1O5H A;  1LVK A;  5KYX A;  1CPR A;  3AG4 C;  3I4U A;  1IZM A;  2W4B A;  5FCL A;  3EH2 A;  4CSA C;  3S28 A;  1EI7 A;  5A6K A;  1YVI A;  2R7T A;  5COM A;  5T3W A;  2DYR C;  5KYW B;  4KI2 A;  3DM5 A;  5T3T A;  2J9B A;  2OJE D;  1TQG A;  1KTM A;  1T6Q A;  2IOQ A;  3EFO A;  2OJQ A;  5KYU A;  4CS9 A;  4CDY A;  2R7W A;  1YZC A;  3K1I C;  3OWT A;  5AGF A;  4CS7 A;  2HJ3 A;  3C7J A;  3V5Y A;  1OKK D;  2Y3D A;  2JX0 A;  2NSF A;  3NMI A;  3AGT A;  4MVR A;  1FFT C;  2XSE A;  3GAN A;  1JOG A;  1D0Y A;  3C8G A;  3ZVR A;  1JRA A;  3NDB B;  3N0T A;  3LEO A;  1G4W R;  1VLT A;  2ZXR A;  3GEI A;  2XLE A;  4NCQ A;  3M4C A;  3BEH A;  1Z23 A;  3PCV A;  4N06 A;  4ZLC A;  2EPK X;  3WAQ A;  3T4R A;  4BEJ A;  2IM8 A;  3CQZ A;  1LKX A;  2HV6 A;  1TWC A;  4MVU A;  2KGO A;  3ASO C;  3SZR A;  1RJ9 A;  4E0H A;  3RQF A;  2M4E A;  3CZ6 A;  1HMD A;  2ZXO A;  2HV7 A;  2GAQ A;  2NUT B;  2QUP A;  2VB6 A;  1VB5 A;  4QI0 A;  4PFO A;  3O10 A;  4Z9H A;  1VYK A;  3FDQ A;  3EG9 B;  1MMG A;  4N4W A;  1D1B A;  2L6F A;  1Z63 A;  3LES A;  4YT8 A;  4K7B A;  1UFB A;  4FX5 A;  2V3C C;  1BR4 A;  2IXO A;  1ZHT A;  2WZF A;  3ZC4 A;  3AG3 C;  3JTL O;  4G7O F;  1ZHW A;  5B1A C;  3K1H A;  2YRF A;  3DZA A;  3MBG A;  3GOD A;  4U5H A;  2A0U A;  3G50 A;  3HNJ A;  1LI5 A;  5L0J A;  1H6G A;  1Z5Z A;  1APC A;  2XM0 A;  4X0R A;  2IBF A;  3ABL C;  4HFF B;  1SZI A;  3TD7 A;  3UMI A;  1M2V A;  3K33 A;  4F4B A;  3QVZ A;  3EGX B;  1E2X A;  1MMN A;  5A69 A;  3ASN C;  2Z15 A;  3E70 C;  4BG0 A;  3C18 A;  1XZQ A;  4JW1 A;  2ASR A;  2OU6 A;  4LDK A;  3V7O A;  1Z6A A;  3B9Q A;  4PK4 A;  1A7D A;  1VMA A;  4WGZ A;  1QZX A;  1E83 A;  3JSE O;  3QZC A;  2EPL X;  4CS8 A;  3CSK A;  3U3B A;  3W8I A;  1SR2 A;  1MMD A;  3DXJ F;  1VK5 A;  1HW1 A;  3DMD A;  3LNM B;  4U9E A;  4CDV A;  3VAY A;  5KYW A;  2RD9 A;  3DWW A;  4JTA B;  3UGP A;  4YL1 A;  3H2U A;  1ORY A;  2M64 A;  3FMS A;  3L1M A;  4XPX A;  1KNY A;  1T01 A;  1VOM A;  4Z9I A;  2EPM X;  3SXY A;  1IW7 F;  3W8H A;  3L8I A;  1WN0 A;  2XLV A;  1VYI A;  4W8P A;  3L8J A;  4OIN F;  3HJC A;  4YN0 B;  3TOL A;  1OQC A;  3QTH A;  2WVN A;  3FAJ A;  2X51 A;  2L7A A;  3EZI A;  1NFN A;  1NU9 C;  2NG1 A;  2FGY A;  3GOR A;  4G7H F;  2YLD A;  3RYL A;  3UR3 C;  3ZDL A;  2A6E F;  3IQT A;  3DE8 A;  1G5Z A;  2YWA A;  2NUT A;  1BR2 A;  1OXK A;  4XLP F;  4PJJ A;  4WAB A;  1ORS C;  3RF3 A;  3K7D A;  3EG9 A;  3C8G B;  3LEV A;  1NBB A;  1Z7Q c;  3FOO A;  1M6T A;  3JSZ A;  4OIP F;  1D0Z A;  4E7Z A;  3OA1 A;  1A7E A;  2YL7 A;  3G4X A;  4OIO F;  4NY3 A;  3CAX A;  2A1D D;  2LK4 A;  2IXM A;  2R02 A;  3ATP A;  3L0I A;  3MYI A;  4I1M A;  4JIO A;  4MTO A;  1CGM E;  1D1C A;  3KL4 A;  1RJ9 B;  3L34 A;  3RH3 A;  3V5X A;  4AX2 A;  4CIP A;  4Q4Z F;  1A7V A;  1LE4 A;  2Y39 A;  4NTA A;  3T6B A;  1OW7 A;  5TJ5 E;  2J7P A;  3DJU B;  3FHD A;  3NMJ A;  3IEE A;  4YL0 A;  4U5E E;  1M2O A;  3U8P A;  1EA8 A;  4C3D A;  2F22 A;  4H54 A;  3M79 A;  2WZG A;  1V55 C;  4P6I C;  1GGQ A;  1UG7 A;  3DAF A;  1QLE C;  3ZTM A;  4PAC A;  1C17 M;  3F47 A;  4LDR A;  3RFY A;  1FTS A;  3ZSU A;  2Q7R A;  2OG2 A;  3U9M A;  2G3K A;  1OXB A;  4H4K C;  3EPV A;  2OCC C;  1QKR A;  5AC4 A;  2VCB A;  2YL0 A;  1YDI A;  1S7Z A;  4XQ1 A;  2OEV A;  3FVY A;  1RKC A;  3JYY A;  1RXQ A;  3JRT A;  2R25 A;  2LP4 A;  4A2N B;  4IJJ A;  2NUP B;  1F1M A;  2A69 F;  1FMW A;  1V74 B;  3UGO A;  1GS9 A;  2FAP B;  3HNK A;  3W2W A;  1ZHZ A;  4D4X A;  2V26 A;  2CNW D;  3M4B A;  1BZ4 A;  2XL4 A;  2P0N A;  3N2Z B;  4LLE A;  5E3C A;  4JJG A;  1VLS A;  1YYJ A;  1WWP A;  4JC7 A;  1U6H A;  2BC5 A;  1TR2 A;  4CS9 C;  3K6B A;  4C3B A;  3PHF 2;  1ZHX A;  4MQ9 F;  4JCZ A;  1K04 A;  5KYY A;  2IXP A;  3B0P A;  1G8X A;  2CCY A;  2NSG A;  5L0I A;  5DS4 A;  5CI8 A;  3U8V A;  2HFI A;  4MND A;  1O87 A;  2KW3 C;  2OKU A;  2R7O A;  2ZXP A;  3I5Q A;  5JUA A;  1R4T A;  3ECS A;  2D5R B;  2HMQ A;  5HV9 A;  2HKV A;  2KSF A;  2H7O A;  3DE9 A;  3VM6 A;  4AK9 A;  1N1C A;  2Y3B A;  1LI7 A;  4I3M A;  4J7Y A;  2YL1 A;  3U3F A;  3S0X A;  3EJN A;  5JS5 A;  1LE2 A;  1WOL A;  3KYI A;  2XLO A;  2Q00 A;  1LS1 A;  2EIJ C;  3NKE A;  3O55 A;  3HNI A;  3S29 A;  2TMV P;  1HMO A;  1FAP B;  2EIM C;  2L6G A;  3LAY A;  5E3A A;  2IXN A;  3HTK C;  4Q5S F;  1YYX A;  2QY9 A;  3GEE A;  5DS6 A;  3PDM P;  1BR1 A;  3NYL A;  3S9O A;  1OCC C;  3HLZ A;  2EPO A;  4CDA A;  4O6M A;  4YWQ A;  5JRA A;  3EGD A;  4E7S A;  4LAC B; 
#chains in the Genus database with same CATH homology
 3UNG C;  4M63 A;  4C3E A;  3B0V C;  1JPJ A;  5E2Q A;  3QMK A;  4QDL A;  2MWQ A;  2FFH A;  2WB7 A;  4OIR F;  3WG7 C;  3VYW A;  2J45 A;  2I8B A;  2P7V A;  3PMR A;  4JVS A;  3DM9 B;  3N24 A;  4PJM A;  2H7B A;  2NUP A;  2H7V C;  5HSW A;  4XLN F;  4DBR A;  2J9U A;  4CS8 C;  4ZLD A;  5CI9 A;  3EHN A;  1D0X A;  4O79 A;  2XXA A;  2C03 A;  3SP1 A;  2JD3 A;  4W8K A;  3DD7 A;  4O6N A;  4BJ1 A;  2B0J A;  2YHS A;  3OEO A;  3DJN B;  2WL8 A;  4IRU A;  3EH1 A;  4YT2 A;  2Q3T A;  3JCU Q;  3NG1 A;  2PF4 E;  5KYY B;  3K66 A;  1PD0 A;  4PFP A;  3AG1 C;  2Y69 C;  4BJ6 A;  4AE4 A;  3RIP A;  1FFH A;  2CW0 F;  3EHM A;  4Q7C A;  3AQC A;  2KJG A;  2WVO A;  4JCH A;  2XRH A;  2LSE A;  5DQT A;  1WGW A;  3NYM A;  2DGJ A;  3KMI A;  4EWC A;  3LLK A;  4DBQ A;  5EGY A;  5L3Q A;  1M57 C;  3EGD B;  2R7R A;  3POV A;  3LLI A;  3Q6M A;  2A6H F;  4KNW A;  2EIN C;  4U5B E;  1NZE A;  3NYJ A;  2Q9C A;  4EBB A;  2EIL C;  2L81 A;  3LNR A;  4PJN A;  3UMK A;  1TWG A;  1ZHY A;  4KNV A;  3SYN A;  4HFK B;  2BE5 F;  4FWV A;  2E87 A;  2GFH A;  3Q7L A;  1ZU4 A;  3LS1 A;  4BJ5 A;  1MMA A;  2W45 A;  4KBL A;  5DS5 A;  2XXA B;  1SF8 A;  4U5C E;  3EZH A;  3O6X A;  3X1O A;  4J32 B;  2QTV A;  3LJB A;  4LER A;  1JPN A;  1OCO C;  4OD5 A;  2R7Q A;  1ZYR F;  2C04 A;  3SNH A;  4DVY P;  4YJW A;  4ULW A;  3X2Q C;  4DOZ A;  4RD9 A;  3JT1 A;  4CSA A;  4JUR I;  3Q7G A;  4U5F E;  2W4M A;  2J7P D;  4U5G A;  2CDQ A;  2EIK C;  4HE8 D;  4RDA A;  3ITF A;  4LLC A;  3UMH A;  4AE4 B;  3ZG1 A;  1ST6 A;  1J8M F;  3O39 A;  4JJF A;  5B1B C;  4FES A;  1NG1 A;  3F46 A;  1TWH A;  1TWA A;  2J0X A;  2J9V A;  2VAS A;  3I5P A;  3Q6N A;  4KC9 A;  3ZIB A;  1Z3I X;  4XTK A;  4G7Z F;  4G0H A;  2KNH A;  4U5D E;  1D1A A;  1J8Y F;  1W2W A;  2G62 A;  5E33 A;  5DLJ A;  1MND A;  1KU2 A;  4YT5 A;  1FMV A;  4C7O A;  2P6V A;  4O6Y A;  3W2V A;  2W9Y A;  5F5F A;  1OCR C;  3B0U X;  5D91 A;  4J30 B;  3M1C B;  4K0D A;  5T1D B;  1M56 C;  1SMY F;  2O9X A;  2J46 A;  3E9V A;  4IAO A;  2WZL A;  2PX0 A;  3S27 A;  4QI2 A;  4XWJ A;  1PCX A;  1V54 C;  3AQB A;  2R7V A;  3ABK C;  4IWB A;  2YEV A;  1MNE A;  2R7U A;  4JZA A;  5F5H A;  2Y3G A;  4HEA J;  4BJ6 C;  2PX3 A;  2Q9A A;  4I44 A;  4O7G A;  2CGE A;  3AG2 C;  5KYX B;  4OD4 A;  5L3V A;  1PD1 A;  3KKB A;  3MX3 A;  3SEO A;  4I1O B;  2J9W A;  3NKD A;  2Q9B A;  2KQ9 A;  2Y3H A;  2CNW A;  3EQL F;  3KH2 A;  2A68 F;  3EFO B;  4B6I A;  5KYU B;  3ABM C;  4ANJ A;  2R7S A;  2MYS A;  5KYN A;  1OCZ C;  2G3V A;  3RKO F;  3T6J A;  5B3S C;  1ZU5 A;  3WOD F;  1OKK A;  2PP4 A;  4RBN A;  2DYS C;  2J0W A;  2L9J A;  2PFD A;  4GYT A;  4CIH A;  2VH3 A;  5BUO A;  3JYH A;  1TKN A;  4BJT A;  4C7O B;  1NU7 D;  5IY5 C;  4GEH A;  4PJL A;  4BJ5 C;  5EHH A;  2WVQ A;  2ZPA A;  5DQZ A;  2YZS A;  3EGX A;  2R7X A;  3DAG A;  2IYL D;  2ZXW C;  4WJ0 A;  3LS0 A;  3NRH A;  4OIQ F;  4CBE A;  5DVW A;  5D92 A;  3MLG A;  1M2V B;  3H65 A;  4DVZ A;  1O5H A;  1LVK A;  5KYX A;  3AG4 C;  3I4U A;  1IZM A;  2W4B A;  5FCL A;  3EH2 A;  4CSA C;  3S28 A;  2R7T A;  5T3W A;  2DYR C;  5KYW B;  4KI2 A;  3DM5 A;  5T3T A;  2IOQ A;  3EFO A;  5KYU A;  4CS9 A;  3K1I C;  3OWT A;  4CS7 A;  1OKK D;  2Y3D A;  1FFT C;  2XSE A;  3GAN A;  1D0Y A;  3ZVR A;  3NDB B;  3N0T A;  2ZXR A;  4ZLC A;  1Z23 A;  4N06 A;  3T4R A;  4BEJ A;  3CQZ A;  1LKX A;  2HV6 A;  1TWC A;  2KGO A;  3ASO C;  3SZR A;  1RJ9 A;  2M4E A;  3CZ6 A;  2ZXO A;  2HV7 A;  2NUT B;  2VB6 A;  4QI0 A;  4PFO A;  1VYK A;  3FDQ A;  3EG9 B;  1MMG A;  1D1B A;  1Z63 A;  3LES A;  4YT8 A;  4K7B A;  4FX5 A;  2V3C C;  1BR4 A;  2IXO A;  1ZHT A;  2WZF A;  3ZC4 A;  3AG3 C;  4G7O F;  1ZHW A;  5B1A C;  3K1H A;  3DZA A;  3GOD A;  4U5H A;  1Z5Z A;  4YT4 A;  4X0R A;  3TD7 A;  3UMI A;  3ABL C;  4F4B A;  4HFF B;  1SZI A;  2R7W A;  1M2V A;  3K33 A;  3EGX B;  1MMN A;  3ASN C;  2Z15 A;  3E70 C;  4BG0 A;  4JW1 A;  3V7O A;  1Z6A A;  3B9Q A;  4PK4 A;  1VMA A;  1QZX A;  3QZC A;  4CS8 A;  3CSK A;  3W8I A;  1MMD A;  3DXJ F;  1VK5 A;  3DMD A;  5KYW A;  3VAY A;  3UGP A;  1VOM A;  1IW7 F;  3W8H A;  1VYI A;  4OIN F;  3HJC A;  4YN0 B;  2WVN A;  3FAJ A;  2X51 A;  3EZI A;  1NU9 C;  2NG1 A;  2FGY A;  4G7H F;  3RYL A;  3UR3 C;  2A6E F;  2NUT A;  1BR2 A;  4XLP F;  4PJJ A;  3K7D A;  3EG9 A;  3LEV A;  3JSZ A;  4OIP F;  1D0Z A;  4E7Z A;  3OA1 A;  4OIO F;  4NY3 A;  2A1D D;  3L0I A;  2IXM A;  4I1M A;  1D1C A;  3KL4 A;  1RJ9 B;  3L34 A;  3RH3 A;  4AX2 A;  4Q4Z F;  2Y39 A;  3T6B A;  2J7P A;  3DJU B;  3FHD A;  3IEE A;  4U5E E;  1M2O A;  4C3D A;  2WZG A;  1V55 C;  4P6I C;  3DAF A;  1QLE C;  3F47 A;  3RFY A;  1FTS A;  3ZSU A;  2OG2 A;  2G3K A;  4H4K C;  3EPV A;  2OCC C;  1S7Z A;  3FVY A;  3JRT A;  4A2N B;  4IJJ A;  2NUP B;  2A69 F;  1FMW A;  3UGO A;  3W2W A;  1ZHZ A;  2V26 A;  2CNW D;  2XL4 A;  3N2Z B;  4LLE A;  5E3C A;  4JJG A;  1TR2 A;  4CS9 C;  3K6B A;  4C3B A;  3PHF 2;  1ZHX A;  4MQ9 F;  5KYY A;  2IXP A;  3B0P A;  1G8X A;  5DS4 A;  5CI8 A;  4MND A;  1O87 A;  2KW3 C;  2R7O A;  3I5Q A;  2ZXP A;  3ECS A;  2D5R B;  2H7O A;  4AK9 A;  1N1C A;  2Y3B A;  4I3M A;  3S0X A;  3EJN A;  1LS1 A;  2EIJ C;  3NKE A;  3S29 A;  3LAY A;  2EIM C;  5E3A A;  2IXN A;  3HTK C;  4Q5S F;  2QY9 A;  5DS6 A;  1BR1 A;  3NYL A;  1OCC C;  3HLZ A;  4YWQ A;  4O6M A;  3EGD A;  4E7S A;  4LAC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...