2O9XA

Crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
RENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reductase, assembly protein
publication title An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 51
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02613 Nitrate_red_del Nitrate reductase delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4070.10 Mainly Alpha Orthogonal Bundle putative redox-enzyme maturation protein fold putative redox-enzyme maturation protein domain 2o9xA02
1.20.120.700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2o9xA01
2O9XA
chains in the Genus database with same CATH superfamily
3KYIA 3NKDA 5BQGA 3T9OA 4AE4B 2R7WA 3S27A 5L0DA 3BRJA 3WG7C 5AGFA 2RSEB 2UUHA 4JRZA 2VCBA 3B0VC 4O6NA 3IQTA 3H65A 4ANJA 4WGYA 3MFNA 1FMVA 4XQ1A 3S0XA 2A1DD 1OCZC 2OU6A 3EFOB 3GM1A 5BQIA 1PV3A 4Q4ZF 4YT4A 4CS7A 2LK4A 3NG1A 1ZYRF 3LJBA 1HE1A 2BC5A 4K0DA 1A7VA 2XRHA 2IXOA 2DGJA 4JJFA 3EGDA 5FCLA 3M15A 2KSFA 3FOPA 3TOMA 3RQEA 2G3VA 4C7OB 2XS8A 1V54C 1ZHZA 2CNWD 3LAYA 3VYWA 3I4UA 2KGOA 4J7YA 4RD9A 3U8PA 3V5YA 3DI5A 4G78A 2Q3TA 2LIGA 3BEHA 4PK4A 1HW1A 1LVKA 1OQCA 3DJNB 4DRJB 4ER9A 3FAPB 2HV6A 1T6IA 4JCHA 1B68A 3L0IA 2H7OA 1I4YA 2VCAA 3LNMB 4FWVA 1VOMA 2R25A 1TWAA 5F5HA 1ST6A 3ZQYA 3GORA 4EHPA 1A7DA 1NFNA 3M4CA 1NLXA 2YLGA 4K7BA 1EA8A 1M6TA 3QTHA 3RF3A 4AL0A 4GEHA 2Q9CA 1ZW3A 3EHNA 3U0CA 5A6JA 5B1AC 3PDMP 2KC3A 1FMWA 2YZSA 4XLPF 1G8XA 3B9QA 4I1OB 2NSFA 2W4BA 4LLEA 1DOVA 1OCOC 2ZXRA 2O9XA 4PFOA 5DVWA 1Q0KA 4BEJA 3AQCA 1D0XA 1K05A 1Y6DA 4NTFA 1LIHA 2OOCA 2W45A 2WZGA 2L81A 4JTCB 3ZVRA 4AL1A 2IM8A 3KPHA 4OINF 4LDKA 2J7PA 3O10A 1QSPA 1TQGA 2NUPB 4BPMA 4C3DA 4JVSA 4JEBA 5L0JA 1H7IA 3SNHA 3MX3A 2HMQA 4GYTA 4KNVA 4DBRA 2J0WA 4QI0A 3K1IA 2XLVA 3NYJA 4IB4A 2XL6A 1ZZPA 3RW0A 1YZAA 2YL3A 1LE2A 3JT1A 3MYFA 4QDLA 3OEOA 4JTAB 3B0PA 2Y3BA 1T9KA 3W2WA 1O87A 2LCHA 4G7HF 2YWAA 2J0XA 2PFDA 4XEFA 2OCCC 2FFHA 3MLGA 2R03A 5T1DB 2OKUA 4CS9A 4OIOF 2OJQA 4LLCA 2J45A 1JR8A 2G62A 2D4UA 4LERA 4U5EE 2PP4A 4QI2A 3ECSA 1T6UA 5CI9A 1CGNA 5GPGB 1K04A 3E9VA 4O7GA 5CI8A 4ZLCA 5A6BA 3QZCA 3S90A 3ZSUA 1MMGA 5F5FA 5DS4A 4OD4A 3PHF2 1O3UA 1OKKD 3JSZA 1G5ZA 1JPJA 1YJGA 3AGUA 1A7EA 2Y3GA 3V7OA 2R7VA 4AE4A 3VAYA 2XXAB 2WVOA 3IPMO 1RCPA 1NSGB 1RKCA 4PJJA 1OW6A 3K7DA 3TQOA 2KYHA 4EKWA 2OEXA 2QNLA 1EI7A 2PBEA 4DVYP 1TFOB 4ULVA 3POVA 1Q0DA 3AG1C 1Q0FA 3LLKA 1WTYA 2HMZA 3B71A 4FESA 4J32B 3RYLA 2IBFA 4NC3A 5TJ5E 4EUKB 1LS4A 2QUPA 3H2VA 3VF0A 3EJNA 3EZHA 3G4ZA 3LS1A 2A0UA 3LUTB 5DQZA 2BE5F 2OG2A 4I3MA 4PFPA 1APCA 3HTKC 5KYUB 1D0YA 2R05A 3GEIA 1EQ1A 4PJNA 4A2NB 5BQHA 3ZTMA 4CS8C 4C7OA 3KMIA 4OD5A 1NFOA 3CZ6A 2XLHA 1HE9A 4JE9A 3AQBA 2R7QA 1QQ3A 4MNDA 3W2VA 1NG1A 4XWJA 3ZG1A 3NKEA 3C8GD 4P9TA 1QZXA 5JS5A 4G7OF 5T3TA 3TULA 1TR2A 3EG9A 4DXWA 4WABA 4MS2A 2R7RA 3DD7A 3SP1A 2JD3A 3JCUQ 1RJ9B 3Q6NA 3AG2C 4U5CE 3X1OA 3CQZA 4RDAA 2CYDA 3ITFA 5FZTA 2CDQA 1YYJA 5A6AA 2P61A 1EKYA 256BA 2Y39A 4J30B 4ONSA 4Z9IA 3TJ5A 4BJ6C 2CNWA 2ZXPA 2XS1A 4F4BA 1VMAA 3KL4A 2PF4E 1Y4CA 3LNRA 1LPEA 4P9FA 1CGME 5D92A 4CIPA 3FDQA 2I8BA 2FAPB 2Q00A 1F1MA 3C8GB 4AX2A 2HSQA 3DWWA 3EH2A 3QW0A 1ZHXA 2XLOA 2CW0F 2MYSA 1Q0MA 3Q6MA 3W4YA 3ZIBA 3PMRA 4E18A 1RMVA 1JRAA 1QVXA 4YT2A 2LFFA 2ZPAA 3WHNA 3K1HA 3K33A 5EK0A 5JP7A 4KNWA 5B3SC 4N6HA 5KYXA 1HY5A 1Z6AA 1YZCA 2A0BA 2NUPA 2P1AA 5F28E 4EBKA 2LQGA 4BJTA 1BR2A 3JZ0A 3QW1A 3JYHA 3IQCA 2EIJC 2XLWA 1S05A 3Q7LA 1ZU5A 3B29A 3WODF 2D5RB 3V5ZA 4MW8A 2LFDA 4JTDB 3X2QC 1TFKB 3GODA 1YDIA 2GFHA 3C62A 4Z9HA 3L34A 4YL1A 2LD6A 1YYXA 4IWBA 5KYWB 2AVKA 2L6GA 2YKZA 3IHUA 3LS0A 2AWYA 4M63A 2X0CA 1E86A 4KC9A 1D1AA 2EPLX 1SR2A 3GWNA 4YJWA 3S29A 4OIQF 4DRIB 1OXKA 1U0BB 3N0TA 5E33A 4J7TA 3IEEA 3DM9B 3GEEA 2ZD9A 2P0NA 1CPRA 1E2XA 3DE9A 3NMIA 4BJ1A 2P6VA 2IYLD 1Z5ZA 2L6HA 2ZXOA 3CAXA 4IAQA 2J9VA 5JT4A 2EIMC 4E0HA 3NMKA 2HFIA 1Q0GA 2A6EF 3ZWIA 3R2PA 1T5OA 2YRFA 1U6HA 2YEVA 2X51A 2JPUA 4H4KC 4YK5A 2ETSA 4YL0A 2KW3C 1RKEA 2B0HA 2R7OA 5COFA 3EHMA 3TJ6A 1E85A 4E7SA 1H6GA 1G4WR 1JOGA 1YAUO 3EZIA 3OA1A 5JSLA 3U3BA 4CJGA 4Q5SF 5CIVA 5E3CA 5JRAA 4MVOA 3EGXB 3N24A 1YVIA 4FX5A 1L3PA 1LE4A 1LS1A 1Z3IX 1AEPA 1ZHTA 4CDYA 4IGGA 4EIYA 2HV7A 2HZ8A 3UNGC 5A6KA 2QE9A 4Q7CA 1WWPA 1AUEA 3MYIA 3RQGA 5DS6A 2HS5A 5HV9A 1FR0A 1U89A 1OKKA 5DS5A 4CSAA 1PD0A 2OJED 4HFFB 1WN0A 1SYQA 3JRTA 3IQ5A 4JEAA 2F22A 2YL1A 2DB4A 1VYKA 1D1CA 2GA0A 3U5SA 5KYYA 4PJMA 3EH1A 1OW8A 3K1IC 4BJ5A 4IARA 5HSWA 2LSEA 3K66A 1ZHWA 2DYSC 2GDCA 4N4WA 3EGDB 4MVRA 2KQ9A 2UUIA 4GQHA 2CGEA 4JURI 1LM3B 1SZIA 4NTBA 1ORYA 3DM5A 5K0IA 1V55C 2H8AA 2Q4FA 3DAFA 1OR2A 3JYYA 3F46A 1BZ4A 2WVQA 4CS9C 2YVKA 3M4BA 1VK5A 1MNEA 3LEOA 3I5QA 5B1BC 3LESA 1WASA 2XM4A 3DXJF 3ABLC 3MBGA 1BR1A 2EPKX 3PCVA 3RVYA 2V3CC 3ZTZA 3S28A 2R7UA 2HJ3A 1JPNA 4JJGA 3R7CA 4YWQA 3C8GA 2P7VA 4G0HA 2IXPA 1V4AA 3EFOA 1S7ZA 4IAOA 5KYNA 2RD9A 3ABMC 3GANA 3FMSA 3RFYA 2R02A 3UMKA 1E83A 3FVYA 1BR4A 3L8JA 1V74B 2AU5A 1SMYF 1ZVZA 2H7BA 2XM0A 3N2ZB 4HFKB 4JKVA 4N6CA 5T3WA 4D4NA 4DBQA 2XL4A 4YT8A 4LACB 4W8KA 1FNTc 4KI2A 3ATPA 4YL3A 4XEKA 4L6RA 5COGA 3V5XA 3GM3A 4CDVA 1M2VB 2LP4A 1MNDA 3RQFA 1ORJA 2A6HF 2QY9A 1RXQA 4O79A 2YLDA 1XWJA 4BG0A 4W8PA 4C3BA 2WVNA 2B0JA 1BBHA 3SEOA 2V26A 2Y3DA 4FAPB 2L9JA 2R9RB 1FFTC 2YQYA 1QLEC 3ASNC 2HJMA 4MVMA 4ULWA 1O5HA 2VCCA 2EPNA 4P6IC 4DVZA 1CPQA 5L0CA 5L3QA 2J9UA 2XSEA 3QVYA 4U5GA 1CGOA 1ZHYA 4XPWA 2PX3A 2HSBA 1Z63A 3SXKA 3ABKC 3TK0A 3B0UX 4JZAA 5E3AA 1VLTA 3G50A 3WAQA 2R7TA 5DQTA 1NU7D 1N1CA 2BL2A 1UG7A 2MWQA 3AJMA 2XL8A 3GM2A 1JMWA 1WOLA 1OR3A 1GS9A 1WGWA 1TWHA 4CIHA 2W9YA 3T6JA 1LI7A 5L3VA 1YA9A 4MTOA 4BJ6A 5A69A 4NQFA 1QKRA 2M4EA 1D0ZA 1FTSA 2XLDA 2H7VC 3SXYA 3EGXA 5JLIA 2KNHA 2QTVA 1ZU4A 3OWTA 3SYNA 4OIPF 3FAJA 4XTKA 2XLEA 3DAGA 3GWLA 5L0FA 1FAPB 2KK1A 4WGZA 2L6FA 1A41A 3NMJA 2EINC 1MMDA 2KJGA 3NYLA 4PR9A 2VASA 1XZQA 3NDBB 1OXBA 2VH3A 2NUTB 1MMAA 3JSEO 3M79A 1H9TA 1WATA 2Q7RA 4PACA 3ZC4A 3U2LA 5AC4A 5L0IA 2R7XA 3CEXA 3U3FA 1D1BA 2Y3HA 4MW3A 4R32A 1PCXA 3DZAA 4O6MA 3U8VA 4A4AA 3J06A 3O39A 4MVZA 2HKVA 4X0RA 4YN0B 3DE8A 4KBLA 1HMOA 2Q9AA 3FHDA 3HNKA 3JTLO 2MHRA 4RBNA 2OEVA 2Y69C 2WZFA 4YT5A 2GWWA 3JRMO 3US6A 3S9OA 4DRHB 1H9GA 2C03A 1YARO 2J8WA 2XXAA 4NTAA 5EHHA 5JVEA 2A69F 2PNOA 3A11A 3EG9B 2C04A 2IXNA 4JCZA 3F47A 3DMDA 4Z9JA 4EBJA 3L8IA 1LKXA 2M64A 5D91A 3W8IA 3DKAA 4DOZA 3AGTA 2HUJA 1NBBA 3AG4C 2YL0A 3HLZA 4LDRA 1R4TA 1M56C 2EPOA 3NYMA 2WL8A 1A0BA 3FOOA 4MQ9F 1DOWA 1GGQA 3UMIA 2ASRA 5BUOA 3K6BA 4JC7A 4UDVA 4PJLA 2J9WA 2AWCA 4CBEA 2L7AA 4U5DE 2IOQA 2R7SA 2J46A 3CSKA 5KYUA 1KNYA 1M2VA 4B6IA 4LDQA 3UGOA 1PD1A 3G4XA 2EILC 4MVQA 2A68F 3DJUB 4E0IA 1IW7F 1T01A 1KTMA 3VM6A 2J9BA 2QLAA 5KYXB 3O55A 4IJJA 2NSGA 2OQMA 3KYJA 3C8ZA 1I4ZA 4IRUA 4CJOA 5L0GA 1NU9C 4CDAA 4U5BE 4CSAC 3T4RA 1XZPA 3NRHA 3RVZA 3UMHA 5AC5A 2I15A 1J8YF 1MQVA 3LEVA 1FFHA 1K40A 1M2OA 1YA7O 3ASOC 3C18A 3HNIA 4MTFA 2PX0A 1TWCA 4JIOA 4BJ5C 4DJ9A 1RJ9A 3H2UA 3ZQVA 2NG1A 3GEHA 5COMA 1I5NA 4XPXA 1OW7A 4XEVA 1BDJB 1NZEA 4WJ0A 4CX9A 1C17M 4MVUA 3HNJA 3S84A 3QVZA 3W8HA 1C03A 1JAFA 2WB7A 2DI3A 3HJCA 1YLMA 4N06A 3T6BA 2J7PD 4NY3A 3T6GB 3U9MA 3KH2A 4XLNF 3IQ6A 2YLIA 3SXZA 1VTMP 5JUAA 1TKNA 1Z23A 5DLJA 3VRCA 1MMNA 4U9DA 2YHSA 4JW1A 1AVOB 4OIRF 5B3IA 2CCYA 2NPUA 2Q9BA 3HKKA 1TWGA 4NCQA 3FXHA 3O6XA 5IY5C 1R5ID 2W4MA 1ORSC 3A9CA 4G7ZF 1VLSA 2DYRC 1OCRC 4O6YA 1RKEB 4EWCA 1ZW2A 1Z7Qc 3U2MA 3EQLF 2IXMA 2JX0A 2XLMA 3UGPA 4HEAJ 3I5PA 3RKOF 1UFBA 2ZXWC 3TOLA 1OCCC 3SZRA 3ZDLA 1SF8A 1GQAA 2G3KA 1IZMA 3C63A 3Q7GA 2GAQA 3LLIA 2WZLA 5E2QA 3RIPA 4CS8A 1J8MF 4H54A 3KKBA 3AG3C 4K1OA 3HNLA 5KYWA 1VB5A 2YL7A 2Z15A 2NUTA 4E7ZA 1HW2A 2VB6A 2EPMX 5A6BD 2EIKC 3L1MA 1L7CA 3QMKA 2VC9A 1M57C 4I44A 1E84A 2AP3A 4ZLDA 4C3EA 1GM5A 3TD7A 2TMVP 3U9JA 3RH3A 4D4XA 5KYYB 4MVSA 4EBBA 1LI5A 4BEMJ 3AOUA 1T6QA 1W2WA 2FGYA 4U9EA 4U5HA 4XPYA 1KU2A 3E70C 5L0HA 4HE8D 3EPVA 2ICWG 4MTGA 5EGYA 4I1MA 3UR3C 4AK9A 3C7JA 3SXMA 1G4US 2E87A 1VYIA 4U5FE 1HMDA 4E17A 3M1CB 1C02A 1QPUA
chains in the Genus database with same CATH topology
3NKDA 2R7WA 4AE4B 3S27A 3WG7C 3B0VC 4O6NA 3H65A 4ANJA 1FMVA 2A1DD 1OCZC 3EFOB 4Q4ZF 4YT4A 4CS7A 3NG1A 1ZYRF 3LJBA 4K0DA 2XRHA 2IXOA 2DGJA 4JJFA 3EGDA 5FCLA 2G3VA 4C7OB 1V54C 1ZHZA 2CNWD 3LAYA 3VYWA 3I4UA 2KGOA 4RD9A 2Q3TA 4PK4A 1LVKA 3DJNB 2HV6A 4JCHA 3L0IA 2H7OA 4FWVA 5F5HA 3S0XA 1VOMA 1TWAA 1ST6A 4K7BA 4GEHA 2Q9CA 3EHNA 5B1AC 1FMWA 2YZSA 4XLPF 1G8XA 3B9QA 4I1OB 2W4BA 4LLEA 1OCOC 2ZXRA 2O9XA 4PFOA 5DVWA 4BEJA 3AQCA 1D0XA 2W45A 2WZGA 3ZVRA 2L81A 4OINF 2J7PA 2NUPB 4C3DA 4JVSA 3SNHA 3MX3A 4GYTA 4KNVA 4DBRA 2J0WA 4QI0A 3NYJA 3JT1A 4QDLA 3OEOA 3B0PA 2Y3BA 3W2WA 1O87A 4G7HF 2J0XA 2PFDA 2OCCC 2FFHA 3MLGA 5T1DB 4CS9A 4OIOF 4LLCA 2J45A 2G62A 4LERA 4U5EE 2PP4A 3ECSA 5CI9A 3E9VA 4O7GA 5CI8A 4ZLCA 5F5FA 3QZCA 3ZSUA 1MMGA 5DS4A 4OD4A 3PHF2 1OKKD 3JSZA 1JPJA 3V7OA 2Y3GA 2R7VA 4AE4A 3VAYA 2XXAB 2WVOA 4PJJA 3K7DA 4DVYP 3POVA 3AG1C 3LLKA 4QI2A 4FESA 4J32B 3RYLA 3EJNA 3EZHA 3LS1A 5DQZA 2BE5F 2OG2A 4I3MA 4PFPA 3HTKC 5KYUB 1D0YA 4PJNA 4A2NB 4CS8C 4C7OA 3KMIA 4OD5A 3CZ6A 4MNDA 3W2VA 3ZG1A 3AQBA 2R7QA 1NG1A 4XWJA 3NKEA 1QZXA 4G7OF 5T3TA 1TR2A 3EG9A 2R7RA 3DD7A 3SP1A 2JD3A 3JCUQ 1RJ9B 3Q6NA 3AG2C 4U5CE 3CQZA 4RDAA 3ITFA 2CDQA 2Y39A 4J30B 4BJ6C 2CNWA 2ZXPA 4F4BA 1VMAA 3KL4A 2PF4E 3LNRA 5D92A 3FDQA 2I8BA 4AX2A 3EH2A 1ZHXA 2CW0F 2MYSA 3Q6MA 3ZIBA 3PMRA 4YT2A 2ZPAA 3K1HA 3K33A 5KYXA 4KNWA 5B3SC 1Z6AA 2NUPA 4BJTA 1BR2A 3JYHA 2EIJC 3Q7LA 1ZU5A 3WODF 2D5RB 3X2QC 3GODA 2GFHA 3L34A 4IWBA 5KYWB 3LS0A 4M63A 4KC9A 1D1AA 4OIQF 4YJWA 3S29A 3N0TA 5E33A 3IEEA 3DM9B 4BJ1A 2P6VA 2IYLD 1Z5ZA 2ZXOA 2J9VA 2EIMC 2A6EF 2YEVA 3X1OA 4H4KC 2X51A 2KW3C 2R7OA 3EHMA 4E7SA 3EZIA 3OA1A 4Q5SF 5E3CA 3EGXB 3N24A 4FX5A 1LS1A 1Z3IX 1ZHTA 2HV7A 3UNGC 4Q7CA 5DS6A 1OKKA 5DS5A 4CSAA 1PD0A 4HFFB 3JRTA 1VYKA 1D1CA 5KYYA 4PJMA 3EH1A 4BJ5A 3K1IC 5HSWA 2LSEA 3K66A 1ZHWA 2DYSC 3EGDB 2KQ9A 2CGEA 4JURI 1SZIA 3DM5A 1V55C 3DAFA 3F46A 4CS9C 2WVQA 1VK5A 1MNEA 3I5QA 5B1BC 3LESA 3DXJF 3ABLC 1BR1A 2V3CC 3S28A 2R7UA 1JPNA 4JJGA 4YWQA 2P7VA 4G0HA 2IXPA 3EFOA 1S7ZA 4IAOA 5KYNA 3GANA 3ABMC 3RFYA 3UMKA 3FVYA 1BR4A 1SMYF 2H7BA 3N2ZB 4HFKB 4DBQA 5T3WA 4YT8A 4KI2A 2XL4A 4LACB 4W8KA 1M2VB 1MNDA 2A6HF 2QY9A 4O79A 4BG0A 4C3BA 2WVNA 2B0JA 3SEOA 2V26A 2Y3DA 2L9JA 1FFTC 1QLEC 3ASNC 4ULWA 1O5HA 4P6IC 4DVZA 5L3QA 2J9UA 2XSEA 4U5GA 1ZHYA 2PX3A 1Z63A 3ABKC 3B0UX 4JZAA 5E3AA 2R7TA 5DQTA 1NU7D 1N1CA 2MWQA 1WGWA 1TWHA 4CIHA 2W9YA 3T6JA 5L3VA 4BJ6A 2M4EA 1D0ZA 1FTSA 2H7VC 3EGXA 2KNHA 2QTVA 1ZU4A 3OWTA 3SYNA 4OIPF 3FAJA 4XTKA 3DAGA 2EINC 1MMDA 2KJGA 3NYLA 2VASA 3NDBB 2VH3A 2NUTB 1MMAA 3ZC4A 2R7XA 1D1BA 2Y3HA 1PCXA 3DZAA 4O6MA 3O39A 4X0RA 4YN0B 4KBLA 2Q9AA 3FHDA 4RBNA 4YT5A 2Y69C 2WZFA 2C03A 2XXAA 5EHHA 2A69F 3EG9B 2C04A 2IXNA 3F47A 3DMDA 1LKXA 5D91A 3W8IA 4DOZA 3AG4C 3HLZA 3UR3C 1M56C 3NYMA 3UMIA 2WL8A 4MQ9F 5BUOA 3K6BA 4PJLA 2J9WA 4CBEA 4U5DE 2IOQA 2R7SA 2J46A 3CSKA 5KYUA 1M2VA 4B6IA 3UGOA 1PD1A 2EILC 2A68F 3DJUB 1IW7F 5KYXB 4IJJA 4IRUA 1NU9C 4CSAC 4U5BE 3T4RA 3NRHA 3UMHA 1J8YF 3LEVA 1FFHA 1M2OA 3ASOC 2PX0A 1TWCA 4BJ5C 1RJ9A 2NG1A 1NZEA 4WJ0A 3W8HA 2WB7A 3HJCA 4N06A 3T6BA 2J7PD 4NY3A 3KH2A 4XLNF 1TKNA 1Z23A 5DLJA 1MMNA 2YHSA 4JW1A 4OIRF 2Q9BA 1TWGA 3O6XA 5IY5C 4G7ZF 2W4MA 2DYRC 1OCRC 4O6YA 4EWCA 3EQLF 2IXMA 3UGPA 4HEAJ 3I5PA 3RKOF 2ZXWC 1OCCC 3SZRA 1SF8A 2G3KA 1IZMA 3Q7GA 3LLIA 2WZLA 5E2QA 3RIPA 4CS8A 1J8MF 5KYWA 3KKBA 3AG3C 2Z15A 2NUTA 4E7ZA 2VB6A 2EIKC 3QMKA 1M57C 4I44A 4ZLDA 4C3EA 3TD7A 3RH3A 5KYYB 4EBBA 1W2WA 2FGYA 4U5HA 1KU2A 3E70C 4HE8D 3EPVA 5EGYA 4I1MA 4AK9A 2E87A 1VYIA 4U5FE 3M1CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9X A; 
#chains in the Genus database with same CATH topology
 3KYI A;  3NKD A;  5BQG A;  3T9O A;  4AE4 B;  2R7W A;  3S27 A;  5L0D A;  3BRJ A;  3WG7 C;  5AGF A;  2RSE B;  2UUH A;  4JRZ A;  2VCB A;  3B0V C;  4O6N A;  3IQT A;  3H65 A;  4ANJ A;  4WGY A;  3MFN A;  1FMV A;  4XQ1 A;  3S0X A;  2A1D D;  1OCZ C;  2OU6 A;  3EFO B;  3GM1 A;  5BQI A;  1PV3 A;  4Q4Z F;  4YT4 A;  4CS7 A;  2LK4 A;  3NG1 A;  1ZYR F;  3LJB A;  1HE1 A;  2BC5 A;  4K0D A;  1A7V A;  2XRH A;  2IXO A;  2DGJ A;  4JJF A;  3EGD A;  5FCL A;  3M15 A;  2KSF A;  3FOP A;  3TOM A;  3RQE A;  2G3V A;  4C7O B;  2XS8 A;  1V54 C;  1ZHZ A;  2CNW D;  3LAY A;  3VYW A;  3I4U A;  2KGO A;  4J7Y A;  4RD9 A;  3U8P A;  3V5Y A;  3DI5 A;  4G78 A;  2Q3T A;  2LIG A;  3BEH A;  4PK4 A;  1HW1 A;  1LVK A;  1OQC A;  3DJN B;  4DRJ B;  4ER9 A;  3FAP B;  2HV6 A;  1T6I A;  4JCH A;  1B68 A;  3L0I A;  2H7O A;  1I4Y A;  2VCA A;  3LNM B;  4FWV A;  1VOM A;  2R25 A;  1TWA A;  5F5H A;  1ST6 A;  3ZQY A;  3GOR A;  4EHP A;  1A7D A;  1NFN A;  3M4C A;  1NLX A;  2YLG A;  4K7B A;  1EA8 A;  1M6T A;  3QTH A;  3RF3 A;  4AL0 A;  4GEH A;  2Q9C A;  1ZW3 A;  3EHN A;  3U0C A;  5A6J A;  5B1A C;  3PDM P;  2KC3 A;  1FMW A;  2YZS A;  4XLP F;  1G8X A;  3B9Q A;  4I1O B;  2NSF A;  2W4B A;  4LLE A;  1DOV A;  1OCO C;  2ZXR A;  2O9X A;  4PFO A;  5DVW A;  1Q0K A;  4BEJ A;  3AQC A;  1D0X A;  1K05 A;  1Y6D A;  4NTF A;  1LIH A;  2OOC A;  2W45 A;  2WZG A;  2L81 A;  4JTC B;  3ZVR A;  4AL1 A;  2IM8 A;  3KPH A;  4OIN F;  4LDK A;  2J7P A;  3O10 A;  1QSP A;  1TQG A;  2NUP B;  4BPM A;  4C3D A;  4JVS A;  4JEB A;  5L0J A;  1H7I A;  3SNH A;  3MX3 A;  2HMQ A;  4GYT A;  4KNV A;  4DBR A;  2J0W A;  4QI0 A;  3K1I A;  2XLV A;  3NYJ A;  4IB4 A;  2XL6 A;  1ZZP A;  3RW0 A;  1YZA A;  2YL3 A;  1LE2 A;  3JT1 A;  3MYF A;  4QDL A;  3OEO A;  4JTA B;  3B0P A;  2Y3B A;  1T9K A;  3W2W A;  1O87 A;  2LCH A;  4G7H F;  2YWA A;  2J0X A;  2PFD A;  4XEF A;  2OCC C;  2FFH A;  3MLG A;  2R03 A;  5T1D B;  2OKU A;  4CS9 A;  4OIO F;  2OJQ A;  4LLC A;  2J45 A;  1JR8 A;  2G62 A;  2D4U A;  4LER A;  4U5E E;  2PP4 A;  4QI2 A;  3ECS A;  1T6U A;  5CI9 A;  1CGN A;  5GPG B;  1K04 A;  3E9V A;  4O7G A;  5CI8 A;  4ZLC A;  5A6B A;  3QZC A;  3S90 A;  3ZSU A;  1MMG A;  5F5F A;  5DS4 A;  4OD4 A;  3PHF 2;  1O3U A;  1OKK D;  3JSZ A;  1G5Z A;  1JPJ A;  1YJG A;  3AGU A;  1A7E A;  2Y3G A;  3V7O A;  2R7V A;  4AE4 A;  3VAY A;  2XXA B;  2WVO A;  3IPM O;  1RCP A;  1NSG B;  1RKC A;  4PJJ A;  1OW6 A;  3K7D A;  3TQO A;  2KYH A;  4EKW A;  2OEX A;  2QNL A;  1EI7 A;  2PBE A;  4DVY P;  1TFO B;  4ULV A;  3POV A;  1Q0D A;  3AG1 C;  1Q0F A;  3LLK A;  1WTY A;  2HMZ A;  3B71 A;  4FES A;  4J32 B;  3RYL A;  2IBF A;  4NC3 A;  5TJ5 E;  4EUK B;  1LS4 A;  2QUP A;  3H2V A;  3VF0 A;  3EJN A;  3EZH A;  3G4Z A;  3LS1 A;  2A0U A;  3LUT B;  5DQZ A;  2BE5 F;  2OG2 A;  4I3M A;  4PFP A;  1APC A;  3HTK C;  5KYU B;  1D0Y A;  2R05 A;  3GEI A;  1EQ1 A;  4PJN A;  4A2N B;  5BQH A;  3ZTM A;  4CS8 C;  4C7O A;  3KMI A;  4OD5 A;  1NFO A;  3CZ6 A;  2XLH A;  1HE9 A;  4JE9 A;  3AQB A;  2R7Q A;  1QQ3 A;  4MND A;  3W2V A;  1NG1 A;  4XWJ A;  3ZG1 A;  3NKE A;  3C8G D;  4P9T A;  1QZX A;  5JS5 A;  4G7O F;  5T3T A;  3TUL A;  1TR2 A;  3EG9 A;  4DXW A;  4WAB A;  4MS2 A;  2R7R A;  3DD7 A;  3SP1 A;  2JD3 A;  3JCU Q;  1RJ9 B;  3Q6N A;  3AG2 C;  4U5C E;  3X1O A;  3CQZ A;  4RDA A;  2CYD A;  3ITF A;  5FZT A;  2CDQ A;  1YYJ A;  5A6A A;  2P61 A;  1EKY A;  256B A;  2Y39 A;  4J30 B;  4ONS A;  4Z9I A;  3TJ5 A;  4BJ6 C;  2CNW A;  2ZXP A;  2XS1 A;  4F4B A;  1VMA A;  3KL4 A;  2PF4 E;  1Y4C A;  3LNR A;  1LPE A;  4P9F A;  1CGM E;  5D92 A;  4CIP A;  3FDQ A;  2I8B A;  2FAP B;  2Q00 A;  1F1M A;  3C8G B;  4AX2 A;  2HSQ A;  3DWW A;  3EH2 A;  3QW0 A;  1ZHX A;  2XLO A;  2CW0 F;  2MYS A;  1Q0M A;  3Q6M A;  3W4Y A;  3ZIB A;  3PMR A;  4E18 A;  1RMV A;  1JRA A;  1QVX A;  4YT2 A;  2LFF A;  2ZPA A;  3WHN A;  3K1H A;  3K33 A;  5EK0 A;  5JP7 A;  4KNW A;  5B3S C;  4N6H A;  5KYX A;  1HY5 A;  1Z6A A;  1YZC A;  2A0B A;  2NUP A;  2P1A A;  5F28 E;  4EBK A;  2LQG A;  4BJT A;  1BR2 A;  3JZ0 A;  3QW1 A;  3JYH A;  3IQC A;  2EIJ C;  2XLW A;  1S05 A;  3Q7L A;  1ZU5 A;  3B29 A;  3WOD F;  2D5R B;  3V5Z A;  4MW8 A;  2LFD A;  4JTD B;  3X2Q C;  1TFK B;  3GOD A;  1YDI A;  2GFH A;  3C62 A;  4Z9H A;  3L34 A;  4YL1 A;  2LD6 A;  1YYX A;  4IWB A;  5KYW B;  2AVK A;  2L6G A;  2YKZ A;  3IHU A;  3LS0 A;  2AWY A;  4M63 A;  2X0C A;  1E86 A;  4KC9 A;  1D1A A;  2EPL X;  1SR2 A;  3GWN A;  4YJW A;  3S29 A;  4OIQ F;  4DRI B;  1OXK A;  1U0B B;  3N0T A;  5E33 A;  4J7T A;  3IEE A;  3DM9 B;  3GEE A;  2ZD9 A;  2P0N A;  1CPR A;  1E2X A;  3DE9 A;  3NMI A;  4BJ1 A;  2P6V A;  2IYL D;  1Z5Z A;  2L6H A;  2ZXO A;  3CAX A;  4IAQ A;  2J9V A;  5JT4 A;  2EIM C;  4E0H A;  3NMK A;  2HFI A;  1Q0G A;  2A6E F;  3ZWI A;  3R2P A;  1T5O A;  2YRF A;  1U6H A;  2YEV A;  2X51 A;  2JPU A;  4H4K C;  4YK5 A;  2ETS A;  4YL0 A;  2KW3 C;  1RKE A;  2B0H A;  2R7O A;  5COF A;  3EHM A;  3TJ6 A;  1E85 A;  4E7S A;  1H6G A;  1G4W R;  1JOG A;  1YAU O;  3EZI A;  3OA1 A;  5JSL A;  3U3B A;  4CJG A;  4Q5S F;  5CIV A;  5E3C A;  5JRA A;  4MVO A;  3EGX B;  3N24 A;  1YVI A;  4FX5 A;  1L3P A;  1LE4 A;  1LS1 A;  1Z3I X;  1AEP A;  1ZHT A;  4CDY A;  4IGG A;  4EIY A;  2HV7 A;  2HZ8 A;  3UNG C;  5A6K A;  2QE9 A;  4Q7C A;  1WWP A;  1AUE A;  3MYI A;  3RQG A;  5DS6 A;  2HS5 A;  5HV9 A;  1FR0 A;  1U89 A;  1OKK A;  5DS5 A;  4CSA A;  1PD0 A;  2OJE D;  4HFF B;  1WN0 A;  1SYQ A;  3JRT A;  3IQ5 A;  4JEA A;  2F22 A;  2YL1 A;  2DB4 A;  1VYK A;  1D1C A;  2GA0 A;  3U5S A;  5KYY A;  4PJM A;  3EH1 A;  1OW8 A;  3K1I C;  4BJ5 A;  4IAR A;  5HSW A;  2LSE A;  3K66 A;  1ZHW A;  2DYS C;  2GDC A;  4N4W A;  3EGD B;  4MVR A;  2KQ9 A;  2UUI A;  4GQH A;  2CGE A;  4JUR I;  1LM3 B;  1SZI A;  4NTB A;  1ORY A;  3DM5 A;  5K0I A;  1V55 C;  2H8A A;  2Q4F A;  3DAF A;  1OR2 A;  3JYY A;  3F46 A;  1BZ4 A;  2WVQ A;  4CS9 C;  2YVK A;  3M4B A;  1VK5 A;  1MNE A;  3LEO A;  3I5Q A;  5B1B C;  3LES A;  1WAS A;  2XM4 A;  3DXJ F;  3ABL C;  3MBG A;  1BR1 A;  2EPK X;  3PCV A;  3RVY A;  2V3C C;  3ZTZ A;  3S28 A;  2R7U A;  2HJ3 A;  1JPN A;  4JJG A;  3R7C A;  4YWQ A;  3C8G A;  2P7V A;  4G0H A;  2IXP A;  1V4A A;  3EFO A;  1S7Z A;  4IAO A;  5KYN A;  2RD9 A;  3ABM C;  3GAN A;  3FMS A;  3RFY A;  2R02 A;  3UMK A;  1E83 A;  3FVY A;  1BR4 A;  3L8J A;  1V74 B;  2AU5 A;  1SMY F;  1ZVZ A;  2H7B A;  2XM0 A;  3N2Z B;  4HFK B;  4JKV A;  4N6C A;  5T3W A;  4D4N A;  4DBQ A;  2XL4 A;  4YT8 A;  4LAC B;  4W8K A;  1FNT c;  4KI2 A;  3ATP A;  4YL3 A;  4XEK A;  4L6R A;  5COG A;  3V5X A;  3GM3 A;  4CDV A;  1M2V B;  2LP4 A;  1MND A;  3RQF A;  1ORJ A;  2A6H F;  2QY9 A;  1RXQ A;  4O79 A;  2YLD A;  1XWJ A;  4BG0 A;  4W8P A;  4C3B A;  2WVN A;  2B0J A;  1BBH A;  3SEO A;  2V26 A;  2Y3D A;  4FAP B;  2L9J A;  2R9R B;  1FFT C;  2YQY A;  1QLE C;  3ASN C;  2HJM A;  4MVM A;  4ULW A;  1O5H A;  2VCC A;  2EPN A;  4P6I C;  4DVZ A;  1CPQ A;  5L0C A;  5L3Q A;  2J9U A;  2XSE A;  3QVY A;  4U5G A;  1CGO A;  1ZHY A;  4XPW A;  2PX3 A;  2HSB A;  1Z63 A;  3SXK A;  3ABK C;  3TK0 A;  3B0U X;  4JZA A;  5E3A A;  1VLT A;  3G50 A;  3WAQ A;  2R7T A;  5DQT A;  1NU7 D;  1N1C A;  2BL2 A;  1UG7 A;  2MWQ A;  3AJM A;  2XL8 A;  3GM2 A;  1JMW A;  1WOL A;  1OR3 A;  1GS9 A;  1WGW A;  1TWH A;  4CIH A;  2W9Y A;  3T6J A;  1LI7 A;  5L3V A;  1YA9 A;  4MTO A;  4BJ6 A;  5A69 A;  4NQF A;  1QKR A;  2M4E A;  1D0Z A;  1FTS A;  2XLD A;  2H7V C;  3SXY A;  3EGX A;  5JLI A;  2KNH A;  2QTV A;  1ZU4 A;  3OWT A;  3SYN A;  4OIP F;  3FAJ A;  4XTK A;  2XLE A;  3DAG A;  3GWL A;  5L0F A;  1FAP B;  2KK1 A;  4WGZ A;  2L6F A;  1A41 A;  3NMJ A;  2EIN C;  1MMD A;  2KJG A;  3NYL A;  4PR9 A;  2VAS A;  1XZQ A;  3NDB B;  1OXB A;  2VH3 A;  2NUT B;  1MMA A;  3JSE O;  3M79 A;  1H9T A;  1WAT A;  2Q7R A;  4PAC A;  3ZC4 A;  3U2L A;  5AC4 A;  5L0I A;  2R7X A;  3CEX A;  3U3F A;  1D1B A;  2Y3H A;  4MW3 A;  4R32 A;  1PCX A;  3DZA A;  4O6M A;  3U8V A;  4A4A A;  3J06 A;  3O39 A;  4MVZ A;  2HKV A;  4X0R A;  4YN0 B;  3DE8 A;  4KBL A;  1HMO A;  2Q9A A;  3FHD A;  3HNK A;  3JTL O;  2MHR A;  4RBN A;  2OEV A;  2Y69 C;  2WZF A;  4YT5 A;  2GWW A;  3JRM O;  3US6 A;  3S9O A;  4DRH B;  1H9G A;  2C03 A;  1YAR O;  2J8W A;  2XXA A;  4NTA A;  5EHH A;  5JVE A;  2A69 F;  2PNO A;  3A11 A;  3EG9 B;  2C04 A;  2IXN A;  4JCZ A;  3F47 A;  3DMD A;  4Z9J A;  4EBJ A;  3L8I A;  1LKX A;  2M64 A;  5D91 A;  3W8I A;  3DKA A;  4DOZ A;  3AGT A;  2HUJ A;  1NBB A;  3AG4 C;  2YL0 A;  3HLZ A;  4LDR A;  1R4T A;  1M56 C;  2EPO A;  3NYM A;  2WL8 A;  1A0B A;  3FOO A;  4MQ9 F;  1DOW A;  1GGQ A;  3UMI A;  2ASR A;  5BUO A;  3K6B A;  4JC7 A;  4UDV A;  4PJL A;  2J9W A;  2AWC A;  4CBE A;  2L7A A;  4U5D E;  2IOQ A;  2R7S A;  2J46 A;  3CSK A;  5KYU A;  1KNY A;  1M2V A;  4B6I A;  4LDQ A;  3UGO A;  1PD1 A;  3G4X A;  2EIL C;  4MVQ A;  2A68 F;  3DJU B;  4E0I A;  1IW7 F;  1T01 A;  1KTM A;  3VM6 A;  2J9B A;  2QLA A;  5KYX B;  3O55 A;  4IJJ A;  2NSG A;  2OQM A;  3KYJ A;  3C8Z A;  1I4Z A;  4IRU A;  4CJO A;  5L0G A;  1NU9 C;  4CDA A;  4U5B E;  4CSA C;  3T4R A;  1XZP A;  3NRH A;  3RVZ A;  3UMH A;  5AC5 A;  2I15 A;  1J8Y F;  1MQV A;  3LEV A;  1FFH A;  1K40 A;  1M2O A;  1YA7 O;  3ASO C;  3C18 A;  3HNI A;  4MTF A;  2PX0 A;  1TWC A;  4JIO A;  4BJ5 C;  4DJ9 A;  1RJ9 A;  3H2U A;  3ZQV A;  2NG1 A;  3GEH A;  5COM A;  1I5N A;  4XPX A;  1OW7 A;  4XEV A;  1BDJ B;  1NZE A;  4WJ0 A;  4CX9 A;  1C17 M;  4MVU A;  3HNJ A;  3S84 A;  3QVZ A;  3W8H A;  1C03 A;  1JAF A;  2WB7 A;  2DI3 A;  3HJC A;  1YLM A;  4N06 A;  3T6B A;  2J7P D;  4NY3 A;  3T6G B;  3U9M A;  3KH2 A;  4XLN F;  3IQ6 A;  2YLI A;  3SXZ A;  1VTM P;  5JUA A;  1TKN A;  1Z23 A;  5DLJ A;  3VRC A;  1MMN A;  4U9D A;  2YHS A;  4JW1 A;  1AVO B;  4OIR F;  5B3I A;  2CCY A;  2NPU A;  2Q9B A;  3HKK A;  1TWG A;  4NCQ A;  3FXH A;  3O6X A;  5IY5 C;  1R5I D;  2W4M A;  1ORS C;  3A9C A;  4G7Z F;  1VLS A;  2DYR C;  1OCR C;  4O6Y A;  1RKE B;  4EWC A;  1ZW2 A;  1Z7Q c;  3U2M A;  3EQL F;  2IXM A;  2JX0 A;  2XLM A;  3UGP A;  4HEA J;  3I5P A;  3RKO F;  1UFB A;  2ZXW C;  3TOL A;  1OCC C;  3SZR A;  3ZDL A;  1SF8 A;  1GQA A;  2G3K A;  1IZM A;  3C63 A;  3Q7G A;  2GAQ A;  3LLI A;  2WZL A;  5E2Q A;  3RIP A;  4CS8 A;  1J8M F;  4H54 A;  3KKB A;  3AG3 C;  4K1O A;  3HNL A;  5KYW A;  1VB5 A;  2YL7 A;  2Z15 A;  2NUT A;  4E7Z A;  1HW2 A;  2VB6 A;  2EPM X;  5A6B D;  2EIK C;  3L1M A;  1L7C A;  3QMK A;  2VC9 A;  1M57 C;  4I44 A;  1E84 A;  2AP3 A;  4ZLD A;  4C3E A;  1GM5 A;  3TD7 A;  2TMV P;  3U9J A;  3RH3 A;  4D4X A;  5KYY B;  4MVS A;  4EBB A;  1LI5 A;  4BEM J;  3AOU A;  1T6Q A;  1W2W A;  2FGY A;  4U9E A;  4U5H A;  4XPY A;  1KU2 A;  3E70 C;  5L0H A;  4HE8 D;  3EPV A;  2ICW G;  4MTG A;  5EGY A;  4I1M A;  3UR3 C;  4AK9 A;  3C7J A;  3SXM A;  1G4U S;  2E87 A;  1VYI A;  4U5F E;  1HMD A;  4E17 A;  3M1C B;  1C02 A;  1QPU A; 
#chains in the Genus database with same CATH homology
 3NKD A;  2R7W A;  4AE4 B;  3S27 A;  3WG7 C;  3B0V C;  4O6N A;  3H65 A;  4ANJ A;  1FMV A;  2A1D D;  1OCZ C;  3EFO B;  4Q4Z F;  4YT4 A;  4CS7 A;  3NG1 A;  1ZYR F;  3LJB A;  4K0D A;  2XRH A;  2IXO A;  2DGJ A;  4JJF A;  3EGD A;  5FCL A;  2G3V A;  4C7O B;  1V54 C;  1ZHZ A;  2CNW D;  3LAY A;  3VYW A;  3I4U A;  2KGO A;  4RD9 A;  2Q3T A;  4PK4 A;  1LVK A;  3DJN B;  2HV6 A;  4JCH A;  3L0I A;  2H7O A;  4FWV A;  5F5H A;  3S0X A;  1VOM A;  1TWA A;  1ST6 A;  4K7B A;  4GEH A;  2Q9C A;  3EHN A;  5B1A C;  1FMW A;  2YZS A;  4XLP F;  1G8X A;  3B9Q A;  4I1O B;  2W4B A;  4LLE A;  1OCO C;  2ZXR A;  2O9X A;  4PFO A;  5DVW A;  4BEJ A;  3AQC A;  1D0X A;  2W45 A;  2WZG A;  3ZVR A;  2L81 A;  4OIN F;  2J7P A;  2NUP B;  4C3D A;  4JVS A;  3SNH A;  3MX3 A;  4GYT A;  4KNV A;  4DBR A;  2J0W A;  4QI0 A;  3NYJ A;  3JT1 A;  4QDL A;  3OEO A;  3B0P A;  2Y3B A;  3W2W A;  1O87 A;  4G7H F;  2J0X A;  2PFD A;  2OCC C;  2FFH A;  3MLG A;  5T1D B;  4CS9 A;  4OIO F;  4LLC A;  2J45 A;  2G62 A;  4LER A;  4U5E E;  2PP4 A;  3ECS A;  5CI9 A;  3E9V A;  4O7G A;  5CI8 A;  4ZLC A;  5F5F A;  3QZC A;  3ZSU A;  1MMG A;  5DS4 A;  4OD4 A;  3PHF 2;  1OKK D;  3JSZ A;  1JPJ A;  3V7O A;  2Y3G A;  2R7V A;  4AE4 A;  3VAY A;  2XXA B;  2WVO A;  4PJJ A;  3K7D A;  4DVY P;  3POV A;  3AG1 C;  3LLK A;  4QI2 A;  4FES A;  4J32 B;  3RYL A;  3EJN A;  3EZH A;  3LS1 A;  5DQZ A;  2BE5 F;  2OG2 A;  4I3M A;  4PFP A;  3HTK C;  5KYU B;  1D0Y A;  4PJN A;  4A2N B;  4CS8 C;  4C7O A;  3KMI A;  4OD5 A;  3CZ6 A;  4MND A;  3W2V A;  3ZG1 A;  3AQB A;  2R7Q A;  1NG1 A;  4XWJ A;  3NKE A;  1QZX A;  4G7O F;  5T3T A;  1TR2 A;  3EG9 A;  2R7R A;  3DD7 A;  3SP1 A;  2JD3 A;  3JCU Q;  1RJ9 B;  3Q6N A;  3AG2 C;  4U5C E;  3CQZ A;  4RDA A;  3ITF A;  2CDQ A;  2Y39 A;  4J30 B;  4BJ6 C;  2CNW A;  2ZXP A;  4F4B A;  1VMA A;  3KL4 A;  2PF4 E;  3LNR A;  5D92 A;  3FDQ A;  2I8B A;  4AX2 A;  3EH2 A;  1ZHX A;  2CW0 F;  2MYS A;  3Q6M A;  3ZIB A;  3PMR A;  4YT2 A;  2ZPA A;  3K1H A;  3K33 A;  5KYX A;  4KNW A;  5B3S C;  1Z6A A;  2NUP A;  4BJT A;  1BR2 A;  3JYH A;  2EIJ C;  3Q7L A;  1ZU5 A;  3WOD F;  2D5R B;  3X2Q C;  3GOD A;  2GFH A;  3L34 A;  4IWB A;  5KYW B;  3LS0 A;  4M63 A;  4KC9 A;  1D1A A;  4OIQ F;  4YJW A;  3S29 A;  3N0T A;  5E33 A;  3IEE A;  3DM9 B;  4BJ1 A;  2P6V A;  2IYL D;  1Z5Z A;  2ZXO A;  2J9V A;  2EIM C;  2A6E F;  2YEV A;  3X1O A;  4H4K C;  2X51 A;  2KW3 C;  2R7O A;  3EHM A;  4E7S A;  3EZI A;  3OA1 A;  4Q5S F;  5E3C A;  3EGX B;  3N24 A;  4FX5 A;  1LS1 A;  1Z3I X;  1ZHT A;  2HV7 A;  3UNG C;  4Q7C A;  5DS6 A;  1OKK A;  5DS5 A;  4CSA A;  1PD0 A;  4HFF B;  3JRT A;  1VYK A;  1D1C A;  5KYY A;  4PJM A;  3EH1 A;  4BJ5 A;  3K1I C;  5HSW A;  2LSE A;  3K66 A;  1ZHW A;  2DYS C;  3EGD B;  2KQ9 A;  2CGE A;  4JUR I;  1SZI A;  3DM5 A;  1V55 C;  3DAF A;  3F46 A;  4CS9 C;  2WVQ A;  1VK5 A;  1MNE A;  3I5Q A;  5B1B C;  3LES A;  3DXJ F;  3ABL C;  1BR1 A;  2V3C C;  3S28 A;  2R7U A;  1JPN A;  4JJG A;  4YWQ A;  2P7V A;  4G0H A;  2IXP A;  3EFO A;  1S7Z A;  4IAO A;  5KYN A;  3GAN A;  3ABM C;  3RFY A;  3UMK A;  3FVY A;  1BR4 A;  1SMY F;  2H7B A;  3N2Z B;  4HFK B;  4DBQ A;  5T3W A;  4YT8 A;  4KI2 A;  2XL4 A;  4LAC B;  4W8K A;  1M2V B;  1MND A;  2A6H F;  2QY9 A;  4O79 A;  4BG0 A;  4C3B A;  2WVN A;  2B0J A;  3SEO A;  2V26 A;  2Y3D A;  2L9J A;  1FFT C;  1QLE C;  3ASN C;  4ULW A;  1O5H A;  4P6I C;  4DVZ A;  5L3Q A;  2J9U A;  2XSE A;  4U5G A;  1ZHY A;  2PX3 A;  1Z63 A;  3ABK C;  3B0U X;  4JZA A;  5E3A A;  2R7T A;  5DQT A;  1NU7 D;  1N1C A;  2MWQ A;  1WGW A;  1TWH A;  4CIH A;  2W9Y A;  3T6J A;  5L3V A;  4BJ6 A;  2M4E A;  1D0Z A;  1FTS A;  2H7V C;  3EGX A;  2KNH A;  2QTV A;  1ZU4 A;  3OWT A;  3SYN A;  4OIP F;  3FAJ A;  4XTK A;  3DAG A;  2EIN C;  1MMD A;  2KJG A;  3NYL A;  2VAS A;  3NDB B;  2VH3 A;  2NUT B;  1MMA A;  3ZC4 A;  2R7X A;  1D1B A;  2Y3H A;  1PCX A;  3DZA A;  4O6M A;  3O39 A;  4X0R A;  4YN0 B;  4KBL A;  2Q9A A;  3FHD A;  4RBN A;  4YT5 A;  2Y69 C;  2WZF A;  2C03 A;  2XXA A;  5EHH A;  2A69 F;  3EG9 B;  2C04 A;  2IXN A;  3F47 A;  3DMD A;  1LKX A;  5D91 A;  3W8I A;  4DOZ A;  3AG4 C;  3HLZ A;  3UR3 C;  1M56 C;  3NYM A;  3UMI A;  2WL8 A;  4MQ9 F;  5BUO A;  3K6B A;  4PJL A;  2J9W A;  4CBE A;  4U5D E;  2IOQ A;  2R7S A;  2J46 A;  3CSK A;  5KYU A;  1M2V A;  4B6I A;  3UGO A;  1PD1 A;  2EIL C;  2A68 F;  3DJU B;  1IW7 F;  5KYX B;  4IJJ A;  4IRU A;  1NU9 C;  4CSA C;  4U5B E;  3T4R A;  3NRH A;  3UMH A;  1J8Y F;  3LEV A;  1FFH A;  1M2O A;  3ASO C;  2PX0 A;  1TWC A;  4BJ5 C;  1RJ9 A;  2NG1 A;  1NZE A;  4WJ0 A;  3W8H A;  2WB7 A;  3HJC A;  4N06 A;  3T6B A;  2J7P D;  4NY3 A;  3KH2 A;  4XLN F;  1TKN A;  1Z23 A;  5DLJ A;  1MMN A;  2YHS A;  4JW1 A;  4OIR F;  2Q9B A;  1TWG A;  3O6X A;  5IY5 C;  4G7Z F;  2W4M A;  2DYR C;  1OCR C;  4O6Y A;  4EWC A;  3EQL F;  2IXM A;  3UGP A;  4HEA J;  3I5P A;  3RKO F;  2ZXW C;  1OCC C;  3SZR A;  1SF8 A;  2G3K A;  1IZM A;  3Q7G A;  3LLI A;  2WZL A;  5E2Q A;  3RIP A;  4CS8 A;  1J8M F;  5KYW A;  3KKB A;  3AG3 C;  2Z15 A;  2NUT A;  4E7Z A;  2VB6 A;  2EIK C;  3QMK A;  1M57 C;  4I44 A;  4ZLD A;  4C3E A;  3TD7 A;  3RH3 A;  5KYY B;  4EBB A;  1W2W A;  2FGY A;  4U5H A;  1KU2 A;  3E70 C;  4HE8 D;  3EPV A;  5EGY A;  4I1M A;  4AK9 A;  2E87 A;  1VYI A;  4U5F E;  3M1C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...