2O9XA

Crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
RENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reductase, assembly protein
publication title An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 51
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02613 Nitrate_red_del Nitrate reductase delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4070.10 Mainly Alpha Orthogonal Bundle putative redox-enzyme maturation protein fold putative redox-enzyme maturation protein domain 2o9xA02
1.20.120.700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2o9xA01
2O9XA
chains in the Genus database with same CATH superfamily
3GANA 4RBNA 1NBBA 2OEXA 4DOZA 2I8BA 5FCLA 4MVMA 1V4AA 3TULA 3AGTA 1JOGA 1YZCA 1OW8A 3LUTB 3LS1A 2H7BA 1CPQA 5L0JA 1LM3B 3NRHA 2Q3TA 3NMJA 2X51A 3C62A 4PJLA 1XZQA 1I5NA 2R02A 4OD4A 5JSLA 1GQAA 5T3WA 2FFHA 1FNTc 2Y39A 1BBHA 3ZQYA 1U6HA 4O6YA 1IZMA 3V7OA 1L3PA 2XSEA 1CGNA 1J8MF 2GDCA 4G78A 3WHNA 1KTMA 4QI0A 4I3MA 1RCPA 3U3BA 1D0XA 4C7OA 3LAYA 4AX2A 1MQVA 3LESA 1M2OA 5CIVA 3JCUQ 1GM5A 3VAYA 5A6BA 2R05A 2A6HF 2LSEA 3PHF2 4BJ6A 4WJ0A 2MYSA 3QVYA 3RQEA 5A6JA 1ORJA 3FAJA 3JZ0A 5CI9A 3JRMO 3ECSA 3KH2A 4EUKB 2Q9CA 2R7UA 4MTOA 3G4XA 4E0HA 1D1CA 2XXAB 1RKEB 3DZAA 2YL0A 4D4NA 1H9TA 2EPMX 2Z15A 2XLHA 1OR3A 5B1BC 1XWJA 3UGOA 4K0DA 2V3CC 3ASNC 4XLPF 3MBGA 1ZZPA 2JPUA 2OG2A 3C18A 4DVYP 5EK0A 1CPRA 3ABMC 4XWJA 1LS1A 2KSFA 1YJGA 3RF3A 3RH3A 1T6IA 1OW6A 4YWQA 3QMKA 1NU7D 4KI2A 3EH2A 2GA0A 4Z9JA 2L6FA 2CCYA 3U8PA 2E87A 1H9GA 3NYMA 5JUAA 3S84A 2VASA 5HV9A 2HMZA 2PX0A 2XXAA 4MQ9F 3IQCA 4XLNF 4CS7A 2R7WA 1HMOA 256BA 2RD9A 4AK9A 1Y4CA 5T1DB 5F5HA 4DRJB 2J7PA 4G7ZF 4CS9C 4LACB 4DBQA 3O10A 3DWWA 3SXYA 1BDJB 1CGME 2OU6A 3ZDLA 1ST6A 3ZIBA 1RKCA 2BC5A 4P6IC 1YARO 2P6VA 4NCQA 3EHNA 3MYIA 3C8ZA 4OINF 5A69A 2ETSA 2LQGA 3F46A 1LS4A 5D92A 4C3BA 1E2XA 1W2WA 4JJGA 2M4EA 3G4ZA 2P0NA 4N06A 5A6KA 4W8PA 4DBRA 3LEOA 1OCCC 4IJJA 4XQ1A 3SNHA 1BZ4A 4YK5A 3V5XA 3IQ6A 5L0GA 1BR1A 4NTFA 4XEFA 1ZHTA 4PK4A 5KYUA 3NKDA 3EH1A 3VRCA 1ORYA 4GQHA 5COFA 3DE9A 1LI5A 3VM6A 2OCCC 4BJ5C 2VB6A 4CDYA 3U0CA 2Q7RA 5F5FA 2HUJA 3UR3C 1M2VB 3VYWA 3KMIA 4U5EE 4ULWA 3LNMB 3RVZA 3U9MA 1VYIA 2L81A 1HY5A 4RDAA 2J8WA 4OIRF 4IAOA 2Y3GA 1C17M 2CDQA 1EA8A 5COMA 3B71A 1D1BA 1LI7A 2YQYA 1SR2A 3FHDA 1NLXA 3LEVA 4NTBA 5B1AC 2J0WA 2LP4A 3T6BA 1HE9A 5DQZA 5L0DA 2EPOA 3R7CA 4WGZA 3C7JA 3TK0A 1LVKA 2XL8A 3MYFA 1Y6DA 3PDMP 2YL7A 4AL1A 1E84A 3S28A 3EG9A 3M79A 1ORSC 4G0HA 1TKNA 2HJ3A 4BEJA 4IRUA 4U5CE 1M2VA 4IAQA 1S05A 2NPUA 1OCZC 1WTYA 3CZ6A 4OIPF 2YLIA 1SYQA 3I5QA 2AP3A 3US6A 1RJ9B 4CBEA 4CJOA 4CDAA 1AVOB 4ZLCA 2LIGA 4CIPA 1WATA 3EHMA 1U0BB 1TWHA 5JS5A 1AUEA 1ZVZA 2YEVA 3CAXA 1H6GA 3S9OA 4E18A 3HLZA 3B0PA 3S90A 3TQOA 1A0BA 2YKZA 5KYYB 1WASA 5KYXB 4I44A 3X1OA 3IHUA 1FTSA 3LJBA 1YDIA 1ZHYA 2EILC 2WL8A 4JE9A 1ZW3A 3L34A 1RJ9A 4JCZA 2B0JA 4I1MA 2Q00A 4O6MA 3Q6MA 4F4BA 4DVZA 1OW7A 3EZIA 2L9JA 3KPHA 1DOWA 4Q7CA 3TOLA 2ZXPA 4ER9A 2R7VA 3MX3A 3GWLA 3B9QA 3QTHA 3X2QC 2LK4A 3K66A 2X0CA 4CSAA 3RW0A 1T6QA 1TFOB 3DM9B 4K1OA 5JRAA 5KYYA 1I4ZA 2W4BA 5KYXA 4CJGA 3A9CA 1QSPA 2XL4A 2W4MA 1F1MA 2W45A 4P9TA 5DLJA 4NC3A 3FVYA 1A7EA 2PFDA 3HNIA 3W2WA 3V5YA 1C03A 1LKXA 4JRZA 2R7RA 1PCXA 3PMRA 4M63A 1SMYF 2LCHA 3POVA 1MMAA 3EGDB 1ZU5A 1TWGA 2L6GA 1NZEA 2BL2A 2Q9BA 2R03A 2PBEA 3IQTA 4PJJA 3C63A 4YT5A 5JVEA 4OIOF 3GEHA 4PFOA 1D1AA 4O79A 4CX9A 2IXMA 2IBFA 2QTVA 4BG0A 1Q0FA 2OEVA 2DI3A 1WOLA 2D4UA 2VH3A 3VF0A 1ZW2A 4JJFA 3BRJA 4G7OF 2PP4A 2XRHA 4XEKA 5B3IA 4EHPA 2PF4E 2WB7A 3N2ZB 3SP1A 4KC9A 1JMWA 3HTKC 4QI2A 3K7DA 1A7VA 3RYLA 2PX3A 4MVSA 3M15A 3NYJA 3OWTA 5CI8A 5DQTA 5A6BD 4HEAJ 3EZHA 3L8JA 3RQFA 3OEOA 3EGDA 1RXQA 3ITFA 3GM3A 2H8AA 4JEAA 3CEXA 1SZIA 2G3VA 1VLSA 5A6AA 4JEBA 2ZD9A 2PNOA 4O7GA 2AWYA 2FAPB 1YLMA 1OKKA 4IGGA 1WGWA 4NTAA 5D91A 1CGOA 4JTDB 4XPXA 2VCBA 3S27A 4GEHA 3JYYA 4OIQF 1O87A 4CS8C 5L3QA 4AL0A 1C02A 2XLEA 4Q5SF 2KNHA 1N1CA 2IM8A 1G4WR 4DXWA 1YZAA 3AQCA 3JSEO 3IEEA 3Q6NA 3DM5A 2MHRA 2CNWA 3GORA 5L3VA 3J06A 2G62A 4D4XA 2XLWA 1FFTC 4DJ9A 2EINC 1LPEA 2ZXWC 4ANJA 5BUOA 1M56C 5KYUB 2XLMA 3FDQA 3I5PA 2J0XA 3L8IA 4U5BE 3EFOA 4XEVA 3NG1A 2HZ8A 2HKVA 4JIOA 4PFPA 3ZTZA 3E9VA 2WVQA 4BEMJ 4J7YA 3SXKA 1A7DA 1M6TA 3K1IA 4FESA 2G3KA 2J7PD 1MMGA 2QLAA 2CW0F 3KYIA 1HW2A 1G8XA 3TJ6A 3DI5A 1G5ZA 4L6RA 3LLKA 4HFFB 5E3CA 1Z7Qc 2XM0A 1FR0A 3MLGA 3TJ5A 3R2PA 1VLTA 1KU2A 1TWAA 4PJMA 1FMVA 1D0YA 4BJ1A 4CDVA 3PCVA 2J9WA 4PR9A 3U2MA 3C8GB 4NY3A 3EG9B 2KJGA 2OJQA 2OKUA 4ULVA 3NDBB 2A1DD 3AJMA 2J9UA 3F47A 2EIJC 3EJNA 4G7HF 2IYLD 2LD6A 4OD5A 3L1MA 5F28E 1NU9C 2RSEB 3T6GB 1T6UA 3AOUA 3N24A 3UMHA 4BJ6C 3LS0A 4LDQA 4E7ZA 1G4US 4JC7A 1ZYRF 2XLOA 1EQ1A 3SXZA 2CYDA 3NYLA 2IXOA 3ZC4A 2IOQA 3S0XA 3KKBA 1PD1A 4MVRA 2EPNA 5DVWA 1L7CA 3QW0A 5DS4A 1IW7F 2XS1A 3C8GA 4J30B 1I4YA 2WVOA 3JRTA 2YL3A 5AGFA 4E7SA 1Q0KA 2LFFA 3QW1A 2EIKC 4UDVA 2L7AA 3RKOF 3ZVRA 3FAPB 3B0UX 5E3AA 1QQ3A 1V55C 4FWVA 2NG1A 2P1AA 2KC3A 3HKKA 2ZPAA 1K04A 1YA9A 3NKEA 3U3FA 4C3EA 1GGQA 4HE8D 4EKWA 1Z5ZA 4WABA 3GWNA 4A4AA 3C8GD 3IQ5A 3LNRA 5DS6A 1Z63A 2VCCA 1YAUO 4E0IA 2GFHA 2KYHA 2KQ9A 2OQMA 3RIPA 1B68A 1HE1A 2VCAA 4CIHA 3K33A 1WN0A 4U5FE 4FAPB 4Z9IA 3JSZA 2GWWA 2JD3A 3AG1C 4N6HA 4N6CA 3GEIA 3RFYA 1YYXA 2QUPA 4JURI 1T5OA 3RVYA 3O6XA 1K40A 2O9XA 2Y3DA 3K1HA 2UUHA 3GM2A 4GYTA 3UMIA 5T3TA 3M4BA 4BJTA 2NSFA 2HV7A 5E2QA 4IWBA 1ZU4A 3HNJA 3W2VA 1FMWA 1E86A 1ZHZA 4YT4A 2BE5F 4HFKB 4LDRA 3GODA 4ZLDA 5TJ5E 5BQGA 1FFHA 4XPYA 5HSWA 2R7TA 4MTGA 2V26A 4EBKA 1PD0A 2B0HA 4EBBA 2IXNA 3WG7C 3CSKA 5EHHA 2Q4FA 3DKAA 2QY9A 4JTAB 4U9EA 2M64A 3U9JA 4PJNA 1R4TA 5B3SC 3G50A 3FOPA 1FAPB 2KGOA 4U5DE 1BR2A 2R7QA 2OJED 3H2VA 1QKRA 3SYNA 3U8VA 3ZSUA 5L0IA 3AG2C 3DAGA 4QDLA 4MW3A 2NUPB 3ZG1A 3EPVA 3T6JA 2WVNA 2YLDA 2ZXOA 3TOMA 3ATPA 1T9KA 2Q9AA 5KYWB 2AWCA 2NSGA 2EPKX 2WZGA 1TFKB 4PACA 2YZSA 1AEPA 1NSGB 2ICWG 3AGUA 5FZTA 3NMIA 2I15A 1H7IA 2QNLA 1MNEA 2R9RB 4JKVA 1NG1A 2OOCA 2P61A 2W9YA 4LLEA 4MW8A 4BPMA 3E70C 1ZHXA 1VK5A 4Z9HA 3Q7GA 1VB5A 3GM1A 3UNGC 4BJ5A 5EGYA 1R5ID 4I1OB 5AC5A 2AU5A 1V54C 3EFOB 4JW1A 1M57C 4E17A 1A41A 5E33A 3SZRA 3B0VC 2NUPA 2NUTB 4U9DA 3HJCA 2J9VA 3Q7LA 4MVOA 4AE4B 1NFNA 4MVQA 4R32A 5COGA 2KW3C 1XZPA 5KYWA 1QLEC 4IB4A 4EWCA 2HV6A 3SEOA 2R25A 2DGJA 4YL1A 2C04A 4U5GA 3ZWIA 1VMAA 2HJMA 3EQLF 3W8HA 2XM4A 3UGPA 2QE9A 4YN0B 3O39A 2R7SA 4MNDA 2LFDA 1S7ZA 1TQGA 3V5ZA 3OA1A 3EGXB 1U89A 1OKKD 3N0TA 1MMDA 5BQIA 4MVUA 3MFNA 3W4YA 4YL0A 2NUTA 3ZQVA 4A2NB 5DS5A 3H2UA 4AE4A 2WZFA 1T01A 4RD9A 1O5HA 2ASRA 2WZLA 2A6EF 1NFOA 2CNWD 3W8IA 1JR8A 4EBJA 1OCOC 1OQCA 1V74B 2AVKA 1JRAA 1APCA 2F22A 2J46A 1YYJA 1Q0GA 1PV3A 1RKEA 3DXJF 4O6NA 4CSAC 4JCHA 4LERA 1E83A 2XLDA 4MVZA 3BEHA 5JT4A 3T4RA 5L0HA 1LIHA 2Y3HA 3EGXA 2Y3BA 5L0FA 4ONSA 3ABLC 2DB4A 3KL4A 3NMKA 3CQZA 4J32B 1GS9A 3JYHA 3SXMA 5K0IA 4DRHB 1O3UA 4WGYA 2YRFA 4JZAA 3KYJA 4JTCB 2HSBA 4P9FA 2H7VC 2IXPA 2EIMC 2XLVA 2JX0A 2XL6A 1QVXA 3A11A 3AG4C 3RQGA 3FOOA 4Q4ZF 3T9OA 5AC4A 3IPMO 2A69F 2HFIA 2YL1A 5IY5C 2KK1A 1HMDA 2XS8A 1QZXA 2YVKA 4LLCA 3WODF 1JAFA 2C03A 1K05A 1YVIA 1VYKA 4MS2A 2A0UA 1OXKA 3JTLO 2EPLX 3AG3C 1RMVA 1UG7A 3L0IA 2A0BA 5BQHA 1LE4A 2TMVP 1JPNA 1OXBA 4H4KC 3QZCA 4MTFA 4K7BA 4U5HA 3M1CB 1BR4A 3H65A 1D0ZA 4YJWA 2MWQA 1Z3IX 3I4UA 3UMKA 2HS5A 3M4CA 3GEEA 4KNVA 3HNKA 4YT8A 1TR2A 1YA7O 4KBLA 4EIYA 4C7OB 2GAQA 3ABKC 3AQBA 2D5RB 1E85A 4YT2A 1MMNA 1DOVA 5JP7A 3U2LA 2DYSC 3JT1A 3DMDA 3ASOC 3QVZA 1Z23A 2VC9A 3FXHA 1Z6AA 2J9BA 3TD7A 2HSQA 1HW1A 2L6HA 3DAFA 1OCRC 2YWAA 3ZTMA 2J45A 1VTMP 1EKYA 1Q0DA 4YL3A 1KNYA 1MNDA 3DJUB 4J7TA 2HMQA 5JLIA 2H7OA 4N4WA 2YHSA 5GPGB 4X0RA 1WWPA 3K6BA 4JVSA 5KYNA 1VOMA 1UFBA 4XPWA 2FGYA 2YLGA 3FMSA 3K1IC 1ZHWA 3O55A 2Y69C 1EI7A 1LE2A 1Q0MA 3LLIA 3U5SA 1OR2A 2A68F 3DE8A 4B6IA 3DJNB 2UUIA 4KNWA 4W8KA 3WAQA 1SF8A 2P7VA 4CS8A 4DRIB 4C3DA 2ZXRA 1QPUA 3S29A 1TWCA 4IARA 4XTKA 5L0CA 2CGEA 2R7OA 1JPJA 1J8YF 3B29A 3HNLA 3DD7A 4NQFA 2R7XA 2DYRC 4FX5A 4LDKA 4CS9A 4H54A
chains in the Genus database with same CATH topology
3GANA 4RBNA 4DOZA 5FCLA 2I8BA 3LS1A 2H7BA 3NRHA 2Q3TA 2X51A 4PJLA 4OD4A 5T3WA 2FFHA 2Y39A 4O6YA 1IZMA 3V7OA 2XSEA 1J8MF 4QI0A 4I3MA 1D0XA 3LAYA 4AX2A 3LESA 1M2OA 3JCUQ 3VAYA 2A6HF 2LSEA 3PHF2 4BJ6A 4WJ0A 2MYSA 3FAJA 5CI9A 3ECSA 3KH2A 2Q9CA 2R7UA 1D1CA 2XXAB 3DZAA 2Z15A 5B1BC 2V3CC 3UGOA 4K0DA 3ASNC 4XLPF 2OG2A 4DVYP 3ABMC 4XWJA 1LS1A 3RH3A 3QMKA 1NU7D 4KI2A 3EH2A 2E87A 3NYMA 2VASA 2PX0A 2XXAA 4MQ9F 4CS7A 2R7WA 4AK9A 5T1DB 5F5HA 2J7PA 4CS9C 4LACB 4DBQA 1ST6A 3ZIBA 4P6IC 2P6VA 3EHNA 4OINF 3F46A 5D92A 4C3BA 1W2WA 4JJGA 2M4EA 4N06A 4DBRA 1OCCC 4IJJA 3SNHA 1BR1A 1ZHTA 4PK4A 5KYUA 3NKDA 3EH1A 2OCCC 4BJ5C 2VB6A 5F5FA 3UR3C 1M2VB 3VYWA 3KMIA 4U5EE 4ULWA 1VYIA 2L81A 4RDAA 4OIRF 4IAOA 2Y3GA 2CDQA 1D1BA 3FHDA 5B1AC 5DS6A 3LEVA 2J0WA 5DQZA 3T6BA 1LVKA 3S28A 3EG9A 4G0HA 1TKNA 4BEJA 4IRUA 4U5CE 1M2VA 1OCZC 3CZ6A 4OIPF 3I5QA 1RJ9B 4CBEA 4ZLCA 3EHMA 1TWHA 2YEVA 3HLZA 3B0PA 5KYYB 5KYXB 4I44A 3X1OA 1FTSA 3LJBA 1ZHYA 2EILC 2WL8A 3L34A 1RJ9A 2B0JA 4I1MA 4O6MA 3Q6MA 4F4BA 4DVZA 3EZIA 2L9JA 4Q7CA 2R7VA 2ZXPA 3MX3A 3B9QA 3X2QC 3K66A 4CSAA 3DM9B 5KYYA 2W4BA 5KYXA 2XL4A 2W4MA 5DLJA 2W45A 3FVYA 2PFDA 3W2WA 1LKXA 2R7RA 1PCXA 3PMRA 4M63A 1SMYF 3POVA 1MMAA 3EGDB 1ZU5A 1TWGA 2Q9BA 1NZEA 4PJJA 4G7ZF 4YT5A 4OIOF 4PFOA 1D1AA 4O79A 2IXMA 2QTVA 4BG0A 2VH3A 4JJFA 4G7OF 2PP4A 2XRHA 3N2ZB 2PF4E 2WB7A 3SP1A 4KC9A 3HTKC 4QI2A 3K7DA 3RYLA 2PX3A 5DQTA 3OWTA 3NYJA 5CI8A 4HEAJ 3EZHA 3OEOA 3EGDA 3ITFA 1SZIA 2G3VA 4O7GA 1OKKA 5D91A 1WGWA 3S27A 4OIQF 4GEHA 1O87A 4CS8C 5L3QA 2KNHA 1N1CA 3AQCA 3IEEA 3Q6NA 3DM5A 2CNWA 5L3VA 2G62A 1FFTC 2EINC 2ZXWC 4ANJA 5BUOA 1M56C 5KYUB 3FDQA 3I5PA 2J0XA 4U5BE 3EFOA 3NG1A 4PFPA 3E9VA 2WVQA 4FESA 2G3KA 2J7PD 1MMGA 2CW0F 1G8XA 5E3CA 3LLKA 4HFFB 3MLGA 1KU2A 1TWAA 4PJMA 1FMVA 1D0YA 4BJ1A 2J9WA 4NY3A 3EG9B 2KJGA 3NDBB 2A1DD 3F47A 2J9UA 4G7HF 2EIJC 3EJNA 2IYLD 4OD5A 1NU9C 4BJ6C 3N24A 3UMHA 3LS0A 4E7ZA 1ZYRF 3NYLA 2IXOA 3ZC4A 2IOQA 3S0XA 3KKBA 1PD1A 5DVWA 5DS4A 1IW7F 4J30B 2WVOA 3JRTA 4E7SA 2EIKC 3RKOF 3B0UX 5E3AA 1V55C 4FWVA 2NG1A 3NKEA 4C3EA 4HE8D 1Z5ZA 3LNRA 1Z63A 2GFHA 2KQ9A 3RIPA 4CIHA 3K33A 4U5FE 3JSZA 3RFYA 2JD3A 3AG1C 4YWQA 4JURI 3O6XA 2O9XA 2Y3DA 3K1HA 4GYTA 3UMIA 5T3TA 4BJTA 2HV7A 5E2QA 4IWBA 1ZU4A 3W2VA 1FMWA 1ZHZA 4YT4A 2BE5F 4HFKB 3GODA 4ZLDA 1FFHA 5HSWA 2R7TA 2V26A 1PD0A 4EBBA 2IXNA 3WG7C 3CSKA 5EHHA 2QY9A 4PJNA 5B3SC 3SYNA 4U5DE 2KGOA 1BR2A 2R7QA 3ZSUA 3AG2C 3DAGA 4QDLA 2NUPB 3ZG1A 3EPVA 3T6JA 2WVNA 2ZXOA 2Q9AA 5KYWB 2WZGA 2YZSA 1MNEA 4LLEA 1NG1A 2W9YA 3E70C 1ZHXA 1VK5A 3Q7GA 3UNGC 4BJ5A 5EGYA 4I1OB 1V54C 3EFOB 4JW1A 1M57C 5E33A 3SZRA 3B0VC 2NUPA 2NUTB 3HJCA 2J9VA 3Q7LA 4AE4B 2KW3C 5KYWA 1QLEC 4EWCA 2HV6A 3SEOA 2DGJA 2C04A 4U5GA 1VMAA 3W8HA 3EQLF 2R7SA 4YN0B 3O39A 4MNDA 1S7ZA 3OA1A 3EGXB 3N0TA 1OKKD 1MMDA 4A2NB 2NUTA 5DS5A 4AE4A 2WZFA 4RD9A 1O5HA 2WZLA 2A6EF 2CNWD 3W8IA 1OCOC 2ZPAA 2J46A 4O6NA 3DXJF 4CSAC 4JCHA 4LERA 3T4RA 2Y3HA 3EGXA 2Y3BA 3ABLC 3KL4A 3CQZA 4J32B 3JYHA 4JZAA 2H7VC 2IXPA 2EIMC 4Q4ZF 3AG4C 3UGPA 2A69F 5IY5C 1QZXA 4LLCA 3WODF 2C03A 1VYKA 3AG3C 3L0IA 1JPNA 4H4KC 3QZCA 4K7BA 4U5HA 3M1CB 1BR4A 3H65A 1D0ZA 4YJWA 2MWQA 1Z3IX 3I4UA 3UMKA 4KNVA 4YT8A 1TR2A 4KBLA 4C7OB 3AQBA 3ABKC 2D5RB 4YT2A 1MMNA 2DYSC 3JT1A 3DMDA 3ASOC 1Z23A 1Z6AA 3TD7A 3DAFA 1OCRC 2J45A 3DJUB 1MNDA 2H7OA 2YHSA 4X0RA 3K6BA 4JVSA 5KYNA 1VOMA 3ZVRA 4C7OA 2FGYA 3K1IC 4Q5SF 1ZHWA 2Y69C 3LLIA 2A68F 4B6IA 3DJNB 4KNWA 4W8KA 1SF8A 2P7VA 4CS8A 4C3DA 2ZXRA 3S29A 1TWCA 4XTKA 2CGEA 2R7OA 1JPJA 1J8YF 3DD7A 2R7XA 2DYRC 4FX5A 4CS9A 4XLNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9X A; 
#chains in the Genus database with same CATH topology
 3GAN A;  4RBN A;  1NBB A;  2OEX A;  4DOZ A;  2I8B A;  5FCL A;  4MVM A;  1V4A A;  3TUL A;  3AGT A;  1JOG A;  1YZC A;  1OW8 A;  3LUT B;  3LS1 A;  2H7B A;  1CPQ A;  5L0J A;  1LM3 B;  3NRH A;  2Q3T A;  3NMJ A;  2X51 A;  3C62 A;  4PJL A;  1XZQ A;  1I5N A;  2R02 A;  4OD4 A;  5JSL A;  1GQA A;  5T3W A;  2FFH A;  1FNT c;  2Y39 A;  1BBH A;  3ZQY A;  1U6H A;  4O6Y A;  1IZM A;  3V7O A;  1L3P A;  2XSE A;  1CGN A;  1J8M F;  2GDC A;  4G78 A;  3WHN A;  1KTM A;  4QI0 A;  4I3M A;  1RCP A;  3U3B A;  1D0X A;  4C7O A;  3LAY A;  4AX2 A;  1MQV A;  3LES A;  1M2O A;  5CIV A;  3JCU Q;  1GM5 A;  3VAY A;  5A6B A;  2R05 A;  2A6H F;  2LSE A;  3PHF 2;  4BJ6 A;  4WJ0 A;  2MYS A;  3QVY A;  3RQE A;  5A6J A;  1ORJ A;  3FAJ A;  3JZ0 A;  5CI9 A;  3JRM O;  3ECS A;  3KH2 A;  4EUK B;  2Q9C A;  2R7U A;  4MTO A;  3G4X A;  4E0H A;  1D1C A;  2XXA B;  1RKE B;  3DZA A;  2YL0 A;  4D4N A;  1H9T A;  2EPM X;  2Z15 A;  2XLH A;  1OR3 A;  5B1B C;  1XWJ A;  3UGO A;  4K0D A;  2V3C C;  3ASN C;  4XLP F;  3MBG A;  1ZZP A;  2JPU A;  2OG2 A;  3C18 A;  4DVY P;  5EK0 A;  1CPR A;  3ABM C;  4XWJ A;  1LS1 A;  2KSF A;  1YJG A;  3RF3 A;  3RH3 A;  1T6I A;  1OW6 A;  4YWQ A;  3QMK A;  1NU7 D;  4KI2 A;  3EH2 A;  2GA0 A;  4Z9J A;  2L6F A;  2CCY A;  3U8P A;  2E87 A;  1H9G A;  3NYM A;  5JUA A;  3S84 A;  2VAS A;  5HV9 A;  2HMZ A;  2PX0 A;  2XXA A;  4MQ9 F;  3IQC A;  4XLN F;  4CS7 A;  2R7W A;  1HMO A;  256B A;  2RD9 A;  4AK9 A;  1Y4C A;  5T1D B;  5F5H A;  4DRJ B;  2J7P A;  4G7Z F;  4CS9 C;  4LAC B;  4DBQ A;  3O10 A;  3DWW A;  3SXY A;  1BDJ B;  1CGM E;  2OU6 A;  3ZDL A;  1ST6 A;  3ZIB A;  1RKC A;  2BC5 A;  4P6I C;  1YAR O;  2P6V A;  4NCQ A;  3EHN A;  3MYI A;  3C8Z A;  4OIN F;  5A69 A;  2ETS A;  2LQG A;  3F46 A;  1LS4 A;  5D92 A;  4C3B A;  1E2X A;  1W2W A;  4JJG A;  2M4E A;  3G4Z A;  2P0N A;  4N06 A;  5A6K A;  4W8P A;  4DBR A;  3LEO A;  1OCC C;  4IJJ A;  4XQ1 A;  3SNH A;  1BZ4 A;  4YK5 A;  3V5X A;  3IQ6 A;  5L0G A;  1BR1 A;  4NTF A;  4XEF A;  1ZHT A;  4PK4 A;  5KYU A;  3NKD A;  3EH1 A;  3VRC A;  1ORY A;  4GQH A;  5COF A;  3DE9 A;  1LI5 A;  3VM6 A;  2OCC C;  4BJ5 C;  2VB6 A;  4CDY A;  3U0C A;  2Q7R A;  5F5F A;  2HUJ A;  3UR3 C;  1M2V B;  3VYW A;  3KMI A;  4U5E E;  4ULW A;  3LNM B;  3RVZ A;  3U9M A;  1VYI A;  2L81 A;  1HY5 A;  4RDA A;  2J8W A;  4OIR F;  4IAO A;  2Y3G A;  1C17 M;  2CDQ A;  1EA8 A;  5COM A;  3B71 A;  1D1B A;  1LI7 A;  2YQY A;  1SR2 A;  3FHD A;  1NLX A;  3LEV A;  4NTB A;  5B1A C;  2J0W A;  2LP4 A;  3T6B A;  1HE9 A;  5DQZ A;  5L0D A;  2EPO A;  3R7C A;  4WGZ A;  3C7J A;  3TK0 A;  1LVK A;  2XL8 A;  3MYF A;  1Y6D A;  3PDM P;  2YL7 A;  4AL1 A;  1E84 A;  3S28 A;  3EG9 A;  3M79 A;  1ORS C;  4G0H A;  1TKN A;  2HJ3 A;  4BEJ A;  4IRU A;  4U5C E;  1M2V A;  4IAQ A;  1S05 A;  2NPU A;  1OCZ C;  1WTY A;  3CZ6 A;  4OIP F;  2YLI A;  1SYQ A;  3I5Q A;  2AP3 A;  3US6 A;  1RJ9 B;  4CBE A;  4CJO A;  4CDA A;  1AVO B;  4ZLC A;  2LIG A;  4CIP A;  1WAT A;  3EHM A;  1U0B B;  1TWH A;  5JS5 A;  1AUE A;  1ZVZ A;  2YEV A;  3CAX A;  1H6G A;  3S9O A;  4E18 A;  3HLZ A;  3B0P A;  3S90 A;  3TQO A;  1A0B A;  2YKZ A;  5KYY B;  1WAS A;  5KYX B;  4I44 A;  3X1O A;  3IHU A;  1FTS A;  3LJB A;  1YDI A;  1ZHY A;  2EIL C;  2WL8 A;  4JE9 A;  1ZW3 A;  3L34 A;  1RJ9 A;  4JCZ A;  2B0J A;  4I1M A;  2Q00 A;  4O6M A;  3Q6M A;  4F4B A;  4DVZ A;  1OW7 A;  3EZI A;  2L9J A;  3KPH A;  1DOW A;  4Q7C A;  3TOL A;  2ZXP A;  4ER9 A;  2R7V A;  3MX3 A;  3GWL A;  3B9Q A;  3QTH A;  3X2Q C;  2LK4 A;  3K66 A;  2X0C A;  4CSA A;  3RW0 A;  1T6Q A;  1TFO B;  3DM9 B;  4K1O A;  5JRA A;  5KYY A;  1I4Z A;  2W4B A;  5KYX A;  4CJG A;  3A9C A;  1QSP A;  2XL4 A;  2W4M A;  1F1M A;  2W45 A;  4P9T A;  5DLJ A;  4NC3 A;  3FVY A;  1A7E A;  2PFD A;  3HNI A;  3W2W A;  3V5Y A;  1C03 A;  1LKX A;  4JRZ A;  2R7R A;  1PCX A;  3PMR A;  4M63 A;  1SMY F;  2LCH A;  3POV A;  1MMA A;  3EGD B;  1ZU5 A;  1TWG A;  2L6G A;  1NZE A;  2BL2 A;  2Q9B A;  2R03 A;  2PBE A;  3IQT A;  4PJJ A;  3C63 A;  4YT5 A;  5JVE A;  4OIO F;  3GEH A;  4PFO A;  1D1A A;  4O79 A;  4CX9 A;  2IXM A;  2IBF A;  2QTV A;  4BG0 A;  1Q0F A;  2OEV A;  2DI3 A;  1WOL A;  2D4U A;  2VH3 A;  3VF0 A;  1ZW2 A;  4JJF A;  3BRJ A;  4G7O F;  2PP4 A;  2XRH A;  4XEK A;  5B3I A;  4EHP A;  2PF4 E;  2WB7 A;  3N2Z B;  3SP1 A;  4KC9 A;  1JMW A;  3HTK C;  4QI2 A;  3K7D A;  1A7V A;  3RYL A;  2PX3 A;  4MVS A;  3M15 A;  3NYJ A;  3OWT A;  5CI8 A;  5DQT A;  5A6B D;  4HEA J;  3EZH A;  3L8J A;  3RQF A;  3OEO A;  3EGD A;  1RXQ A;  3ITF A;  3GM3 A;  2H8A A;  4JEA A;  3CEX A;  1SZI A;  2G3V A;  1VLS A;  5A6A A;  4JEB A;  2ZD9 A;  2PNO A;  4O7G A;  2AWY A;  2FAP B;  1YLM A;  1OKK A;  4IGG A;  1WGW A;  4NTA A;  5D91 A;  1CGO A;  4JTD B;  4XPX A;  2VCB A;  3S27 A;  4GEH A;  3JYY A;  4OIQ F;  1O87 A;  4CS8 C;  5L3Q A;  4AL0 A;  1C02 A;  2XLE A;  4Q5S F;  2KNH A;  1N1C A;  2IM8 A;  1G4W R;  4DXW A;  1YZA A;  3AQC A;  3JSE O;  3IEE A;  3Q6N A;  3DM5 A;  2MHR A;  2CNW A;  3GOR A;  5L3V A;  3J06 A;  2G62 A;  4D4X A;  2XLW A;  1FFT C;  4DJ9 A;  2EIN C;  1LPE A;  2ZXW C;  4ANJ A;  5BUO A;  1M56 C;  5KYU B;  2XLM A;  3FDQ A;  3I5P A;  2J0X A;  3L8I A;  4U5B E;  3EFO A;  4XEV A;  3NG1 A;  2HZ8 A;  2HKV A;  4JIO A;  4PFP A;  3ZTZ A;  3E9V A;  2WVQ A;  4BEM J;  4J7Y A;  3SXK A;  1A7D A;  1M6T A;  3K1I A;  4FES A;  2G3K A;  2J7P D;  1MMG A;  2QLA A;  2CW0 F;  3KYI A;  1HW2 A;  1G8X A;  3TJ6 A;  3DI5 A;  1G5Z A;  4L6R A;  3LLK A;  4HFF B;  5E3C A;  1Z7Q c;  2XM0 A;  1FR0 A;  3MLG A;  3TJ5 A;  3R2P A;  1VLT A;  1KU2 A;  1TWA A;  4PJM A;  1FMV A;  1D0Y A;  4BJ1 A;  4CDV A;  3PCV A;  2J9W A;  4PR9 A;  3U2M A;  3C8G B;  4NY3 A;  3EG9 B;  2KJG A;  2OJQ A;  2OKU A;  4ULV A;  3NDB B;  2A1D D;  3AJM A;  2J9U A;  3F47 A;  2EIJ C;  3EJN A;  4G7H F;  2IYL D;  2LD6 A;  4OD5 A;  3L1M A;  5F28 E;  1NU9 C;  2RSE B;  3T6G B;  1T6U A;  3AOU A;  3N24 A;  3UMH A;  4BJ6 C;  3LS0 A;  4LDQ A;  4E7Z A;  1G4U S;  4JC7 A;  1ZYR F;  2XLO A;  1EQ1 A;  3SXZ A;  2CYD A;  3NYL A;  2IXO A;  3ZC4 A;  2IOQ A;  3S0X A;  3KKB A;  1PD1 A;  4MVR A;  2EPN A;  5DVW A;  1L7C A;  3QW0 A;  5DS4 A;  1IW7 F;  2XS1 A;  3C8G A;  4J30 B;  1I4Y A;  2WVO A;  3JRT A;  2YL3 A;  5AGF A;  4E7S A;  1Q0K A;  2LFF A;  3QW1 A;  2EIK C;  4UDV A;  2L7A A;  3RKO F;  3ZVR A;  3FAP B;  3B0U X;  5E3A A;  1QQ3 A;  1V55 C;  4FWV A;  2NG1 A;  2P1A A;  2KC3 A;  3HKK A;  2ZPA A;  1K04 A;  1YA9 A;  3NKE A;  3U3F A;  4C3E A;  1GGQ A;  4HE8 D;  4EKW A;  1Z5Z A;  4WAB A;  3GWN A;  4A4A A;  3C8G D;  3IQ5 A;  3LNR A;  5DS6 A;  1Z63 A;  2VCC A;  1YAU O;  4E0I A;  2GFH A;  2KYH A;  2KQ9 A;  2OQM A;  3RIP A;  1B68 A;  1HE1 A;  2VCA A;  4CIH A;  3K33 A;  1WN0 A;  4U5F E;  4FAP B;  4Z9I A;  3JSZ A;  2GWW A;  2JD3 A;  3AG1 C;  4N6H A;  4N6C A;  3GEI A;  3RFY A;  1YYX A;  2QUP A;  4JUR I;  1T5O A;  3RVY A;  3O6X A;  1K40 A;  2O9X A;  2Y3D A;  3K1H A;  2UUH A;  3GM2 A;  4GYT A;  3UMI A;  5T3T A;  3M4B A;  4BJT A;  2NSF A;  2HV7 A;  5E2Q A;  4IWB A;  1ZU4 A;  3HNJ A;  3W2V A;  1FMW A;  1E86 A;  1ZHZ A;  4YT4 A;  2BE5 F;  4HFK B;  4LDR A;  3GOD A;  4ZLD A;  5TJ5 E;  5BQG A;  1FFH A;  4XPY A;  5HSW A;  2R7T A;  4MTG A;  2V26 A;  4EBK A;  1PD0 A;  2B0H A;  4EBB A;  2IXN A;  3WG7 C;  3CSK A;  5EHH A;  2Q4F A;  3DKA A;  2QY9 A;  4JTA B;  4U9E A;  2M64 A;  3U9J A;  4PJN A;  1R4T A;  5B3S C;  3G50 A;  3FOP A;  1FAP B;  2KGO A;  4U5D E;  1BR2 A;  2R7Q A;  2OJE D;  3H2V A;  1QKR A;  3SYN A;  3U8V A;  3ZSU A;  5L0I A;  3AG2 C;  3DAG A;  4QDL A;  4MW3 A;  2NUP B;  3ZG1 A;  3EPV A;  3T6J A;  2WVN A;  2YLD A;  2ZXO A;  3TOM A;  3ATP A;  1T9K A;  2Q9A A;  5KYW B;  2AWC A;  2NSG A;  2EPK X;  2WZG A;  1TFK B;  4PAC A;  2YZS A;  1AEP A;  1NSG B;  2ICW G;  3AGU A;  5FZT A;  3NMI A;  2I15 A;  1H7I A;  2QNL A;  1MNE A;  2R9R B;  4JKV A;  1NG1 A;  2OOC A;  2P61 A;  2W9Y A;  4LLE A;  4MW8 A;  4BPM A;  3E70 C;  1ZHX A;  1VK5 A;  4Z9H A;  3Q7G A;  1VB5 A;  3GM1 A;  3UNG C;  4BJ5 A;  5EGY A;  1R5I D;  4I1O B;  5AC5 A;  2AU5 A;  1V54 C;  3EFO B;  4JW1 A;  1M57 C;  4E17 A;  1A41 A;  5E33 A;  3SZR A;  3B0V C;  2NUP A;  2NUT B;  4U9D A;  3HJC A;  2J9V A;  3Q7L A;  4MVO A;  4AE4 B;  1NFN A;  4MVQ A;  4R32 A;  5COG A;  2KW3 C;  1XZP A;  5KYW A;  1QLE C;  4IB4 A;  4EWC A;  2HV6 A;  3SEO A;  2R25 A;  2DGJ A;  4YL1 A;  2C04 A;  4U5G A;  3ZWI A;  1VMA A;  2HJM A;  3EQL F;  3W8H A;  2XM4 A;  3UGP A;  2QE9 A;  4YN0 B;  3O39 A;  2R7S A;  4MND A;  2LFD A;  1S7Z A;  1TQG A;  3V5Z A;  3OA1 A;  3EGX B;  1U89 A;  1OKK D;  3N0T A;  1MMD A;  5BQI A;  4MVU A;  3MFN A;  3W4Y A;  4YL0 A;  2NUT A;  3ZQV A;  4A2N B;  5DS5 A;  3H2U A;  4AE4 A;  2WZF A;  1T01 A;  4RD9 A;  1O5H A;  2ASR A;  2WZL A;  2A6E F;  1NFO A;  2CNW D;  3W8I A;  1JR8 A;  4EBJ A;  1OCO C;  1OQC A;  1V74 B;  2AVK A;  1JRA A;  1APC A;  2F22 A;  2J46 A;  1YYJ A;  1Q0G A;  1PV3 A;  1RKE A;  3DXJ F;  4O6N A;  4CSA C;  4JCH A;  4LER A;  1E83 A;  2XLD A;  4MVZ A;  3BEH A;  5JT4 A;  3T4R A;  5L0H A;  1LIH A;  2Y3H A;  3EGX A;  2Y3B A;  5L0F A;  4ONS A;  3ABL C;  2DB4 A;  3KL4 A;  3NMK A;  3CQZ A;  4J32 B;  1GS9 A;  3JYH A;  3SXM A;  5K0I A;  4DRH B;  1O3U A;  4WGY A;  2YRF A;  4JZA A;  3KYJ A;  4JTC B;  2HSB A;  4P9F A;  2H7V C;  2IXP A;  2EIM C;  2XLV A;  2JX0 A;  2XL6 A;  1QVX A;  3A11 A;  3AG4 C;  3RQG A;  3FOO A;  4Q4Z F;  3T9O A;  5AC4 A;  3IPM O;  2A69 F;  2HFI A;  2YL1 A;  5IY5 C;  2KK1 A;  1HMD A;  2XS8 A;  1QZX A;  2YVK A;  4LLC A;  3WOD F;  1JAF A;  2C03 A;  1K05 A;  1YVI A;  1VYK A;  4MS2 A;  2A0U A;  1OXK A;  3JTL O;  2EPL X;  3AG3 C;  1RMV A;  1UG7 A;  3L0I A;  2A0B A;  5BQH A;  1LE4 A;  2TMV P;  1JPN A;  1OXB A;  4H4K C;  3QZC A;  4MTF A;  4K7B A;  4U5H A;  3M1C B;  1BR4 A;  3H65 A;  1D0Z A;  4YJW A;  2MWQ A;  1Z3I X;  3I4U A;  3UMK A;  2HS5 A;  3M4C A;  3GEE A;  4KNV A;  3HNK A;  4YT8 A;  1TR2 A;  1YA7 O;  4KBL A;  4EIY A;  4C7O B;  2GAQ A;  3ABK C;  3AQB A;  2D5R B;  1E85 A;  4YT2 A;  1MMN A;  1DOV A;  5JP7 A;  3U2L A;  2DYS C;  3JT1 A;  3DMD A;  3ASO C;  3QVZ A;  1Z23 A;  2VC9 A;  3FXH A;  1Z6A A;  2J9B A;  3TD7 A;  2HSQ A;  1HW1 A;  2L6H A;  3DAF A;  1OCR C;  2YWA A;  3ZTM A;  2J45 A;  1VTM P;  1EKY A;  1Q0D A;  4YL3 A;  1KNY A;  1MND A;  3DJU B;  4J7T A;  2HMQ A;  5JLI A;  2H7O A;  4N4W A;  2YHS A;  5GPG B;  4X0R A;  1WWP A;  3K6B A;  4JVS A;  5KYN A;  1VOM A;  1UFB A;  4XPW A;  2FGY A;  2YLG A;  3FMS A;  3K1I C;  1ZHW A;  3O55 A;  2Y69 C;  1EI7 A;  1LE2 A;  1Q0M A;  3LLI A;  3U5S A;  1OR2 A;  2A68 F;  3DE8 A;  4B6I A;  3DJN B;  2UUI A;  4KNW A;  4W8K A;  3WAQ A;  1SF8 A;  2P7V A;  4CS8 A;  4DRI B;  4C3D A;  2ZXR A;  1QPU A;  3S29 A;  1TWC A;  4IAR A;  4XTK A;  5L0C A;  2CGE A;  2R7O A;  1JPJ A;  1J8Y F;  3B29 A;  3HNL A;  3DD7 A;  4NQF A;  2R7X A;  2DYR C;  4FX5 A;  4LDK A;  4CS9 A;  4H54 A; 
#chains in the Genus database with same CATH homology
 3GAN A;  4RBN A;  4DOZ A;  5FCL A;  2I8B A;  3LS1 A;  2H7B A;  3NRH A;  2Q3T A;  2X51 A;  4PJL A;  4OD4 A;  5T3W A;  2FFH A;  2Y39 A;  4O6Y A;  1IZM A;  3V7O A;  2XSE A;  1J8M F;  4QI0 A;  4I3M A;  1D0X A;  3LAY A;  4AX2 A;  3LES A;  1M2O A;  3JCU Q;  3VAY A;  2A6H F;  2LSE A;  3PHF 2;  4BJ6 A;  4WJ0 A;  2MYS A;  3FAJ A;  5CI9 A;  3ECS A;  3KH2 A;  2Q9C A;  2R7U A;  1D1C A;  2XXA B;  3DZA A;  2Z15 A;  5B1B C;  2V3C C;  3UGO A;  4K0D A;  3ASN C;  4XLP F;  2OG2 A;  4DVY P;  3ABM C;  4XWJ A;  1LS1 A;  3RH3 A;  3QMK A;  1NU7 D;  4KI2 A;  3EH2 A;  2E87 A;  3NYM A;  2VAS A;  2PX0 A;  2XXA A;  4MQ9 F;  4CS7 A;  2R7W A;  4AK9 A;  5T1D B;  5F5H A;  2J7P A;  4CS9 C;  4LAC B;  4DBQ A;  1ST6 A;  3ZIB A;  4P6I C;  2P6V A;  3EHN A;  4OIN F;  3F46 A;  5D92 A;  4C3B A;  1W2W A;  4JJG A;  2M4E A;  4N06 A;  4DBR A;  1OCC C;  4IJJ A;  3SNH A;  1BR1 A;  1ZHT A;  4PK4 A;  5KYU A;  3NKD A;  3EH1 A;  2OCC C;  4BJ5 C;  2VB6 A;  5F5F A;  3UR3 C;  1M2V B;  3VYW A;  3KMI A;  4U5E E;  4ULW A;  1VYI A;  2L81 A;  4RDA A;  4OIR F;  4IAO A;  2Y3G A;  2CDQ A;  1D1B A;  3FHD A;  5B1A C;  5DS6 A;  3LEV A;  2J0W A;  5DQZ A;  3T6B A;  1LVK A;  3S28 A;  3EG9 A;  4G0H A;  1TKN A;  4BEJ A;  4IRU A;  4U5C E;  1M2V A;  1OCZ C;  3CZ6 A;  4OIP F;  3I5Q A;  1RJ9 B;  4CBE A;  4ZLC A;  3EHM A;  1TWH A;  2YEV A;  3HLZ A;  3B0P A;  5KYY B;  5KYX B;  4I44 A;  3X1O A;  1FTS A;  3LJB A;  1ZHY A;  2EIL C;  2WL8 A;  3L34 A;  1RJ9 A;  2B0J A;  4I1M A;  4O6M A;  3Q6M A;  4F4B A;  4DVZ A;  3EZI A;  2L9J A;  4Q7C A;  2R7V A;  2ZXP A;  3MX3 A;  3B9Q A;  3X2Q C;  3K66 A;  4CSA A;  3DM9 B;  5KYY A;  2W4B A;  5KYX A;  2XL4 A;  2W4M A;  5DLJ A;  2W45 A;  3FVY A;  2PFD A;  3W2W A;  1LKX A;  2R7R A;  1PCX A;  3PMR A;  4M63 A;  1SMY F;  3POV A;  1MMA A;  3EGD B;  1ZU5 A;  1TWG A;  2Q9B A;  1NZE A;  4PJJ A;  4G7Z F;  4YT5 A;  4OIO F;  4PFO A;  1D1A A;  4O79 A;  2IXM A;  2QTV A;  4BG0 A;  2VH3 A;  4JJF A;  4G7O F;  2PP4 A;  2XRH A;  3N2Z B;  2PF4 E;  2WB7 A;  3SP1 A;  4KC9 A;  3HTK C;  4QI2 A;  3K7D A;  3RYL A;  2PX3 A;  5DQT A;  3OWT A;  3NYJ A;  5CI8 A;  4HEA J;  3EZH A;  3OEO A;  3EGD A;  3ITF A;  1SZI A;  2G3V A;  4O7G A;  1OKK A;  5D91 A;  1WGW A;  3S27 A;  4OIQ F;  4GEH A;  1O87 A;  4CS8 C;  5L3Q A;  2KNH A;  1N1C A;  3AQC A;  3IEE A;  3Q6N A;  3DM5 A;  2CNW A;  5L3V A;  2G62 A;  1FFT C;  2EIN C;  2ZXW C;  4ANJ A;  5BUO A;  1M56 C;  5KYU B;  3FDQ A;  3I5P A;  2J0X A;  4U5B E;  3EFO A;  3NG1 A;  4PFP A;  3E9V A;  2WVQ A;  4FES A;  2G3K A;  2J7P D;  1MMG A;  2CW0 F;  1G8X A;  5E3C A;  3LLK A;  4HFF B;  3MLG A;  1KU2 A;  1TWA A;  4PJM A;  1FMV A;  1D0Y A;  4BJ1 A;  2J9W A;  4NY3 A;  3EG9 B;  2KJG A;  3NDB B;  2A1D D;  3F47 A;  2J9U A;  4G7H F;  2EIJ C;  3EJN A;  2IYL D;  4OD5 A;  1NU9 C;  4BJ6 C;  3N24 A;  3UMH A;  3LS0 A;  4E7Z A;  1ZYR F;  3NYL A;  2IXO A;  3ZC4 A;  2IOQ A;  3S0X A;  3KKB A;  1PD1 A;  5DVW A;  5DS4 A;  1IW7 F;  4J30 B;  2WVO A;  3JRT A;  4E7S A;  2EIK C;  3RKO F;  3B0U X;  5E3A A;  1V55 C;  4FWV A;  2NG1 A;  3NKE A;  4C3E A;  4HE8 D;  1Z5Z A;  3LNR A;  1Z63 A;  2GFH A;  2KQ9 A;  3RIP A;  4CIH A;  3K33 A;  4U5F E;  3JSZ A;  3RFY A;  2JD3 A;  3AG1 C;  4YWQ A;  4JUR I;  3O6X A;  2O9X A;  2Y3D A;  3K1H A;  4GYT A;  3UMI A;  5T3T A;  4BJT A;  2HV7 A;  5E2Q A;  4IWB A;  1ZU4 A;  3W2V A;  1FMW A;  1ZHZ A;  4YT4 A;  2BE5 F;  4HFK B;  3GOD A;  4ZLD A;  1FFH A;  5HSW A;  2R7T A;  2V26 A;  1PD0 A;  4EBB A;  2IXN A;  3WG7 C;  3CSK A;  5EHH A;  2QY9 A;  4PJN A;  5B3S C;  3SYN A;  4U5D E;  2KGO A;  1BR2 A;  2R7Q A;  3ZSU A;  3AG2 C;  3DAG A;  4QDL A;  2NUP B;  3ZG1 A;  3EPV A;  3T6J A;  2WVN A;  2ZXO A;  2Q9A A;  5KYW B;  2WZG A;  2YZS A;  1MNE A;  4LLE A;  1NG1 A;  2W9Y A;  3E70 C;  1ZHX A;  1VK5 A;  3Q7G A;  3UNG C;  4BJ5 A;  5EGY A;  4I1O B;  1V54 C;  3EFO B;  4JW1 A;  1M57 C;  5E33 A;  3SZR A;  3B0V C;  2NUP A;  2NUT B;  3HJC A;  2J9V A;  3Q7L A;  4AE4 B;  2KW3 C;  5KYW A;  1QLE C;  4EWC A;  2HV6 A;  3SEO A;  2DGJ A;  2C04 A;  4U5G A;  1VMA A;  3W8H A;  3EQL F;  2R7S A;  4YN0 B;  3O39 A;  4MND A;  1S7Z A;  3OA1 A;  3EGX B;  3N0T A;  1OKK D;  1MMD A;  4A2N B;  2NUT A;  5DS5 A;  4AE4 A;  2WZF A;  4RD9 A;  1O5H A;  2WZL A;  2A6E F;  2CNW D;  3W8I A;  1OCO C;  2ZPA A;  2J46 A;  4O6N A;  3DXJ F;  4CSA C;  4JCH A;  4LER A;  3T4R A;  2Y3H A;  3EGX A;  2Y3B A;  3ABL C;  3KL4 A;  3CQZ A;  4J32 B;  3JYH A;  4JZA A;  2H7V C;  2IXP A;  2EIM C;  4Q4Z F;  3AG4 C;  3UGP A;  2A69 F;  5IY5 C;  1QZX A;  4LLC A;  3WOD F;  2C03 A;  1VYK A;  3AG3 C;  3L0I A;  1JPN A;  4H4K C;  3QZC A;  4K7B A;  4U5H A;  3M1C B;  1BR4 A;  3H65 A;  1D0Z A;  4YJW A;  2MWQ A;  1Z3I X;  3I4U A;  3UMK A;  4KNV A;  4YT8 A;  1TR2 A;  4KBL A;  4C7O B;  3AQB A;  3ABK C;  2D5R B;  4YT2 A;  1MMN A;  2DYS C;  3JT1 A;  3DMD A;  3ASO C;  1Z23 A;  1Z6A A;  3TD7 A;  3DAF A;  1OCR C;  2J45 A;  3DJU B;  1MND A;  2H7O A;  2YHS A;  4X0R A;  3K6B A;  4JVS A;  5KYN A;  1VOM A;  3ZVR A;  4C7O A;  2FGY A;  3K1I C;  4Q5S F;  1ZHW A;  2Y69 C;  3LLI A;  2A68 F;  4B6I A;  3DJN B;  4KNW A;  4W8K A;  1SF8 A;  2P7V A;  4CS8 A;  4C3D A;  2ZXR A;  3S29 A;  1TWC A;  4XTK A;  2CGE A;  2R7O A;  1JPJ A;  1J8Y F;  3DD7 A;  2R7X A;  2DYR C;  4FX5 A;  4CS9 A;  4XLN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...