2O9XA

Crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
RENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Reductase, assembly protein
total genus 51
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02613 Nitrate_red_del Nitrate reductase delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4070.10 Mainly Alpha Orthogonal Bundle putative redox-enzyme maturation protein fold putative redox-enzyme maturation protein domain 2o9xA02
1.20.120.700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2o9xA01
2O9XA
chains in the Genus database with same CATH superfamily
1ZHZA 3ITFA 3AQBA 1RCPA 4CDAA 2WVQA 2HFIA 2IXNA 1RKEB 3S90A 3VAYA 3EGDB 3SXYA 2QNLA 2WL8A 1OXBA 3C8ZA 2HSBA 4H54A 3GANA 3NKEA 1A0BA 2XL6A 3UR3C 1OCZC 1SF8A 2ZXRA 1TWCA 3F47A 3MBGA 3SXZA 1PV3A 2Z15A 1NZEA 3IQ5A 4NCQA 4XEKA 3V5XA 5L3QA 1WOLA 4PR9A 4G7OF 2Q4FA 1T6IA 3DKAA 1ZU5A 1M2OA 1F1MA 5CI9A 5B3IA 1ZW2A 4WGZA 4EUKB 1LS1A 4XPWA 2KC3A 2ETSA 2XS1A 1OW6A 3O6XA 1C02A 2G3VA 4XPYA 1NU7D 3FOOA 4P6IC 1XWJA 5KYYA 5COGA 2PNOA 5EK0A 3OA1A 1LM3B 4K0DA 1RXQA 2JPUA 3NMKA 4I3MA 4N06A 4ER9A 2L6GA 2YLIA 4XEVA 2CYDA 4YK5A 4OD5A 1Z23A 3L1MA 4JJFA 1VYIA 1WASA 3ZTZA 2YRFA 4JZAA 4AE4A 3GORA 3T4RA 3O55A 3QVYA 2R03A 4G7ZF 3T9OA 4YT2A 2CW0F 4I1OB 4XPXA 4BG0A 4C7OA 4CIPA 2A68F 4PK4A 2W4MA 2YL1A 2I8BA 3FAJA 1VYKA 4R32A 3L8JA 4DVYP 4W8PA 3IPMO 1LE2A 4LACB 3U3BA 5BQGA 2MHRA 2YVKA 4NTFA 2EIJC 3O10A 1JOGA 2AWCA 2H7BA 2HMQA 2Q00A 1VB5A 1FAPB 1U6HA 2A6HF 4HFKB 5JT4A 1CPRA 4PACA 3PCVA 3K33A 3W2WA 1TFKB 4MTGA 1AUEA 1I4ZA 2QLAA 4E17A 1A7DA 1LI7A 2LFDA 4MTOA 4AX2A 2UUIA 1MMDA 2GDCA 3K66A 3ASOC 3C8GA 3EZIA 4RBNA 4WGYA 2RSEB 2VC9A 3LS0A 2A0UA 3M15A 4WJ0A 1FMWA 2Q9CA 3I4UA 4G7HF 1H9TA 3UMHA 2EPOA 3FHDA 3NYJA 1IW7F 1HW1A 3I5PA 4IB4A 2KJGA 3SXMA 5KYXB 3RIPA 5JVEA 1W2WA 2KGOA 2OQMA 1DOVA 3ZC4A 1VMAA 4BJ5C 3ZQYA 1QZXA 4JTCB 3S28A 1TFOB 2DYRC 2P0NA 5FZTA 1SR2A 1V54C 1V74B 2PP4A 4LDKA 3KPHA 5D92A 2OKUA 2P6VA 1D0XA 3U8VA 2CNWA 4CJOA 1TWGA 4O6NA 4EHPA 1PD0A 2YQYA 3U8PA 4YT5A 2B0HA 4OIQF 1T01A 2YLDA 2LQGA 2FGYA 2XL4A 1ZU4A 2NSFA 5D91A 4CJGA 4CS9C 3KL4A 2HZ8A 3HNLA 1L3PA 1TQGA 4BJTA 5DQTA 4ANJA 4EBJA 3QW0A 4YT8A 3WG7C 3TJ6A 1M57C 2XLOA 2J9WA 1AEPA 3ECSA 3KMIA 2KW3C 2YL3A 3O39A 4O6MA 3RVZA 5BQHA 1S7ZA 1BZ4A 3QZCA 4E0IA 4OD4A 3Q6MA 1D1AA 1G5ZA 2G3KA 1ZHYA 2AU5A 2M4EA 1E2XA 2OJQA 3RH3A 3T6GB 4A4AA 5A6BA 1YZAA 3R2PA 3S84A 2XM4A 3K7DA 1A7EA 3JZ0A 3DJUB 3HTKC 4JJGA 2QY9A 1CPQA 4KNVA 1ZZPA 1KNYA 2C04A 3EHMA 4ULVA 1OXKA 4MQ9F 3DJNB 5T3WA 3TQOA 3VYWA 5A6KA 1D1BA 5A6AA 1RJ9B 4MVRA 1NFNA 3HNJA 4DJ9A 4NY3A 1OW8A 3PMRA 3HLZA 5L0GA 4BEMJ 1K04A 1YLMA 5E2QA 1T9KA 1OKKD 256BA 4U5EE 3WHNA 4EIYA 5EGYA 3JRMO 5E3CA 5KYWB 5L0FA 3H2VA 3KKBA 4YL3A 3TD7A 3QVZA 3DAFA 2WB7A 4OINF 1YDIA 1EQ1A 4JURI 4Q4ZF 2A69F 2JX0A 5JS5A 2J45A 5JUAA 1ORJA 1N1CA 4JKVA 4HE8D 5KYYB 2P1AA 3OEOA 1RKCA 1YYXA 1TWHA 3ASNC 2J8WA 2C03A 4P9FA 3AOUA 2VCBA 3GEIA 2Q7RA 1VLTA 2L9JA 1T6QA 2R25A 4OIRF 4Q5SF 2CDQA 4KC9A 1K05A 4M63A 1G4US 4PFOA 4CBEA 4AK9A 5KYXA 1V4AA 1BDJB 3PDMP 1MNEA 4J7YA 1MMAA 5B1AC 5L0CA 5FCLA 3GWNA 4Z9JA 3B0VC 4MVQA 3LLIA 4U5CE 2R7XA 1CGNA 1NU9C 1AVOB 2J0XA 1LI5A 2W4BA 2Y3HA 3LEVA 4JC7A 3RYLA 3U2MA 4BJ5A 2NPUA 4KBLA 1U89A 2NSGA 3K1IC 4J32B 4MS2A 3W4YA 4D4NA 3I5QA 2ZXPA 3NYLA 2DB4A 4JTDB 4U5HA 4P9TA 1QVXA 2EPMX 3RFYA 5KYNA 3AGUA 3B29A 4A2NB 3EGDA 1M56C 2NUPB 2KK1A 1GQAA 4CIHA 4JE9A 4Z9HA 4BJ6A 4JIOA 1Z63A 2ZXOA 5JSLA 1FTSA 4ZLDA 3MFNA 5JP7A 4PJNA 5COMA 4FESA 3C8GD 1D0ZA 5DS6A 4U9EA 3GEEA 3MX3A 4YL1A 4U5FE 1KU2A 5F5FA 2AP3A 4E7ZA 1C03A 3LAYA 3V5YA 1HMOA 4JRZA 2KNHA 4N6CA 3HKKA 3IEEA 4JEBA 4YN0B 3U2LA 2Y3BA 3JRTA 2UUHA 3TULA 4XQ1A 2A6EF 4LDQA 1JMWA 2VCCA 2XM0A 2XLWA 2HSQA 4MVSA 4O79A 5B3SC 2XLVA 1KTMA 3N2ZB 1J8MF 1M6TA 2AVKA 2Y3DA 3LUTB 5F5HA 1BR4A 3ZTMA 2IXMA 3VM6A 2DI3A 2GWWA 1LPEA 3LEOA 3C7JA 3E70C 4Z9IA 3SEOA 2HV7A 5A6JA 2EIMC 2FAPB 2IXOA 3DE9A 1O5HA 3VRCA 4CSAC 1GS9A 3M79A 1BR1A 1UFBA 2HJ3A 2I15A 2XRHA 3E9VA 4D4XA 3J06A 3TOMA 2LD6A 4LLCA 1E85A 3H65A 4E18A 3NDBB 1QLEC 3EH1A 3TK0A 1T6UA 1CGME 2A1DD 1I5NA 5TJ5E 2XSEA 2LK4A 3KYJA 2LIGA 1PD1A 1G4WR 5A6BD 4HFFB 3B71A 2LCHA 4IWBA 2EPNA 4YWQA 3SP1A 3EG9B 1PCXA 4U5DE 1O87A 3ABKC 3FAPB 4C3DA 2J7PD 2KYHA 1ORSC 2A0BA 2BC5A 4K7BA 3L0IA 5JLIA 4JW1A 1R4TA 2YHSA 4MTFA 3SZRA 2R9RB 4C7OB 4CDVA 2LP4A 1EI7A 2QUPA 3LNRA 1L7CA 3QW1A 4FWVA 3ZQVA 1HMDA 2XS8A 1Y6DA 1OCOC 3PHF2 2OG2A 3N0TA 4BJ6C 3EFOA 3M4BA 2XLEA 2X0CA 1WTYA 4YL0A 2QTVA 3AJMA 1Q0FA 2LSEA 2Q9BA 3KYIA 4U5BE 1VOMA 3JSZA 1TKNA 2GAQA 1CGOA 2J9BA 2VCAA 2Y3GA 3EJNA 3LJBA 1YYJA 3LLKA 3UGPA 3ZDLA 5GPGB 2HUJA 4C3BA 3US6A 2J9UA 3L34A 4IARA 3ZVRA 3ATPA 2G62A 1OQCA 4I44A 3ZWIA 3FDQA 4CS8C 3CSKA 4CSAA 2P61A 4RDAA 2D4UA 3ZG1A 1ZHXA 1OCCC 2XL8A 4I1MA 1EKYA 3H2UA 3EH2A 3S27A 2FFHA 1J8YF 3EGXB 3IHUA 5DVWA 1NLXA 3X1OA 2MYSA 5L0DA 5CI8A 2WVNA 3VF0A 2YWAA 3F46A 3IQ6A 4XTKA 2W9YA 3DZAA 5E3AA 4DXWA 2ZD9A 3GM3A 2BL2A 2XLHA 3U3FA 4DOZA 2R7RA 3EG9A 1HW2A 2KQ9A 2Y69C 1Q0DA 2TMVP 3RKOF 1SMYF 2E87A 1MMGA 3DE8A 2XLMA 4IGGA 4ULWA 2ASRA 3WAQA 1MNDA 5EHHA 3RW0A 2OOCA 2R7VA 3K6BA 4OIOF 1QPUA 1ST6A 2R05A 1WN0A 1QQ3A 3C62A 1JPNA 2OCCC 3AGTA 4JTAB 2L6FA 2VH3A 4GQHA 1VK5A 4IAOA 3M1CB 3NYMA 3SNHA 1H6GA 1RMVA 4BEJA 3G4XA 4XLPF 4LLEA 2GFHA 1HY5A 2R02A 1Z6AA 2WZFA 3GM2A 4Q7CA 4DBQA 5L0JA 3AG3C 1A41A 5K0IA 1YZCA 1ZHWA 2H8AA 5KYUB 4N6HA 3MYIA 2AWYA 1XZPA 3JT1A 3W2VA 5DS5A 3Q7LA 2IOQA 3R7CA 2BE5F 4J7TA 3M4CA 3DI5A 4BPMA 1VTMP 3UMKA 1Q0KA 1EA8A 1JPJA 1YAUO 1QSPA 4NTAA 4UDVA 2EILC 4IAQA 4MVUA 4XEFA 4KNWA 3RQFA 3EGXA 5AGFA 3GM1A 3EHNA 1ORYA 3KH2A 2YKZA 3MLGA 1OCRC 3GEHA 4O7GA 4ONSA 4MVMA 3GODA 4PJLA 1FFTC 1D1CA 5HV9A 2P7VA 2V3CC 3AG4C 3S29A 1ZYRF 2WZGA 5IY5C 1YARO 4EWCA 5KYUA 3AG2C 2D5RB 2WZLA 5AC4A 3AQCA 2OEXA 4CS7A 4AL0A 2XXAB 3CZ6A 4DRHB 3IQCA 2MWQA 2NUTB 2HMZA 5CIVA 1Y4CA 3Q7GA 2Y39A 1E84A 3NMIA 3JCUQ 4XWJA 5COFA 4PFPA 4AE4B 2VASA 3WODF 4MW3A 2OU6A 1HE9A 4JEAA 3LS1A 2J7PA 3U9MA 3JTLO 4MVZA 3N24A 4LERA 3T6JA 2Q3TA 3BRJA 3EPVA 1LVKA 1LIHA 3LNMB 1BR2A 4L6RA 3C18A 2R7OA 4JCHA 2EPKX 2IYLD 2CNWD 2ZXWC 2IXPA 2QE9A 2J0WA 3DAGA 3EZHA 3NG1A 2IM8A 3DMDA 3MYFA 4EBKA 4DBRA 4LDRA 1FMVA 2L81A 3ABMC 3JYHA 4IRUA 2Q9AA 3GWLA 4EBBA 3IQTA 1WWPA 1FNTc 4FX5A 5F28E 4J30B 4G0HA 2R7QA 3NMJA 3RVYA 3FXHA 2V26A 2YZSA 1A7VA 1C17M 3DM5A 2RD9A 3C8GB 3V5ZA 4QDLA 4B6IA 4JVSA 4DRIB 1LKXA 3FMSA 4MNDA 1Z7Qc 1TWAA 2GA0A 3K1IA 3A9CA 1HE1A 4DRJB 3G4ZA 3RQGA 3TOLA 1MQVA 2EIKC 1U0BB 2M64A 3NKDA 4DVZA 1ZW3A 1B68A 1NG1A 1SYQA 2B0JA 2VB6A 3B9QA 3L8IA 3QMKA 4NC3A 3ABLC 3U5SA 1QKRA 3EQLF 4X0RA 2OEVA 3RF3A 4EKWA 4MW8A 4N4WA 3RQEA 2HS5A 2F22A 1DOWA 4YT4A 4QI2A 1YVIA 4CDYA 4CX9A 2O9XA 1V55C 2CCYA 3DD7A 4E0HA 1RKEA 1VLSA 3T6BA 4CS8A 2YLGA 3FVYA 4MVOA 3U9JA 1NBBA 4C3EA 2R7TA 2WVOA 2LFFA 4O6YA 1WATA 5BUOA 2EPLX 4HEAJ 4WABA 1JR8A 1M2VB 5B1BC 1T5OA 1WGWA 3ZSUA 2YL0A 4AL1A 3JYYA 5A69A 1YA7O 2ICWG 2YL7A 1TR2A 5BQIA 5DQZA 1APCA 1Q0GA 1OR2A 2PFDA 3UNGC 1G8XA 1E86A 1E83A 3G50A 1FFHA 2PX3A 2XLDA 1OR3A 2PBEA 2H7VC 2PX0A 3HJCA 4K1OA 4PJJA 4U5GA 2R7UA 2R7WA 5E33A 3W8IA 5AC5A 1K40A 1LE4A 2YEVA 3EFOB 3C63A 1Q0MA 4E7SA 3HNKA 1O3UA 4JCZA 3B0UX 1Z3IX 3QTHA 3SXKA 1SZIA 2L6HA 2HJMA 2R7SA 2CGEA 2L7AA 2DGJA 2NG1A 2X51A 3HNIA 1S05A 1JAFA 4XLNF 3AG1C 4YJWA 3UGOA 4NQFA 2XXAA 4GEHA 5T1DB 5L3VA 4F4BA 3S0XA 4CS9A 1GM5A 3DM9B 2OJED 1OKKA 3CQZA 1H9GA 3NRHA 4RD9A 5L0HA 1ZHTA 2NUTA 2NUPA 4GYTA 2EINC 4PJMA 1JRAA 2ZPAA 2KSFA 4NTBA 1FR0A 1GGQA 3ZIBA 3LESA 3POVA 3V7OA 3K1HA 3W8HA 3S9OA 4FAPB 3CAXA 3B0PA 1IZMA 1MMNA 3BEHA 3JSEO 4H4KC 3U0CA 3CEXA 2H7OA 2HKVA 1YA9A 3UMIA 5KYWA 3DWWA 2J46A 2JD3A 2PF4E 1ZVZA 1UG7A 1I4YA 3Q6NA 3A11A 1NSGB 5HSWA 4QI0A 4OIPF 2HV6A 4IJJA 4W8KA 1R5ID 1RJ9A 5L0IA 2IBFA 3FOPA 1D0YA 1Z5ZA 4U9DA 4G78A 5T3TA 3DXJF 5DLJA 3OWTA 4ZLCA 5DS4A 5JRAA 2DYSC 1H7IA 1NFOA 1YJGA 1BBHA 4BJ1A 3SYNA 2J9VA 1OW7A 1XZQA 2W45A 4KI2A 1M2VA 1LS4A 3X2QC 3TJ5A
chains in the Genus database with same CATH topology
1ZHZA 3ITFA 3AQBA 2WVQA 2IXNA 3VAYA 3EGDB 2WL8A 3GANA 3NKEA 3UR3C 1OCZC 1SF8A 2ZXRA 1TWCA 3F47A 2Z15A 1NZEA 5L3QA 4G7OF 1ZU5A 1M2OA 5CI9A 1LS1A 3O6XA 2G3VA 1NU7D 4P6IC 5KYYA 3OA1A 4K0DA 4I3MA 4N06A 4OD5A 1Z23A 4JJFA 1VYIA 4JZAA 4AE4A 3T4RA 4G7ZF 4YT2A 2CW0F 4I1OB 4BG0A 4C7OA 2A68F 4PK4A 2W4MA 3FAJA 2I8BA 1VYKA 4DVYP 4LACB 2EIJC 2H7BA 2A6HF 4HFKB 3W2WA 3K33A 4AX2A 3K66A 1MMDA 4RBNA 3ASOC 3EZIA 3LS0A 4WJ0A 1FMWA 2Q9CA 3I4UA 4G7HF 3UMHA 3NYJA 3FHDA 1IW7F 3I5PA 5KYXB 2KJGA 3RIPA 1W2WA 2KGOA 3ZC4A 1VMAA 4BJ5C 1QZXA 3S28A 2DYRC 1V54C 2PP4A 5D92A 2P6VA 1D0XA 2CNWA 1TWGA 4O6NA 1PD0A 4OIQF 2XL4A 2FGYA 1ZU4A 5D91A 4CS9C 3KL4A 4ANJA 4BJTA 5DQTA 4YT8A 3WG7C 1M57C 3ECSA 2J9WA 3KMIA 3O39A 2KW3C 4O6MA 1S7ZA 3QZCA 4OD4A 3Q6MA 1D1AA 2G3KA 4YT4A 1ZHYA 3RH3A 2M4EA 3K7DA 3HTKC 3DJUB 4JJGA 2QY9A 4KNVA 2C04A 3EHMA 4MQ9F 3DJNB 5T3WA 3VYWA 1D1BA 1RJ9B 4NY3A 3PMRA 3HLZA 5E2QA 1OKKD 5EGYA 4U5EE 5E3CA 5KYWB 3KKBA 3TD7A 3DAFA 2WB7A 4OINF 4JURI 4Q4ZF 2A69F 2J45A 1N1CA 5KYYB 4HE8D 3OEOA 1TWHA 3ASNC 2C03A 2L9JA 4OIRF 4Q5SF 2CDQA 4KC9A 4M63A 4PFOA 4CBEA 4AK9A 5KYXA 1MNEA 5B1AC 1MMAA 5FCLA 3B0VC 3LLIA 4U5CE 2R7XA 1NU9C 2Y3HA 2J0XA 2W4BA 3LEVA 3RYLA 4BJ5A 4KBLA 3K1IC 4J32B 3I5QA 2ZXPA 3NYLA 3RFYA 4U5HA 5KYNA 4A2NB 3EGDA 1M56C 2NUPB 4CIHA 4BJ6A 1Z63A 2ZXOA 1FTSA 4ZLDA 4PJNA 4FESA 1D0ZA 5DS6A 3MX3A 5F5FA 4U5FE 1KU2A 4E7ZA 3LAYA 2KNHA 4YN0B 3IEEA 2Y3BA 3JRTA 2A6EF 4O79A 5B3SC 3N2ZB 1J8MF 5F5HA 2Y3DA 1BR4A 2IXMA 3E70C 3SEOA 2HV7A 2EIMC 2IXOA 1O5HA 4CSAC 1BR1A 2XRHA 3E9VA 4LLCA 3H65A 3NDBB 1QLEC 3EH1A 2A1DD 2XSEA 1PD1A 4HFFB 4IWBA 4YWQA 3SP1A 3EG9B 1PCXA 4U5DE 1O87A 3ABKC 4C3DA 2J7PD 4K7BA 3L0IA 4JW1A 2YHSA 3SZRA 4C7OB 4FWVA 3LNRA 1OCOC 3PHF2 2OG2A 3N0TA 4BJ6C 3EFOA 2QTVA 2Q9BA 2LSEA 4U5BE 1VOMA 3JSZA 1TKNA 2Y3GA 3EJNA 3LLKA 3LJBA 4YT5A 3UGPA 2XXAA 4C3BA 2J9UA 3L34A 3ZVRA 4I44A 2G62A 3FDQA 4CS8C 3CSKA 4CSAA 4RDAA 3ZG1A 1ZHXA 1OCCC 4I1MA 3EH2A 3S27A 2FFHA 1J8YF 3EGXB 5DVWA 3X1OA 2MYSA 5CI8A 2WVNA 3F46A 4XTKA 2W9YA 3DZAA 5E3AA 2R7RA 4DOZA 3EG9A 2KQ9A 2Y69C 3RKOF 1SMYF 2E87A 1MMGA 4ULWA 1MNDA 5EHHA 2R7VA 3K6BA 4OIOF 1ST6A 1JPNA 2OCCC 2VH3A 1VK5A 4IAOA 3M1CB 3NYMA 3SNHA 4BEJA 4XLPF 4LLEA 2GFHA 2WZFA 1Z6AA 4Q7CA 4DBQA 3AG3C 5KYUB 1ZHWA 3W2VA 3JT1A 5DS5A 3Q7LA 2IOQA 2BE5F 3UMKA 1JPJA 2EILC 4KNWA 3EGXA 3EHNA 4O7GA 3KH2A 3MLGA 4PJLA 1OCRC 3GODA 1FFTC 1D1CA 2V3CC 2P7VA 3AG4C 3S29A 1ZYRF 2WZGA 5IY5C 4EWCA 5KYUA 3AG2C 2D5RB 2WZLA 3AQCA 4CS7A 2XXAB 3CZ6A 2MWQA 2NUTB 3Q7GA 2Y39A 3JCUQ 4XWJA 4AE4B 4PFPA 2VASA 3WODF 3LS1A 2J7PA 3N24A 4LERA 3T6JA 2Q3TA 3EPVA 1LVKA 1BR2A 2R7OA 4JCHA 2IYLD 2CNWD 2ZXWC 2IXPA 3DAGA 2J0WA 3EZHA 3NG1A 3DMDA 4DBRA 3ABMC 1FMVA 3JYHA 2L81A 4IRUA 2Q9AA 4EBBA 4FX5A 4J30B 4G0HA 2R7QA 2V26A 2YZSA 3DM5A 4QDLA 4B6IA 4JVSA 1LKXA 4MNDA 1TWAA 2EIKC 3NKDA 4DVZA 1NG1A 2B0JA 2VB6A 3B9QA 3QMKA 3ABLC 3EQLF 4X0RA 4QI2A 2O9XA 1V55C 3DD7A 3T6BA 4CS8A 3FVYA 2R7TA 4C3EA 2WVOA 4O6YA 5BUOA 4HEAJ 1M2VB 5B1BC 1WGWA 3ZSUA 1TR2A 5DQZA 2PFDA 3UNGC 1G8XA 1FFHA 2PX3A 3HJCA 2H7VC 2PX0A 4PJJA 4U5GA 2R7UA 2R7WA 5E33A 3W8IA 2YEVA 3EFOB 4E7SA 3B0UX 1Z3IX 1SZIA 2R7SA 2CGEA 2NG1A 2DGJA 2X51A 4XLNF 3AG1C 4YJWA 3UGOA 4GEHA 5T1DB 5L3VA 4F4BA 3S0XA 4CS9A 3DM9B 1OKKA 3CQZA 3NRHA 4RD9A 1ZHTA 2NUTA 2NUPA 4GYTA 2EINC 4PJMA 2ZPAA 3ZIBA 3LESA 3POVA 3V7OA 3K1HA 3W8HA 3B0PA 1IZMA 1MMNA 4H4KC 2H7OA 3UMIA 5KYWA 2J46A 2JD3A 2PF4E 3Q6NA 5HSWA 4QI0A 4OIPF 2HV6A 4IJJA 4W8KA 1RJ9A 1D0YA 1Z5ZA 5T3TA 5DLJA 4ZLCA 3DXJF 5DS4A 3OWTA 2DYSC 4BJ1A 3SYNA 2J9VA 2W45A 4KI2A 1M2VA 3X2QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9X A; 
#chains in the Genus database with same CATH topology
 1ZHZ A;  3ITF A;  3AQB A;  1RCP A;  4CDA A;  2WVQ A;  2HFI A;  2IXN A;  1RKE B;  3S90 A;  3VAY A;  3EGD B;  3SXY A;  2QNL A;  2WL8 A;  1OXB A;  3C8Z A;  2HSB A;  4H54 A;  3GAN A;  3NKE A;  1A0B A;  2XL6 A;  3UR3 C;  1OCZ C;  1SF8 A;  2ZXR A;  1TWC A;  3F47 A;  3MBG A;  3SXZ A;  1PV3 A;  2Z15 A;  1NZE A;  3IQ5 A;  4NCQ A;  4XEK A;  3V5X A;  5L3Q A;  1WOL A;  4PR9 A;  4G7O F;  2Q4F A;  1T6I A;  3DKA A;  1ZU5 A;  1M2O A;  1F1M A;  5CI9 A;  5B3I A;  1ZW2 A;  4WGZ A;  4EUK B;  1LS1 A;  4XPW A;  2KC3 A;  2ETS A;  2XS1 A;  1OW6 A;  3O6X A;  1C02 A;  2G3V A;  4XPY A;  1NU7 D;  3FOO A;  4P6I C;  1XWJ A;  5KYY A;  5COG A;  2PNO A;  5EK0 A;  3OA1 A;  1LM3 B;  4K0D A;  1RXQ A;  2JPU A;  3NMK A;  4I3M A;  4N06 A;  4ER9 A;  2L6G A;  2YLI A;  4XEV A;  2CYD A;  4YK5 A;  4OD5 A;  1Z23 A;  3L1M A;  4JJF A;  1VYI A;  1WAS A;  3ZTZ A;  2YRF A;  4JZA A;  4AE4 A;  3GOR A;  3T4R A;  3O55 A;  3QVY A;  2R03 A;  4G7Z F;  3T9O A;  4YT2 A;  2CW0 F;  4I1O B;  4XPX A;  4BG0 A;  4C7O A;  4CIP A;  2A68 F;  4PK4 A;  2W4M A;  2YL1 A;  2I8B A;  3FAJ A;  1VYK A;  4R32 A;  3L8J A;  4DVY P;  4W8P A;  3IPM O;  1LE2 A;  4LAC B;  3U3B A;  5BQG A;  2MHR A;  2YVK A;  4NTF A;  2EIJ C;  3O10 A;  1JOG A;  2AWC A;  2H7B A;  2HMQ A;  2Q00 A;  1VB5 A;  1FAP B;  1U6H A;  2A6H F;  4HFK B;  5JT4 A;  1CPR A;  4PAC A;  3PCV A;  3K33 A;  3W2W A;  1TFK B;  4MTG A;  1AUE A;  1I4Z A;  2QLA A;  4E17 A;  1A7D A;  1LI7 A;  2LFD A;  4MTO A;  4AX2 A;  2UUI A;  1MMD A;  2GDC A;  3K66 A;  3ASO C;  3C8G A;  3EZI A;  4RBN A;  4WGY A;  2RSE B;  2VC9 A;  3LS0 A;  2A0U A;  3M15 A;  4WJ0 A;  1FMW A;  2Q9C A;  3I4U A;  4G7H F;  1H9T A;  3UMH A;  2EPO A;  3FHD A;  3NYJ A;  1IW7 F;  1HW1 A;  3I5P A;  4IB4 A;  2KJG A;  3SXM A;  5KYX B;  3RIP A;  5JVE A;  1W2W A;  2KGO A;  2OQM A;  1DOV A;  3ZC4 A;  1VMA A;  4BJ5 C;  3ZQY A;  1QZX A;  4JTC B;  3S28 A;  1TFO B;  2DYR C;  2P0N A;  5FZT A;  1SR2 A;  1V54 C;  1V74 B;  2PP4 A;  4LDK A;  3KPH A;  5D92 A;  2OKU A;  2P6V A;  1D0X A;  3U8V A;  2CNW A;  4CJO A;  1TWG A;  4O6N A;  4EHP A;  1PD0 A;  2YQY A;  3U8P A;  4YT5 A;  2B0H A;  4OIQ F;  1T01 A;  2YLD A;  2LQG A;  2FGY A;  2XL4 A;  1ZU4 A;  2NSF A;  5D91 A;  4CJG A;  4CS9 C;  3KL4 A;  2HZ8 A;  3HNL A;  1L3P A;  1TQG A;  4BJT A;  5DQT A;  4ANJ A;  4EBJ A;  3QW0 A;  4YT8 A;  3WG7 C;  3TJ6 A;  1M57 C;  2XLO A;  2J9W A;  1AEP A;  3ECS A;  3KMI A;  2KW3 C;  2YL3 A;  3O39 A;  4O6M A;  3RVZ A;  5BQH A;  1S7Z A;  1BZ4 A;  3QZC A;  4E0I A;  4OD4 A;  3Q6M A;  1D1A A;  1G5Z A;  2G3K A;  1ZHY A;  2AU5 A;  2M4E A;  1E2X A;  2OJQ A;  3RH3 A;  3T6G B;  4A4A A;  5A6B A;  1YZA A;  3R2P A;  3S84 A;  2XM4 A;  3K7D A;  1A7E A;  3JZ0 A;  3DJU B;  3HTK C;  4JJG A;  2QY9 A;  1CPQ A;  4KNV A;  1ZZP A;  1KNY A;  2C04 A;  3EHM A;  4ULV A;  1OXK A;  4MQ9 F;  3DJN B;  5T3W A;  3TQO A;  3VYW A;  5A6K A;  1D1B A;  5A6A A;  1RJ9 B;  4MVR A;  1NFN A;  3HNJ A;  4DJ9 A;  4NY3 A;  1OW8 A;  3PMR A;  3HLZ A;  5L0G A;  4BEM J;  1K04 A;  1YLM A;  5E2Q A;  1T9K A;  1OKK D;  256B A;  4U5E E;  3WHN A;  4EIY A;  5EGY A;  3JRM O;  5E3C A;  5KYW B;  5L0F A;  3H2V A;  3KKB A;  4YL3 A;  3TD7 A;  3QVZ A;  3DAF A;  2WB7 A;  4OIN F;  1YDI A;  1EQ1 A;  4JUR I;  4Q4Z F;  2A69 F;  2JX0 A;  5JS5 A;  2J45 A;  5JUA A;  1ORJ A;  1N1C A;  4JKV A;  4HE8 D;  5KYY B;  2P1A A;  3OEO A;  1RKC A;  1YYX A;  1TWH A;  3ASN C;  2J8W A;  2C03 A;  4P9F A;  3AOU A;  2VCB A;  3GEI A;  2Q7R A;  1VLT A;  2L9J A;  1T6Q A;  2R25 A;  4OIR F;  4Q5S F;  2CDQ A;  4KC9 A;  1K05 A;  4M63 A;  1G4U S;  4PFO A;  4CBE A;  4AK9 A;  5KYX A;  1V4A A;  1BDJ B;  3PDM P;  1MNE A;  4J7Y A;  1MMA A;  5B1A C;  5L0C A;  5FCL A;  3GWN A;  4Z9J A;  3B0V C;  4MVQ A;  3LLI A;  4U5C E;  2R7X A;  1CGN A;  1NU9 C;  1AVO B;  2J0X A;  1LI5 A;  2W4B A;  2Y3H A;  3LEV A;  4JC7 A;  3RYL A;  3U2M A;  4BJ5 A;  2NPU A;  4KBL A;  1U89 A;  2NSG A;  3K1I C;  4J32 B;  4MS2 A;  3W4Y A;  4D4N A;  3I5Q A;  2ZXP A;  3NYL A;  2DB4 A;  4JTD B;  4U5H A;  4P9T A;  1QVX A;  2EPM X;  3RFY A;  5KYN A;  3AGU A;  3B29 A;  4A2N B;  3EGD A;  1M56 C;  2NUP B;  2KK1 A;  1GQA A;  4CIH A;  4JE9 A;  4Z9H A;  4BJ6 A;  4JIO A;  1Z63 A;  2ZXO A;  5JSL A;  1FTS A;  4ZLD A;  3MFN A;  5JP7 A;  4PJN A;  5COM A;  4FES A;  3C8G D;  1D0Z A;  5DS6 A;  4U9E A;  3GEE A;  3MX3 A;  4YL1 A;  4U5F E;  1KU2 A;  5F5F A;  2AP3 A;  4E7Z A;  1C03 A;  3LAY A;  3V5Y A;  1HMO A;  4JRZ A;  2KNH A;  4N6C A;  3HKK A;  3IEE A;  4JEB A;  4YN0 B;  3U2L A;  2Y3B A;  3JRT A;  2UUH A;  3TUL A;  4XQ1 A;  2A6E F;  4LDQ A;  1JMW A;  2VCC A;  2XM0 A;  2XLW A;  2HSQ A;  4MVS A;  4O79 A;  5B3S C;  2XLV A;  1KTM A;  3N2Z B;  1J8M F;  1M6T A;  2AVK A;  2Y3D A;  3LUT B;  5F5H A;  1BR4 A;  3ZTM A;  2IXM A;  3VM6 A;  2DI3 A;  2GWW A;  1LPE A;  3LEO A;  3C7J A;  3E70 C;  4Z9I A;  3SEO A;  2HV7 A;  5A6J A;  2EIM C;  2FAP B;  2IXO A;  3DE9 A;  1O5H A;  3VRC A;  4CSA C;  1GS9 A;  3M79 A;  1BR1 A;  1UFB A;  2HJ3 A;  2I15 A;  2XRH A;  3E9V A;  4D4X A;  3J06 A;  3TOM A;  2LD6 A;  4LLC A;  1E85 A;  3H65 A;  4E18 A;  3NDB B;  1QLE C;  3EH1 A;  3TK0 A;  1T6U A;  1CGM E;  2A1D D;  1I5N A;  5TJ5 E;  2XSE A;  2LK4 A;  3KYJ A;  2LIG A;  1PD1 A;  1G4W R;  5A6B D;  4HFF B;  3B71 A;  2LCH A;  4IWB A;  2EPN A;  4YWQ A;  3SP1 A;  3EG9 B;  1PCX A;  4U5D E;  1O87 A;  3ABK C;  3FAP B;  4C3D A;  2J7P D;  2KYH A;  1ORS C;  2A0B A;  2BC5 A;  4K7B A;  3L0I A;  5JLI A;  4JW1 A;  1R4T A;  2YHS A;  4MTF A;  3SZR A;  2R9R B;  4C7O B;  4CDV A;  2LP4 A;  1EI7 A;  2QUP A;  3LNR A;  1L7C A;  3QW1 A;  4FWV A;  3ZQV A;  1HMD A;  2XS8 A;  1Y6D A;  1OCO C;  3PHF 2;  2OG2 A;  3N0T A;  4BJ6 C;  3EFO A;  3M4B A;  2XLE A;  2X0C A;  1WTY A;  4YL0 A;  2QTV A;  3AJM A;  1Q0F A;  2LSE A;  2Q9B A;  3KYI A;  4U5B E;  1VOM A;  3JSZ A;  1TKN A;  2GAQ A;  1CGO A;  2J9B A;  2VCA A;  2Y3G A;  3EJN A;  3LJB A;  1YYJ A;  3LLK A;  3UGP A;  3ZDL A;  5GPG B;  2HUJ A;  4C3B A;  3US6 A;  2J9U A;  3L34 A;  4IAR A;  3ZVR A;  3ATP A;  2G62 A;  1OQC A;  4I44 A;  3ZWI A;  3FDQ A;  4CS8 C;  3CSK A;  4CSA A;  2P61 A;  4RDA A;  2D4U A;  3ZG1 A;  1ZHX A;  1OCC C;  2XL8 A;  4I1M A;  1EKY A;  3H2U A;  3EH2 A;  3S27 A;  2FFH A;  1J8Y F;  3EGX B;  3IHU A;  5DVW A;  1NLX A;  3X1O A;  2MYS A;  5L0D A;  5CI8 A;  2WVN A;  3VF0 A;  2YWA A;  3F46 A;  3IQ6 A;  4XTK A;  2W9Y A;  3DZA A;  5E3A A;  4DXW A;  2ZD9 A;  3GM3 A;  2BL2 A;  2XLH A;  3U3F A;  4DOZ A;  2R7R A;  3EG9 A;  1HW2 A;  2KQ9 A;  2Y69 C;  1Q0D A;  2TMV P;  3RKO F;  1SMY F;  2E87 A;  1MMG A;  3DE8 A;  2XLM A;  4IGG A;  4ULW A;  2ASR A;  3WAQ A;  1MND A;  5EHH A;  3RW0 A;  2OOC A;  2R7V A;  3K6B A;  4OIO F;  1QPU A;  1ST6 A;  2R05 A;  1WN0 A;  1QQ3 A;  3C62 A;  1JPN A;  2OCC C;  3AGT A;  4JTA B;  2L6F A;  2VH3 A;  4GQH A;  1VK5 A;  4IAO A;  3M1C B;  3NYM A;  3SNH A;  1H6G A;  1RMV A;  4BEJ A;  3G4X A;  4XLP F;  4LLE A;  2GFH A;  1HY5 A;  2R02 A;  1Z6A A;  2WZF A;  3GM2 A;  4Q7C A;  4DBQ A;  5L0J A;  3AG3 C;  1A41 A;  5K0I A;  1YZC A;  1ZHW A;  2H8A A;  5KYU B;  4N6H A;  3MYI A;  2AWY A;  1XZP A;  3JT1 A;  3W2V A;  5DS5 A;  3Q7L A;  2IOQ A;  3R7C A;  2BE5 F;  4J7T A;  3M4C A;  3DI5 A;  4BPM A;  1VTM P;  3UMK A;  1Q0K A;  1EA8 A;  1JPJ A;  1YAU O;  1QSP A;  4NTA A;  4UDV A;  2EIL C;  4IAQ A;  4MVU A;  4XEF A;  4KNW A;  3RQF A;  3EGX A;  5AGF A;  3GM1 A;  3EHN A;  1ORY A;  3KH2 A;  2YKZ A;  3MLG A;  1OCR C;  3GEH A;  4O7G A;  4ONS A;  4MVM A;  3GOD A;  4PJL A;  1FFT C;  1D1C A;  5HV9 A;  2P7V A;  2V3C C;  3AG4 C;  3S29 A;  1ZYR F;  2WZG A;  5IY5 C;  1YAR O;  4EWC A;  5KYU A;  3AG2 C;  2D5R B;  2WZL A;  5AC4 A;  3AQC A;  2OEX A;  4CS7 A;  4AL0 A;  2XXA B;  3CZ6 A;  4DRH B;  3IQC A;  2MWQ A;  2NUT B;  2HMZ A;  5CIV A;  1Y4C A;  3Q7G A;  2Y39 A;  1E84 A;  3NMI A;  3JCU Q;  4XWJ A;  5COF A;  4PFP A;  4AE4 B;  2VAS A;  3WOD F;  4MW3 A;  2OU6 A;  1HE9 A;  4JEA A;  3LS1 A;  2J7P A;  3U9M A;  3JTL O;  4MVZ A;  3N24 A;  4LER A;  3T6J A;  2Q3T A;  3BRJ A;  3EPV A;  1LVK A;  1LIH A;  3LNM B;  1BR2 A;  4L6R A;  3C18 A;  2R7O A;  4JCH A;  2EPK X;  2IYL D;  2CNW D;  2ZXW C;  2IXP A;  2QE9 A;  2J0W A;  3DAG A;  3EZH A;  3NG1 A;  2IM8 A;  3DMD A;  3MYF A;  4EBK A;  4DBR A;  4LDR A;  1FMV A;  2L81 A;  3ABM C;  3JYH A;  4IRU A;  2Q9A A;  3GWL A;  4EBB A;  3IQT A;  1WWP A;  1FNT c;  4FX5 A;  5F28 E;  4J30 B;  4G0H A;  2R7Q A;  3NMJ A;  3RVY A;  3FXH A;  2V26 A;  2YZS A;  1A7V A;  1C17 M;  3DM5 A;  2RD9 A;  3C8G B;  3V5Z A;  4QDL A;  4B6I A;  4JVS A;  4DRI B;  1LKX A;  3FMS A;  4MND A;  1Z7Q c;  1TWA A;  2GA0 A;  3K1I A;  3A9C A;  1HE1 A;  4DRJ B;  3G4Z A;  3RQG A;  3TOL A;  1MQV A;  2EIK C;  1U0B B;  2M64 A;  3NKD A;  4DVZ A;  1ZW3 A;  1B68 A;  1NG1 A;  1SYQ A;  2B0J A;  2VB6 A;  3B9Q A;  3L8I A;  3QMK A;  4NC3 A;  3ABL C;  3U5S A;  1QKR A;  3EQL F;  4X0R A;  2OEV A;  3RF3 A;  4EKW A;  4MW8 A;  4N4W A;  3RQE A;  2HS5 A;  2F22 A;  1DOW A;  4YT4 A;  4QI2 A;  1YVI A;  4CDY A;  4CX9 A;  2O9X A;  1V55 C;  2CCY A;  3DD7 A;  4E0H A;  1RKE A;  1VLS A;  3T6B A;  4CS8 A;  2YLG A;  3FVY A;  4MVO A;  3U9J A;  1NBB A;  4C3E A;  2R7T A;  2WVO A;  2LFF A;  4O6Y A;  1WAT A;  5BUO A;  2EPL X;  4HEA J;  4WAB A;  1JR8 A;  1M2V B;  5B1B C;  1T5O A;  1WGW A;  3ZSU A;  2YL0 A;  4AL1 A;  3JYY A;  5A69 A;  1YA7 O;  2ICW G;  2YL7 A;  1TR2 A;  5BQI A;  5DQZ A;  1APC A;  1Q0G A;  1OR2 A;  2PFD A;  3UNG C;  1G8X A;  1E86 A;  1E83 A;  3G50 A;  1FFH A;  2PX3 A;  2XLD A;  1OR3 A;  2PBE A;  2H7V C;  2PX0 A;  3HJC A;  4K1O A;  4PJJ A;  4U5G A;  2R7U A;  2R7W A;  5E33 A;  3W8I A;  5AC5 A;  1K40 A;  1LE4 A;  2YEV A;  3EFO B;  3C63 A;  1Q0M A;  4E7S A;  3HNK A;  1O3U A;  4JCZ A;  3B0U X;  1Z3I X;  3QTH A;  3SXK A;  1SZI A;  2L6H A;  2HJM A;  2R7S A;  2CGE A;  2L7A A;  2DGJ A;  2NG1 A;  2X51 A;  3HNI A;  1S05 A;  1JAF A;  4XLN F;  3AG1 C;  4YJW A;  3UGO A;  4NQF A;  2XXA A;  4GEH A;  5T1D B;  5L3V A;  4F4B A;  3S0X A;  4CS9 A;  1GM5 A;  3DM9 B;  2OJE D;  1OKK A;  3CQZ A;  1H9G A;  3NRH A;  4RD9 A;  5L0H A;  1ZHT A;  2NUT A;  2NUP A;  4GYT A;  2EIN C;  4PJM A;  1JRA A;  2ZPA A;  2KSF A;  4NTB A;  1FR0 A;  1GGQ A;  3ZIB A;  3LES A;  3POV A;  3V7O A;  3K1H A;  3W8H A;  3S9O A;  4FAP B;  3CAX A;  3B0P A;  1IZM A;  1MMN A;  3BEH A;  3JSE O;  4H4K C;  3U0C A;  3CEX A;  2H7O A;  2HKV A;  1YA9 A;  3UMI A;  5KYW A;  3DWW A;  2J46 A;  2JD3 A;  2PF4 E;  1ZVZ A;  1UG7 A;  1I4Y A;  3Q6N A;  3A11 A;  1NSG B;  5HSW A;  4QI0 A;  4OIP F;  2HV6 A;  4IJJ A;  4W8K A;  1R5I D;  1RJ9 A;  5L0I A;  2IBF A;  3FOP A;  1D0Y A;  1Z5Z A;  4U9D A;  4G78 A;  5T3T A;  3DXJ F;  5DLJ A;  3OWT A;  4ZLC A;  5DS4 A;  5JRA A;  2DYS C;  1H7I A;  1NFO A;  1YJG A;  1BBH A;  4BJ1 A;  3SYN A;  2J9V A;  1OW7 A;  1XZQ A;  2W45 A;  4KI2 A;  1M2V A;  1LS4 A;  3X2Q C;  3TJ5 A; 
#chains in the Genus database with same CATH homology
 1ZHZ A;  3ITF A;  3AQB A;  2WVQ A;  2IXN A;  3VAY A;  3EGD B;  2WL8 A;  3GAN A;  3NKE A;  3UR3 C;  1OCZ C;  1SF8 A;  2ZXR A;  1TWC A;  3F47 A;  2Z15 A;  1NZE A;  5L3Q A;  4G7O F;  1ZU5 A;  1M2O A;  5CI9 A;  1LS1 A;  3O6X A;  2G3V A;  1NU7 D;  4P6I C;  5KYY A;  3OA1 A;  4K0D A;  4I3M A;  4N06 A;  4OD5 A;  1Z23 A;  4JJF A;  1VYI A;  4JZA A;  4AE4 A;  3T4R A;  4G7Z F;  4YT2 A;  2CW0 F;  4I1O B;  4BG0 A;  4C7O A;  2A68 F;  4PK4 A;  2W4M A;  3FAJ A;  2I8B A;  1VYK A;  4DVY P;  4LAC B;  2EIJ C;  2H7B A;  2A6H F;  4HFK B;  3W2W A;  3K33 A;  4AX2 A;  3K66 A;  1MMD A;  4RBN A;  3ASO C;  3EZI A;  3LS0 A;  4WJ0 A;  1FMW A;  2Q9C A;  3I4U A;  4G7H F;  3UMH A;  3NYJ A;  3FHD A;  1IW7 F;  3I5P A;  5KYX B;  2KJG A;  3RIP A;  1W2W A;  2KGO A;  3ZC4 A;  1VMA A;  4BJ5 C;  1QZX A;  3S28 A;  2DYR C;  1V54 C;  2PP4 A;  5D92 A;  2P6V A;  1D0X A;  2CNW A;  1TWG A;  4O6N A;  1PD0 A;  4OIQ F;  2XL4 A;  2FGY A;  1ZU4 A;  5D91 A;  4CS9 C;  3KL4 A;  4ANJ A;  4BJT A;  5DQT A;  4YT8 A;  3WG7 C;  1M57 C;  3ECS A;  2J9W A;  3KMI A;  3O39 A;  2KW3 C;  4O6M A;  1S7Z A;  3QZC A;  4OD4 A;  3Q6M A;  1D1A A;  2G3K A;  4YT4 A;  1ZHY A;  3RH3 A;  2M4E A;  3K7D A;  3HTK C;  3DJU B;  4JJG A;  2QY9 A;  4KNV A;  2C04 A;  3EHM A;  4MQ9 F;  3DJN B;  5T3W A;  3VYW A;  1D1B A;  1RJ9 B;  4NY3 A;  3PMR A;  3HLZ A;  5E2Q A;  1OKK D;  5EGY A;  4U5E E;  5E3C A;  5KYW B;  3KKB A;  3TD7 A;  3DAF A;  2WB7 A;  4OIN F;  4JUR I;  4Q4Z F;  2A69 F;  2J45 A;  1N1C A;  5KYY B;  4HE8 D;  3OEO A;  1TWH A;  3ASN C;  2C03 A;  2L9J A;  4OIR F;  4Q5S F;  2CDQ A;  4KC9 A;  4M63 A;  4PFO A;  4CBE A;  4AK9 A;  5KYX A;  1MNE A;  5B1A C;  1MMA A;  5FCL A;  3B0V C;  3LLI A;  4U5C E;  2R7X A;  1NU9 C;  2Y3H A;  2J0X A;  2W4B A;  3LEV A;  3RYL A;  4BJ5 A;  4KBL A;  3K1I C;  4J32 B;  3I5Q A;  2ZXP A;  3NYL A;  3RFY A;  4U5H A;  5KYN A;  4A2N B;  3EGD A;  1M56 C;  2NUP B;  4CIH A;  4BJ6 A;  1Z63 A;  2ZXO A;  1FTS A;  4ZLD A;  4PJN A;  4FES A;  1D0Z A;  5DS6 A;  3MX3 A;  5F5F A;  4U5F E;  1KU2 A;  4E7Z A;  3LAY A;  2KNH A;  4YN0 B;  3IEE A;  2Y3B A;  3JRT A;  2A6E F;  4O79 A;  5B3S C;  3N2Z B;  1J8M F;  5F5H A;  2Y3D A;  1BR4 A;  2IXM A;  3E70 C;  3SEO A;  2HV7 A;  2EIM C;  2IXO A;  1O5H A;  4CSA C;  1BR1 A;  2XRH A;  3E9V A;  4LLC A;  3H65 A;  3NDB B;  1QLE C;  3EH1 A;  2A1D D;  2XSE A;  1PD1 A;  4HFF B;  4IWB A;  4YWQ A;  3SP1 A;  3EG9 B;  1PCX A;  4U5D E;  1O87 A;  3ABK C;  4C3D A;  2J7P D;  4K7B A;  3L0I A;  4JW1 A;  2YHS A;  3SZR A;  4C7O B;  4FWV A;  3LNR A;  1OCO C;  3PHF 2;  2OG2 A;  3N0T A;  4BJ6 C;  3EFO A;  2QTV A;  2Q9B A;  2LSE A;  4U5B E;  1VOM A;  3JSZ A;  1TKN A;  2Y3G A;  3EJN A;  3LLK A;  3LJB A;  4YT5 A;  3UGP A;  2XXA A;  4C3B A;  2J9U A;  3L34 A;  3ZVR A;  4I44 A;  2G62 A;  3FDQ A;  4CS8 C;  3CSK A;  4CSA A;  4RDA A;  3ZG1 A;  1ZHX A;  1OCC C;  4I1M A;  3EH2 A;  3S27 A;  2FFH A;  1J8Y F;  3EGX B;  5DVW A;  3X1O A;  2MYS A;  5CI8 A;  2WVN A;  3F46 A;  4XTK A;  2W9Y A;  3DZA A;  5E3A A;  2R7R A;  4DOZ A;  3EG9 A;  2KQ9 A;  2Y69 C;  3RKO F;  1SMY F;  2E87 A;  1MMG A;  4ULW A;  1MND A;  5EHH A;  2R7V A;  3K6B A;  4OIO F;  1ST6 A;  1JPN A;  2OCC C;  2VH3 A;  1VK5 A;  4IAO A;  3M1C B;  3NYM A;  3SNH A;  4BEJ A;  4XLP F;  4LLE A;  2GFH A;  2WZF A;  1Z6A A;  4Q7C A;  4DBQ A;  3AG3 C;  5KYU B;  1ZHW A;  3W2V A;  3JT1 A;  5DS5 A;  3Q7L A;  2IOQ A;  2BE5 F;  3UMK A;  1JPJ A;  2EIL C;  4KNW A;  3EGX A;  3EHN A;  4O7G A;  3KH2 A;  3MLG A;  4PJL A;  1OCR C;  3GOD A;  1FFT C;  1D1C A;  2V3C C;  2P7V A;  3AG4 C;  3S29 A;  1ZYR F;  2WZG A;  5IY5 C;  4EWC A;  5KYU A;  3AG2 C;  2D5R B;  2WZL A;  3AQC A;  4CS7 A;  2XXA B;  3CZ6 A;  2MWQ A;  2NUT B;  3Q7G A;  2Y39 A;  3JCU Q;  4XWJ A;  4AE4 B;  4PFP A;  2VAS A;  3WOD F;  3LS1 A;  2J7P A;  3N24 A;  4LER A;  3T6J A;  2Q3T A;  3EPV A;  1LVK A;  1BR2 A;  2R7O A;  4JCH A;  2IYL D;  2CNW D;  2ZXW C;  2IXP A;  3DAG A;  2J0W A;  3EZH A;  3NG1 A;  3DMD A;  4DBR A;  3ABM C;  1FMV A;  3JYH A;  2L81 A;  4IRU A;  2Q9A A;  4EBB A;  4FX5 A;  4J30 B;  4G0H A;  2R7Q A;  2V26 A;  2YZS A;  3DM5 A;  4QDL A;  4B6I A;  4JVS A;  1LKX A;  4MND A;  1TWA A;  2EIK C;  3NKD A;  4DVZ A;  1NG1 A;  2B0J A;  2VB6 A;  3B9Q A;  3QMK A;  3ABL C;  3EQL F;  4X0R A;  4QI2 A;  2O9X A;  1V55 C;  3DD7 A;  3T6B A;  4CS8 A;  3FVY A;  2R7T A;  4C3E A;  2WVO A;  4O6Y A;  5BUO A;  4HEA J;  1M2V B;  5B1B C;  1WGW A;  3ZSU A;  1TR2 A;  5DQZ A;  2PFD A;  3UNG C;  1G8X A;  1FFH A;  2PX3 A;  3HJC A;  2H7V C;  2PX0 A;  4PJJ A;  4U5G A;  2R7U A;  2R7W A;  5E33 A;  3W8I A;  2YEV A;  3EFO B;  4E7S A;  3B0U X;  1Z3I X;  1SZI A;  2R7S A;  2CGE A;  2NG1 A;  2DGJ A;  2X51 A;  4XLN F;  3AG1 C;  4YJW A;  3UGO A;  4GEH A;  5T1D B;  5L3V A;  4F4B A;  3S0X A;  4CS9 A;  3DM9 B;  1OKK A;  3CQZ A;  3NRH A;  4RD9 A;  1ZHT A;  2NUT A;  2NUP A;  4GYT A;  2EIN C;  4PJM A;  2ZPA A;  3ZIB A;  3LES A;  3POV A;  3V7O A;  3K1H A;  3W8H A;  3B0P A;  1IZM A;  1MMN A;  4H4K C;  2H7O A;  3UMI A;  5KYW A;  2J46 A;  2JD3 A;  2PF4 E;  3Q6N A;  5HSW A;  4QI0 A;  4OIP F;  2HV6 A;  4IJJ A;  4W8K A;  1RJ9 A;  1D0Y A;  1Z5Z A;  5T3T A;  5DLJ A;  4ZLC A;  3DXJ F;  5DS4 A;  3OWT A;  2DYS C;  4BJ1 A;  3SYN A;  2J9V A;  2W45 A;  4KI2 A;  1M2V A;  3X2Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...