3W8HA

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of stk25
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
197
structure length
190
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/transferase
molecule keywords Programmed cell death protein 10
publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 190
sequence length 197
ec nomenclature
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3w8hA00
3W8HA 4GEHA 3W8IA
chains in the Genus database with same CATH superfamily
4DOZA 5EGYA 3UMIA 2ZXRA 3POVA 1VOMA 2A0UA 2Q00A 2OEXA 3EHNA 1LS1A 1Q0KA 5IY5C 4I44A 3RQEA 3U2MA 4EKWA 1AVOB 2EPOA 4JC7A 5A6KA 1J8MF 4JKVA 5JS5A 2DGJA 3VF0A 1L3PA 4YT8A 4CS8C 3RQGA 5JSLA 3HNIA 3VYWA 1WN0A 1OCCC 1AEPA 3CZ6A 1Z63A 2OG2A 4QI2A 4C3DA 4XQ1A 4JZAA 2HFIA 1TWCA 3DD7A 3QVZA 3SXKA 2IBFA 1RKEA 2WZFA 3I4UA 3EGXB 3R7CA 3TQOA 1OKKD 2PP4A 3NKDA 4XEKA 1OW7A 3KL4A 2NUTB 4K0DA 5T3TA 4OIRF 4J30B 4MVRA 3ASOC 3T6BA 4Q4ZF 3ZWIA 1M2OA 2LIGA 4I3MA 3C18A 3LNMB 5CI9A 4B6IA 5HV9A 2KNHA 2YL0A 2Q9BA 1YA9A 2J7PA 3E9VA 5JRAA 3G4ZA 1Z23A 2CYDA 1VLSA 1OXKA 3M4CA 3Q6MA 4CBEA 2TMVP 3UR3C 1C03A 5BUOA 4CIHA 2WZGA 5F5HA 3ASNC 4P9TA 4MVSA 3U3BA 5E33A 4ZLDA 3JSZA 1U6HA 2M64A 1PCXA 4U5EE 4IAOA 3N24A 1RJ9B 4KNVA 1S7ZA 2ZXPA 4PJMA 4U5BE 1KTMA 2DYSC 1LE2A 2NSGA 4JTAB 4PK4A 5L0DA 3ZTMA 2XS8A 5B1AC 2I8BA 4I1MA 4LLEA 1JPNA 3B29A 4FWVA 5E3CA 2Y3BA 3QVYA 4GYTA 4MNDA 2Q7RA 5KYNA 1GM5A 3NYMA 1HE1A 1Q0GA 2FFHA 2NSFA 4D4NA 1GS9A 1JRAA 3UNGC 4EIYA 1JOGA 1O3UA 3AGUA 4G0HA 3G4XA 3RFYA 2HSBA 3L34A 4ZLCA 1M2VB 2HJ3A 5JP7A 3B0UX 3ZTZA 2R7WA 3CAXA 2XL6A 1JR8A 2YL1A 2ZXOA 2LFDA 3EZIA 3LLKA 4JRZA 2ASRA 2GDCA 2J46A 4PJJA 1TFOB 3ZC4A 2L6FA 1FNTc 1Q0MA 2QLAA 3DE8A 1TFKB 3MBGA 4JVSA 1OR3A 1QVXA 2R7RA 5B1BC 4KC9A 4Z9IA 3NMKA 1HW2A 4WJ0A 1NSGB 4CJOA 1U0BB 2KYHA 1YZAA 1E2XA 3TJ6A 5B3SC 4BJTA 1OR2A 2CCYA 3DM5A 1NZEA 2R25A 4CSAA 5A6AA 3VM6A 3QTHA 1MNDA 2GAQA 4U5FE 3W2VA 3S0XA 1LKXA 1V74B 4CDVA 3O6XA 4EHPA 1T6IA 3LLIA 4U5HA 3MLGA 1NU9C 4KNWA 2R05A 2YL3A 2PFDA 2R02A 2Y3DA 3SYNA 3L0IA 1CGME 4ULVA 4BEJA 2YVKA 4CSAC 4C3EA 2LSEA 3GORA 3QZCA 1VMAA 3V5ZA 5L0FA 1KU2A 1M57C 3AOUA 3T4RA 1Y6DA 2NUPB 3JYYA 5TJ5E 2PX3A 2ZD9A 1R4TA 3PMRA 1NLXA 3AG2C 2HUJA 1A41A 1D1BA 2B0HA 2XS1A 3H2VA 3NMIA 5JUAA 4EBKA 1WOLA 2KK1A 1XZQA 2VH3A 2EPMX 1D1CA 4X0RA 3ABLC 4CDYA 2NUPA 2JX0A 2J7PD 3FMSA 4U5CE 4KI2A 2R7VA 4QI0A 1RKCA 1TQGA 1OW8A 1TWGA 1H9GA 5L0CA 4OIQF 2XXAA 3MYIA 2W4MA 1MMDA 4E18A 1FFHA 1FMWA 3PDMP 1XZPA 3S9OA 5COFA 1G4WR 5E2QA 4LLCA 5EHHA 5AC5A 3RVZA 1Z7Qc 1S05A 3EJNA 4E7ZA 1WWPA 2YEVA 3BRJA 4DRJB 2W4BA 2PNOA 1Q0DA 2PF4E 5DS6A 1IZMA 3DAGA 2A6HF 1JAFA 3K7DA 4N06A 4YT5A 2A6EF 2QUPA 1NU7D 3I5PA 3LNRA 2L9JA 4O6YA 1QKRA 1EI7A 1I5NA 5AGFA 5T1DB 5KYUB 2IOQA 1YJGA 2OQMA 3AG4C 3JYHA 3NYLA 4J7TA 1MMAA 4MS2A 1D0YA 1ORYA 4KBLA 3Q6NA 4YJWA 3TD7A 5F5FA 1VK5A 3EG9B 2JPUA 2JD3A 2OJQA 4M63A 1SYQA 2AWCA 2LQGA 3C7JA 2J9BA 4H54A 5L0GA 1OQCA 5KYYA 4JIOA 2R7UA 4ONSA 1PD1A 2YWAA 1BBHA 3TOMA 2DI3A 5HSWA 4HE8D 1H7IA 1VLTA 2V26A 4P9FA 2LCHA 5DQTA 3JZ0A 4PJLA 1G8XA 1APCA 1K40A 1VYKA 1U89A 2RD9A 4CS9C 2HV7A 5L0HA 3ABMC 2J0XA 1OCZC 4XWJA 4XLNF 4Z9HA 3N2ZB 3GEEA 3ZDLA 3ZG1A 3V5YA 4CIPA 3PCVA 2XM0A 1QZXA 1K04A 4XPXA 3T6JA 3U2LA 3HNKA 5DQZA 4CS9A 3ABKC 1R5ID 2Q4FA 1B68A 3LS1A 2L81A 1E85A 2R9RB 4W8PA 3U0CA 5L3VA 3IQ6A 4DVZA 5GPGB 2OOCA 2M4EA 4NTAA 3AJMA 5A6BA 4U5GA 2L7AA 5KYWB 1FR0A 1I4ZA 2XLOA 3A11A 4DXWA 2R7XA 3HTKC 2IXPA 1BR2A 2C03A 2H7OA 3DI5A 2LD6A 3EGXA 4I1OB 3SXMA 4GEHA 2NUTA 3UGPA 4U5DE 3K1IC 4OINF 2HSQA 3RKOF 3RIPA 4UDVA 4IRUA 2DYRC 2EIJC 2WVOA 1Z6AA 1ZW3A 2OJED 3C8GB 1MMGA 3EGDB 2QE9A 2YL7A 3JRTA 4NTBA 4JTCB 4OIOF 3K1IA 4JURI 2LFFA 3O10A 1ZHTA 2GA0A 4XLPF 2MYSA 2XRHA 3DZAA 3LAYA 3O39A 4ER9A 4E0HA 4LACB 3SP1A 1VTMP 1A0BA 1PV3A 2ZXWC 3GODA 5A69A 5D92A 1UFBA 3K1HA 3SEOA 5CI8A 1RJ9A 3A9CA 3CSKA 3HNJA 3KMIA 4HFFB 4LERA 3R2PA 3ZQVA 1QLEC 3B9QA 5COMA 4C7OB 4FX5A 5D91A 5L3QA 3I5QA 4DVYP 4E0IA 1D0XA 2Q3TA 3F47A 1YLMA 2EPNA 3M79A 3WHNA 2EIKC 1T9KA 2F22A 5F28E 2YLIA 3PHF2 1ZW2A 3IQCA 1DOWA 3EFOB 3MYFA 1VYIA 4HEAJ 5COGA 4N6HA 1TWAA 3DE9A 4P6IC 1GQAA 3TULA 2I15A 1TR2A 1PD0A 3Q7GA 1CPRA 4JEAA 2G62A 1ZU5A 2RSEB 2X51A 2W45A 1M2VA 2XL8A 5JT4A 4OD4A 3SZRA 3J06A 1NFNA 4HFKB 4G7ZF 2D5RB 2HJMA 3KYIA 1WATA 1Z5ZA 2Y3GA 3IEEA 3LS0A 1OW6A 4DRIB 2HKVA 4AL0A 1LS4A 2A1DD 3FAPB 2XSEA 2UUHA 5K0IA 3DXJF 1O87A 2CNWA 1DOVA 2KSFA 1I4YA 4FAPB 2ZPAA 3NDBB 1ZU4A 5CIVA 3C63A 4CS8A 1V54C 3HJCA 2KJGA 2C04A 5KYXB 4BJ1A 3VAYA 3RYLA 4JCZA 1T6QA 5A6JA 2H7VC 3S90A 2YHSA 3DAFA 1UG7A 3NKEA 3B0PA 1J8YF 3N0TA 1ZHYA 1C02A 5FCLA 2PBEA 1YDIA 2VCBA 1KNYA 1YZCA 2VCAA 4BEMJ 1K05A 2V3CC 1M56C 4U9EA 4NTFA 4Z9JA 1ZHXA 1A7VA 1WTYA 2PX0A 4Q7CA 3RH3A 2WZLA 4NC3A 5BQGA 4QDLA 1LI7A 2YLDA 1Z3IX 1ZHZA 4LDQA 5A6BD 4W8KA 4BG0A 4AE4B 3NG1A 2B0JA 1E83A 4PFOA 1FTSA 4E7SA 1LVKA 3QW0A 4OIPF 2HV6A 3M4BA 3FVYA 4IB4A 4DJ9A 3V7OA 3MX3A 1BR4A 3ZVRA 4YK5A 2R03A 2J8WA 3FHDA 3DMDA 3EPVA 4O7GA 1C17M 3W8IA 1EA8A 2EIMC 3LEVA 2DB4A 2QTVA 2WVQA 4JEBA 4JTDB 3QW1A 3OA1A 3US6A 2VCCA 4RDAA 4RD9A 1XWJA 1IW7F 1E84A 1BR1A 3IPMO 2LK4A 3RVYA 3SXZA 5DS5A 1H9TA 2L6GA 3GM3A 1NFOA 3EZHA 3ZQYA 1OXBA 2P6VA 2J9UA 4CDAA 1RXQA 1YAUO 3EH2A 2X0CA 3KPHA 3RQFA 2KQ9A 4N4WA 5KYUA 4DRHB 3DJUB 2OEVA 2HMZA 3K33A 3OEOA 3WAQA 5BQHA 2OKUA 5DVWA 4LDRA 1FMVA 3EG9A 2P7VA 1CGOA 4O79A 2BE5F 3ECSA 2A0BA 4G78A 1SF8A 1NBBA 2KW3C 2D4UA 3C62A 3S29A 3HNLA 1OCRC 3DJNB 4G7HF 1G5ZA 1F1MA 2MHRA 2Y69C 1T01A 4CS7A 3OWTA 2AU5A 3CQZA 1ZHWA 1ZVZA 4K7BA 4LDKA 1RKEB 3UMHA 4CJGA 2FAPB 3X2QC 3AG3C 4YWQA 3CEXA 4DBRA 1QSPA 5B3IA 2G3KA 3AQCA 1HE9A 4NCQA 3JTLO 2CNWD 3L8IA 3DWWA 3AG1C 3B71A 4L6RA 4XPYA 2R7QA 2YKZA 2ETSA 4MVZA 3DM9B 2J9WA 1EQ1A 3NMJA 3FDQA 3IHUA 1T5OA 2EILC 1MQVA 3U9MA 1WGWA 5KYWA 2BL2A 2J9VA 2KGOA 3W8HA 4Q5SF 4ANJA 3IQ5A 3SNHA 3EH1A 1TKNA 2OU6A 3E70C 2CW0F 4BJ5C 3TK0A 2R7SA 4JW1A 3B0VC 3NRHA 2IYLD 1SR2A 2IXNA 4J32B 4IGGA 1JMWA 5FZTA 1YARO 4JJFA 5BQIA 3C8GA 3EGDA 1RCPA 4JE9A 4BJ5A 2LP4A 1BDJB 4IWBA 5AC4A 3W4YA 3LJBA 2KC3A 2P1AA 1YA7O 3UGOA 2HS5A 2YZSA 4E17A 4XEVA 1D0ZA 4XEFA 3JRMO 1HMDA 1SZIA 2W9YA 2XLHA 4MTFA 3S28A 4J7YA 2AVKA 3EQLF 1L7CA 3M1CB 5E3AA 4PACA 3FXHA 3H65A 3LEOA 3U3FA 5L0IA 3WODF 3GWLA 3G50A 4AK9A 4C7OA 3L8JA 4YL1A 4JCHA 3FOOA 2XLVA 2VB6A 3MFNA 3EHMA 3FAJA 3GEHA 3K6BA 4AL1A 2XLDA 3AGTA 2EPLX 3EFOA 5EK0A 3X1OA 4EUKB 4YN0B 4MVOA 4FESA 4EBJA 4MQ9F 2HZ8A 4MVQA 4C3BA 1Q0FA 4PR9A 1Y4CA 1M6TA 4XTKA 4MVMA 3ATPA 1GGQA 4OD5A 4N6CA 4D4XA 3C8ZA 2OCCC 1SMYF 1V4AA 2O9XA 1A7DA 3JT1A 1HMOA 5DLJA 1VB5A 1ST6A 4PJNA 1A7EA 1N1CA 4EWCA 1OKKA 4YL0A 2J0WA 3GM1A 4U9DA 1CPQA 2J45A 1YYJA 3L1MA 4H4KC 1E86A 1HW1A 1ORSC 2WVNA 2XLMA 2Z15A 1H6GA 3BEHA 1TWHA 2IM8A 4NY3A 5T3WA 5JLIA 1QQ3A 2IXMA 2UUIA 4MW8A 2Q9AA 4MW3A 2ICWG 3JSEO 2A69F 3U9JA 2NG1A 3W2WA 3KH2A 4AX2A 4YL3A 3T6GB 1HY5A 4GQHA 4PFPA 5JVEA 3HKKA 3DKAA 5KYXA 2YLGA 3GANA 2L6HA 2R7OA 3HLZA 2BC5A 3M15A 2Y3HA 4NQFA 4O6MA 4RBNA 4BJ6C 2WB7A 3JCUQ 2EPKX 3S27A 3U8PA 4XPWA 1JPJA 1LI5A 1EKYA 2P61A 3ZSUA 1NG1A 3T9OA 1LIHA 4CX9A 2MWQA 1D1AA 4F4BA 2YRFA 2P0NA 3AQBA 2NPUA 2H8AA 2Y39A 4BJ6A 1O5HA 2XLWA 3GWNA 3KKBA 1ZZPA 3IQTA 4EBBA 5DS4A 4IARA 4G7OF 1RMVA 2Q9CA 2VASA 2HMQA 3LUTB 4BPMA 4YT2A 4MTOA 4ULWA 1MMNA 4IJJA 3U8VA 2XXAB 1ORJA 2A68F 3F46A 3Q7LA 4O6NA 3UMKA 2XL4A 1YYXA 2CDQA 2XLEA 4AE4A 5L0JA 4MTGA 3GM2A 2R7TA 1FFTC 2EINC 2QNLA 1T6UA 2QY9A 1ZYRF 3WG7C 3U5SA 4R32A 3RF3A 2AP3A 4IAQA 2H7BA 3RW0A 1BZ4A 3QMKA 4A2NB 1LPEA 1YVIA 3FOPA 3ZIBA 1FAPB 3LESA 2FGYA 3NYJA 2VC9A 1LM3B 4K1OA 3C8GD 2GFHA 4WGZA 3V5XA 3KYJA 1LE4A 1OCOC 3O55A 1CGNA 1QPUA 1AUEA 5KYYB 2XM4A 1V55C 2IXOA 3TJ5A 4A4AA 3ITFA 2G3VA 1WASA 3GEIA 3K66A 4MVUA 4WABA 2AWYA 256BA 4WGYA 3H2UA 2YQYA 2CGEA 4YT4A 4DBQA 3S84A 4JJGA 3SXYA 2E87A 2GWWA 1G4US 3TOLA 1W2WA 1MNEA 3VRCA 2WL8A
chains in the Genus database with same CATH topology
4DOZA 5EGYA 3UMIA 2ZXRA 3POVA 1VOMA 3EHNA 1LS1A 5IY5C 4I44A 1J8MF 2DGJA 4YT8A 4CS8C 3VYWA 1OCCC 3CZ6A 1Z63A 2OG2A 4QI2A 4C3DA 4JZAA 3DD7A 1TWCA 3ZSUA 4CS8A 3I4UA 2WZFA 3EGXB 1OKKD 2PP4A 3NKDA 4OIRF 3KL4A 4K0DA 2NUTB 5T3TA 3T6BA 4Q4ZF 4J30B 3ASOC 1M2OA 4I3MA 5CI9A 4B6IA 2KNHA 2Q9BA 2J7PA 3E9VA 1Z23A 4CBEA 3Q6MA 3UR3C 5BUOA 4CIHA 2WZGA 5F5HA 3ASNC 5E33A 4ZLDA 3JSZA 1PCXA 4U5EE 4IAOA 3N24A 1RJ9B 4KNVA 1S7ZA 2ZXPA 4PJMA 4U5BE 2DYSC 4PK4A 5B1AC 2I8BA 4I1MA 4LLEA 1JPNA 4FWVA 5E3CA 2Y3BA 4GYTA 4MNDA 5KYNA 3NYMA 2FFHA 3UNGC 4G0HA 3RFYA 4ZLCA 3L34A 1M2VB 3B0UX 2R7WA 2ZXOA 3EZIA 3LLKA 2J46A 4PJJA 3ZC4A 4JVSA 2R7RA 5B1BC 4KC9A 4WJ0A 5B3SC 4BJTA 3DM5A 1NZEA 1MNDA 3W2VA 4U5FE 3S0XA 1LKXA 3O6XA 3LLIA 4U5HA 3MLGA 1NU9C 4KNWA 2PFDA 2Y3DA 3SYNA 3L0IA 4BEJA 4CSAC 4C3EA 2LSEA 3QZCA 1VMAA 1KU2A 1M57C 3T4RA 2NUPB 2PX3A 3PMRA 3AG2C 1D1BA 2VH3A 1D1CA 4X0RA 3ABLC 2NUPA 2J7PD 4KI2A 4U5CE 2R7VA 4QI0A 1TWGA 4OIQF 2XXAA 2W4MA 1MMDA 1FMWA 1FFHA 5E2QA 5EHHA 4LLCA 3PHF2 3EJNA 4E7ZA 2YEVA 5DS6A 2W4BA 2PF4E 1IZMA 3DAGA 2A6HF 3K7DA 4N06A 4YT5A 2A6EF 1NU7D 3I5PA 3LNRA 2L9JA 4O6YA 5T1DB 5KYUB 2IOQA 3JYHA 3AG4C 3NYLA 1MMAA 1D0YA 4KBLA 4YJWA 3Q6NA 3TD7A 5F5FA 1VK5A 3EG9B 2JD3A 4M63A 5KYYA 2R7UA 1PD1A 5HSWA 4HE8D 2V26A 5DQTA 4PJLA 1G8XA 1VYKA 4CS9C 2HV7A 3ABMC 2J0XA 1OCZC 4XWJA 4XLNF 3ZG1A 3N2ZB 1QZXA 3T6JA 5DQZA 4CS9A 3ABKC 3LS1A 2L81A 5L3VA 4DVZA 2M4EA 4U5GA 5KYWB 2R7XA 3HTKC 2IXPA 1BR2A 2C03A 2H7OA 3EGXA 4I1OB 4GEHA 2NUTA 3UGPA 4U5DE 3K1IC 4OINF 3RKOF 3RIPA 4IRUA 2DYRC 2EIJC 2WVOA 1Z6AA 3EGDB 3JRTA 4OIOF 1MMGA 4JURI 1ZHTA 4XLPF 2MYSA 2XRHA 3DZAA 3LAYA 3O39A 4LACB 3SP1A 2ZXWC 3GODA 5D92A 3K1HA 3SEOA 5CI8A 1RJ9A 3CSKA 3KMIA 4HFFB 4LERA 1QLEC 3B9QA 4C7OB 4FX5A 5D91A 5L3QA 3I5QA 4DVYP 1D0XA 2Q3TA 3F47A 2EIKC 3EFOB 4HEAJ 1VYIA 1TWAA 4P6IC 1TR2A 1PD0A 3Q7GA 2G62A 1ZU5A 2X51A 2W45A 1M2VA 4OD4A 3SZRA 4G7ZF 4HFKB 2D5RB 1Z5ZA 2Y3GA 3IEEA 3LS0A 2A1DD 2XSEA 3DXJF 1O87A 2CNWA 2ZPAA 3NDBB 1ZU4A 1V54C 3HJCA 2KJGA 2C04A 5KYXB 4BJ1A 3VAYA 3RYLA 2H7VC 2YHSA 3DAFA 3NKEA 3B0PA 1J8YF 3N0TA 1ZHYA 5FCLA 4CSAA 2V3CC 1M56C 1ZHXA 4Q7CA 2PX0A 3RH3A 2WZLA 4QDLA 1Z3IX 1ZHZA 4W8KA 4BG0A 4AE4B 3NG1A 2B0JA 4PFOA 1FTSA 4E7SA 1LVKA 4OIPF 2HV6A 3FVYA 3V7OA 3MX3A 1BR4A 3ZVRA 3W8IA 3FHDA 3DMDA 3EPVA 4O7GA 2EIMC 3LEVA 2QTVA 2WVQA 3OA1A 4RD9A 4RDAA 1IW7F 1BR1A 5DS5A 3EZHA 2P6VA 2J9UA 3EH2A 2KQ9A 5KYUA 3DJUB 3K33A 3OEOA 5DVWA 1FMVA 3EG9A 2P7VA 4O79A 2BE5F 3ECSA 1SF8A 2KW3C 3S29A 1OCRC 3DJNB 4G7HF 2Y69C 4CS7A 3OWTA 3CQZA 1ZHWA 4K7BA 3UMHA 3X2QC 3AG3C 4YWQA 4DBRA 2G3KA 3AQCA 2CNWD 3AG1C 2R7QA 3DM9B 2J9WA 3FDQA 2EILC 1WGWA 5KYWA 2KGOA 2J9VA 3W8HA 4Q5SF 4ANJA 3SNHA 3EH1A 1TKNA 3E70C 2CW0F 4BJ5C 2R7SA 4JW1A 3B0VC 3NRHA 2IYLD 2IXNA 4J32B 4JJFA 4BJ5A 3EGDA 4IWBA 3LJBA 3UGOA 2YZSA 1D0ZA 3S28A 1SZIA 2W9YA 3EQLF 3M1CB 5E3AA 3H65A 3WODF 4AK9A 4C7OA 4JCHA 2VB6A 3EHMA 3FAJA 3K6BA 3EFOA 3X1OA 4YN0B 4FESA 4MQ9F 4C3BA 4XTKA 4OD5A 2OCCC 1SMYF 2O9XA 3JT1A 5DLJA 1ST6A 4PJNA 1N1CA 4EWCA 1OKKA 2J0WA 2J45A 4H4KC 2WVNA 2Z15A 4NY3A 1TWHA 5T3WA 2IXMA 2Q9AA 2A69F 2NG1A 3W2WA 3KH2A 4AX2A 4PFPA 5KYXA 3GANA 3HLZA 2R7OA 4O6MA 4RBNA 2Y3HA 4BJ6C 2WB7A 3JCUQ 3S27A 1JPJA 1NG1A 2MWQA 1D1AA 4F4BA 3AQBA 2Y39A 4BJ6A 1O5HA 3KKBA 4EBBA 5DS4A 4G7OF 2Q9CA 2VASA 4YT2A 4ULWA 1MMNA 4IJJA 2XXAB 2A68F 3F46A 3Q7LA 4O6NA 3UMKA 2XL4A 2CDQA 4AE4A 2R7TA 1FFTC 2EINC 2QY9A 1ZYRF 3WG7C 2H7BA 3QMKA 4A2NB 3ZIBA 3LESA 2FGYA 3NYJA 2GFHA 1OCOC 5KYYB 1V55C 2IXOA 3ITFA 2G3VA 3K66A 2CGEA 4YT4A 4DBQA 4JJGA 2E87A 1W2WA 1MNEA 2WL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8H A;  4GEH A;  3W8I A; 
#chains in the Genus database with same CATH topology
 4DOZ A;  5EGY A;  3UMI A;  2ZXR A;  3POV A;  1VOM A;  2A0U A;  2Q00 A;  2OEX A;  3EHN A;  1LS1 A;  1Q0K A;  5IY5 C;  4I44 A;  3RQE A;  3U2M A;  4EKW A;  1AVO B;  2EPO A;  4JC7 A;  5A6K A;  1J8M F;  4JKV A;  5JS5 A;  2DGJ A;  3VF0 A;  1L3P A;  4YT8 A;  4CS8 C;  3RQG A;  5JSL A;  3HNI A;  3VYW A;  1WN0 A;  1OCC C;  1AEP A;  3CZ6 A;  1Z63 A;  2OG2 A;  4QI2 A;  4C3D A;  4XQ1 A;  4JZA A;  2HFI A;  1TWC A;  3DD7 A;  3QVZ A;  3SXK A;  2IBF A;  1RKE A;  2WZF A;  3I4U A;  3EGX B;  3R7C A;  3TQO A;  1OKK D;  2PP4 A;  3NKD A;  4XEK A;  1OW7 A;  3KL4 A;  2NUT B;  4K0D A;  5T3T A;  4OIR F;  4J30 B;  4MVR A;  3ASO C;  3T6B A;  4Q4Z F;  3ZWI A;  1M2O A;  2LIG A;  4I3M A;  3C18 A;  3LNM B;  5CI9 A;  4B6I A;  5HV9 A;  2KNH A;  2YL0 A;  2Q9B A;  1YA9 A;  2J7P A;  3E9V A;  5JRA A;  3G4Z A;  1Z23 A;  2CYD A;  1VLS A;  1OXK A;  3M4C A;  3Q6M A;  4CBE A;  2TMV P;  3UR3 C;  1C03 A;  5BUO A;  4CIH A;  2WZG A;  5F5H A;  3ASN C;  4P9T A;  4MVS A;  3U3B A;  5E33 A;  4ZLD A;  3JSZ A;  1U6H A;  2M64 A;  1PCX A;  4U5E E;  4IAO A;  3N24 A;  1RJ9 B;  4KNV A;  1S7Z A;  2ZXP A;  4PJM A;  4U5B E;  1KTM A;  2DYS C;  1LE2 A;  2NSG A;  4JTA B;  4PK4 A;  5L0D A;  3ZTM A;  2XS8 A;  5B1A C;  2I8B A;  4I1M A;  4LLE A;  1JPN A;  3B29 A;  4FWV A;  5E3C A;  2Y3B A;  3QVY A;  4GYT A;  4MND A;  2Q7R A;  5KYN A;  1GM5 A;  3NYM A;  1HE1 A;  1Q0G A;  2FFH A;  2NSF A;  4D4N A;  1GS9 A;  1JRA A;  3UNG C;  4EIY A;  1JOG A;  1O3U A;  3AGU A;  4G0H A;  3G4X A;  3RFY A;  2HSB A;  3L34 A;  4ZLC A;  1M2V B;  2HJ3 A;  5JP7 A;  3B0U X;  3ZTZ A;  2R7W A;  3CAX A;  2XL6 A;  1JR8 A;  2YL1 A;  2ZXO A;  2LFD A;  3EZI A;  3LLK A;  4JRZ A;  2ASR A;  2GDC A;  2J46 A;  4PJJ A;  1TFO B;  3ZC4 A;  2L6F A;  1FNT c;  1Q0M A;  2QLA A;  3DE8 A;  1TFK B;  3MBG A;  4JVS A;  1OR3 A;  1QVX A;  2R7R A;  5B1B C;  4KC9 A;  4Z9I A;  3NMK A;  1HW2 A;  4WJ0 A;  1NSG B;  4CJO A;  1U0B B;  2KYH A;  1YZA A;  1E2X A;  3TJ6 A;  5B3S C;  4BJT A;  1OR2 A;  2CCY A;  3DM5 A;  1NZE A;  2R25 A;  4CSA A;  5A6A A;  3VM6 A;  3QTH A;  1MND A;  2GAQ A;  4U5F E;  3W2V A;  3S0X A;  1LKX A;  1V74 B;  4CDV A;  3O6X A;  4EHP A;  1T6I A;  3LLI A;  4U5H A;  3MLG A;  1NU9 C;  4KNW A;  2R05 A;  2YL3 A;  2PFD A;  2R02 A;  2Y3D A;  3SYN A;  3L0I A;  1CGM E;  4ULV A;  4BEJ A;  2YVK A;  4CSA C;  4C3E A;  2LSE A;  3GOR A;  3QZC A;  1VMA A;  3V5Z A;  5L0F A;  1KU2 A;  1M57 C;  3AOU A;  3T4R A;  1Y6D A;  2NUP B;  3JYY A;  5TJ5 E;  2PX3 A;  2ZD9 A;  1R4T A;  3PMR A;  1NLX A;  3AG2 C;  2HUJ A;  1A41 A;  1D1B A;  2B0H A;  2XS1 A;  3H2V A;  3NMI A;  5JUA A;  4EBK A;  1WOL A;  2KK1 A;  1XZQ A;  2VH3 A;  2EPM X;  1D1C A;  4X0R A;  3ABL C;  4CDY A;  2NUP A;  2JX0 A;  2J7P D;  3FMS A;  4U5C E;  4KI2 A;  2R7V A;  4QI0 A;  1RKC A;  1TQG A;  1OW8 A;  1TWG A;  1H9G A;  5L0C A;  4OIQ F;  2XXA A;  3MYI A;  2W4M A;  1MMD A;  4E18 A;  1FFH A;  1FMW A;  3PDM P;  1XZP A;  3S9O A;  5COF A;  1G4W R;  5E2Q A;  4LLC A;  5EHH A;  5AC5 A;  3RVZ A;  1Z7Q c;  1S05 A;  3EJN A;  4E7Z A;  1WWP A;  2YEV A;  3BRJ A;  4DRJ B;  2W4B A;  2PNO A;  1Q0D A;  2PF4 E;  5DS6 A;  1IZM A;  3DAG A;  2A6H F;  1JAF A;  3K7D A;  4N06 A;  4YT5 A;  2A6E F;  2QUP A;  1NU7 D;  3I5P A;  3LNR A;  2L9J A;  4O6Y A;  1QKR A;  1EI7 A;  1I5N A;  5AGF A;  5T1D B;  5KYU B;  2IOQ A;  1YJG A;  2OQM A;  3AG4 C;  3JYH A;  3NYL A;  4J7T A;  1MMA A;  4MS2 A;  1D0Y A;  1ORY A;  4KBL A;  3Q6N A;  4YJW A;  3TD7 A;  5F5F A;  1VK5 A;  3EG9 B;  2JPU A;  2JD3 A;  2OJQ A;  4M63 A;  1SYQ A;  2AWC A;  2LQG A;  3C7J A;  2J9B A;  4H54 A;  5L0G A;  1OQC A;  5KYY A;  4JIO A;  2R7U A;  4ONS A;  1PD1 A;  2YWA A;  1BBH A;  3TOM A;  2DI3 A;  5HSW A;  4HE8 D;  1H7I A;  1VLT A;  2V26 A;  4P9F A;  2LCH A;  5DQT A;  3JZ0 A;  4PJL A;  1G8X A;  1APC A;  1K40 A;  1VYK A;  1U89 A;  2RD9 A;  4CS9 C;  2HV7 A;  5L0H A;  3ABM C;  2J0X A;  1OCZ C;  4XWJ A;  4XLN F;  4Z9H A;  3N2Z B;  3GEE A;  3ZDL A;  3ZG1 A;  3V5Y A;  4CIP A;  3PCV A;  2XM0 A;  1QZX A;  1K04 A;  4XPX A;  3T6J A;  3U2L A;  3HNK A;  5DQZ A;  4CS9 A;  3ABK C;  1R5I D;  2Q4F A;  1B68 A;  3LS1 A;  2L81 A;  1E85 A;  2R9R B;  4W8P A;  3U0C A;  5L3V A;  3IQ6 A;  4DVZ A;  5GPG B;  2OOC A;  2M4E A;  4NTA A;  3AJM A;  5A6B A;  4U5G A;  2L7A A;  5KYW B;  1FR0 A;  1I4Z A;  2XLO A;  3A11 A;  4DXW A;  2R7X A;  3HTK C;  2IXP A;  1BR2 A;  2C03 A;  2H7O A;  3DI5 A;  2LD6 A;  3EGX A;  4I1O B;  3SXM A;  4GEH A;  2NUT A;  3UGP A;  4U5D E;  3K1I C;  4OIN F;  2HSQ A;  3RKO F;  3RIP A;  4UDV A;  4IRU A;  2DYR C;  2EIJ C;  2WVO A;  1Z6A A;  1ZW3 A;  2OJE D;  3C8G B;  1MMG A;  3EGD B;  2QE9 A;  2YL7 A;  3JRT A;  4NTB A;  4JTC B;  4OIO F;  3K1I A;  4JUR I;  2LFF A;  3O10 A;  1ZHT A;  2GA0 A;  4XLP F;  2MYS A;  2XRH A;  3DZA A;  3LAY A;  3O39 A;  4ER9 A;  4E0H A;  4LAC B;  3SP1 A;  1VTM P;  1A0B A;  1PV3 A;  2ZXW C;  3GOD A;  5A69 A;  5D92 A;  1UFB A;  3K1H A;  3SEO A;  5CI8 A;  1RJ9 A;  3A9C A;  3CSK A;  3HNJ A;  3KMI A;  4HFF B;  4LER A;  3R2P A;  3ZQV A;  1QLE C;  3B9Q A;  5COM A;  4C7O B;  4FX5 A;  5D91 A;  5L3Q A;  3I5Q A;  4DVY P;  4E0I A;  1D0X A;  2Q3T A;  3F47 A;  1YLM A;  2EPN A;  3M79 A;  3WHN A;  2EIK C;  1T9K A;  2F22 A;  5F28 E;  2YLI A;  3PHF 2;  1ZW2 A;  3IQC A;  1DOW A;  3EFO B;  3MYF A;  1VYI A;  4HEA J;  5COG A;  4N6H A;  1TWA A;  3DE9 A;  4P6I C;  1GQA A;  3TUL A;  2I15 A;  1TR2 A;  1PD0 A;  3Q7G A;  1CPR A;  4JEA A;  2G62 A;  1ZU5 A;  2RSE B;  2X51 A;  2W45 A;  1M2V A;  2XL8 A;  5JT4 A;  4OD4 A;  3SZR A;  3J06 A;  1NFN A;  4HFK B;  4G7Z F;  2D5R B;  2HJM A;  3KYI A;  1WAT A;  1Z5Z A;  2Y3G A;  3IEE A;  3LS0 A;  1OW6 A;  4DRI B;  2HKV A;  4AL0 A;  1LS4 A;  2A1D D;  3FAP B;  2XSE A;  2UUH A;  5K0I A;  3DXJ F;  1O87 A;  2CNW A;  1DOV A;  2KSF A;  1I4Y A;  4FAP B;  2ZPA A;  3NDB B;  1ZU4 A;  5CIV A;  3C63 A;  4CS8 A;  1V54 C;  3HJC A;  2KJG A;  2C04 A;  5KYX B;  4BJ1 A;  3VAY A;  3RYL A;  4JCZ A;  1T6Q A;  5A6J A;  2H7V C;  3S90 A;  2YHS A;  3DAF A;  1UG7 A;  3NKE A;  3B0P A;  1J8Y F;  3N0T A;  1ZHY A;  1C02 A;  5FCL A;  2PBE A;  1YDI A;  2VCB A;  1KNY A;  1YZC A;  2VCA A;  4BEM J;  1K05 A;  2V3C C;  1M56 C;  4U9E A;  4NTF A;  4Z9J A;  1ZHX A;  1A7V A;  1WTY A;  2PX0 A;  4Q7C A;  3RH3 A;  2WZL A;  4NC3 A;  5BQG A;  4QDL A;  1LI7 A;  2YLD A;  1Z3I X;  1ZHZ A;  4LDQ A;  5A6B D;  4W8K A;  4BG0 A;  4AE4 B;  3NG1 A;  2B0J A;  1E83 A;  4PFO A;  1FTS A;  4E7S A;  1LVK A;  3QW0 A;  4OIP F;  2HV6 A;  3M4B A;  3FVY A;  4IB4 A;  4DJ9 A;  3V7O A;  3MX3 A;  1BR4 A;  3ZVR A;  4YK5 A;  2R03 A;  2J8W A;  3FHD A;  3DMD A;  3EPV A;  4O7G A;  1C17 M;  3W8I A;  1EA8 A;  2EIM C;  3LEV A;  2DB4 A;  2QTV A;  2WVQ A;  4JEB A;  4JTD B;  3QW1 A;  3OA1 A;  3US6 A;  2VCC A;  4RDA A;  4RD9 A;  1XWJ A;  1IW7 F;  1E84 A;  1BR1 A;  3IPM O;  2LK4 A;  3RVY A;  3SXZ A;  5DS5 A;  1H9T A;  2L6G A;  3GM3 A;  1NFO A;  3EZH A;  3ZQY A;  1OXB A;  2P6V A;  2J9U A;  4CDA A;  1RXQ A;  1YAU O;  3EH2 A;  2X0C A;  3KPH A;  3RQF A;  2KQ9 A;  4N4W A;  5KYU A;  4DRH B;  3DJU B;  2OEV A;  2HMZ A;  3K33 A;  3OEO A;  3WAQ A;  5BQH A;  2OKU A;  5DVW A;  4LDR A;  1FMV A;  3EG9 A;  2P7V A;  1CGO A;  4O79 A;  2BE5 F;  3ECS A;  2A0B A;  4G78 A;  1SF8 A;  1NBB A;  2KW3 C;  2D4U A;  3C62 A;  3S29 A;  3HNL A;  1OCR C;  3DJN B;  4G7H F;  1G5Z A;  1F1M A;  2MHR A;  2Y69 C;  1T01 A;  4CS7 A;  3OWT A;  2AU5 A;  3CQZ A;  1ZHW A;  1ZVZ A;  4K7B A;  4LDK A;  1RKE B;  3UMH A;  4CJG A;  2FAP B;  3X2Q C;  3AG3 C;  4YWQ A;  3CEX A;  4DBR A;  1QSP A;  5B3I A;  2G3K A;  3AQC A;  1HE9 A;  4NCQ A;  3JTL O;  2CNW D;  3L8I A;  3DWW A;  3AG1 C;  3B71 A;  4L6R A;  4XPY A;  2R7Q A;  2YKZ A;  2ETS A;  4MVZ A;  3DM9 B;  2J9W A;  1EQ1 A;  3NMJ A;  3FDQ A;  3IHU A;  1T5O A;  2EIL C;  1MQV A;  3U9M A;  1WGW A;  5KYW A;  2BL2 A;  2J9V A;  2KGO A;  3W8H A;  4Q5S F;  4ANJ A;  3IQ5 A;  3SNH A;  3EH1 A;  1TKN A;  2OU6 A;  3E70 C;  2CW0 F;  4BJ5 C;  3TK0 A;  2R7S A;  4JW1 A;  3B0V C;  3NRH A;  2IYL D;  1SR2 A;  2IXN A;  4J32 B;  4IGG A;  1JMW A;  5FZT A;  1YAR O;  4JJF A;  5BQI A;  3C8G A;  3EGD A;  1RCP A;  4JE9 A;  4BJ5 A;  2LP4 A;  1BDJ B;  4IWB A;  5AC4 A;  3W4Y A;  3LJB A;  2KC3 A;  2P1A A;  1YA7 O;  3UGO A;  2HS5 A;  2YZS A;  4E17 A;  4XEV A;  1D0Z A;  4XEF A;  3JRM O;  1HMD A;  1SZI A;  2W9Y A;  2XLH A;  4MTF A;  3S28 A;  4J7Y A;  2AVK A;  3EQL F;  1L7C A;  3M1C B;  5E3A A;  4PAC A;  3FXH A;  3H65 A;  3LEO A;  3U3F A;  5L0I A;  3WOD F;  3GWL A;  3G50 A;  4AK9 A;  4C7O A;  3L8J A;  4YL1 A;  4JCH A;  3FOO A;  2XLV A;  2VB6 A;  3MFN A;  3EHM A;  3FAJ A;  3GEH A;  3K6B A;  4AL1 A;  2XLD A;  3AGT A;  2EPL X;  3EFO A;  5EK0 A;  3X1O A;  4EUK B;  4YN0 B;  4MVO A;  4FES A;  4EBJ A;  4MQ9 F;  2HZ8 A;  4MVQ A;  4C3B A;  1Q0F A;  4PR9 A;  1Y4C A;  1M6T A;  4XTK A;  4MVM A;  3ATP A;  1GGQ A;  4OD5 A;  4N6C A;  4D4X A;  3C8Z A;  2OCC C;  1SMY F;  1V4A A;  2O9X A;  1A7D A;  3JT1 A;  1HMO A;  5DLJ A;  1VB5 A;  1ST6 A;  4PJN A;  1A7E A;  1N1C A;  4EWC A;  1OKK A;  4YL0 A;  2J0W A;  3GM1 A;  4U9D A;  1CPQ A;  2J45 A;  1YYJ A;  3L1M A;  4H4K C;  1E86 A;  1HW1 A;  1ORS C;  2WVN A;  2XLM A;  2Z15 A;  1H6G A;  3BEH A;  1TWH A;  2IM8 A;  4NY3 A;  5T3W A;  5JLI A;  1QQ3 A;  2IXM A;  2UUI A;  4MW8 A;  2Q9A A;  4MW3 A;  2ICW G;  3JSE O;  2A69 F;  3U9J A;  2NG1 A;  3W2W A;  3KH2 A;  4AX2 A;  4YL3 A;  3T6G B;  1HY5 A;  4GQH A;  4PFP A;  5JVE A;  3HKK A;  3DKA A;  5KYX A;  2YLG A;  3GAN A;  2L6H A;  2R7O A;  3HLZ A;  2BC5 A;  3M15 A;  2Y3H A;  4NQF A;  4O6M A;  4RBN A;  4BJ6 C;  2WB7 A;  3JCU Q;  2EPK X;  3S27 A;  3U8P A;  4XPW A;  1JPJ A;  1LI5 A;  1EKY A;  2P61 A;  3ZSU A;  1NG1 A;  3T9O A;  1LIH A;  4CX9 A;  2MWQ A;  1D1A A;  4F4B A;  2YRF A;  2P0N A;  3AQB A;  2NPU A;  2H8A A;  2Y39 A;  4BJ6 A;  1O5H A;  2XLW A;  3GWN A;  3KKB A;  1ZZP A;  3IQT A;  4EBB A;  5DS4 A;  4IAR A;  4G7O F;  1RMV A;  2Q9C A;  2VAS A;  2HMQ A;  3LUT B;  4BPM A;  4YT2 A;  4MTO A;  4ULW A;  1MMN A;  4IJJ A;  3U8V A;  2XXA B;  1ORJ A;  2A68 F;  3F46 A;  3Q7L A;  4O6N A;  3UMK A;  2XL4 A;  1YYX A;  2CDQ A;  2XLE A;  4AE4 A;  5L0J A;  4MTG A;  3GM2 A;  2R7T A;  1FFT C;  2EIN C;  2QNL A;  1T6U A;  2QY9 A;  1ZYR F;  3WG7 C;  3U5S A;  4R32 A;  3RF3 A;  2AP3 A;  4IAQ A;  2H7B A;  3RW0 A;  1BZ4 A;  3QMK A;  4A2N B;  1LPE A;  1YVI A;  3FOP A;  3ZIB A;  1FAP B;  3LES A;  2FGY A;  3NYJ A;  2VC9 A;  1LM3 B;  4K1O A;  3C8G D;  2GFH A;  4WGZ A;  3V5X A;  3KYJ A;  1LE4 A;  1OCO C;  3O55 A;  1CGN A;  1QPU A;  1AUE A;  5KYY B;  2XM4 A;  1V55 C;  2IXO A;  3TJ5 A;  4A4A A;  3ITF A;  2G3V A;  1WAS A;  3GEI A;  3K66 A;  4MVU A;  4WAB A;  2AWY A;  256B A;  4WGY A;  3H2U A;  2YQY A;  2CGE A;  4YT4 A;  4DBQ A;  3S84 A;  4JJG A;  3SXY A;  2E87 A;  2GWW A;  1G4U S;  3TOL A;  1W2W A;  1MNE A;  3VRC A;  2WL8 A; 
#chains in the Genus database with same CATH homology
 4DOZ A;  5EGY A;  3UMI A;  2ZXR A;  3POV A;  1VOM A;  3EHN A;  1LS1 A;  5IY5 C;  4I44 A;  1J8M F;  2DGJ A;  4YT8 A;  4CS8 C;  3VYW A;  1OCC C;  3CZ6 A;  1Z63 A;  2OG2 A;  4QI2 A;  4C3D A;  4JZA A;  3DD7 A;  1TWC A;  3ZSU A;  4CS8 A;  3I4U A;  2WZF A;  3EGX B;  1OKK D;  2PP4 A;  3NKD A;  4OIR F;  3KL4 A;  4K0D A;  2NUT B;  5T3T A;  3T6B A;  4Q4Z F;  4J30 B;  3ASO C;  1M2O A;  4I3M A;  5CI9 A;  4B6I A;  2KNH A;  2Q9B A;  2J7P A;  3E9V A;  1Z23 A;  4CBE A;  3Q6M A;  3UR3 C;  5BUO A;  4CIH A;  2WZG A;  5F5H A;  3ASN C;  5E33 A;  4ZLD A;  3JSZ A;  1PCX A;  4U5E E;  4IAO A;  3N24 A;  1RJ9 B;  4KNV A;  1S7Z A;  2ZXP A;  4PJM A;  4U5B E;  2DYS C;  4PK4 A;  5B1A C;  2I8B A;  4I1M A;  4LLE A;  1JPN A;  4FWV A;  5E3C A;  2Y3B A;  4GYT A;  4MND A;  5KYN A;  3NYM A;  2FFH A;  3UNG C;  4G0H A;  3RFY A;  4ZLC A;  3L34 A;  1M2V B;  3B0U X;  2R7W A;  2ZXO A;  3EZI A;  3LLK A;  2J46 A;  4PJJ A;  3ZC4 A;  4JVS A;  2R7R A;  5B1B C;  4KC9 A;  4WJ0 A;  5B3S C;  4BJT A;  3DM5 A;  1NZE A;  1MND A;  3W2V A;  4U5F E;  3S0X A;  1LKX A;  3O6X A;  3LLI A;  4U5H A;  3MLG A;  1NU9 C;  4KNW A;  2PFD A;  2Y3D A;  3SYN A;  3L0I A;  4BEJ A;  4CSA C;  4C3E A;  2LSE A;  3QZC A;  1VMA A;  1KU2 A;  1M57 C;  3T4R A;  2NUP B;  2PX3 A;  3PMR A;  3AG2 C;  1D1B A;  2VH3 A;  1D1C A;  4X0R A;  3ABL C;  2NUP A;  2J7P D;  4KI2 A;  4U5C E;  2R7V A;  4QI0 A;  1TWG A;  4OIQ F;  2XXA A;  2W4M A;  1MMD A;  1FMW A;  1FFH A;  5E2Q A;  5EHH A;  4LLC A;  3PHF 2;  3EJN A;  4E7Z A;  2YEV A;  5DS6 A;  2W4B A;  2PF4 E;  1IZM A;  3DAG A;  2A6H F;  3K7D A;  4N06 A;  4YT5 A;  2A6E F;  1NU7 D;  3I5P A;  3LNR A;  2L9J A;  4O6Y A;  5T1D B;  5KYU B;  2IOQ A;  3JYH A;  3AG4 C;  3NYL A;  1MMA A;  1D0Y A;  4KBL A;  4YJW A;  3Q6N A;  3TD7 A;  5F5F A;  1VK5 A;  3EG9 B;  2JD3 A;  4M63 A;  5KYY A;  2R7U A;  1PD1 A;  5HSW A;  4HE8 D;  2V26 A;  5DQT A;  4PJL A;  1G8X A;  1VYK A;  4CS9 C;  2HV7 A;  3ABM C;  2J0X A;  1OCZ C;  4XWJ A;  4XLN F;  3ZG1 A;  3N2Z B;  1QZX A;  3T6J A;  5DQZ A;  4CS9 A;  3ABK C;  3LS1 A;  2L81 A;  5L3V A;  4DVZ A;  2M4E A;  4U5G A;  5KYW B;  2R7X A;  3HTK C;  2IXP A;  1BR2 A;  2C03 A;  2H7O A;  3EGX A;  4I1O B;  4GEH A;  2NUT A;  3UGP A;  4U5D E;  3K1I C;  4OIN F;  3RKO F;  3RIP A;  4IRU A;  2DYR C;  2EIJ C;  2WVO A;  1Z6A A;  3EGD B;  3JRT A;  4OIO F;  1MMG A;  4JUR I;  1ZHT A;  4XLP F;  2MYS A;  2XRH A;  3DZA A;  3LAY A;  3O39 A;  4LAC B;  3SP1 A;  2ZXW C;  3GOD A;  5D92 A;  3K1H A;  3SEO A;  5CI8 A;  1RJ9 A;  3CSK A;  3KMI A;  4HFF B;  4LER A;  1QLE C;  3B9Q A;  4C7O B;  4FX5 A;  5D91 A;  5L3Q A;  3I5Q A;  4DVY P;  1D0X A;  2Q3T A;  3F47 A;  2EIK C;  3EFO B;  4HEA J;  1VYI A;  1TWA A;  4P6I C;  1TR2 A;  1PD0 A;  3Q7G A;  2G62 A;  1ZU5 A;  2X51 A;  2W45 A;  1M2V A;  4OD4 A;  3SZR A;  4G7Z F;  4HFK B;  2D5R B;  1Z5Z A;  2Y3G A;  3IEE A;  3LS0 A;  2A1D D;  2XSE A;  3DXJ F;  1O87 A;  2CNW A;  2ZPA A;  3NDB B;  1ZU4 A;  1V54 C;  3HJC A;  2KJG A;  2C04 A;  5KYX B;  4BJ1 A;  3VAY A;  3RYL A;  2H7V C;  2YHS A;  3DAF A;  3NKE A;  3B0P A;  1J8Y F;  3N0T A;  1ZHY A;  5FCL A;  4CSA A;  2V3C C;  1M56 C;  1ZHX A;  4Q7C A;  2PX0 A;  3RH3 A;  2WZL A;  4QDL A;  1Z3I X;  1ZHZ A;  4W8K A;  4BG0 A;  4AE4 B;  3NG1 A;  2B0J A;  4PFO A;  1FTS A;  4E7S A;  1LVK A;  4OIP F;  2HV6 A;  3FVY A;  3V7O A;  3MX3 A;  1BR4 A;  3ZVR A;  3W8I A;  3FHD A;  3DMD A;  3EPV A;  4O7G A;  2EIM C;  3LEV A;  2QTV A;  2WVQ A;  3OA1 A;  4RD9 A;  4RDA A;  1IW7 F;  1BR1 A;  5DS5 A;  3EZH A;  2P6V A;  2J9U A;  3EH2 A;  2KQ9 A;  5KYU A;  3DJU B;  3K33 A;  3OEO A;  5DVW A;  1FMV A;  3EG9 A;  2P7V A;  4O79 A;  2BE5 F;  3ECS A;  1SF8 A;  2KW3 C;  3S29 A;  1OCR C;  3DJN B;  4G7H F;  2Y69 C;  4CS7 A;  3OWT A;  3CQZ A;  1ZHW A;  4K7B A;  3UMH A;  3X2Q C;  3AG3 C;  4YWQ A;  4DBR A;  2G3K A;  3AQC A;  2CNW D;  3AG1 C;  2R7Q A;  3DM9 B;  2J9W A;  3FDQ A;  2EIL C;  1WGW A;  5KYW A;  2KGO A;  2J9V A;  3W8H A;  4Q5S F;  4ANJ A;  3SNH A;  3EH1 A;  1TKN A;  3E70 C;  2CW0 F;  4BJ5 C;  2R7S A;  4JW1 A;  3B0V C;  3NRH A;  2IYL D;  2IXN A;  4J32 B;  4JJF A;  4BJ5 A;  3EGD A;  4IWB A;  3LJB A;  3UGO A;  2YZS A;  1D0Z A;  3S28 A;  1SZI A;  2W9Y A;  3EQL F;  3M1C B;  5E3A A;  3H65 A;  3WOD F;  4AK9 A;  4C7O A;  4JCH A;  2VB6 A;  3EHM A;  3FAJ A;  3K6B A;  3EFO A;  3X1O A;  4YN0 B;  4FES A;  4MQ9 F;  4C3B A;  4XTK A;  4OD5 A;  2OCC C;  1SMY F;  2O9X A;  3JT1 A;  5DLJ A;  1ST6 A;  4PJN A;  1N1C A;  4EWC A;  1OKK A;  2J0W A;  2J45 A;  4H4K C;  2WVN A;  2Z15 A;  4NY3 A;  1TWH A;  5T3W A;  2IXM A;  2Q9A A;  2A69 F;  2NG1 A;  3W2W A;  3KH2 A;  4AX2 A;  4PFP A;  5KYX A;  3GAN A;  3HLZ A;  2R7O A;  4O6M A;  4RBN A;  2Y3H A;  4BJ6 C;  2WB7 A;  3JCU Q;  3S27 A;  1JPJ A;  1NG1 A;  2MWQ A;  1D1A A;  4F4B A;  3AQB A;  2Y39 A;  4BJ6 A;  1O5H A;  3KKB A;  4EBB A;  5DS4 A;  4G7O F;  2Q9C A;  2VAS A;  4YT2 A;  4ULW A;  1MMN A;  4IJJ A;  2XXA B;  2A68 F;  3F46 A;  3Q7L A;  4O6N A;  3UMK A;  2XL4 A;  2CDQ A;  4AE4 A;  2R7T A;  1FFT C;  2EIN C;  2QY9 A;  1ZYR F;  3WG7 C;  2H7B A;  3QMK A;  4A2N B;  3ZIB A;  3LES A;  2FGY A;  3NYJ A;  2GFH A;  1OCO C;  5KYY B;  1V55 C;  2IXO A;  3ITF A;  2G3V A;  3K66 A;  2CGE A;  4YT4 A;  4DBQ A;  4JJG A;  2E87 A;  1W2W A;  1MNE A;  2WL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...