3W8HA

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of stk25
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
197
structure length
190
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 79
structure length 190
sequence length 197
ec nomenclature
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3w8hA00
4GEHA 3W8IA 3W8HA
chains in the Genus database with same CATH superfamily
4LLEA 4E0IA 2Y3GA 2HJ3A 1WATA 3KH2A 2MYSA 1EKYA 2XLHA 1LE4A 3FAJA 4ER9A 2ETSA 3C62A 5DS4A 2P0NA 3B71A 3WODF 1Q0DA 1J8YF 1NSGB 2QY9A 3C63A 3WAQA 4AX2A 1TWCA 4ULVA 1U89A 3EFOA 5JUAA 4E7SA 4EBBA 2O9XA 2H7BA 2PP4A 2ZXWC 3LNRA 3I5PA 1Z7Qc 1VOMA 2HFIA 4MNDA 1MQVA 1T6QA 3KL4A 4XWJA 2A6EF 4GEHA 2P7VA 1M57C 1JRAA 1F1MA 1CGOA 1H6GA 1MNDA 5DS5A 2XSEA 5BQHA 1I4YA 5DQZA 1M2OA 4CS9C 1OW7A 4DBQA 1RKEB 2VASA 2I8BA 1DOWA 1GS9A 5L0FA 2IOQA 4PJJA 3HKKA 3UMHA 4IGGA 1YZCA 1NBBA 2RD9A 3EGDA 2XS8A 4CIHA 2EIJC 2L6FA 1PD1A 3NRHA 2KC3A 3BEHA 3NMJA 4O6YA 3PDMP 5A6BD 5D91A 4CDYA 1OR3A 1WWPA 2WZLA 4JC7A 4IRUA 3EHMA 4BJTA 1ZYRF 2KW3C 3U5SA 3RW0A 2X51A 4YT4A 2QTVA 3M1CB 3O39A 4EBKA 3H2VA 4PR9A 4MTFA 4ANJA 4JURI 3QW0A 4YT5A 3MLGA 3DE8A 1WGWA 1DOVA 2VC9A 2XL6A 3EH1A 4P9FA 4WGYA 2DI3A 4PJMA 3T9OA 3U2MA 3HNJA 4E18A 3E9VA 3AJMA 3L34A 3ABLC 4JE9A 1OCCC 2YVKA 3DD7A 2WVNA 4JJGA 2OKUA 3EQLF 5AC5A 3RVZA 4FAPB 1Z3IX 256BA 5FCLA 3ITFA 4JKVA 2XXAB 1TR2A 4PJLA 4EBJA 2YLDA 4JVSA 2G3KA 2GAQA 3ASNC 1FNTc 1HY5A 2KYHA 4F4BA 3RQGA 2IBFA 3LESA 1NU7D 1T01A 5EHHA 1YLMA 3E70C 4N6HA 3T6JA 1FMVA 1NZEA 2AWCA 1BDJB 2NUPB 4C7OB 1A0BA 1T5OA 2CNWA 2Q7RA 2FAPB 2GDCA 3MX3A 1RJ9B 4C3BA 2YL1A 2V26A 3SYNA 2HMZA 3NYMA 1RKCA 2TMVP 1GGQA 4G7ZF 2BE5F 3K33A 4KBLA 3X1OA 4I1OB 1G4US 2EPLX 2YKZA 4ZLCA 2B0JA 2M64A 3EHNA 4G7OF 1EI7A 4ZLDA 3ATPA 5KYWB 1FAPB 1OR2A 3KKBA 2WZFA 2R7UA 3TJ6A 2L7AA 3EZIA 3AG1C 3VYWA 3KYJA 2V3CC 2C04A 2LIGA 4OIQF 3IHUA 4HEAJ 3HNIA 4NTBA 1YYXA 2J7PD 3EFOB 4PK4A 3M4CA 4WABA 4CS9A 1LI5A 2R05A 2KGOA 3VRCA 2XLMA 4HFKB 3ASOC 2XM4A 4NCQA 5DLJA 1IW7F 2JD3A 2Q00A 1ZU5A 3X2QC 2HMQA 1QZXA 1LKXA 4OIOF 2IXPA 3K1HA 4J32B 3F46A 4CJGA 1M56C 4DBRA 3W8IA 1D1BA 1E2XA 3RYLA 4G78A 3US6A 4O7GA 1D0YA 4LDKA 3JZ0A 2CDQA 4U5GA 1OCZC 2IXNA 5AGFA 3G50A 5KYUB 2R7XA 1CPRA 2RSEB 3M79A 3DI5A 3AG2C 3RF3A 1E83A 4OIPF 3DWWA 1QSPA 1YZAA 3U9MA 1SMYF 2BL2A 5E3AA 1K04A 3GEHA 3QMKA 1TWAA 3SXZA 1OW6A 3ABKC 3OA1A 4XPYA 4C7OA 3K7DA 2NUPA 4IARA 3MBGA 3U2LA 5AC4A 4DRIB 3DM5A 1JAFA 3HLZA 2VCAA 3RH3A 3Q6NA 3W4YA 4CBEA 2HV6A 4J7YA 1V4AA 1H7IA 2R25A 4A4AA 3LEOA 3S9OA 3U3FA 3EPVA 4NTAA 3IPMO 5KYNA 1LVKA 1MMGA 3U3BA 5F5FA 3B29A 2LFDA 3MYIA 5A69A 4H54A 4MVMA 1OW8A 1KNYA 2YL7A 2OQMA 4R32A 4DRHB 2R7SA 1NFOA 3AQCA 1EQ1A 3SXMA 3L1MA 3RQFA 2IXMA 1K05A 2BC5A 4FX5A 2XLEA 5HV9A 1V54C 4KNWA 2R7OA 5HSWA 1NLXA 1S05A 5BQGA 3POVA 2Q3TA 1CPQA 2J9WA 4CS8C 3ZC4A 3TD7A 2EIMC 4NY3A 2J8WA 1HW2A 5B1AC 4M63A 3NMKA 2EINC 3TOLA 2D5RB 2I15A 4AK9A 2HS5A 5KYXA 5IY5C 2F22A 1M2VB 1V74B 3ZSUA 2LQGA 4U9DA 4XPXA 2P1AA 3FDQA 3NMIA 1RMVA 2EPMX 4O6NA 3C18A 1ZHTA 3JYYA 1AUEA 3QVZA 5L3QA 1APCA 3LS0A 3LAYA 3L8JA 1D1AA 1MMDA 3GM1A 5B3IA 3R2PA 5JT4A 3NDBB 2ZXOA 4HE8D 2A0BA 2AU5A 3EH2A 1CGNA 2KSFA 1TFOB 4CIPA 5FZTA 4Z9HA 1BBHA 2R02A 4MVQA 5KYUA 3TULA 4Z9JA 1SR2A 2ASRA 2YRFA 3UNGC 3PHF2 3K66A 2OJQA 3NG1A 1ORYA 4MVRA 3CQZA 4U5BE 1C03A 3C8GB 4C3EA 3ABMC 4XLPF 4JTAB 2QUPA 4RDAA 1YA9A 3LLIA 2DGJA 3TJ5A 5KYYA 3DE9A 1H9GA 2P6VA 1BR4A 3FXHA 2YEVA 3ZTMA 2M4EA 2WVQA 4MVZA 5BQIA 4U5DE 3B9QA 2GA0A 5EGYA 5DVWA 1Q0KA 1AVOB 2CNWD 3FHDA 3W8HA 2KJGA 2L9JA 1ORSC 3DAFA 4YK5A 5T3TA 2W9YA 3CZ6A 2Y69C 1G8XA 2ZPAA 3UR3C 3IQCA 1BZ4A 1WOLA 3M15A 4XTKA 4AL0A 1BR2A 2A6HF 4LACB 3ZQVA 4CX9A 2YL3A 3A9CA 3A11A 3QTHA 5JSLA 3GM3A 3U8VA 2VB6A 1LIHA 1FTSA 2A68F 3M4BA 1JOGA 3LNMB 2J0WA 3OEOA 5L0JA 4DRJB 2Q9AA 2QNLA 1SYQA 4D4XA 5B3SC 2Y39A 4N6CA 2A1DD 2CYDA 2P61A 3G4ZA 3TQOA 5JRAA 1A41A 2UUHA 3UMKA 1I5NA 1O3UA 4Q4ZF 1M2VA 1LM3B 1Y4CA 2VCCA 5L0CA 3AGUA 2LCHA 4N4WA 5K0IA 1OCRC 2YWAA 4G7HF 3RVYA 1V55C 2Q4FA 1H9TA 2R03A 4JEAA 3MFNA 1PCXA 1N1CA 4J7TA 4BJ5A 5DQTA 2PX3A 4MTOA 4N06A 2PFDA 4IAOA 3S28A 1ZZPA 4CS8A 4Q5SF 5COFA 3FOPA 3AG4C 3LLKA 4YL0A 3T4RA 1ZU4A 4RBNA 4W8PA 4JEBA 2OEXA 2EILC 1E84A 1T6IA 3QVYA 1HMOA 1PV3A 1TFKB 3GM2A 4J30B 3O10A 4I44A 4JW1A 1D1CA 2DB4A 3C8GA 4LDRA 2LFFA 5GPGB 3ZQYA 3C7JA 3S84A 3K1IA 4P6IC 3T6BA 4OD5A 2EPKX 4O79A 1JMWA 4WGZA 1ZHXA 4A2NB 4K7BA 2A69F 2CCYA 1VB5A 2LK4A 3U8PA 4YJWA 2XXAA 5JLIA 5A6AA 3PMRA 3RKOF 1HE9A 2DYSC 3F47A 1VYIA 4XPWA 1XZQA 5KYXB 5E2QA 1RCPA 2B0HA 3NKEA 1QPUA 1RXQA 2IYLD 3ZDLA 4CJOA 3RFYA 1EA8A 3ZWIA 4DXWA 4YT2A 2MWQA 2HZ8A 1K40A 4BJ6A 5L0IA 1Z6AA 3JYHA 1QLEC 3LUTB 3AOUA 3ECSA 1C02A 1GQAA 2DYRC 3JTLO 4DVZA 1TKNA 3HTKC 3IQTA 5T3WA 3TOMA 3UMIA 1LS1A 1VYKA 4PFOA 1OQCA 4XLNF 4IJJA 3V5XA 4JTDB 4BPMA 4CSAA 4K0DA 2J45A 5KYYB 2WZGA 2MHRA 5A6KA 1JPJA 4EKWA 4CDVA 3PCVA 1YA7O 4O6MA 2CW0F 4XEKA 2YLIA 2AP3A 3JSZA 2XM0A 3KPHA 2J9UA 3U9JA 2J0XA 4KI2A 1D0XA 3ZVRA 3KMIA 3LJBA 4NC3A 1R5ID 1NU9C 4XEVA 1A7VA 4U5FE 1OXKA 5E33A 2OJED 3AQBA 1XZPA 4L6RA 1JR8A 3JRMO 2G62A 3K6BA 1MMNA 3GANA 2HKVA 4OINF 4YWQA 2PNOA 1Q0GA 3UGOA 4UDVA 1L7CA 2NUTA 3V5ZA 5L0DA 4XEFA 4E17A 1YDIA 1ZW3A 3B0VC 1QVXA 1OKKA 3IEEA 3W2VA 3I4UA 3ZTZA 3R7CA 4BJ5C 2VH3A 3AG3C 3FAPB 1W2WA 3S29A 1D0ZA 4BEMJ 4CDAA 1NFNA 3B0UX 4E7ZA 2FFHA 2J9BA 4Q7CA 1A7EA 2GFHA 3DJUB 4ULWA 1HW1A 1BR1A 2W4BA 2H8AA 4JCHA 2XLWA 2YLGA 4W8KA 1FFTC 4IWBA 5CI8A 1ZHWA 1NG1A 3NYLA 2C03A 3DZAA 3JSEO 3L0IA 3FMSA 2OCCC 2J46A 3K1IC 3WHNA 1Z5ZA 1T6UA 5A6JA 2XL8A 3L8IA 3GWNA 1Q0MA 1TQGA 2A0UA 3HNLA 3QW1A 3O6XA 4Z9IA 3S27A 2ZD9A 1E85A 2YQYA 3UGPA 3WG7C 4I3MA 3ZIBA 3LEVA 2Y3HA 3VAYA 1UG7A 4MW3A 3SNHA 1E86A 1OXBA 1U0BB 1WN0A 4BJ6C 1S7ZA 2Z15A 1J8MF 4U5EE 3SEOA 2H7OA 2E87A 2IM8A 2XLDA 3GWLA 2HUJA 3U0CA 1AEPA 2QE9A 4H4KC 4E0HA 4MVSA 4HFFB 2XLVA 4QI2A 5COGA 3EGXA 3V7OA 2FGYA 3FOOA 4FWVA 1XWJA 4MQ9F 3I5QA 4CSAC 5EK0A 3B0PA 2XL4A 4GYTA 2AWYA 3ZG1A 2R7WA 2WVOA 4BEJA 2NSFA 2XRHA 3J06A 4DVYP 1JPNA 1PD0A 4QI0A 5KYWA 1QKRA 4KC9A 3SXYA 1VLTA 1YYJA 3GODA 4P9TA 2XLOA 3HNKA 2OEVA 1A7DA 1QQ3A 5F5HA 1LE2A 3H65A 3QZCA 3C8GD 2JX0A 1IZMA 4NQFA 1TWGA 1ZVZA 4JIOA 4XQ1A 3LS1A 1CGME 2HV7A 4LERA 2HJMA 2LP4A 4YT8A 4PJNA 4JJFA 2QLAA 3DJNB 3EG9B 5DS6A 5CI9A 1Z23A 4EHPA 4G0HA 4YL1A 1G4WR 1U6HA 3DXJF 3GEIA 4I1MA 2GWWA 2EIKC 2KNHA 1M6TA 2R7TA 4BJ1A 3Q7LA 1LS4A 1VK5A 3T6GB 4CS7A 2LSEA 4GQHA 3EJNA 3MYFA 4ONSA 1VMAA 5COMA 5F28E 3BRJA 2NSGA 3V5YA 2D4UA 1ZHZA 2X0CA 1T9KA 5A6BA 4AE4B 1FFHA 3S0XA 2NUTB 2L81A 2Y3DA 2XS1A 4U5CE 3H2UA 3CSKA 4BG0A 4C3DA 4NTFA 3S90A 4OD4A 1UFBA 4JTCB 4EUKB 5L0GA 4PFPA 3Q7GA 2PBEA 4EWCA 3CEXA 1OCOC 5T1DB 5E3CA 3RIPA 2Y3BA 1MNEA 3GORA 4YN0B 4DOZA 3KYIA 3NYJA 3VM6A 2R7VA 1G5ZA 2OOCA 3VF0A 2KQ9A 1RKEA 3IQ6A 1YAUO 4DJ9A 2ZXRA 1Y6DA 1HE1A 3SXKA 1WASA 3EZHA 1GM5A 3JT1A 1VTMP 1YVIA 4PACA 5JS5A 3FVYA 3JRTA 2H7VC 2CGEA 5L3VA 4MTGA 4U9EA 5BUOA 1ST6A 3N0TA 1SZIA 2J9VA 2PX0A 1Q0FA 4IB4A 4LDQA 2OG2A 4MVUA 3N2ZB 4EIYA 2HSBA 2NG1A 4AL1A 3DMDA 5D92A 2R9RB 2YZSA 4K1OA 3W2WA 4MVOA 2HSQA 2Q9CA 3O55A 1OKKD 4OIRF 2W45A 4YL3A 1MMAA 1Z63A 4RD9A 1O5HA 3AGTA 2ICWG 4LLCA 5JP7A 1SF8A 3EG9A 3N24A 2LD6A 3DKAA 2KK1A 4U5HA 1WTYA 5TJ5E 4X0RA 3SZRA 2JPUA 3CAXA 3EGXB 3GEEA 3G4XA 1YJGA 2G3VA 2YHSA 2W4MA 2EPNA 1TWHA 4QDLA 3TK0A 2WL8A 1L3PA 2YL0A 4D4NA 2R7QA 5CIVA 1O87A 2VCBA 3C8ZA 3EGDB 4MW8A 2OU6A 4MS2A 2UUIA 4AE4A 4B6IA 1B68A 2IXOA 3Q6MA 1VLSA 1C17M 4IAQA 3SP1A 5JVEA 2J7PA 3JCUQ 1FMWA 1ZHYA 1ZW2A 4FESA 3RQEA 4JRZA 5B1BC 2EPOA 1FR0A 2ZXPA 3NKDA 1LPEA 3OWTA 2NPUA 1LI7A 3HJCA 2L6GA 2Q9BA 3DM9B 1HMDA 4JCZA 2L6HA 5L0HA 2AVKA 2R7RA 4JZAA 3DAGA 1RJ9A 2PF4E 1KU2A 1KTMA 1ORJA 1YARO 4KNVA 1I4ZA 4WJ0A 3IQ5A 2WB7A 1R4TA
chains in the Genus database with same CATH topology
4LLEA 2Y3GA 3KH2A 2MYSA 3FAJA 5DS4A 3WODF 1J8YF 4AX2A 2QY9A 1TWCA 3EFOA 4E7SA 4EBBA 2O9XA 2H7BA 2PP4A 2ZXWC 3LNRA 3I5PA 1VOMA 4MNDA 3KL4A 4XWJA 2A6EF 4GEHA 2P7VA 1M57C 5DS5A 1MNDA 2XSEA 5DQZA 1M2OA 4CS9C 4DBQA 2VASA 2I8BA 2IOQA 4PJJA 3UMHA 3EGDA 4CIHA 2EIJC 1PD1A 3NRHA 4O6YA 5D91A 2WZLA 4IRUA 3EHMA 4BJTA 1ZYRF 2KW3C 2X51A 4YT4A 2QTVA 3M1CB 3O39A 4ANJA 4JURI 4YT5A 3MLGA 3EH1A 1WGWA 4PJMA 3E9VA 3L34A 3ABLC 1OCCC 4JJGA 3DD7A 2WVNA 3EQLF 1Z3IX 5FCLA 3ITFA 2XXAB 1TR2A 4PJLA 4JVSA 2G3KA 3ASNC 4F4BA 3LESA 1NU7D 5EHHA 3E70C 3T6JA 1FMVA 1NZEA 4C7OB 2NUPB 2CNWA 3MX3A 1RJ9B 4C3BA 3SYNA 2V26A 3NYMA 4G7ZF 2BE5F 3K33A 4KBLA 3X1OA 4I1OB 4ZLCA 2B0JA 3EHNA 4G7OF 4ZLDA 3KKBA 2WZFA 2R7UA 3VYWA 3EZIA 3AG1C 2V3CC 2C04A 4OIQF 4HEAJ 2J7PD 3EFOB 4PK4A 4CS9A 2KGOA 4HFKB 3ASOC 5DLJA 1IW7F 2JD3A 1ZU5A 3X2QC 1QZXA 1LKXA 4OIOF 3K1HA 2IXPA 4J32B 3F46A 1M56C 4DBRA 3W8IA 1D1BA 3RYLA 4O7GA 1D0YA 2CDQA 4U5GA 1OCZC 2IXNA 5KYUB 2R7XA 3AG2C 4OIPF 1SMYF 5E3AA 3QMKA 1TWAA 3ABKC 3OA1A 4C7OA 3K7DA 2NUPA 3DM5A 3HLZA 3RH3A 3Q6NA 4CBEA 2HV6A 3EPVA 5KYNA 1MMGA 1LVKA 5F5FA 2R7SA 3AQCA 2IXMA 4FX5A 1V54C 4KNWA 2R7OA 5HSWA 3POVA 2Q3TA 2J9WA 4CS8C 3ZC4A 3TD7A 2EIMC 4NY3A 5B1AC 4M63A 2EINC 2D5RB 4AK9A 5KYXA 5IY5C 1M2VB 3ZSUA 3FDQA 2R7TA 4O6NA 1ZHTA 5L3QA 3LS0A 3LAYA 1D1AA 1MMDA 3NDBB 2ZXOA 4HE8D 3EH2A 5KYUA 3UNGC 3PHF2 3K66A 3NG1A 3CQZA 4U5BE 4XLPF 3ABMC 4RDAA 3LLIA 5KYYA 2DGJA 2P6VA 1BR4A 2YEVA 5EGYA 2M4EA 2WVQA 4U5DE 3B9QA 5DVWA 2CNWD 3FHDA 3W8HA 2KJGA 2L9JA 3DAFA 5T3TA 2W9YA 3CZ6A 2Y69C 1G8XA 2ZPAA 3UR3C 4XTKA 1BR2A 2A6HF 4LACB 2VB6A 1FTSA 2A68F 3OEOA 2J0WA 2Q9AA 5B3SC 2Y39A 2A1DD 3UMKA 4Q4ZF 1M2VA 1OCRC 4G7HF 1V55C 1PCXA 1N1CA 4BJ5A 5DQTA 2PX3A 4N06A 2PFDA 4IAOA 3S28A 4CS8A 4Q5SF 3AG4C 3LLKA 3T4RA 1ZU4A 4RBNA 2EILC 4J30B 4JW1A 4I44A 1D1CA 4P6IC 3T6BA 4OD5A 4O79A 1ZHXA 4A2NB 4K7BA 2A69F 4YJWA 3PMRA 3RKOF 2DYSC 3F47A 5KYXB 1VYIA 5E2QA 3NKEA 2IYLD 3RFYA 4YT2A 2MWQA 4BJ6A 1Z6AA 3JYHA 1QLEC 3ECSA 4DVZA 2DYRC 1TKNA 3HTKC 5T3WA 3UMIA 1LS1A 1VYKA 4PFOA 4XLNF 4IJJA 4CSAA 4K0DA 2J45A 5KYYB 2WZGA 1JPJA 4O6MA 2CW0F 3JSZA 2J9UA 4KI2A 2J0XA 1D0XA 3ZVRA 3KMIA 3LJBA 1NU9C 4U5FE 5E33A 3AQBA 4OINF 2G62A 3K6BA 1MMNA 3GANA 4YWQA 3UGOA 2NUTA 3B0VC 1OKKA 3IEEA 3W2VA 3I4UA 4BJ5C 4C3EA 2VH3A 3AG3C 3S29A 1W2WA 3B0UX 1D0ZA 4E7ZA 2FFHA 4Q7CA 3DJUB 2GFHA 4ULWA 1BR1A 2W4BA 4JCHA 4W8KA 1FFTC 4IWBA 5CI8A 1ZHWA 1NG1A 3NYLA 2C03A 3DZAA 3L0IA 2OCCC 2J46A 3K1IC 1Z5ZA 3S27A 3O6XA 3UGPA 3WG7C 4I3MA 3ZIBA 3LEVA 2Y3HA 3VAYA 3SNHA 4BJ6C 1S7ZA 2Z15A 1J8MF 4U5EE 3SEOA 2H7OA 2E87A 4H4KC 4HFFB 4QI2A 3EGXA 3V7OA 2FGYA 4FWVA 4MQ9F 3I5QA 4CSAC 3B0PA 2XL4A 4GYTA 3ZG1A 2R7WA 2WVOA 4BEJA 2XRHA 4DVYP 1JPNA 1PD0A 4QI0A 5KYWA 4KC9A 3GODA 5F5HA 3H65A 3QZCA 1IZMA 1TWGA 3LS1A 2HV7A 4LERA 4YT8A 4PJNA 4JJFA 3DJNB 3EG9B 5DS6A 5CI9A 1Z23A 4G0HA 3DXJF 4I1MA 2EIKC 2KNHA 4BJ1A 3Q7LA 1VK5A 4CS7A 2LSEA 3EJNA 1VMAA 1ZHZA 4AE4B 1FFHA 3S0XA 2NUTB 2L81A 2Y3DA 4U5CE 3CSKA 4BG0A 4C3DA 4OD4A 4PFPA 3Q7GA 4EWCA 1OCOC 5T1DB 5E3CA 3RIPA 2Y3BA 1MNEA 4YN0B 4DOZA 3NYJA 2R7VA 2KQ9A 2ZXRA 3EZHA 3JT1A 3FVYA 3JRTA 2H7VC 2CGEA 5L3VA 5BUOA 1ST6A 3N0TA 1SZIA 2J9VA 2PX0A 2OG2A 3N2ZB 2NG1A 3DMDA 5D92A 2YZSA 3W2WA 2Q9CA 1OKKD 4OIRF 2W45A 1MMAA 1Z63A 4RD9A 1O5HA 4LLCA 1SF8A 3EG9A 3N24A 4U5HA 4X0RA 3SZRA 3EGXB 2G3VA 2YHSA 2W4MA 1TWHA 4QDLA 2WL8A 2R7QA 1O87A 3EGDB 4B6IA 4AE4A 5KYWB 2XXAA 2IXOA 3Q6MA 3SP1A 2J7PA 3JCUQ 1FMWA 1ZHYA 4FESA 5B1BC 2ZXPA 3NKDA 3OWTA 3HJCA 2Q9BA 3DM9B 2R7RA 4JZAA 3DAGA 1RJ9A 2PF4E 1KU2A 4KNVA 4WJ0A 2WB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GEH A;  3W8I A;  3W8H A; 
#chains in the Genus database with same CATH topology
 4LLE A;  4E0I A;  2Y3G A;  2HJ3 A;  1WAT A;  3KH2 A;  2MYS A;  1EKY A;  2XLH A;  1LE4 A;  3FAJ A;  4ER9 A;  2ETS A;  3C62 A;  5DS4 A;  2P0N A;  3B71 A;  3WOD F;  1Q0D A;  1J8Y F;  1NSG B;  2QY9 A;  3C63 A;  3WAQ A;  4AX2 A;  1TWC A;  4ULV A;  1U89 A;  3EFO A;  5JUA A;  4E7S A;  4EBB A;  2O9X A;  2H7B A;  2PP4 A;  2ZXW C;  3LNR A;  3I5P A;  1Z7Q c;  1VOM A;  2HFI A;  4MND A;  1MQV A;  1T6Q A;  3KL4 A;  4XWJ A;  2A6E F;  4GEH A;  2P7V A;  1M57 C;  1JRA A;  1F1M A;  1CGO A;  1H6G A;  1MND A;  5DS5 A;  2XSE A;  5BQH A;  1I4Y A;  5DQZ A;  1M2O A;  4CS9 C;  1OW7 A;  4DBQ A;  1RKE B;  2VAS A;  2I8B A;  1DOW A;  1GS9 A;  5L0F A;  2IOQ A;  4PJJ A;  3HKK A;  3UMH A;  4IGG A;  1YZC A;  1NBB A;  2RD9 A;  3EGD A;  2XS8 A;  4CIH A;  2EIJ C;  2L6F A;  1PD1 A;  3NRH A;  2KC3 A;  3BEH A;  3NMJ A;  4O6Y A;  3PDM P;  5A6B D;  5D91 A;  4CDY A;  1OR3 A;  1WWP A;  2WZL A;  4JC7 A;  4IRU A;  3EHM A;  4BJT A;  1ZYR F;  2KW3 C;  3U5S A;  3RW0 A;  2X51 A;  4YT4 A;  2QTV A;  3M1C B;  3O39 A;  4EBK A;  3H2V A;  4PR9 A;  4MTF A;  4ANJ A;  4JUR I;  3QW0 A;  4YT5 A;  3MLG A;  3DE8 A;  1WGW A;  1DOV A;  2VC9 A;  2XL6 A;  3EH1 A;  4P9F A;  4WGY A;  2DI3 A;  4PJM A;  3T9O A;  3U2M A;  3HNJ A;  4E18 A;  3E9V A;  3AJM A;  3L34 A;  3ABL C;  4JE9 A;  1OCC C;  2YVK A;  3DD7 A;  2WVN A;  4JJG A;  2OKU A;  3EQL F;  5AC5 A;  3RVZ A;  4FAP B;  1Z3I X;  256B A;  5FCL A;  3ITF A;  4JKV A;  2XXA B;  1TR2 A;  4PJL A;  4EBJ A;  2YLD A;  4JVS A;  2G3K A;  2GAQ A;  3ASN C;  1FNT c;  1HY5 A;  2KYH A;  4F4B A;  3RQG A;  2IBF A;  3LES A;  1NU7 D;  1T01 A;  5EHH A;  1YLM A;  3E70 C;  4N6H A;  3T6J A;  1FMV A;  1NZE A;  2AWC A;  1BDJ B;  2NUP B;  4C7O B;  1A0B A;  1T5O A;  2CNW A;  2Q7R A;  2FAP B;  2GDC A;  3MX3 A;  1RJ9 B;  4C3B A;  2YL1 A;  2V26 A;  3SYN A;  2HMZ A;  3NYM A;  1RKC A;  2TMV P;  1GGQ A;  4G7Z F;  2BE5 F;  3K33 A;  4KBL A;  3X1O A;  4I1O B;  1G4U S;  2EPL X;  2YKZ A;  4ZLC A;  2B0J A;  2M64 A;  3EHN A;  4G7O F;  1EI7 A;  4ZLD A;  3ATP A;  5KYW B;  1FAP B;  1OR2 A;  3KKB A;  2WZF A;  2R7U A;  3TJ6 A;  2L7A A;  3EZI A;  3AG1 C;  3VYW A;  3KYJ A;  2V3C C;  2C04 A;  2LIG A;  4OIQ F;  3IHU A;  4HEA J;  3HNI A;  4NTB A;  1YYX A;  2J7P D;  3EFO B;  4PK4 A;  3M4C A;  4WAB A;  4CS9 A;  1LI5 A;  2R05 A;  2KGO A;  3VRC A;  2XLM A;  4HFK B;  3ASO C;  2XM4 A;  4NCQ A;  5DLJ A;  1IW7 F;  2JD3 A;  2Q00 A;  1ZU5 A;  3X2Q C;  2HMQ A;  1QZX A;  1LKX A;  4OIO F;  2IXP A;  3K1H A;  4J32 B;  3F46 A;  4CJG A;  1M56 C;  4DBR A;  3W8I A;  1D1B A;  1E2X A;  3RYL A;  4G78 A;  3US6 A;  4O7G A;  1D0Y A;  4LDK A;  3JZ0 A;  2CDQ A;  4U5G A;  1OCZ C;  2IXN A;  5AGF A;  3G50 A;  5KYU B;  2R7X A;  1CPR A;  2RSE B;  3M79 A;  3DI5 A;  3AG2 C;  3RF3 A;  1E83 A;  4OIP F;  3DWW A;  1QSP A;  1YZA A;  3U9M A;  1SMY F;  2BL2 A;  5E3A A;  1K04 A;  3GEH A;  3QMK A;  1TWA A;  3SXZ A;  1OW6 A;  3ABK C;  3OA1 A;  4XPY A;  4C7O A;  3K7D A;  2NUP A;  4IAR A;  3MBG A;  3U2L A;  5AC4 A;  4DRI B;  3DM5 A;  1JAF A;  3HLZ A;  2VCA A;  3RH3 A;  3Q6N A;  3W4Y A;  4CBE A;  2HV6 A;  4J7Y A;  1V4A A;  1H7I A;  2R25 A;  4A4A A;  3LEO A;  3S9O A;  3U3F A;  3EPV A;  4NTA A;  3IPM O;  5KYN A;  1LVK A;  1MMG A;  3U3B A;  5F5F A;  3B29 A;  2LFD A;  3MYI A;  5A69 A;  4H54 A;  4MVM A;  1OW8 A;  1KNY A;  2YL7 A;  2OQM A;  4R32 A;  4DRH B;  2R7S A;  1NFO A;  3AQC A;  1EQ1 A;  3SXM A;  3L1M A;  3RQF A;  2IXM A;  1K05 A;  2BC5 A;  4FX5 A;  2XLE A;  5HV9 A;  1V54 C;  4KNW A;  2R7O A;  5HSW A;  1NLX A;  1S05 A;  5BQG A;  3POV A;  2Q3T A;  1CPQ A;  2J9W A;  4CS8 C;  3ZC4 A;  3TD7 A;  2EIM C;  4NY3 A;  2J8W A;  1HW2 A;  5B1A C;  4M63 A;  3NMK A;  2EIN C;  3TOL A;  2D5R B;  2I15 A;  4AK9 A;  2HS5 A;  5KYX A;  5IY5 C;  2F22 A;  1M2V B;  1V74 B;  3ZSU A;  2LQG A;  4U9D A;  4XPX A;  2P1A A;  3FDQ A;  3NMI A;  1RMV A;  2EPM X;  4O6N A;  3C18 A;  1ZHT A;  3JYY A;  1AUE A;  3QVZ A;  5L3Q A;  1APC A;  3LS0 A;  3LAY A;  3L8J A;  1D1A A;  1MMD A;  3GM1 A;  5B3I A;  3R2P A;  5JT4 A;  3NDB B;  2ZXO A;  4HE8 D;  2A0B A;  2AU5 A;  3EH2 A;  1CGN A;  2KSF A;  1TFO B;  4CIP A;  5FZT A;  4Z9H A;  1BBH A;  2R02 A;  4MVQ A;  5KYU A;  3TUL A;  4Z9J A;  1SR2 A;  2ASR A;  2YRF A;  3UNG C;  3PHF 2;  3K66 A;  2OJQ A;  3NG1 A;  1ORY A;  4MVR A;  3CQZ A;  4U5B E;  1C03 A;  3C8G B;  4C3E A;  3ABM C;  4XLP F;  4JTA B;  2QUP A;  4RDA A;  1YA9 A;  3LLI A;  2DGJ A;  3TJ5 A;  5KYY A;  3DE9 A;  1H9G A;  2P6V A;  1BR4 A;  3FXH A;  2YEV A;  3ZTM A;  2M4E A;  2WVQ A;  4MVZ A;  5BQI A;  4U5D E;  3B9Q A;  2GA0 A;  5EGY A;  5DVW A;  1Q0K A;  1AVO B;  2CNW D;  3FHD A;  3W8H A;  2KJG A;  2L9J A;  1ORS C;  3DAF A;  4YK5 A;  5T3T A;  2W9Y A;  3CZ6 A;  2Y69 C;  1G8X A;  2ZPA A;  3UR3 C;  3IQC A;  1BZ4 A;  1WOL A;  3M15 A;  4XTK A;  4AL0 A;  1BR2 A;  2A6H F;  4LAC B;  3ZQV A;  4CX9 A;  2YL3 A;  3A9C A;  3A11 A;  3QTH A;  5JSL A;  3GM3 A;  3U8V A;  2VB6 A;  1LIH A;  1FTS A;  2A68 F;  3M4B A;  1JOG A;  3LNM B;  2J0W A;  3OEO A;  5L0J A;  4DRJ B;  2Q9A A;  2QNL A;  1SYQ A;  4D4X A;  5B3S C;  2Y39 A;  4N6C A;  2A1D D;  2CYD A;  2P61 A;  3G4Z A;  3TQO A;  5JRA A;  1A41 A;  2UUH A;  3UMK A;  1I5N A;  1O3U A;  4Q4Z F;  1M2V A;  1LM3 B;  1Y4C A;  2VCC A;  5L0C A;  3AGU A;  2LCH A;  4N4W A;  5K0I A;  1OCR C;  2YWA A;  4G7H F;  3RVY A;  1V55 C;  2Q4F A;  1H9T A;  2R03 A;  4JEA A;  3MFN A;  1PCX A;  1N1C A;  4J7T A;  4BJ5 A;  5DQT A;  2PX3 A;  4MTO A;  4N06 A;  2PFD A;  4IAO A;  3S28 A;  1ZZP A;  4CS8 A;  4Q5S F;  5COF A;  3FOP A;  3AG4 C;  3LLK A;  4YL0 A;  3T4R A;  1ZU4 A;  4RBN A;  4W8P A;  4JEB A;  2OEX A;  2EIL C;  1E84 A;  1T6I A;  3QVY A;  1HMO A;  1PV3 A;  1TFK B;  3GM2 A;  4J30 B;  3O10 A;  4I44 A;  4JW1 A;  1D1C A;  2DB4 A;  3C8G A;  4LDR A;  2LFF A;  5GPG B;  3ZQY A;  3C7J A;  3S84 A;  3K1I A;  4P6I C;  3T6B A;  4OD5 A;  2EPK X;  4O79 A;  1JMW A;  4WGZ A;  1ZHX A;  4A2N B;  4K7B A;  2A69 F;  2CCY A;  1VB5 A;  2LK4 A;  3U8P A;  4YJW A;  2XXA A;  5JLI A;  5A6A A;  3PMR A;  3RKO F;  1HE9 A;  2DYS C;  3F47 A;  1VYI A;  4XPW A;  1XZQ A;  5KYX B;  5E2Q A;  1RCP A;  2B0H A;  3NKE A;  1QPU A;  1RXQ A;  2IYL D;  3ZDL A;  4CJO A;  3RFY A;  1EA8 A;  3ZWI A;  4DXW A;  4YT2 A;  2MWQ A;  2HZ8 A;  1K40 A;  4BJ6 A;  5L0I A;  1Z6A A;  3JYH A;  1QLE C;  3LUT B;  3AOU A;  3ECS A;  1C02 A;  1GQA A;  2DYR C;  3JTL O;  4DVZ A;  1TKN A;  3HTK C;  3IQT A;  5T3W A;  3TOM A;  3UMI A;  1LS1 A;  1VYK A;  4PFO A;  1OQC A;  4XLN F;  4IJJ A;  3V5X A;  4JTD B;  4BPM A;  4CSA A;  4K0D A;  2J45 A;  5KYY B;  2WZG A;  2MHR A;  5A6K A;  1JPJ A;  4EKW A;  4CDV A;  3PCV A;  1YA7 O;  4O6M A;  2CW0 F;  4XEK A;  2YLI A;  2AP3 A;  3JSZ A;  2XM0 A;  3KPH A;  2J9U A;  3U9J A;  2J0X A;  4KI2 A;  1D0X A;  3ZVR A;  3KMI A;  3LJB A;  4NC3 A;  1R5I D;  1NU9 C;  4XEV A;  1A7V A;  4U5F E;  1OXK A;  5E33 A;  2OJE D;  3AQB A;  1XZP A;  4L6R A;  1JR8 A;  3JRM O;  2G62 A;  3K6B A;  1MMN A;  3GAN A;  2HKV A;  4OIN F;  4YWQ A;  2PNO A;  1Q0G A;  3UGO A;  4UDV A;  1L7C A;  2NUT A;  3V5Z A;  5L0D A;  4XEF A;  4E17 A;  1YDI A;  1ZW3 A;  3B0V C;  1QVX A;  1OKK A;  3IEE A;  3W2V A;  3I4U A;  3ZTZ A;  3R7C A;  4BJ5 C;  2VH3 A;  3AG3 C;  3FAP B;  1W2W A;  3S29 A;  1D0Z A;  4BEM J;  4CDA A;  1NFN A;  3B0U X;  4E7Z A;  2FFH A;  2J9B A;  4Q7C A;  1A7E A;  2GFH A;  3DJU B;  4ULW A;  1HW1 A;  1BR1 A;  2W4B A;  2H8A A;  4JCH A;  2XLW A;  2YLG A;  4W8K A;  1FFT C;  4IWB A;  5CI8 A;  1ZHW A;  1NG1 A;  3NYL A;  2C03 A;  3DZA A;  3JSE O;  3L0I A;  3FMS A;  2OCC C;  2J46 A;  3K1I C;  3WHN A;  1Z5Z A;  1T6U A;  5A6J A;  2XL8 A;  3L8I A;  3GWN A;  1Q0M A;  1TQG A;  2A0U A;  3HNL A;  3QW1 A;  3O6X A;  4Z9I A;  3S27 A;  2ZD9 A;  1E85 A;  2YQY A;  3UGP A;  3WG7 C;  4I3M A;  3ZIB A;  3LEV A;  2Y3H A;  3VAY A;  1UG7 A;  4MW3 A;  3SNH A;  1E86 A;  1OXB A;  1U0B B;  1WN0 A;  4BJ6 C;  1S7Z A;  2Z15 A;  1J8M F;  4U5E E;  3SEO A;  2H7O A;  2E87 A;  2IM8 A;  2XLD A;  3GWL A;  2HUJ A;  3U0C A;  1AEP A;  2QE9 A;  4H4K C;  4E0H A;  4MVS A;  4HFF B;  2XLV A;  4QI2 A;  5COG A;  3EGX A;  3V7O A;  2FGY A;  3FOO A;  4FWV A;  1XWJ A;  4MQ9 F;  3I5Q A;  4CSA C;  5EK0 A;  3B0P A;  2XL4 A;  4GYT A;  2AWY A;  3ZG1 A;  2R7W A;  2WVO A;  4BEJ A;  2NSF A;  2XRH A;  3J06 A;  4DVY P;  1JPN A;  1PD0 A;  4QI0 A;  5KYW A;  1QKR A;  4KC9 A;  3SXY A;  1VLT A;  1YYJ A;  3GOD A;  4P9T A;  2XLO A;  3HNK A;  2OEV A;  1A7D A;  1QQ3 A;  5F5H A;  1LE2 A;  3H65 A;  3QZC A;  3C8G D;  2JX0 A;  1IZM A;  4NQF A;  1TWG A;  1ZVZ A;  4JIO A;  4XQ1 A;  3LS1 A;  1CGM E;  2HV7 A;  4LER A;  2HJM A;  2LP4 A;  4YT8 A;  4PJN A;  4JJF A;  2QLA A;  3DJN B;  3EG9 B;  5DS6 A;  5CI9 A;  1Z23 A;  4EHP A;  4G0H A;  4YL1 A;  1G4W R;  1U6H A;  3DXJ F;  3GEI A;  4I1M A;  2GWW A;  2EIK C;  2KNH A;  1M6T A;  2R7T A;  4BJ1 A;  3Q7L A;  1LS4 A;  1VK5 A;  3T6G B;  4CS7 A;  2LSE A;  4GQH A;  3EJN A;  3MYF A;  4ONS A;  1VMA A;  5COM A;  5F28 E;  3BRJ A;  2NSG A;  3V5Y A;  2D4U A;  1ZHZ A;  2X0C A;  1T9K A;  5A6B A;  4AE4 B;  1FFH A;  3S0X A;  2NUT B;  2L81 A;  2Y3D A;  2XS1 A;  4U5C E;  3H2U A;  3CSK A;  4BG0 A;  4C3D A;  4NTF A;  3S90 A;  4OD4 A;  1UFB A;  4JTC B;  4EUK B;  5L0G A;  4PFP A;  3Q7G A;  2PBE A;  4EWC A;  3CEX A;  1OCO C;  5T1D B;  5E3C A;  3RIP A;  2Y3B A;  1MNE A;  3GOR A;  4YN0 B;  4DOZ A;  3KYI A;  3NYJ A;  3VM6 A;  2R7V A;  1G5Z A;  2OOC A;  3VF0 A;  2KQ9 A;  1RKE A;  3IQ6 A;  1YAU O;  4DJ9 A;  2ZXR A;  1Y6D A;  1HE1 A;  3SXK A;  1WAS A;  3EZH A;  1GM5 A;  3JT1 A;  1VTM P;  1YVI A;  4PAC A;  5JS5 A;  3FVY A;  3JRT A;  2H7V C;  2CGE A;  5L3V A;  4MTG A;  4U9E A;  5BUO A;  1ST6 A;  3N0T A;  1SZI A;  2J9V A;  2PX0 A;  1Q0F A;  4IB4 A;  4LDQ A;  2OG2 A;  4MVU A;  3N2Z B;  4EIY A;  2HSB A;  2NG1 A;  4AL1 A;  3DMD A;  5D92 A;  2R9R B;  2YZS A;  4K1O A;  3W2W A;  4MVO A;  2HSQ A;  2Q9C A;  3O55 A;  1OKK D;  4OIR F;  2W45 A;  4YL3 A;  1MMA A;  1Z63 A;  4RD9 A;  1O5H A;  3AGT A;  2ICW G;  4LLC A;  5JP7 A;  1SF8 A;  3EG9 A;  3N24 A;  2LD6 A;  3DKA A;  2KK1 A;  4U5H A;  1WTY A;  5TJ5 E;  4X0R A;  3SZR A;  2JPU A;  3CAX A;  3EGX B;  3GEE A;  3G4X A;  1YJG A;  2G3V A;  2YHS A;  2W4M A;  2EPN A;  1TWH A;  4QDL A;  3TK0 A;  2WL8 A;  1L3P A;  2YL0 A;  4D4N A;  2R7Q A;  5CIV A;  1O87 A;  2VCB A;  3C8Z A;  3EGD B;  4MW8 A;  2OU6 A;  4MS2 A;  2UUI A;  4AE4 A;  4B6I A;  1B68 A;  2IXO A;  3Q6M A;  1VLS A;  1C17 M;  4IAQ A;  3SP1 A;  5JVE A;  2J7P A;  3JCU Q;  1FMW A;  1ZHY A;  1ZW2 A;  4FES A;  3RQE A;  4JRZ A;  5B1B C;  2EPO A;  1FR0 A;  2ZXP A;  3NKD A;  1LPE A;  3OWT A;  2NPU A;  1LI7 A;  3HJC A;  2L6G A;  2Q9B A;  3DM9 B;  1HMD A;  4JCZ A;  2L6H A;  5L0H A;  2AVK A;  2R7R A;  4JZA A;  3DAG A;  1RJ9 A;  2PF4 E;  1KU2 A;  1KTM A;  1ORJ A;  1YAR O;  4KNV A;  1I4Z A;  4WJ0 A;  3IQ5 A;  2WB7 A;  1R4T A; 
#chains in the Genus database with same CATH homology
 4LLE A;  2Y3G A;  3KH2 A;  2MYS A;  3FAJ A;  5DS4 A;  3WOD F;  1J8Y F;  4AX2 A;  2QY9 A;  1TWC A;  3EFO A;  4E7S A;  4EBB A;  2O9X A;  2H7B A;  2PP4 A;  2ZXW C;  3LNR A;  3I5P A;  1VOM A;  4MND A;  3KL4 A;  4XWJ A;  2A6E F;  4GEH A;  2P7V A;  1M57 C;  5DS5 A;  1MND A;  2XSE A;  5DQZ A;  1M2O A;  4CS9 C;  4DBQ A;  2VAS A;  2I8B A;  2IOQ A;  4PJJ A;  3UMH A;  3EGD A;  4CIH A;  2EIJ C;  1PD1 A;  3NRH A;  4O6Y A;  5D91 A;  2WZL A;  4IRU A;  3EHM A;  4BJT A;  1ZYR F;  2KW3 C;  2X51 A;  4YT4 A;  2QTV A;  3M1C B;  3O39 A;  4ANJ A;  4JUR I;  4YT5 A;  3MLG A;  3EH1 A;  1WGW A;  4PJM A;  3E9V A;  3L34 A;  3ABL C;  1OCC C;  4JJG A;  3DD7 A;  2WVN A;  3EQL F;  1Z3I X;  5FCL A;  3ITF A;  2XXA B;  1TR2 A;  4PJL A;  4JVS A;  2G3K A;  3ASN C;  4F4B A;  3LES A;  1NU7 D;  5EHH A;  3E70 C;  3T6J A;  1FMV A;  1NZE A;  4C7O B;  2NUP B;  2CNW A;  3MX3 A;  1RJ9 B;  4C3B A;  3SYN A;  2V26 A;  3NYM A;  4G7Z F;  2BE5 F;  3K33 A;  4KBL A;  3X1O A;  4I1O B;  4ZLC A;  2B0J A;  3EHN A;  4G7O F;  4ZLD A;  3KKB A;  2WZF A;  2R7U A;  3VYW A;  3EZI A;  3AG1 C;  2V3C C;  2C04 A;  4OIQ F;  4HEA J;  2J7P D;  3EFO B;  4PK4 A;  4CS9 A;  2KGO A;  4HFK B;  3ASO C;  5DLJ A;  1IW7 F;  2JD3 A;  1ZU5 A;  3X2Q C;  1QZX A;  1LKX A;  4OIO F;  3K1H A;  2IXP A;  4J32 B;  3F46 A;  1M56 C;  4DBR A;  3W8I A;  1D1B A;  3RYL A;  4O7G A;  1D0Y A;  2CDQ A;  4U5G A;  1OCZ C;  2IXN A;  5KYU B;  2R7X A;  3AG2 C;  4OIP F;  1SMY F;  5E3A A;  3QMK A;  1TWA A;  3ABK C;  3OA1 A;  4C7O A;  3K7D A;  2NUP A;  3DM5 A;  3HLZ A;  3RH3 A;  3Q6N A;  4CBE A;  2HV6 A;  3EPV A;  5KYN A;  1MMG A;  1LVK A;  5F5F A;  2R7S A;  3AQC A;  2IXM A;  4FX5 A;  1V54 C;  4KNW A;  2R7O A;  5HSW A;  3POV A;  2Q3T A;  2J9W A;  4CS8 C;  3ZC4 A;  3TD7 A;  2EIM C;  4NY3 A;  5B1A C;  4M63 A;  2EIN C;  2D5R B;  4AK9 A;  5KYX A;  5IY5 C;  1M2V B;  3ZSU A;  3FDQ A;  2R7T A;  4O6N A;  1ZHT A;  5L3Q A;  3LS0 A;  3LAY A;  1D1A A;  1MMD A;  3NDB B;  2ZXO A;  4HE8 D;  3EH2 A;  5KYU A;  3UNG C;  3PHF 2;  3K66 A;  3NG1 A;  3CQZ A;  4U5B E;  4XLP F;  3ABM C;  4RDA A;  3LLI A;  5KYY A;  2DGJ A;  2P6V A;  1BR4 A;  2YEV A;  5EGY A;  2M4E A;  2WVQ A;  4U5D E;  3B9Q A;  5DVW A;  2CNW D;  3FHD A;  3W8H A;  2KJG A;  2L9J A;  3DAF A;  5T3T A;  2W9Y A;  3CZ6 A;  2Y69 C;  1G8X A;  2ZPA A;  3UR3 C;  4XTK A;  1BR2 A;  2A6H F;  4LAC B;  2VB6 A;  1FTS A;  2A68 F;  3OEO A;  2J0W A;  2Q9A A;  5B3S C;  2Y39 A;  2A1D D;  3UMK A;  4Q4Z F;  1M2V A;  1OCR C;  4G7H F;  1V55 C;  1PCX A;  1N1C A;  4BJ5 A;  5DQT A;  2PX3 A;  4N06 A;  2PFD A;  4IAO A;  3S28 A;  4CS8 A;  4Q5S F;  3AG4 C;  3LLK A;  3T4R A;  1ZU4 A;  4RBN A;  2EIL C;  4J30 B;  4JW1 A;  4I44 A;  1D1C A;  4P6I C;  3T6B A;  4OD5 A;  4O79 A;  1ZHX A;  4A2N B;  4K7B A;  2A69 F;  4YJW A;  3PMR A;  3RKO F;  2DYS C;  3F47 A;  5KYX B;  1VYI A;  5E2Q A;  3NKE A;  2IYL D;  3RFY A;  4YT2 A;  2MWQ A;  4BJ6 A;  1Z6A A;  3JYH A;  1QLE C;  3ECS A;  4DVZ A;  2DYR C;  1TKN A;  3HTK C;  5T3W A;  3UMI A;  1LS1 A;  1VYK A;  4PFO A;  4XLN F;  4IJJ A;  4CSA A;  4K0D A;  2J45 A;  5KYY B;  2WZG A;  1JPJ A;  4O6M A;  2CW0 F;  3JSZ A;  2J9U A;  4KI2 A;  2J0X A;  1D0X A;  3ZVR A;  3KMI A;  3LJB A;  1NU9 C;  4U5F E;  5E33 A;  3AQB A;  4OIN F;  2G62 A;  3K6B A;  1MMN A;  3GAN A;  4YWQ A;  3UGO A;  2NUT A;  3B0V C;  1OKK A;  3IEE A;  3W2V A;  3I4U A;  4BJ5 C;  4C3E A;  2VH3 A;  3AG3 C;  3S29 A;  1W2W A;  3B0U X;  1D0Z A;  4E7Z A;  2FFH A;  4Q7C A;  3DJU B;  2GFH A;  4ULW A;  1BR1 A;  2W4B A;  4JCH A;  4W8K A;  1FFT C;  4IWB A;  5CI8 A;  1ZHW A;  1NG1 A;  3NYL A;  2C03 A;  3DZA A;  3L0I A;  2OCC C;  2J46 A;  3K1I C;  1Z5Z A;  3S27 A;  3O6X A;  3UGP A;  3WG7 C;  4I3M A;  3ZIB A;  3LEV A;  2Y3H A;  3VAY A;  3SNH A;  4BJ6 C;  1S7Z A;  2Z15 A;  1J8M F;  4U5E E;  3SEO A;  2H7O A;  2E87 A;  4H4K C;  4HFF B;  4QI2 A;  3EGX A;  3V7O A;  2FGY A;  4FWV A;  4MQ9 F;  3I5Q A;  4CSA C;  3B0P A;  2XL4 A;  4GYT A;  3ZG1 A;  2R7W A;  2WVO A;  4BEJ A;  2XRH A;  4DVY P;  1JPN A;  1PD0 A;  4QI0 A;  5KYW A;  4KC9 A;  3GOD A;  5F5H A;  3H65 A;  3QZC A;  1IZM A;  1TWG A;  3LS1 A;  2HV7 A;  4LER A;  4YT8 A;  4PJN A;  4JJF A;  3DJN B;  3EG9 B;  5DS6 A;  5CI9 A;  1Z23 A;  4G0H A;  3DXJ F;  4I1M A;  2EIK C;  2KNH A;  4BJ1 A;  3Q7L A;  1VK5 A;  4CS7 A;  2LSE A;  3EJN A;  1VMA A;  1ZHZ A;  4AE4 B;  1FFH A;  3S0X A;  2NUT B;  2L81 A;  2Y3D A;  4U5C E;  3CSK A;  4BG0 A;  4C3D A;  4OD4 A;  4PFP A;  3Q7G A;  4EWC A;  1OCO C;  5T1D B;  5E3C A;  3RIP A;  2Y3B A;  1MNE A;  4YN0 B;  4DOZ A;  3NYJ A;  2R7V A;  2KQ9 A;  2ZXR A;  3EZH A;  3JT1 A;  3FVY A;  3JRT A;  2H7V C;  2CGE A;  5L3V A;  5BUO A;  1ST6 A;  3N0T A;  1SZI A;  2J9V A;  2PX0 A;  2OG2 A;  3N2Z B;  2NG1 A;  3DMD A;  5D92 A;  2YZS A;  3W2W A;  2Q9C A;  1OKK D;  4OIR F;  2W45 A;  1MMA A;  1Z63 A;  4RD9 A;  1O5H A;  4LLC A;  1SF8 A;  3EG9 A;  3N24 A;  4U5H A;  4X0R A;  3SZR A;  3EGX B;  2G3V A;  2YHS A;  2W4M A;  1TWH A;  4QDL A;  2WL8 A;  2R7Q A;  1O87 A;  3EGD B;  4B6I A;  4AE4 A;  5KYW B;  2XXA A;  2IXO A;  3Q6M A;  3SP1 A;  2J7P A;  3JCU Q;  1FMW A;  1ZHY A;  4FES A;  5B1B C;  2ZXP A;  3NKD A;  3OWT A;  3HJC A;  2Q9B A;  3DM9 B;  2R7R A;  4JZA A;  3DAG A;  1RJ9 A;  2PF4 E;  1KU2 A;  4KNV A;  4WJ0 A;  2WB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...