3W8HA

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of stk25
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
197
structure length
190
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 79
structure length 190
sequence length 197
ec nomenclature
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3w8hA00
3W8IA 4GEHA 3W8HA
chains in the Genus database with same CATH superfamily
2XLVA 4L6RA 5KYWA 2XSEA 3H2UA 3U3FA 5DQZA 1PD1A 3TQOA 1JR8A 2KJGA 2HJMA 1XZPA 3WG7C 3WAQA 1Z63A 4IJJA 2H7BA 3S84A 4MVSA 1Z3IX 4O79A 4EWCA 5KYUA 2BL2A 2GAQA 4ULWA 3AQBA 2XLMA 4JEBA 2AWCA 4R32A 4RBNA 2HKVA 5CIVA 3RQFA 3SNHA 1QZXA 3EGXA 1YZAA 3MX3A 3NMKA 5E3AA 1M2VB 3TJ5A 1ZHXA 4CJGA 1JPNA 5A6JA 1TWHA 4P9FA 3WHNA 1A7VA 3L8IA 1QVXA 4BEJA 4BEMJ 4H54A 4JVSA 3X1OA 4JIOA 2R9RB 3PMRA 4FWVA 1GS9A 5JVEA 1OCZC 4YL3A 3FMSA 1WASA 256BA 3K7DA 4WGYA 3UMHA 2YL0A 3ZQVA 2XL4A 3QW1A 1GQAA 4G0HA 2M64A 1EKYA 4CS8A 1TWCA 3GEEA 4YT5A 4C3EA 2G3VA 4AE4B 2OJED 2NUPB 2Y3HA 4CIHA 1I4YA 1H9GA 2PNOA 4YT8A 3ZTZA 3QZCA 1MMAA 1LPEA 2CYDA 4E7SA 2YEVA 5KYYB 2YL3A 3T4RA 4XLNF 2Y3BA 4XEFA 3V5XA 4ZLCA 1MQVA 1NG1A 4FESA 2IXMA 2DGJA 3L8JA 5BUOA 3NYMA 1TQGA 1OR2A 3Q6MA 2YKZA 1D1AA 1D0ZA 4MS2A 1LVKA 1RKEB 1V74B 1ZU5A 2XLWA 2XS8A 1U6HA 2J9UA 2Z15A 3DAGA 3EG9A 3IQCA 3C8GB 4J7TA 3S27A 2KYHA 1A7EA 2ZXOA 5HSWA 3H65A 4NY3A 3K33A 1FNTc 1CPQA 1NBBA 3S29A 2ZPAA 3O10A 3W4YA 3K6BA 5F28E 2YLGA 2YZSA 3SZRA 2IXOA 2KSFA 3NG1A 4YWQA 3DXJF 1W2WA 3JSEO 3KL4A 4LDKA 4G7OF 2J0WA 1PV3A 2OCCC 1OCCC 3DJNB 4MW3A 1ST6A 4NTAA 2Q9CA 2H7VC 1MMNA 3EJNA 3SXYA 3MYIA 1VOMA 2WZFA 3EGDB 2KK1A 2ICWG 4DVYP 5DQTA 3C8ZA 5E2QA 4OD5A 3ZC4A 3N24A 2O9XA 1OW6A 4C7OA 2GA0A 1RCPA 1YARO 1Q0DA 4MNDA 2IM8A 2NSGA 3U8VA 5L0DA 5JRAA 3C63A 3L34A 4JTAB 1RJ9A 3EZIA 2VCCA 3U2MA 3CAXA 2I15A 2YLIA 2JPUA 2OJQA 2PX0A 5F5FA 2F22A 3JCUQ 2DYSC 2EPOA 2LD6A 2X0CA 1AEPA 4OIRF 4BJ6C 2V26A 2W9YA 5JUAA 4XEVA 3I5QA 2JX0A 2DI3A 3IEEA 4JW1A 2NG1A 4J7YA 5DLJA 4CDYA 4U5EE 3FXHA 4X0RA 4AX2A 4LLEA 3FDQA 3CQZA 2HJ3A 3JYYA 3DE9A 3EGXB 1HE9A 1T5OA 4XTKA 2EILC 4ULVA 1O5HA 2OEXA 5AGFA 5B1BC 4J32B 1ORYA 1HW1A 2XXAB 3M79A 5D91A 1CGNA 3GM1A 5K0IA 2LFFA 2WVOA 2QUPA 1SZIA 2P1AA 2OG2A 4BJ6A 3MYFA 4DVZA 4Z9HA 5T3WA 3S0XA 1PD0A 1HMOA 2VB6A 2XLEA 2MWQA 3FAJA 4MTFA 3W2VA 2W4BA 3UNGC 1FTSA 3IHUA 1M2OA 4MVUA 1GM5A 4O6YA 1G4US 1MNDA 2HMZA 2Y39A 4JRZA 2B0JA 2Q00A 1KNYA 1QKRA 2XL8A 2HMQA 1XZQA 3Q7GA 2ZXWC 1AUEA 1Q0GA 2J45A 1YA9A 3EQLF 4MVOA 4NTBA 4P6IC 3I4UA 3DD7A 4MVMA 4U5BE 4CJOA 3K1HA 3K1IC 5JP7A 4XQ1A 3VRCA 5CI8A 3ZTMA 1APCA 2VASA 1I4ZA 5A6AA 4JC7A 5A6BD 3AG1C 3LAYA 3NDBB 3UMIA 4PACA 1D1BA 1LS4A 2WZGA 2G62A 3E9VA 3NMJA 2L6GA 4I1MA 3V5ZA 3EG9B 3ZDLA 4HEAJ 4XWJA 3GWNA 3ECSA 2OOCA 1YJGA 2QTVA 5DS5A 4Q5SF 3AOUA 2P61A 2LP4A 1LS1A 3RKOF 2NSFA 3A11A 3Q6NA 4BG0A 3K1IA 5L3VA 3C8GD 5EHHA 1EQ1A 3GWLA 2PFDA 4CS8C 3KYIA 5BQGA 4H4KC 2BE5F 2CDQA 1PCXA 4WABA 2VH3A 1JOGA 1M6TA 2HV6A 4N6HA 1LI7A 3DM9B 3JYHA 1ORSC 4MVZA 3T6JA 2EPLX 5A69A 4K7BA 4Q4ZF 1OKKD 1YAUO 2A0BA 5L3QA 4GYTA 4K1OA 3LLKA 4QI2A 4U9EA 1H7IA 3F46A 2R7SA 1YDIA 3EZHA 4CBEA 3VYWA 3BRJA 1OR3A 4IWBA 2MYSA 3JTLO 2UUHA 2LCHA 4N06A 1U89A 4IAOA 5JLIA 1UG7A 2Y69C 4U5HA 1RJ9B 1F1MA 3RW0A 4C3BA 3M4BA 4I1OB 3QW0A 3R2PA 4CX9A 3B0PA 3ATPA 4CS9A 1NSGB 2XM4A 4MW8A 1LKXA 4GEHA 4NTFA 1TKNA 4JZAA 2EINC 3LS0A 4Z9IA 3S28A 4BPMA 4DOZA 3W8IA 1VK5A 4D4NA 1GGQA 3RVYA 4PFPA 1E84A 1ZHWA 1YZCA 2H8AA 2P6VA 2RD9A 2Y3GA 4IARA 3RQEA 3V7OA 1K40A 1G8XA 4RD9A 4HFKB 3I5PA 4YJWA 2QY9A 1K04A 2WB7A 2FFHA 3SXKA 1VMAA 2FGYA 2NUTB 2VCAA 4QI0A 3R7CA 5F5HA 4K0DA 4XPYA 1FAPB 2B0HA 5L0CA 5E33A 5L0JA 1JMWA 4O6NA 2RSEB 3HTKC 3DMDA 3B0VC 1D0XA 3ZSUA 5FZTA 1H9TA 2XS1A 4N4WA 3IQTA 5T3TA 5EGYA 1LIHA 4XLPF 2Y3DA 2A6HF 2BC5A 4LACB 3ZG1A 3CEXA 3W8HA 3T6GB 5A6KA 2GDCA 4LERA 1R4TA 2AVKA 1LE4A 2Q4FA 2EPMX 4IGGA 2EIKC 1WTYA 4DXWA 1OW7A 1B68A 1IW7F 2R03A 1VLTA 3G4ZA 4G7ZF 1J8YF 2R7TA 1UFBA 2GWWA 1ZHZA 2OEVA 1T6QA 3IQ5A 3LS1A 3O39A 4EIYA 1OXKA 1FFHA 4DRHB 4JJGA 3HNLA 3UR3C 3GEHA 3ZWIA 1EI7A 1IZMA 1TWGA 3TJ6A 1Z6AA 4HFFB 3AG4C 3QVYA 2IBFA 1V54C 4OIOF 1RXQA 1M2VA 3FOPA 4JCHA 4U5CE 3DZAA 5DVWA 1ZU4A 2TMVP 5DS6A 3B9QA 3U8PA 3OA1A 5KYWB 1QSPA 2R7RA 4BJ5C 3A9CA 4NC3A 1ZHTA 3ABKC 3AGUA 4A2NB 2ETSA 4G78A 1ZW3A 4M63A 4KBLA 4MQ9F 2A69F 2HV7A 3GM3A 2KC3A 3TOLA 1J8MF 5KYUB 2HS5A 4MVQA 4GQHA 1BR2A 2A68F 3B29A 2KQ9A 2VC9A 1WWPA 1A0BA 1YVIA 4E0HA 1YYXA 4MTOA 5COMA 2D4UA 3B0UX 4DBRA 2I8BA 4AE4A 4JTCB 3AJMA 1BR1A 3GM2A 4BJ5A 1E85A 5B3SC 1NFOA 3PCVA 1RKCA 5A6BA 4HE8D 1M56C 3JSZA 4OINF 5KYYA 2WZLA 4N6CA 3UGOA 1T6UA 1CPRA 1Z7Qc 3SYNA 2YLDA 2KNHA 4PR9A 4CS7A 3HJCA 3EHMA 2E87A 3KKBA 1Q0KA 2CNWD 4FX5A 4O7GA 4F4BA 4ZLDA 1T9KA 3EFOA 3DWWA 5HV9A 1CGME 4JEAA 3H2VA 3C8GA 3HNIA 2FAPB 1HE1A 1QLEC 2ZXPA 1EA8A 4CIPA 2P7VA 2Q9AA 5B1AC 2PP4A 3X2QC 2Q7RA 5CI9A 1RMVA 2ASRA 2J7PD 1A7DA 2CGEA 1T01A 2PF4E 3HKKA 4QDLA 5JSLA 3TD7A 4JJFA 3DAFA 5TJ5E 2WL8A 1OKKA 4U9DA 2L6HA 3CSKA 1FFTC 1QPUA 2PBEA 1E86A 2OKUA 3US6A 1I5NA 3IQ6A 3HNKA 2Q3TA 1E2XA 3FAPB 4E17A 2J46A 3UMKA 3MFNA 1HY5A 2X51A 3AG2C 3KH2A 1NU9C 2DYRC 4IRUA 4U5FE 4MTGA 3NRHA 3EGDA 4PJMA 2EPKX 2HFIA 3ITFA 3S9OA 4IAQA 4AL0A 2ZD9A 4E18A 1L3PA 3S90A 4Q7CA 5FCLA 4Z9JA 3ZQYA 3POVA 4PFOA 3NYJA 1BZ4A 1TR2A 1Z5ZA 5KYXA 1C02A 3L0IA 5GPGB 4XPWA 3GORA 2XRHA 2L81A 3ABLC 4CS9C 1MMDA 2IXNA 2R7UA 4MVRA 3B71A 3OEOA 4PJLA 3U5SA 3FOOA 2XLOA 4KNWA 4C7OB 3VM6A 2V3CC 2CCYA 3EH2A 1TWAA 2IOQA 4NCQA 4U5GA 2XLDA 1HMDA 3AG3C 1OW8A 3HNJA 3LNRA 4YL1A 2LK4A 5D92A 3ABMC 2YQYA 1TFOB 3U0CA 1Q0MA 2EIJC 2P0NA 2LQGA 3O55A 4YT4A 2XXAA 2CW0F 4CDAA 3E70C 3VAYA 1WN0A 4WGZA 4U5DE 2JD3A 1KU2A 2MHRA 4JTDB 3SEOA 1SR2A 3NYLA 3FVYA 4W8KA 1H6GA 3U2LA 1OXBA 4OIPF 4BJTA 4BJ1A 1ZW2A 1KTMA 1BR4A 4DRIB 3RH3A 3JZ0A 1YYJA 2R7QA 2WVQA 1OCRC 2R05A 4DRJB 1U0BB 2QE9A 1BBHA 3C18A 4JURI 3RYLA 3RF3A 4I3MA 3ASNC 1S05A 2XLHA 2J9VA 3N2ZB 3EPVA 3ZIBA 2LIGA 3U9JA 2R02A 5COFA 1DOWA 2R7XA 1V55C 3LESA 4A4AA 1LI5A 1FR0A 2WVNA 2A6EF 1XWJA 4PK4A 4IB4A 2R7WA 4KC9A 5BQHA 4JE9A 1NU7D 4E7ZA 4DJ9A 5DS4A 2EPNA 4CSAC 1JAFA 2DB4A 3M15A 1C03A 3BEHA 3RVZA 3U9MA 2J0XA 3JT1A 3QVZA 3W2WA 3KPHA 2J9WA 3EFOB 4DBQA 4YK5A 4P9TA 3GODA 4B6IA 3ASOC 2H7OA 4KI2A 3DJUB 2HZ8A 3EH1A 1LM3B 3LEOA 4O6MA 3NKEA 3GANA 1ZHYA 3TULA 2L7AA 1VYIA 3QTHA 5KYNA 5AC5A 3TK0A 1NLXA 1Q0FA 2R7VA 1OCOC 5AC4A 5JS5A 1FMWA 1OQCA 4FAPB 2AP3A 1D1CA 1O3UA 1SMYF 1Y6DA 1ZVZA 4CSAA 3Q7LA 2J9BA 4OIQF 1ZZPA 2PX3A 2YHSA 3T9OA 3U3BA 3G4XA 2XL6A 2LFDA 3M1CB 2G3KA 3O6XA 3T6BA 3MLGA 4WJ0A 1WATA 3LUTB 2QLAA 5L0IA 2L9JA 4XEKA 2HSQA 1K05A 2CNWA 1O87A 1WOLA 3JRMO 1D0YA 1HW2A 1DOVA 3GEIA 3LJBA 3ZVRA 2LSEA 3G50A 4LDQA 4CDVA 1E83A 3C62A 1FMVA 3DKAA 3SXZA 4EHPA 1NFNA 3AQCA 1M57C 3DI5A 3QMKA 3RFYA 2C03A 5T1DB 3SP1A 2A1DD 2EIMC 2NPUA 2W4MA 2XM0A 5KYXB 1VLSA 2NUPA 2M4EA 3SXMA 2J7PA 4EBJA 4J30B 3PHF2 5BQIA 2GFHA 1A41A 1N1CA 3KMIA 2YVKA 3L1MA 4EBKA 2IXPA 5COGA 3DE8A 2A0UA 1QQ3A 4EKWA 1MNEA 3NKDA 4OD4A 2QNLA 1ZYRF 4EUKB 4YL0A 2OU6A 2R25A 5B3IA 2YRFA 4AL1A 2D5RB 1AVOB 4YT2A 1ORJA 2YL7A 1C17M 3V5YA 3DM5A 3PDMP 4PJJA 1RKEA 3JRTA 2HUJA 4LLCA 1VB5A 4AK9A 1L7CA 2AU5A 1CGOA 3FHDA 1MMGA 2YWAA 4C3DA 2ZXRA 2NUTA 1G5ZA 2VCBA 5EK0A 1T6IA 1SF8A 1YA7O 3M4CA 1BDJB 3C7JA 3UGPA 1WGWA 3OWTA 2OQMA 4ONSA 4UDVA 4G7HF 3RQGA 4NQFA 5JT4A 4EBBA 5L0GA 3IPMO 2J8WA 1Z23A 3LLIA 4JKVA 1Y4CA 3LNMB 3AGTA 3NMIA 1SYQA 2IYLD 4KNVA 5IY5C 4ANJA 4RDAA 4D4XA 5L0FA 1TFKB 2W45A 3VF0A 5L0HA 1JPJA 3WODF 2AWYA 3EHNA 2UUIA 3CZ6A 2KW3C 3RIPA 3MBGA 3F47A 3LEVA 4W8PA 4ER9A 3J06A 1JRAA 5E3CA 3KYJA 4E0IA 3K66A 1YLMA 2R7OA 3HLZA 1VYKA 1R5ID 2C04A 2KGOA 2Q9BA 1NZEA 1G4WR 3TOMA 1V4AA 2L6FA 4PJNA 4I44A 2HSBA 2YL1A 4XPXA 4JCZA 1S7ZA 4YN0B 1VTMP 4LDRA 3N0TA 1LE2A
chains in the Genus database with same CATH topology
5KYWA 2XSEA 5DQZA 1PD1A 2KJGA 3WG7C 1Z63A 4IJJA 2H7BA 1Z3IX 4O79A 4EWCA 5KYUA 4ULWA 3AQBA 4RBNA 3SNHA 1QZXA 3EGXA 3MX3A 5E3AA 1M2VB 1ZHXA 1JPNA 1TWHA 4BEJA 4JVSA 3X1OA 4FWVA 3PMRA 1OCZC 3K7DA 3UMHA 2XL4A 4G0HA 4CS8A 1TWCA 4YT5A 4C3EA 2G3VA 4AE4B 2NUPB 2Y3HA 4CIHA 4YT8A 3QZCA 1MMAA 4E7SA 2YEVA 5KYYB 4ZLCA 3T4RA 4XLNF 2Y3BA 1NG1A 4FESA 2IXMA 2DGJA 5BUOA 3NYMA 3Q6MA 1D1AA 1D0ZA 1LVKA 1ZU5A 3DAGA 3EG9A 2J9UA 2Z15A 3S27A 2ZXOA 5HSWA 3H65A 4NY3A 3K33A 3S29A 2ZPAA 3K6BA 2YZSA 3SZRA 2IXOA 3NG1A 4YWQA 3DXJF 1W2WA 3KL4A 4G7OF 2J0WA 2OCCC 1OCCC 3DJNB 1ST6A 2Q9CA 2H7VC 1MMNA 3EJNA 1VOMA 2WZFA 3EGDB 4DVYP 5DQTA 3ZC4A 5E2QA 4OD5A 4C7OA 3N24A 2O9XA 4MNDA 3L34A 1RJ9A 3EZIA 2PX0A 5F5FA 3JCUQ 2DYSC 4OIRF 4BJ6C 2V26A 2W9YA 3I5QA 4JW1A 3IEEA 2NG1A 5DLJA 4U5EE 4X0RA 4AX2A 4LLEA 3FDQA 3CQZA 4XTKA 3EGXB 2EILC 1O5HA 5B1BC 4J32B 2XXAB 5D91A 2WVOA 1SZIA 2OG2A 4BJ6A 4DVZA 5T3WA 3S0XA 1PD0A 3FAJA 2VB6A 3W2VA 2MWQA 4G7ZF 2W4BA 3UNGC 1FTSA 1M2OA 4O6YA 1MNDA 2Y39A 2B0JA 3Q7GA 4OIQF 3RIPA 2ZXWC 2J45A 3EQLF 4P6IC 3I4UA 3DD7A 4U5BE 3K1HA 3K1IC 5CI8A 2VASA 3AG1C 3LAYA 3NDBB 3UMIA 1D1BA 3E9VA 2WZGA 2G62A 4I1MA 3EG9B 4HEAJ 4XWJA 3ECSA 2QTVA 5DS5A 4Q5SF 3RKOF 1LS1A 3Q6NA 4BG0A 5L3VA 5EHHA 2PFDA 4CS8C 4H4KC 2BE5F 2CDQA 1PCXA 2VH3A 2HV6A 3DM9B 3JYHA 3T6JA 4Q4ZF 4K7BA 1OKKD 5L3QA 4GYTA 3LLKA 4QI2A 3F46A 2R7SA 3EZHA 4CBEA 3VYWA 4IWBA 2MYSA 4N06A 4IAOA 2Y69C 4U5HA 1RJ9B 4C3BA 4I1OB 3B0PA 4CS9A 1LKXA 4GEHA 1TKNA 4JZAA 2EINC 3LS0A 3S28A 4DOZA 3W8IA 1VK5A 4PFPA 1ZHWA 2P6VA 2Y3GA 3V7OA 1G8XA 4RD9A 4HFKB 3I5PA 4YJWA 2QY9A 2WB7A 2FFHA 5F5HA 1VMAA 2FGYA 2NUTB 4QI0A 4K0DA 5E33A 4O6NA 3HTKC 3DMDA 3B0VC 1D0XA 3ZSUA 5T3TA 5EGYA 4XLPF 2Y3DA 2A6HF 4LACB 3ZG1A 3W8HA 4LERA 2EIKC 1IW7F 1J8YF 2R7TA 3O39A 1ZHZA 3LS1A 1FFHA 4JJGA 3UR3C 1IZMA 1TWGA 1Z6AA 4HFFB 3AG4C 1V54C 4OIOF 4JCHA 1M2VA 5DVWA 4U5CE 3DZAA 1ZU4A 5DS6A 3B9QA 3OA1A 5KYWB 2R7RA 4BJ5C 1ZHTA 3ABKC 4A2NB 4M63A 4KBLA 4MQ9F 2A69F 2HV7A 1J8MF 5KYUB 1BR2A 2A68F 2KQ9A 4DBRA 2I8BA 4AE4A 1BR1A 4BJ5A 5B3SC 4HE8D 1M56C 3JSZA 4OINF 5KYYA 2WZLA 3UGOA 3SYNA 4CS7A 2KNHA 3HJCA 3EHMA 2E87A 3KKBA 4O7GA 2CNWD 4FX5A 4ZLDA 4F4BA 3EFOA 2ZXPA 1QLEC 2P7VA 2Q9AA 5B1AC 2PP4A 3X2QC 5CI9A 2J7PD 2CGEA 2PF4E 4QDLA 3TD7A 4JJFA 3DAFA 2WL8A 1OKKA 3CSKA 1FFTC 2Q3TA 2J46A 3UMKA 3AG2C 2X51A 3KH2A 1NU9C 2DYRC 4IRUA 4U5FE 3NRHA 3EGDA 4PJMA 3ITFA 4Q7CA 5FCLA 3POVA 4PFOA 3NYJA 1TR2A 1Z5ZA 5KYXA 3L0IA 2XRHA 2L81A 3ABLC 4CS9C 1MMDA 2IXNA 2R7UA 3OEOA 4PJLA 4KNWA 4C7OB 2V3CC 3EH2A 1TWAA 2IOQA 4U5GA 3AG3C 3LNRA 5D92A 3ABMC 2EIJC 2XXAA 4YT4A 2CW0F 3E70C 3VAYA 4U5DE 2JD3A 1KU2A 3SEOA 3NYLA 3FVYA 4W8KA 4OIPF 4BJTA 4BJ1A 1BR4A 3RH3A 2R7QA 2WVQA 1OCRC 4JURI 3RYLA 4I3MA 3ASNC 3N2ZB 2J9VA 3EPVA 3ZIBA 2R7XA 1V55C 3LESA 2WVNA 2A6EF 4PK4A 2R7WA 4KC9A 1NU7D 4E7ZA 5DS4A 4CSAC 2J0XA 3JT1A 3W2WA 4DBQA 2J9WA 3EFOB 3GODA 4B6IA 3ASOC 2H7OA 4KI2A 3DJUB 3EH1A 4O6MA 3NKEA 3GANA 1ZHYA 1VYIA 5KYNA 2R7VA 1OCOC 1FMWA 1D1CA 1SMYF 4CSAA 3Q7LA 2PX3A 2YHSA 3M1CB 2G3KA 3O6XA 3T6BA 3MLGA 4WJ0A 2L9JA 2CNWA 1O87A 1D0YA 3LJBA 3ZVRA 2LSEA 1FMVA 3AQCA 1M57C 3RFYA 3QMKA 2C03A 5T1DB 3SP1A 2A1DD 2EIMC 2W4MA 5KYXB 2NUPA 2M4EA 2J7PA 4J30B 3PHF2 2GFHA 1N1CA 3KMIA 2IXPA 1MNEA 3NKDA 4OD4A 1ZYRF 2D5RB 4YT2A 3DM5A 4PJJA 3JRTA 4LLCA 4AK9A 3B0UX 4C3DA 3FHDA 1MMGA 2ZXRA 2NUTA 1SF8A 3UGPA 1WGWA 3OWTA 4G7HF 4EBBA 1Z23A 3LLIA 4KNVA 2IYLD 5IY5C 4ANJA 4RDAA 2W45A 1JPJA 3WODF 3EHNA 3CZ6A 2KW3C 3F47A 3LEVA 5E3CA 3K66A 2R7OA 3HLZA 1VYKA 2Q9BA 2C04A 2KGOA 1NZEA 4PJNA 4I44A 4YN0B 1S7ZA 3N0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8I A;  4GEH A;  3W8H A; 
#chains in the Genus database with same CATH topology
 2XLV A;  4L6R A;  5KYW A;  2XSE A;  3H2U A;  3U3F A;  5DQZ A;  1PD1 A;  3TQO A;  1JR8 A;  2KJG A;  2HJM A;  1XZP A;  3WG7 C;  3WAQ A;  1Z63 A;  4IJJ A;  2H7B A;  3S84 A;  4MVS A;  1Z3I X;  4O79 A;  4EWC A;  5KYU A;  2BL2 A;  2GAQ A;  4ULW A;  3AQB A;  2XLM A;  4JEB A;  2AWC A;  4R32 A;  4RBN A;  2HKV A;  5CIV A;  3RQF A;  3SNH A;  1QZX A;  3EGX A;  1YZA A;  3MX3 A;  3NMK A;  5E3A A;  1M2V B;  3TJ5 A;  1ZHX A;  4CJG A;  1JPN A;  5A6J A;  1TWH A;  4P9F A;  3WHN A;  1A7V A;  3L8I A;  1QVX A;  4BEJ A;  4BEM J;  4H54 A;  4JVS A;  3X1O A;  4JIO A;  2R9R B;  3PMR A;  4FWV A;  1GS9 A;  5JVE A;  1OCZ C;  4YL3 A;  3FMS A;  1WAS A;  256B A;  3K7D A;  4WGY A;  3UMH A;  2YL0 A;  3ZQV A;  2XL4 A;  3QW1 A;  1GQA A;  4G0H A;  2M64 A;  1EKY A;  4CS8 A;  1TWC A;  3GEE A;  4YT5 A;  4C3E A;  2G3V A;  4AE4 B;  2OJE D;  2NUP B;  2Y3H A;  4CIH A;  1I4Y A;  1H9G A;  2PNO A;  4YT8 A;  3ZTZ A;  3QZC A;  1MMA A;  1LPE A;  2CYD A;  4E7S A;  2YEV A;  5KYY B;  2YL3 A;  3T4R A;  4XLN F;  2Y3B A;  4XEF A;  3V5X A;  4ZLC A;  1MQV A;  1NG1 A;  4FES A;  2IXM A;  2DGJ A;  3L8J A;  5BUO A;  3NYM A;  1TQG A;  1OR2 A;  3Q6M A;  2YKZ A;  1D1A A;  1D0Z A;  4MS2 A;  1LVK A;  1RKE B;  1V74 B;  1ZU5 A;  2XLW A;  2XS8 A;  1U6H A;  2J9U A;  2Z15 A;  3DAG A;  3EG9 A;  3IQC A;  3C8G B;  4J7T A;  3S27 A;  2KYH A;  1A7E A;  2ZXO A;  5HSW A;  3H65 A;  4NY3 A;  3K33 A;  1FNT c;  1CPQ A;  1NBB A;  3S29 A;  2ZPA A;  3O10 A;  3W4Y A;  3K6B A;  5F28 E;  2YLG A;  2YZS A;  3SZR A;  2IXO A;  2KSF A;  3NG1 A;  4YWQ A;  3DXJ F;  1W2W A;  3JSE O;  3KL4 A;  4LDK A;  4G7O F;  2J0W A;  1PV3 A;  2OCC C;  1OCC C;  3DJN B;  4MW3 A;  1ST6 A;  4NTA A;  2Q9C A;  2H7V C;  1MMN A;  3EJN A;  3SXY A;  3MYI A;  1VOM A;  2WZF A;  3EGD B;  2KK1 A;  2ICW G;  4DVY P;  5DQT A;  3C8Z A;  5E2Q A;  4OD5 A;  3ZC4 A;  3N24 A;  2O9X A;  1OW6 A;  4C7O A;  2GA0 A;  1RCP A;  1YAR O;  1Q0D A;  4MND A;  2IM8 A;  2NSG A;  3U8V A;  5L0D A;  5JRA A;  3C63 A;  3L34 A;  4JTA B;  1RJ9 A;  3EZI A;  2VCC A;  3U2M A;  3CAX A;  2I15 A;  2YLI A;  2JPU A;  2OJQ A;  2PX0 A;  5F5F A;  2F22 A;  3JCU Q;  2DYS C;  2EPO A;  2LD6 A;  2X0C A;  1AEP A;  4OIR F;  4BJ6 C;  2V26 A;  2W9Y A;  5JUA A;  4XEV A;  3I5Q A;  2JX0 A;  2DI3 A;  3IEE A;  4JW1 A;  2NG1 A;  4J7Y A;  5DLJ A;  4CDY A;  4U5E E;  3FXH A;  4X0R A;  4AX2 A;  4LLE A;  3FDQ A;  3CQZ A;  2HJ3 A;  3JYY A;  3DE9 A;  3EGX B;  1HE9 A;  1T5O A;  4XTK A;  2EIL C;  4ULV A;  1O5H A;  2OEX A;  5AGF A;  5B1B C;  4J32 B;  1ORY A;  1HW1 A;  2XXA B;  3M79 A;  5D91 A;  1CGN A;  3GM1 A;  5K0I A;  2LFF A;  2WVO A;  2QUP A;  1SZI A;  2P1A A;  2OG2 A;  4BJ6 A;  3MYF A;  4DVZ A;  4Z9H A;  5T3W A;  3S0X A;  1PD0 A;  1HMO A;  2VB6 A;  2XLE A;  2MWQ A;  3FAJ A;  4MTF A;  3W2V A;  2W4B A;  3UNG C;  1FTS A;  3IHU A;  1M2O A;  4MVU A;  1GM5 A;  4O6Y A;  1G4U S;  1MND A;  2HMZ A;  2Y39 A;  4JRZ A;  2B0J A;  2Q00 A;  1KNY A;  1QKR A;  2XL8 A;  2HMQ A;  1XZQ A;  3Q7G A;  2ZXW C;  1AUE A;  1Q0G A;  2J45 A;  1YA9 A;  3EQL F;  4MVO A;  4NTB A;  4P6I C;  3I4U A;  3DD7 A;  4MVM A;  4U5B E;  4CJO A;  3K1H A;  3K1I C;  5JP7 A;  4XQ1 A;  3VRC A;  5CI8 A;  3ZTM A;  1APC A;  2VAS A;  1I4Z A;  5A6A A;  4JC7 A;  5A6B D;  3AG1 C;  3LAY A;  3NDB B;  3UMI A;  4PAC A;  1D1B A;  1LS4 A;  2WZG A;  2G62 A;  3E9V A;  3NMJ A;  2L6G A;  4I1M A;  3V5Z A;  3EG9 B;  3ZDL A;  4HEA J;  4XWJ A;  3GWN A;  3ECS A;  2OOC A;  1YJG A;  2QTV A;  5DS5 A;  4Q5S F;  3AOU A;  2P61 A;  2LP4 A;  1LS1 A;  3RKO F;  2NSF A;  3A11 A;  3Q6N A;  4BG0 A;  3K1I A;  5L3V A;  3C8G D;  5EHH A;  1EQ1 A;  3GWL A;  2PFD A;  4CS8 C;  3KYI A;  5BQG A;  4H4K C;  2BE5 F;  2CDQ A;  1PCX A;  4WAB A;  2VH3 A;  1JOG A;  1M6T A;  2HV6 A;  4N6H A;  1LI7 A;  3DM9 B;  3JYH A;  1ORS C;  4MVZ A;  3T6J A;  2EPL X;  5A69 A;  4K7B A;  4Q4Z F;  1OKK D;  1YAU O;  2A0B A;  5L3Q A;  4GYT A;  4K1O A;  3LLK A;  4QI2 A;  4U9E A;  1H7I A;  3F46 A;  2R7S A;  1YDI A;  3EZH A;  4CBE A;  3VYW A;  3BRJ A;  1OR3 A;  4IWB A;  2MYS A;  3JTL O;  2UUH A;  2LCH A;  4N06 A;  1U89 A;  4IAO A;  5JLI A;  1UG7 A;  2Y69 C;  4U5H A;  1RJ9 B;  1F1M A;  3RW0 A;  4C3B A;  3M4B A;  4I1O B;  3QW0 A;  3R2P A;  4CX9 A;  3B0P A;  3ATP A;  4CS9 A;  1NSG B;  2XM4 A;  4MW8 A;  1LKX A;  4GEH A;  4NTF A;  1TKN A;  4JZA A;  2EIN C;  3LS0 A;  4Z9I A;  3S28 A;  4BPM A;  4DOZ A;  3W8I A;  1VK5 A;  4D4N A;  1GGQ A;  3RVY A;  4PFP A;  1E84 A;  1ZHW A;  1YZC A;  2H8A A;  2P6V A;  2RD9 A;  2Y3G A;  4IAR A;  3RQE A;  3V7O A;  1K40 A;  1G8X A;  4RD9 A;  4HFK B;  3I5P A;  4YJW A;  2QY9 A;  1K04 A;  2WB7 A;  2FFH A;  3SXK A;  1VMA A;  2FGY A;  2NUT B;  2VCA A;  4QI0 A;  3R7C A;  5F5H A;  4K0D A;  4XPY A;  1FAP B;  2B0H A;  5L0C A;  5E33 A;  5L0J A;  1JMW A;  4O6N A;  2RSE B;  3HTK C;  3DMD A;  3B0V C;  1D0X A;  3ZSU A;  5FZT A;  1H9T A;  2XS1 A;  4N4W A;  3IQT A;  5T3T A;  5EGY A;  1LIH A;  4XLP F;  2Y3D A;  2A6H F;  2BC5 A;  4LAC B;  3ZG1 A;  3CEX A;  3W8H A;  3T6G B;  5A6K A;  2GDC A;  4LER A;  1R4T A;  2AVK A;  1LE4 A;  2Q4F A;  2EPM X;  4IGG A;  2EIK C;  1WTY A;  4DXW A;  1OW7 A;  1B68 A;  1IW7 F;  2R03 A;  1VLT A;  3G4Z A;  4G7Z F;  1J8Y F;  2R7T A;  1UFB A;  2GWW A;  1ZHZ A;  2OEV A;  1T6Q A;  3IQ5 A;  3LS1 A;  3O39 A;  4EIY A;  1OXK A;  1FFH A;  4DRH B;  4JJG A;  3HNL A;  3UR3 C;  3GEH A;  3ZWI A;  1EI7 A;  1IZM A;  1TWG A;  3TJ6 A;  1Z6A A;  4HFF B;  3AG4 C;  3QVY A;  2IBF A;  1V54 C;  4OIO F;  1RXQ A;  1M2V A;  3FOP A;  4JCH A;  4U5C E;  3DZA A;  5DVW A;  1ZU4 A;  2TMV P;  5DS6 A;  3B9Q A;  3U8P A;  3OA1 A;  5KYW B;  1QSP A;  2R7R A;  4BJ5 C;  3A9C A;  4NC3 A;  1ZHT A;  3ABK C;  3AGU A;  4A2N B;  2ETS A;  4G78 A;  1ZW3 A;  4M63 A;  4KBL A;  4MQ9 F;  2A69 F;  2HV7 A;  3GM3 A;  2KC3 A;  3TOL A;  1J8M F;  5KYU B;  2HS5 A;  4MVQ A;  4GQH A;  1BR2 A;  2A68 F;  3B29 A;  2KQ9 A;  2VC9 A;  1WWP A;  1A0B A;  1YVI A;  4E0H A;  1YYX A;  4MTO A;  5COM A;  2D4U A;  3B0U X;  4DBR A;  2I8B A;  4AE4 A;  4JTC B;  3AJM A;  1BR1 A;  3GM2 A;  4BJ5 A;  1E85 A;  5B3S C;  1NFO A;  3PCV A;  1RKC A;  5A6B A;  4HE8 D;  1M56 C;  3JSZ A;  4OIN F;  5KYY A;  2WZL A;  4N6C A;  3UGO A;  1T6U A;  1CPR A;  1Z7Q c;  3SYN A;  2YLD A;  2KNH A;  4PR9 A;  4CS7 A;  3HJC A;  3EHM A;  2E87 A;  3KKB A;  1Q0K A;  2CNW D;  4FX5 A;  4O7G A;  4F4B A;  4ZLD A;  1T9K A;  3EFO A;  3DWW A;  5HV9 A;  1CGM E;  4JEA A;  3H2V A;  3C8G A;  3HNI A;  2FAP B;  1HE1 A;  1QLE C;  2ZXP A;  1EA8 A;  4CIP A;  2P7V A;  2Q9A A;  5B1A C;  2PP4 A;  3X2Q C;  2Q7R A;  5CI9 A;  1RMV A;  2ASR A;  2J7P D;  1A7D A;  2CGE A;  1T01 A;  2PF4 E;  3HKK A;  4QDL A;  5JSL A;  3TD7 A;  4JJF A;  3DAF A;  5TJ5 E;  2WL8 A;  1OKK A;  4U9D A;  2L6H A;  3CSK A;  1FFT C;  1QPU A;  2PBE A;  1E86 A;  2OKU A;  3US6 A;  1I5N A;  3IQ6 A;  3HNK A;  2Q3T A;  1E2X A;  3FAP B;  4E17 A;  2J46 A;  3UMK A;  3MFN A;  1HY5 A;  2X51 A;  3AG2 C;  3KH2 A;  1NU9 C;  2DYR C;  4IRU A;  4U5F E;  4MTG A;  3NRH A;  3EGD A;  4PJM A;  2EPK X;  2HFI A;  3ITF A;  3S9O A;  4IAQ A;  4AL0 A;  2ZD9 A;  4E18 A;  1L3P A;  3S90 A;  4Q7C A;  5FCL A;  4Z9J A;  3ZQY A;  3POV A;  4PFO A;  3NYJ A;  1BZ4 A;  1TR2 A;  1Z5Z A;  5KYX A;  1C02 A;  3L0I A;  5GPG B;  4XPW A;  3GOR A;  2XRH A;  2L81 A;  3ABL C;  4CS9 C;  1MMD A;  2IXN A;  2R7U A;  4MVR A;  3B71 A;  3OEO A;  4PJL A;  3U5S A;  3FOO A;  2XLO A;  4KNW A;  4C7O B;  3VM6 A;  2V3C C;  2CCY A;  3EH2 A;  1TWA A;  2IOQ A;  4NCQ A;  4U5G A;  2XLD A;  1HMD A;  3AG3 C;  1OW8 A;  3HNJ A;  3LNR A;  4YL1 A;  2LK4 A;  5D92 A;  3ABM C;  2YQY A;  1TFO B;  3U0C A;  1Q0M A;  2EIJ C;  2P0N A;  2LQG A;  3O55 A;  4YT4 A;  2XXA A;  2CW0 F;  4CDA A;  3E70 C;  3VAY A;  1WN0 A;  4WGZ A;  4U5D E;  2JD3 A;  1KU2 A;  2MHR A;  4JTD B;  3SEO A;  1SR2 A;  3NYL A;  3FVY A;  4W8K A;  1H6G A;  3U2L A;  1OXB A;  4OIP F;  4BJT A;  4BJ1 A;  1ZW2 A;  1KTM A;  1BR4 A;  4DRI B;  3RH3 A;  3JZ0 A;  1YYJ A;  2R7Q A;  2WVQ A;  1OCR C;  2R05 A;  4DRJ B;  1U0B B;  2QE9 A;  1BBH A;  3C18 A;  4JUR I;  3RYL A;  3RF3 A;  4I3M A;  3ASN C;  1S05 A;  2XLH A;  2J9V A;  3N2Z B;  3EPV A;  3ZIB A;  2LIG A;  3U9J A;  2R02 A;  5COF A;  1DOW A;  2R7X A;  1V55 C;  3LES A;  4A4A A;  1LI5 A;  1FR0 A;  2WVN A;  2A6E F;  1XWJ A;  4PK4 A;  4IB4 A;  2R7W A;  4KC9 A;  5BQH A;  4JE9 A;  1NU7 D;  4E7Z A;  4DJ9 A;  5DS4 A;  2EPN A;  4CSA C;  1JAF A;  2DB4 A;  3M15 A;  1C03 A;  3BEH A;  3RVZ A;  3U9M A;  2J0X A;  3JT1 A;  3QVZ A;  3W2W A;  3KPH A;  2J9W A;  3EFO B;  4DBQ A;  4YK5 A;  4P9T A;  3GOD A;  4B6I A;  3ASO C;  2H7O A;  4KI2 A;  3DJU B;  2HZ8 A;  3EH1 A;  1LM3 B;  3LEO A;  4O6M A;  3NKE A;  3GAN A;  1ZHY A;  3TUL A;  2L7A A;  1VYI A;  3QTH A;  5KYN A;  5AC5 A;  3TK0 A;  1NLX A;  1Q0F A;  2R7V A;  1OCO C;  5AC4 A;  5JS5 A;  1FMW A;  1OQC A;  4FAP B;  2AP3 A;  1D1C A;  1O3U A;  1SMY F;  1Y6D A;  1ZVZ A;  4CSA A;  3Q7L A;  2J9B A;  4OIQ F;  1ZZP A;  2PX3 A;  2YHS A;  3T9O A;  3U3B A;  3G4X A;  2XL6 A;  2LFD A;  3M1C B;  2G3K A;  3O6X A;  3T6B A;  3MLG A;  4WJ0 A;  1WAT A;  3LUT B;  2QLA A;  5L0I A;  2L9J A;  4XEK A;  2HSQ A;  1K05 A;  2CNW A;  1O87 A;  1WOL A;  3JRM O;  1D0Y A;  1HW2 A;  1DOV A;  3GEI A;  3LJB A;  3ZVR A;  2LSE A;  3G50 A;  4LDQ A;  4CDV A;  1E83 A;  3C62 A;  1FMV A;  3DKA A;  3SXZ A;  4EHP A;  1NFN A;  3AQC A;  1M57 C;  3DI5 A;  3QMK A;  3RFY A;  2C03 A;  5T1D B;  3SP1 A;  2A1D D;  2EIM C;  2NPU A;  2W4M A;  2XM0 A;  5KYX B;  1VLS A;  2NUP A;  2M4E A;  3SXM A;  2J7P A;  4EBJ A;  4J30 B;  3PHF 2;  5BQI A;  2GFH A;  1A41 A;  1N1C A;  3KMI A;  2YVK A;  3L1M A;  4EBK A;  2IXP A;  5COG A;  3DE8 A;  2A0U A;  1QQ3 A;  4EKW A;  1MNE A;  3NKD A;  4OD4 A;  2QNL A;  1ZYR F;  4EUK B;  4YL0 A;  2OU6 A;  2R25 A;  5B3I A;  2YRF A;  4AL1 A;  2D5R B;  1AVO B;  4YT2 A;  1ORJ A;  2YL7 A;  1C17 M;  3V5Y A;  3DM5 A;  3PDM P;  4PJJ A;  1RKE A;  3JRT A;  2HUJ A;  4LLC A;  1VB5 A;  4AK9 A;  1L7C A;  2AU5 A;  1CGO A;  3FHD A;  1MMG A;  2YWA A;  4C3D A;  2ZXR A;  2NUT A;  1G5Z A;  2VCB A;  5EK0 A;  1T6I A;  1SF8 A;  1YA7 O;  3M4C A;  1BDJ B;  3C7J A;  3UGP A;  1WGW A;  3OWT A;  2OQM A;  4ONS A;  4UDV A;  4G7H F;  3RQG A;  4NQF A;  5JT4 A;  4EBB A;  5L0G A;  3IPM O;  2J8W A;  1Z23 A;  3LLI A;  4JKV A;  1Y4C A;  3LNM B;  3AGT A;  3NMI A;  1SYQ A;  2IYL D;  4KNV A;  5IY5 C;  4ANJ A;  4RDA A;  4D4X A;  5L0F A;  1TFK B;  2W45 A;  3VF0 A;  5L0H A;  1JPJ A;  3WOD F;  2AWY A;  3EHN A;  2UUI A;  3CZ6 A;  2KW3 C;  3RIP A;  3MBG A;  3F47 A;  3LEV A;  4W8P A;  4ER9 A;  3J06 A;  1JRA A;  5E3C A;  3KYJ A;  4E0I A;  3K66 A;  1YLM A;  2R7O A;  3HLZ A;  1VYK A;  1R5I D;  2C04 A;  2KGO A;  2Q9B A;  1NZE A;  1G4W R;  3TOM A;  1V4A A;  2L6F A;  4PJN A;  4I44 A;  2HSB A;  2YL1 A;  4XPX A;  4JCZ A;  1S7Z A;  4YN0 B;  1VTM P;  4LDR A;  3N0T A;  1LE2 A; 
#chains in the Genus database with same CATH homology
 5KYW A;  2XSE A;  5DQZ A;  1PD1 A;  2KJG A;  3WG7 C;  1Z63 A;  4IJJ A;  2H7B A;  1Z3I X;  4O79 A;  4EWC A;  5KYU A;  4ULW A;  3AQB A;  4RBN A;  3SNH A;  1QZX A;  3EGX A;  3MX3 A;  5E3A A;  1M2V B;  1ZHX A;  1JPN A;  1TWH A;  4BEJ A;  4JVS A;  3X1O A;  4FWV A;  3PMR A;  1OCZ C;  3K7D A;  3UMH A;  2XL4 A;  4G0H A;  4CS8 A;  1TWC A;  4YT5 A;  4C3E A;  2G3V A;  4AE4 B;  2NUP B;  2Y3H A;  4CIH A;  4YT8 A;  3QZC A;  1MMA A;  4E7S A;  2YEV A;  5KYY B;  4ZLC A;  3T4R A;  4XLN F;  2Y3B A;  1NG1 A;  4FES A;  2IXM A;  2DGJ A;  5BUO A;  3NYM A;  3Q6M A;  1D1A A;  1D0Z A;  1LVK A;  1ZU5 A;  3DAG A;  3EG9 A;  2J9U A;  2Z15 A;  3S27 A;  2ZXO A;  5HSW A;  3H65 A;  4NY3 A;  3K33 A;  3S29 A;  2ZPA A;  3K6B A;  2YZS A;  3SZR A;  2IXO A;  3NG1 A;  4YWQ A;  3DXJ F;  1W2W A;  3KL4 A;  4G7O F;  2J0W A;  2OCC C;  1OCC C;  3DJN B;  1ST6 A;  2Q9C A;  2H7V C;  1MMN A;  3EJN A;  1VOM A;  2WZF A;  3EGD B;  4DVY P;  5DQT A;  3ZC4 A;  5E2Q A;  4OD5 A;  4C7O A;  3N24 A;  2O9X A;  4MND A;  3L34 A;  1RJ9 A;  3EZI A;  2PX0 A;  5F5F A;  3JCU Q;  2DYS C;  4OIR F;  4BJ6 C;  2V26 A;  2W9Y A;  3I5Q A;  4JW1 A;  3IEE A;  2NG1 A;  5DLJ A;  4U5E E;  4X0R A;  4AX2 A;  4LLE A;  3FDQ A;  3CQZ A;  4XTK A;  3EGX B;  2EIL C;  1O5H A;  5B1B C;  4J32 B;  2XXA B;  5D91 A;  2WVO A;  1SZI A;  2OG2 A;  4BJ6 A;  4DVZ A;  5T3W A;  3S0X A;  1PD0 A;  3FAJ A;  2VB6 A;  3W2V A;  2MWQ A;  4G7Z F;  2W4B A;  3UNG C;  1FTS A;  1M2O A;  4O6Y A;  1MND A;  2Y39 A;  2B0J A;  3Q7G A;  4OIQ F;  3RIP A;  2ZXW C;  2J45 A;  3EQL F;  4P6I C;  3I4U A;  3DD7 A;  4U5B E;  3K1H A;  3K1I C;  5CI8 A;  2VAS A;  3AG1 C;  3LAY A;  3NDB B;  3UMI A;  1D1B A;  3E9V A;  2WZG A;  2G62 A;  4I1M A;  3EG9 B;  4HEA J;  4XWJ A;  3ECS A;  2QTV A;  5DS5 A;  4Q5S F;  3RKO F;  1LS1 A;  3Q6N A;  4BG0 A;  5L3V A;  5EHH A;  2PFD A;  4CS8 C;  4H4K C;  2BE5 F;  2CDQ A;  1PCX A;  2VH3 A;  2HV6 A;  3DM9 B;  3JYH A;  3T6J A;  4Q4Z F;  4K7B A;  1OKK D;  5L3Q A;  4GYT A;  3LLK A;  4QI2 A;  3F46 A;  2R7S A;  3EZH A;  4CBE A;  3VYW A;  4IWB A;  2MYS A;  4N06 A;  4IAO A;  2Y69 C;  4U5H A;  1RJ9 B;  4C3B A;  4I1O B;  3B0P A;  4CS9 A;  1LKX A;  4GEH A;  1TKN A;  4JZA A;  2EIN C;  3LS0 A;  3S28 A;  4DOZ A;  3W8I A;  1VK5 A;  4PFP A;  1ZHW A;  2P6V A;  2Y3G A;  3V7O A;  1G8X A;  4RD9 A;  4HFK B;  3I5P A;  4YJW A;  2QY9 A;  2WB7 A;  2FFH A;  5F5H A;  1VMA A;  2FGY A;  2NUT B;  4QI0 A;  4K0D A;  5E33 A;  4O6N A;  3HTK C;  3DMD A;  3B0V C;  1D0X A;  3ZSU A;  5T3T A;  5EGY A;  4XLP F;  2Y3D A;  2A6H F;  4LAC B;  3ZG1 A;  3W8H A;  4LER A;  2EIK C;  1IW7 F;  1J8Y F;  2R7T A;  3O39 A;  1ZHZ A;  3LS1 A;  1FFH A;  4JJG A;  3UR3 C;  1IZM A;  1TWG A;  1Z6A A;  4HFF B;  3AG4 C;  1V54 C;  4OIO F;  4JCH A;  1M2V A;  5DVW A;  4U5C E;  3DZA A;  1ZU4 A;  5DS6 A;  3B9Q A;  3OA1 A;  5KYW B;  2R7R A;  4BJ5 C;  1ZHT A;  3ABK C;  4A2N B;  4M63 A;  4KBL A;  4MQ9 F;  2A69 F;  2HV7 A;  1J8M F;  5KYU B;  1BR2 A;  2A68 F;  2KQ9 A;  4DBR A;  2I8B A;  4AE4 A;  1BR1 A;  4BJ5 A;  5B3S C;  4HE8 D;  1M56 C;  3JSZ A;  4OIN F;  5KYY A;  2WZL A;  3UGO A;  3SYN A;  4CS7 A;  2KNH A;  3HJC A;  3EHM A;  2E87 A;  3KKB A;  4O7G A;  2CNW D;  4FX5 A;  4ZLD A;  4F4B A;  3EFO A;  2ZXP A;  1QLE C;  2P7V A;  2Q9A A;  5B1A C;  2PP4 A;  3X2Q C;  5CI9 A;  2J7P D;  2CGE A;  2PF4 E;  4QDL A;  3TD7 A;  4JJF A;  3DAF A;  2WL8 A;  1OKK A;  3CSK A;  1FFT C;  2Q3T A;  2J46 A;  3UMK A;  3AG2 C;  2X51 A;  3KH2 A;  1NU9 C;  2DYR C;  4IRU A;  4U5F E;  3NRH A;  3EGD A;  4PJM A;  3ITF A;  4Q7C A;  5FCL A;  3POV A;  4PFO A;  3NYJ A;  1TR2 A;  1Z5Z A;  5KYX A;  3L0I A;  2XRH A;  2L81 A;  3ABL C;  4CS9 C;  1MMD A;  2IXN A;  2R7U A;  3OEO A;  4PJL A;  4KNW A;  4C7O B;  2V3C C;  3EH2 A;  1TWA A;  2IOQ A;  4U5G A;  3AG3 C;  3LNR A;  5D92 A;  3ABM C;  2EIJ C;  2XXA A;  4YT4 A;  2CW0 F;  3E70 C;  3VAY A;  4U5D E;  2JD3 A;  1KU2 A;  3SEO A;  3NYL A;  3FVY A;  4W8K A;  4OIP F;  4BJT A;  4BJ1 A;  1BR4 A;  3RH3 A;  2R7Q A;  2WVQ A;  1OCR C;  4JUR I;  3RYL A;  4I3M A;  3ASN C;  3N2Z B;  2J9V A;  3EPV A;  3ZIB A;  2R7X A;  1V55 C;  3LES A;  2WVN A;  2A6E F;  4PK4 A;  2R7W A;  4KC9 A;  1NU7 D;  4E7Z A;  5DS4 A;  4CSA C;  2J0X A;  3JT1 A;  3W2W A;  4DBQ A;  2J9W A;  3EFO B;  3GOD A;  4B6I A;  3ASO C;  2H7O A;  4KI2 A;  3DJU B;  3EH1 A;  4O6M A;  3NKE A;  3GAN A;  1ZHY A;  1VYI A;  5KYN A;  2R7V A;  1OCO C;  1FMW A;  1D1C A;  1SMY F;  4CSA A;  3Q7L A;  2PX3 A;  2YHS A;  3M1C B;  2G3K A;  3O6X A;  3T6B A;  3MLG A;  4WJ0 A;  2L9J A;  2CNW A;  1O87 A;  1D0Y A;  3LJB A;  3ZVR A;  2LSE A;  1FMV A;  3AQC A;  1M57 C;  3RFY A;  3QMK A;  2C03 A;  5T1D B;  3SP1 A;  2A1D D;  2EIM C;  2W4M A;  5KYX B;  2NUP A;  2M4E A;  2J7P A;  4J30 B;  3PHF 2;  2GFH A;  1N1C A;  3KMI A;  2IXP A;  1MNE A;  3NKD A;  4OD4 A;  1ZYR F;  2D5R B;  4YT2 A;  3DM5 A;  4PJJ A;  3JRT A;  4LLC A;  4AK9 A;  3B0U X;  4C3D A;  3FHD A;  1MMG A;  2ZXR A;  2NUT A;  1SF8 A;  3UGP A;  1WGW A;  3OWT A;  4G7H F;  4EBB A;  1Z23 A;  3LLI A;  4KNV A;  2IYL D;  5IY5 C;  4ANJ A;  4RDA A;  2W45 A;  1JPJ A;  3WOD F;  3EHN A;  3CZ6 A;  2KW3 C;  3F47 A;  3LEV A;  5E3C A;  3K66 A;  2R7O A;  3HLZ A;  1VYK A;  2Q9B A;  2C04 A;  2KGO A;  1NZE A;  4PJN A;  4I44 A;  4YN0 B;  1S7Z A;  3N0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...