3HNKA

Crystal structure of the dimeric assembly of the cyt cb562 variant ridc-1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hnkA00
1YYJA 4IB4A 3NMKA 3IQ5A 4U9DA 1JAFA 1CGOA 3U8PA 1RCPA 3HNLA 4D4XA 3TOMA 4U9EA 1QPUA 1APCA 2BC5A 2YL7A 4JE9A 2XLMA 3M79A 3TOLA 4CDAA 5JUAA 2YLDA 1E85A 1CGNA 5JT4A 2XLOA 3M4BA 2J9BA 2XLWA 4CJOA 4CX9A 3FOOA 3ZWIA 1CPRA 3NMJA 3IQ6A 2XM0A 5JS5A 1CPQA 4CDYA 2XL6A 1E83A 1YZAA 1MQVA 3DE8A 5JVEA 3QW0A 3QVYA 3C63A 4JEAA 4IARA 2YL1A 3ZTZA 1E84A 2YL3A 4JKVA 2YLGA 5JRAA 1GQAA 4IAQA 2XLDA 3HNKA 3HNJA 2QLAA 4JEBA 3DE9A 2J8WA 1YZCA 3NMIA 2CCYA 2YLIA 1E86A 5B3IA 1EKYA 2XL8A 4NC3A 4WGZA 3C62A 4WGYA 4CJGA 2XLVA 2YKZA 3L1MA 3ZQYA 4D4NA 1M6TA 2XM4A 3QVZA 4ULVA 3ZTMA 3M4CA 4ER9A 1QQ3A 1A7VA 3M15A 1BBHA 2YL0A 5AGFA 4N4WA 4N6HA 4L6RA 5JLIA 4EIYA 1LM3B 3QW1A 3VRCA 3HNIA 1NBBA 1YYXA 2XLEA 2XLHA 4CDVA 3ZQVA 4CIPA 256BA 3FOPA 1S05A 5JP7A 5JSLA
chains in the Genus database with same CATH superfamily
2WL8A 3O55A 5T3TA 3UMKA 4YT8A 3J06A 4QI2A 1C17M 3I4UA 3WHNA 2NUPA 2OKUA 4NTAA 3IQ5A 4OD5A 4U5HA 2B0JA 1NU7D 4U9DA 1MMGA 1UFBA 2Y3BA 4MTFA 4E17A 1GS9A 4AK9A 3U8PA 2H7OA 5AC4A 3TOMA 2KQ9A 2A0UA 3E70C 1MNDA 2ASRA 3JSEO 1WASA 4C3EA 3KPHA 3FVYA 3Q6MA 4AX2A 3B0UX 2V3CC 3MLGA 1JRAA 3M79A 4ULWA 3TOLA 4CDAA 3HKKA 1ZW2A 2H8AA 3IQTA 3K6BA 3CSKA 1ST6A 5L3VA 3M4BA 4BJ6C 2Q7RA 1Z5ZA 2LCHA 4J7TA 3B9QA 3FMSA 2W4BA 5BQIA 1EI7A 3MFNA 1JMWA 5T1DB 4G7HF 4I1MA 3RYLA 4Z9JA 4MW3A 3Q6NA 1Z7Qc 3NMJA 3U9JA 1ORYA 1HW2A 2M64A 2HSQA 3L34A 2J7PA 2R7VA 2XM0A 2ZD9A 1SZIA 3KYJA 1G4US 3AG3C 3ASOC 4YL0A 3POVA 1QZXA 3MYFA 3DM9B 4CDYA 5KYWB 2M4EA 3GM3A 4AL0A 5GPGB 1WOLA 4C3BA 1ZHWA 1C02A 2BE5F 2RD9A 3DZAA 3QW0A 1HMDA 3QVYA 3PDMP 4MQ9F 1NFNA 3C63A 3V5XA 4YT4A 1HW1A 2L6HA 2WB7A 4G7OF 2KGOA 1FTSA 3GANA 3JSZA 5AC5A 4PACA 1ZHXA 5COFA 2CNWD 2VH3A 1VYIA 4KC9A 4PR9A 4RDAA 4AE4A 4MTOA 2H7BA 3C8GD 3M1CB 3RVZA 1LI5A 3LAYA 3K33A 1U6HA 4MW8A 3LS1A 1ZHYA 2EPLX 1RJ9A 5CI9A 2XXAB 2J9VA 3LLKA 4HE8D 1KU2A 3SEOA 4FWVA 3AGUA 4OIOF 2PX0A 1J8MF 1G8XA 4MVOA 1GGQA 3EGDA 3NMIA 4LLCA 2WVNA 3EHNA 2CW0F 3OEOA 3RF3A 1Q0KA 5B3SC 5B3IA 1VOMA 2XL8A 4BJ5A 2V26A 2HV6A 1FMWA 3EZHA 3GM2A 4CSAC 1JPJA 4CJGA 3JYYA 4MVSA 2XLVA 4O79A 5T3WA 1VLTA 1KNYA 2A0BA 1ZU4A 2A6EF 2GDCA 4JIOA 1TWAA 1VB5A 4F4BA 4XLNF 4C7OA 3QTHA 2ZXOA 1Z23A 2EPMX 2I15A 3U8VA 1OQCA 1QQ3A 1RKEB 1S7ZA 2PF4E 3DD7A 3DJNB 4BEMJ 3GORA 1AUEA 2DI3A 5E2QA 1OCRC 4DRIB 3SP1A 5CI8A 1D0XA 1T6QA 3TULA 4N4WA 3KYIA 1OR3A 5BQHA 2R7UA 3TJ6A 2LK4A 1O5HA 2AU5A 2HKVA 3AJMA 3SXKA 2W9YA 1NSGB 2F22A 4YT2A 5KYYB 2HUJA 5E3CA 3RFYA 3ZG1A 3DWWA 1YYXA 3PMRA 3W4YA 2CNWA 3HLZA 4M63A 1WTYA 1Y4CA 2DB4A 1K04A 3C8GA 3C7JA 2KW3C 1S05A 3B29A 3DKAA 3US6A 4CS8C 2CGEA 3G4ZA 5JSLA 1M2VA 3X1OA 1NLXA 5B1BC 5IY5C 3NMKA 1T6UA 2Z15A 5EK0A 2ZXRA 4QDLA 1BDJB 3FDQA 3KMIA 1CGOA 3ABLC 2IM8A 3A11A 4IRUA 5L0JA 1I4YA 2OCCC 4KNVA 2OEXA 1Q0FA 2OG2A 4U9EA 1MMDA 3JT1A 1SR2A 2BC5A 3TJ5A 4MVQA 4KNWA 2Y39A 5DQZA 1R4TA 2Q3TA 3H65A 4NTFA 1T6IA 2P0NA 4JRZA 5DVWA 3DAGA 4DBQA 5JUAA 5L0FA 1HMOA 1LVKA 3EFOB 4LLEA 3ABMC 2HV7A 3JTLO 3ATPA 4JURI 4EBKA 2R7WA 3A9CA 2XLOA 3LJBA 2XLWA 4ZLDA 1BR2A 3NG1A 2KC3A 4CS9C 2PNOA 3U5SA 5F28E 1Q0DA 1ZHTA 2LQGA 3ZWIA 2EIKC 3RQEA 2NUTA 4MVMA 4EKWA 4Q4ZF 3LUTB 3SNHA 2LD6A 1I4ZA 3NYJA 4JVSA 3IQ6A 1MNEA 3W2VA 2A69F 3H2UA 5KYUA 2OJED 3IHUA 1RMVA 1K40A 1H9TA 3VM6A 2R02A 1I5NA 3CEXA 3EH2A 3LEVA 4O7GA 4PFPA 4A4AA 1AEPA 1CPQA 2HZ8A 2XL6A 4UDVA 3T6GB 1YDIA 1MQVA 1OKKD 4QI0A 3U2LA 2WZLA 4JTDB 5F5FA 1FAPB 1H7IA 3B0VC 1TFOB 2AP3A 1YAUO 2VC9A 2GFHA 4JTAB 4P6IC 5KYNA 2IXNA 4I44A 3SYNA 5BUOA 3GEHA 2FGYA 2J0WA 2FAPB 1QVXA 2L6GA 3K1IA 2XL4A 3TD7A 4K0DA 4DJ9A 2XSEA 2YEVA 2H7VC 3KL4A 5L0CA 1E84A 2YL3A 2Y69C 3NKEA 3K7DA 4JKVA 3RQGA 3NYLA 5JRAA 3E9VA 4Z9HA 4IAQA 3K1HA 4E7SA 3GWNA 2P1AA 4O6YA 4K1OA 4O6MA 4NCQA 1D1BA 2Y3DA 4XEKA 4B6IA 1OCOC 2QLAA 4JEBA 4E7ZA 5EGYA 1JOGA 2J8WA 3ZC4A 4W8KA 1C03A 2CCYA 3OA1A 4N6CA 1FNTc 1PCXA 2A6HF 2ZXPA 3CZ6A 2P61A 2NSGA 2OU6A 4IGGA 4C3DA 5EHHA 1ZU5A 4E18A 5HSWA 1Q0MA 4XPXA 3EJNA 1Q0GA 3ABKC 3DI5A 2KK1A 2G3KA 4MS2A 2WZFA 4CS7A 4J30B 3ECSA 3GEEA 4PJMA 1Z6AA 3S9OA 2XS8A 2XM4A 4AE4B 4U5EE 3QVZA 4ULVA 3ZTMA 4EHPA 3M4CA 4RBNA 2HFIA 3AQCA 3EH1A 1XZPA 3S90A 4LDRA 3T6JA 4EBBA 1Z3IX 2O9XA 5L0IA 1YVIA 2R05A 2L9JA 1RJ9B 1GM5A 1NZEA 1LIHA 3BRJA 5KYXB 2R7RA 1FFHA 1OKKA 3U0CA 5JLIA 1BZ4A 3EGDB 1LM3B 1R5ID 4Z9IA 4CS8A 1B68A 4P9FA 1TQGA 2EPOA 4EBJA 5FCLA 3HNIA 4EWCA 3O39A 2R7TA 1E2XA 3DMDA 3G4XA 3LS0A 1HE1A 2EIMC 2X0CA 3S28A 2R7QA 5A6JA 2WVOA 3GODA 3S0XA 2J45A 4PJLA 1A7EA 1HY5A 2ZXWC 4A2NB 2OEVA 4WJ0A 4C7OB 3QMKA 1VMAA 5L0DA 2GWWA 2Q9BA 3RKOF 3UNGC 2EILC 2HSBA 4OD4A 1LS1A 1TWCA 2EPKX 3KH2A 4HEAJ 4XPYA 3GEIA 4DOZA 2HMQA 1OW8A 1F1MA 1Y6DA 2W4MA 5E3AA 4ZLCA 3HNLA 3ZDLA 2CYDA 5DLJA 4D4XA 2XRHA 4DRHB 3T4RA 3MX3A 4IAOA 1LI7A 2YL7A 5D92A 1BR1A 5DS6A 3IPMO 2P7VA 4IWBA 4JE9A 3R2PA 4G78A 2C04A 3IEEA 4BJTA 2QTVA 2OOCA 1OW7A 2LP4A 3R7CA 5L3QA 1E85A 1UG7A 2NPUA 4E0IA 5KYWA 1CGNA 1T01A 2OQMA 3C8GB 5JT4A 4BPMA 4J7YA 2J9BA 4CJOA 3AG1C 1D0ZA 3FXHA 4CX9A 4MVUA 2A68F 3FOOA 4U5FE 1M2VB 4WABA 1VTMP 1LPEA 1QLEC 3GWLA 1WATA 4JTCB 1CPRA 2DYRC 3L8JA 4IJJA 1HE9A 1D0YA 1EA8A 3O6XA 3RQFA 4LDQA 2ZPAA 5A6AA 2JPUA 1O3UA 1RKCA 4JJFA 1H9GA 4K7BA 5JS5A 4H54A 4E0HA 3AG2C 2YHSA 2LFDA 1E83A 3B0PA 4BJ6A 1YZAA 5JVEA 2YVKA 2GA0A 4PJNA 1A7DA 3PCVA 3EG9A 5HV9A 3EGXB 3JYHA 4G0HA 3FHDA 4JC7A 3ZIBA 4JCZA 1YARO 1QKRA 2YL1A 3CAXA 2IXPA 3ZTZA 2UUIA 3G50A 1ZVZA 1A0BA 4BJ5C 4DRJB 3EPVA 5A6KA 3H2VA 3RIPA 4BG0A 2NUTB 1XWJA 2NUPB 2YLGA 3WODF 1CGME 3UR3C 1IZMA 3S29A 1U0BB 2MHRA 2DYSC 4NY3A 4X0RA 5KYUB 3HNKA 3JRTA 3T6BA 3PHF2 4U5DE 3RH3A 3DE9A 2QUPA 3C8ZA 3DXJF 4GEHA 4GQHA 1YZCA 2D5RB 2IXOA 2KYHA 3T9OA 3KKBA 2YLIA 3F46A 4I1OB 1E86A 2HJMA 1EKYA 1SMYF 2PFDA 4NC3A 4WGZA 1ZZPA 4WGYA 1BR4A 3EFOA 1H6GA 1FFTC 3MBGA 4YT5A 5D91A 2YKZA 3DJUB 4MVRA 4RD9A 3VAYA 3L1MA 3UMHA 4JW1A 3SXZA 2B0HA 2JX0A 3EZIA 2DGJA 3N0TA 3W8HA 4YWQA 4XLPF 1M57C 4ER9A 4Q5SF 1DOWA 1A7VA 1U89A 2I8BA 4U5GA 3C18A 3I5PA 2J0XA 4J32B 2YL0A 3JCUQ 3N2ZB 5AGFA 3O10A 4FX5A 4PJJA 4N6HA 2QNLA 3U9MA 4CSAA 4L6RA 4XWJA 1V74B 5E33A 4MNDA 4ONSA 2TMVP 1WWPA 4YL1A 2YRFA 3W8IA 2J9UA 3QW1A 3AG4C 4NQFA 1KTMA 1JR8A 3VRCA 3VYWA 3LNMB 1TWHA 2KSFA 3S84A 2VASA 3ITFA 2J9WA 3LNRA 4JJGA 4XEFA 2JD3A 4ANJA 2IYLD 2Y3GA 4CDVA 2HJ3A 2L6FA 1TFKB 4PFOA 3TQOA 1OCZC 2ETSA 3ZQVA 4CBEA 1OXBA 3FOPA 2QE9A 1TWGA 2Q4FA 5L0GA 2EPNA 1ZHZA 4JZAA 1V54C 1YYJA 4IB4A 1NG1A 4YN0B 5DS4A 4G7ZF 2P6VA 1ZW3A 5COMA 3QZCA 5CIVA 1XZQA 1V4AA 1SYQA 1VLSA 3LLIA 3X2QC 2R7SA 3WG7C 3L8IA 1D1CA 1JAFA 2LSEA 2IOQA 5A69A 5K0IA 3Q7GA 1RCPA 2C03A 2J46A 3EQLF 3MYIA 1L3PA 1QPUA 2CDQA 1APCA 2KNHA 1LE4A 3F47A 3HJCA 2LIGA 2YZSA 3N24A 2PBEA 4HFKB 4XEVA 4YJWA 1AVOB 1OCCC 1WN0A 3CQZA 4XPWA 3S27A 1K05A 2VB6A 4LERA 4YK5A 2XLMA 2ICWG 5L0HA 2YLDA 1L7CA 3LEOA 3JRMO 2EIJC 2AWYA 1N1CA 4KBLA 1NU9C 1OR2A 1ORJA 4MVZA 1IW7F 2R9RB 3W2WA 2PP4A 3ZVRA 1TKNA 1OW6A 4HFFB 3UMIA 3VF0A 1G5ZA 2NSFA 3NRHA 3NYMA 5FZTA 3I5QA 4EUKB 5KYXA 3U3BA 1PD1A 4GYTA 2MYSA 3K1IC 2XXAA 3DAFA 2GAQA 4W8PA 3Q7LA 4U5BE 4OIQF 1YA7O 1M2OA 5A6BD 1WGWA 4YL3A 4OIRF 3TK0A 1SF8A 3DE8A 1JPNA 4CS9A 4DXWA 4DVYP 2AVKA 2WZGA 3V5ZA 5COGA 4H4KC 2OJQA 3WAQA 2AWCA 1O87A 1RXQA 4JCHA 4JEAA 4FAPB 2Q9AA 2HS5A 4IARA 4OIPF 4BJ1A 1YJGA 3HTKC 1LE2A 1EQ1A 3RVYA 2R7XA 3JZ0A 3SXMA 2L81A 1RKEA 4LACB 2YQYA 1VYKA 2QY9A 1GQAA 2E87A 4FESA 3IQCA 2D4UA 3FAJA 5F5HA 1YA9A 1D1AA 2XLDA 4LDKA 1YLMA 3U2MA 3HNJA 4CIHA 3UGOA 4XTKA 3K66A 2L7AA 3ASNC 1T5OA 2HMZA 1QSPA 3ZSUA 3OWTA 3UGPA 2PX3A 2EINC 1A41A 2R03A 5KYYA 1J8YF 1NFOA 3BEHA 5TJ5E 3EG9B 3C62A 3V5YA 2MWQA 3SXYA 2G3VA 5DS5A 1ZYRF 1PV3A 2KJGA 2X51A 3L0IA 2Q9CA 2FFHA 3LESA 1ORSC 4N06A 2R7OA 3ZQYA 2NG1A 4D4NA 1M6TA 1OXKA 1LKXA 4DBRA 2A1DD 2R25A 2UUHA 3AQBA 1FMVA 3NDBB 3M15A 4BEJA 1LS4A 2RSEB 2YWAA 1BBHA 1G4WR 4NTBA 1MMAA 2IXMA 3SZRA 4AL1A 5DQTA 5A6BA 3RW0A 1M56C 1W2WA 2LFFA 2BL2A 2WVQA 3B71A 2XS1A 4O6NA 4P9TA 3V7OA 4EIYA 2W45A 4XQ1A 5B1AC 2Q00A 2J7PD 2VCCA 3DM5A 1MMNA 4KI2A 2IBFA 3EGXA 1Z63A 4MTGA 4Q7CA 1NBBA 4OINF 3U3FA 1FR0A 1DOVA 4I3MA 4R32A 2XLEA 2Y3HA 3NKDA 2XLHA 2VCBA 2G62A 1VK5A 3EHMA 4CIPA 3AGTA 256BA 2VCAA 3FAPB 3GM1A 3AOUA 1PD0A 4PK4A 4U5CE 5JP7A 1TR2A 5BQGA 1T9KA 4DVZA 1V55C
chains in the Genus database with same CATH topology
1YYJA 4IB4A 3NMKA 3IQ5A 4U9DA 1JAFA 1CGOA 3U8PA 1RCPA 3HNLA 4D4XA 3TOMA 4U9EA 1QPUA 1APCA 2BC5A 2YL7A 4JE9A 2XLMA 3M79A 3TOLA 4CDAA 5JUAA 2YLDA 1E85A 1CGNA 5JT4A 2XLOA 3M4BA 2J9BA 2XLWA 4CJOA 4CX9A 3FOOA 3ZWIA 1CPRA 3NMJA 3IQ6A 2XM0A 5JS5A 1CPQA 4CDYA 2XL6A 1E83A 1YZAA 1MQVA 3DE8A 5JVEA 3QW0A 3QVYA 3C63A 4JEAA 4IARA 2YL1A 3ZTZA 1E84A 2YL3A 4JKVA 2YLGA 5JRAA 1GQAA 4IAQA 2XLDA 3HNKA 3HNJA 2QLAA 4JEBA 3DE9A 2J8WA 1YZCA 3NMIA 2CCYA 2YLIA 1E86A 5B3IA 1EKYA 2XL8A 4NC3A 4WGZA 3C62A 4WGYA 4CJGA 2XLVA 2YKZA 3L1MA 3ZQYA 4D4NA 1M6TA 2XM4A 3QVZA 4ULVA 3ZTMA 3M4CA 4ER9A 1QQ3A 1A7VA 3M15A 1BBHA 2YL0A 5AGFA 4N4WA 4N6HA 4L6RA 5JLIA 4EIYA 1LM3B 3QW1A 3VRCA 3HNIA 1NBBA 1YYXA 2XLEA 2XLHA 4CDVA 3ZQVA 4CIPA 256BA 3FOPA 1S05A 5JP7A 5JSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYJ A;  4IB4 A;  3NMK A;  3IQ5 A;  4U9D A;  1JAF A;  1CGO A;  3U8P A;  1RCP A;  3HNL A;  4D4X A;  3TOM A;  4U9E A;  1QPU A;  1APC A;  2BC5 A;  2YL7 A;  4JE9 A;  2XLM A;  3M79 A;  3TOL A;  4CDA A;  5JUA A;  2YLD A;  1E85 A;  1CGN A;  5JT4 A;  2XLO A;  3M4B A;  2J9B A;  2XLW A;  4CJO A;  4CX9 A;  3FOO A;  3ZWI A;  1CPR A;  3NMJ A;  3IQ6 A;  2XM0 A;  5JS5 A;  1CPQ A;  4CDY A;  2XL6 A;  1E83 A;  1YZA A;  1MQV A;  3DE8 A;  5JVE A;  3QW0 A;  3QVY A;  3C63 A;  4JEA A;  4IAR A;  2YL1 A;  3ZTZ A;  1E84 A;  2YL3 A;  4JKV A;  2YLG A;  5JRA A;  1GQA A;  4IAQ A;  2XLD A;  3HNK A;  3HNJ A;  2QLA A;  4JEB A;  3DE9 A;  2J8W A;  1YZC A;  3NMI A;  2CCY A;  2YLI A;  1E86 A;  5B3I A;  1EKY A;  2XL8 A;  4NC3 A;  4WGZ A;  3C62 A;  4WGY A;  4CJG A;  2XLV A;  2YKZ A;  3L1M A;  3ZQY A;  4D4N A;  1M6T A;  2XM4 A;  3QVZ A;  4ULV A;  3ZTM A;  3M4C A;  4ER9 A;  1QQ3 A;  1A7V A;  3M15 A;  1BBH A;  2YL0 A;  5AGF A;  4N4W A;  4N6H A;  4L6R A;  5JLI A;  4EIY A;  1LM3 B;  3QW1 A;  3VRC A;  3HNI A;  1NBB A;  1YYX A;  2XLE A;  2XLH A;  4CDV A;  3ZQV A;  4CIP A;  256B A;  3FOP A;  1S05 A;  5JP7 A;  5JSL A; 
#chains in the Genus database with same CATH topology
 2WL8 A;  3O55 A;  5T3T A;  3UMK A;  4YT8 A;  3J06 A;  4QI2 A;  1C17 M;  3I4U A;  3WHN A;  2NUP A;  2OKU A;  4NTA A;  3IQ5 A;  4OD5 A;  4U5H A;  2B0J A;  1NU7 D;  4U9D A;  1MMG A;  1UFB A;  2Y3B A;  4MTF A;  4E17 A;  1GS9 A;  4AK9 A;  3U8P A;  2H7O A;  5AC4 A;  3TOM A;  2KQ9 A;  2A0U A;  3E70 C;  1MND A;  2ASR A;  3JSE O;  1WAS A;  4C3E A;  3KPH A;  3FVY A;  3Q6M A;  4AX2 A;  3B0U X;  2V3C C;  3MLG A;  1JRA A;  3M79 A;  4ULW A;  3TOL A;  4CDA A;  3HKK A;  1ZW2 A;  2H8A A;  3IQT A;  3K6B A;  3CSK A;  1ST6 A;  5L3V A;  3M4B A;  4BJ6 C;  2Q7R A;  1Z5Z A;  2LCH A;  4J7T A;  3B9Q A;  3FMS A;  2W4B A;  5BQI A;  1EI7 A;  3MFN A;  1JMW A;  5T1D B;  4G7H F;  4I1M A;  3RYL A;  4Z9J A;  4MW3 A;  3Q6N A;  1Z7Q c;  3NMJ A;  3U9J A;  1ORY A;  1HW2 A;  2M64 A;  2HSQ A;  3L34 A;  2J7P A;  2R7V A;  2XM0 A;  2ZD9 A;  1SZI A;  3KYJ A;  1G4U S;  3AG3 C;  3ASO C;  4YL0 A;  3POV A;  1QZX A;  3MYF A;  3DM9 B;  4CDY A;  5KYW B;  2M4E A;  3GM3 A;  4AL0 A;  5GPG B;  1WOL A;  4C3B A;  1ZHW A;  1C02 A;  2BE5 F;  2RD9 A;  3DZA A;  3QW0 A;  1HMD A;  3QVY A;  3PDM P;  4MQ9 F;  1NFN A;  3C63 A;  3V5X A;  4YT4 A;  1HW1 A;  2L6H A;  2WB7 A;  4G7O F;  2KGO A;  1FTS A;  3GAN A;  3JSZ A;  5AC5 A;  4PAC A;  1ZHX A;  5COF A;  2CNW D;  2VH3 A;  1VYI A;  4KC9 A;  4PR9 A;  4RDA A;  4AE4 A;  4MTO A;  2H7B A;  3C8G D;  3M1C B;  3RVZ A;  1LI5 A;  3LAY A;  3K33 A;  1U6H A;  4MW8 A;  3LS1 A;  1ZHY A;  2EPL X;  1RJ9 A;  5CI9 A;  2XXA B;  2J9V A;  3LLK A;  4HE8 D;  1KU2 A;  3SEO A;  4FWV A;  3AGU A;  4OIO F;  2PX0 A;  1J8M F;  1G8X A;  4MVO A;  1GGQ A;  3EGD A;  3NMI A;  4LLC A;  2WVN A;  3EHN A;  2CW0 F;  3OEO A;  3RF3 A;  1Q0K A;  5B3S C;  5B3I A;  1VOM A;  2XL8 A;  4BJ5 A;  2V26 A;  2HV6 A;  1FMW A;  3EZH A;  3GM2 A;  4CSA C;  1JPJ A;  4CJG A;  3JYY A;  4MVS A;  2XLV A;  4O79 A;  5T3W A;  1VLT A;  1KNY A;  2A0B A;  1ZU4 A;  2A6E F;  2GDC A;  4JIO A;  1TWA A;  1VB5 A;  4F4B A;  4XLN F;  4C7O A;  3QTH A;  2ZXO A;  1Z23 A;  2EPM X;  2I15 A;  3U8V A;  1OQC A;  1QQ3 A;  1RKE B;  1S7Z A;  2PF4 E;  3DD7 A;  3DJN B;  4BEM J;  3GOR A;  1AUE A;  2DI3 A;  5E2Q A;  1OCR C;  4DRI B;  3SP1 A;  5CI8 A;  1D0X A;  1T6Q A;  3TUL A;  4N4W A;  3KYI A;  1OR3 A;  5BQH A;  2R7U A;  3TJ6 A;  2LK4 A;  1O5H A;  2AU5 A;  2HKV A;  3AJM A;  3SXK A;  2W9Y A;  1NSG B;  2F22 A;  4YT2 A;  5KYY B;  2HUJ A;  5E3C A;  3RFY A;  3ZG1 A;  3DWW A;  1YYX A;  3PMR A;  3W4Y A;  2CNW A;  3HLZ A;  4M63 A;  1WTY A;  1Y4C A;  2DB4 A;  1K04 A;  3C8G A;  3C7J A;  2KW3 C;  1S05 A;  3B29 A;  3DKA A;  3US6 A;  4CS8 C;  2CGE A;  3G4Z A;  5JSL A;  1M2V A;  3X1O A;  1NLX A;  5B1B C;  5IY5 C;  3NMK A;  1T6U A;  2Z15 A;  5EK0 A;  2ZXR A;  4QDL A;  1BDJ B;  3FDQ A;  3KMI A;  1CGO A;  3ABL C;  2IM8 A;  3A11 A;  4IRU A;  5L0J A;  1I4Y A;  2OCC C;  4KNV A;  2OEX A;  1Q0F A;  2OG2 A;  4U9E A;  1MMD A;  3JT1 A;  1SR2 A;  2BC5 A;  3TJ5 A;  4MVQ A;  4KNW A;  2Y39 A;  5DQZ A;  1R4T A;  2Q3T A;  3H65 A;  4NTF A;  1T6I A;  2P0N A;  4JRZ A;  5DVW A;  3DAG A;  4DBQ A;  5JUA A;  5L0F A;  1HMO A;  1LVK A;  3EFO B;  4LLE A;  3ABM C;  2HV7 A;  3JTL O;  3ATP A;  4JUR I;  4EBK A;  2R7W A;  3A9C A;  2XLO A;  3LJB A;  2XLW A;  4ZLD A;  1BR2 A;  3NG1 A;  2KC3 A;  4CS9 C;  2PNO A;  3U5S A;  5F28 E;  1Q0D A;  1ZHT A;  2LQG A;  3ZWI A;  2EIK C;  3RQE A;  2NUT A;  4MVM A;  4EKW A;  4Q4Z F;  3LUT B;  3SNH A;  2LD6 A;  1I4Z A;  3NYJ A;  4JVS A;  3IQ6 A;  1MNE A;  3W2V A;  2A69 F;  3H2U A;  5KYU A;  2OJE D;  3IHU A;  1RMV A;  1K40 A;  1H9T A;  3VM6 A;  2R02 A;  1I5N A;  3CEX A;  3EH2 A;  3LEV A;  4O7G A;  4PFP A;  4A4A A;  1AEP A;  1CPQ A;  2HZ8 A;  2XL6 A;  4UDV A;  3T6G B;  1YDI A;  1MQV A;  1OKK D;  4QI0 A;  3U2L A;  2WZL A;  4JTD B;  5F5F A;  1FAP B;  1H7I A;  3B0V C;  1TFO B;  2AP3 A;  1YAU O;  2VC9 A;  2GFH A;  4JTA B;  4P6I C;  5KYN A;  2IXN A;  4I44 A;  3SYN A;  5BUO A;  3GEH A;  2FGY A;  2J0W A;  2FAP B;  1QVX A;  2L6G A;  3K1I A;  2XL4 A;  3TD7 A;  4K0D A;  4DJ9 A;  2XSE A;  2YEV A;  2H7V C;  3KL4 A;  5L0C A;  1E84 A;  2YL3 A;  2Y69 C;  3NKE A;  3K7D A;  4JKV A;  3RQG A;  3NYL A;  5JRA A;  3E9V A;  4Z9H A;  4IAQ A;  3K1H A;  4E7S A;  3GWN A;  2P1A A;  4O6Y A;  4K1O A;  4O6M A;  4NCQ A;  1D1B A;  2Y3D A;  4XEK A;  4B6I A;  1OCO C;  2QLA A;  4JEB A;  4E7Z A;  5EGY A;  1JOG A;  2J8W A;  3ZC4 A;  4W8K A;  1C03 A;  2CCY A;  3OA1 A;  4N6C A;  1FNT c;  1PCX A;  2A6H F;  2ZXP A;  3CZ6 A;  2P61 A;  2NSG A;  2OU6 A;  4IGG A;  4C3D A;  5EHH A;  1ZU5 A;  4E18 A;  5HSW A;  1Q0M A;  4XPX A;  3EJN A;  1Q0G A;  3ABK C;  3DI5 A;  2KK1 A;  2G3K A;  4MS2 A;  2WZF A;  4CS7 A;  4J30 B;  3ECS A;  3GEE A;  4PJM A;  1Z6A A;  3S9O A;  2XS8 A;  2XM4 A;  4AE4 B;  4U5E E;  3QVZ A;  4ULV A;  3ZTM A;  4EHP A;  3M4C A;  4RBN A;  2HFI A;  3AQC A;  3EH1 A;  1XZP A;  3S90 A;  4LDR A;  3T6J A;  4EBB A;  1Z3I X;  2O9X A;  5L0I A;  1YVI A;  2R05 A;  2L9J A;  1RJ9 B;  1GM5 A;  1NZE A;  1LIH A;  3BRJ A;  5KYX B;  2R7R A;  1FFH A;  1OKK A;  3U0C A;  5JLI A;  1BZ4 A;  3EGD B;  1LM3 B;  1R5I D;  4Z9I A;  4CS8 A;  1B68 A;  4P9F A;  1TQG A;  2EPO A;  4EBJ A;  5FCL A;  3HNI A;  4EWC A;  3O39 A;  2R7T A;  1E2X A;  3DMD A;  3G4X A;  3LS0 A;  1HE1 A;  2EIM C;  2X0C A;  3S28 A;  2R7Q A;  5A6J A;  2WVO A;  3GOD A;  3S0X A;  2J45 A;  4PJL A;  1A7E A;  1HY5 A;  2ZXW C;  4A2N B;  2OEV A;  4WJ0 A;  4C7O B;  3QMK A;  1VMA A;  5L0D A;  2GWW A;  2Q9B A;  3RKO F;  3UNG C;  2EIL C;  2HSB A;  4OD4 A;  1LS1 A;  1TWC A;  2EPK X;  3KH2 A;  4HEA J;  4XPY A;  3GEI A;  4DOZ A;  2HMQ A;  1OW8 A;  1F1M A;  1Y6D A;  2W4M A;  5E3A A;  4ZLC A;  3HNL A;  3ZDL A;  2CYD A;  5DLJ A;  4D4X A;  2XRH A;  4DRH B;  3T4R A;  3MX3 A;  4IAO A;  1LI7 A;  2YL7 A;  5D92 A;  1BR1 A;  5DS6 A;  3IPM O;  2P7V A;  4IWB A;  4JE9 A;  3R2P A;  4G78 A;  2C04 A;  3IEE A;  4BJT A;  2QTV A;  2OOC A;  1OW7 A;  2LP4 A;  3R7C A;  5L3Q A;  1E85 A;  1UG7 A;  2NPU A;  4E0I A;  5KYW A;  1CGN A;  1T01 A;  2OQM A;  3C8G B;  5JT4 A;  4BPM A;  4J7Y A;  2J9B A;  4CJO A;  3AG1 C;  1D0Z A;  3FXH A;  4CX9 A;  4MVU A;  2A68 F;  3FOO A;  4U5F E;  1M2V B;  4WAB A;  1VTM P;  1LPE A;  1QLE C;  3GWL A;  1WAT A;  4JTC B;  1CPR A;  2DYR C;  3L8J A;  4IJJ A;  1HE9 A;  1D0Y A;  1EA8 A;  3O6X A;  3RQF A;  4LDQ A;  2ZPA A;  5A6A A;  2JPU A;  1O3U A;  1RKC A;  4JJF A;  1H9G A;  4K7B A;  5JS5 A;  4H54 A;  4E0H A;  3AG2 C;  2YHS A;  2LFD A;  1E83 A;  3B0P A;  4BJ6 A;  1YZA A;  5JVE A;  2YVK A;  2GA0 A;  4PJN A;  1A7D A;  3PCV A;  3EG9 A;  5HV9 A;  3EGX B;  3JYH A;  4G0H A;  3FHD A;  4JC7 A;  3ZIB A;  4JCZ A;  1YAR O;  1QKR A;  2YL1 A;  3CAX A;  2IXP A;  3ZTZ A;  2UUI A;  3G50 A;  1ZVZ A;  1A0B A;  4BJ5 C;  4DRJ B;  3EPV A;  5A6K A;  3H2V A;  3RIP A;  4BG0 A;  2NUT B;  1XWJ A;  2NUP B;  2YLG A;  3WOD F;  1CGM E;  3UR3 C;  1IZM A;  3S29 A;  1U0B B;  2MHR A;  2DYS C;  4NY3 A;  4X0R A;  5KYU B;  3HNK A;  3JRT A;  3T6B A;  3PHF 2;  4U5D E;  3RH3 A;  3DE9 A;  2QUP A;  3C8Z A;  3DXJ F;  4GEH A;  4GQH A;  1YZC A;  2D5R B;  2IXO A;  2KYH A;  3T9O A;  3KKB A;  2YLI A;  3F46 A;  4I1O B;  1E86 A;  2HJM A;  1EKY A;  1SMY F;  2PFD A;  4NC3 A;  4WGZ A;  1ZZP A;  4WGY A;  1BR4 A;  3EFO A;  1H6G A;  1FFT C;  3MBG A;  4YT5 A;  5D91 A;  2YKZ A;  3DJU B;  4MVR A;  4RD9 A;  3VAY A;  3L1M A;  3UMH A;  4JW1 A;  3SXZ A;  2B0H A;  2JX0 A;  3EZI A;  2DGJ A;  3N0T A;  3W8H A;  4YWQ A;  4XLP F;  1M57 C;  4ER9 A;  4Q5S F;  1DOW A;  1A7V A;  1U89 A;  2I8B A;  4U5G A;  3C18 A;  3I5P A;  2J0X A;  4J32 B;  2YL0 A;  3JCU Q;  3N2Z B;  5AGF A;  3O10 A;  4FX5 A;  4PJJ A;  4N6H A;  2QNL A;  3U9M A;  4CSA A;  4L6R A;  4XWJ A;  1V74 B;  5E33 A;  4MND A;  4ONS A;  2TMV P;  1WWP A;  4YL1 A;  2YRF A;  3W8I A;  2J9U A;  3QW1 A;  3AG4 C;  4NQF A;  1KTM A;  1JR8 A;  3VRC A;  3VYW A;  3LNM B;  1TWH A;  2KSF A;  3S84 A;  2VAS A;  3ITF A;  2J9W A;  3LNR A;  4JJG A;  4XEF A;  2JD3 A;  4ANJ A;  2IYL D;  2Y3G A;  4CDV A;  2HJ3 A;  2L6F A;  1TFK B;  4PFO A;  3TQO A;  1OCZ C;  2ETS A;  3ZQV A;  4CBE A;  1OXB A;  3FOP A;  2QE9 A;  1TWG A;  2Q4F A;  5L0G A;  2EPN A;  1ZHZ A;  4JZA A;  1V54 C;  1YYJ A;  4IB4 A;  1NG1 A;  4YN0 B;  5DS4 A;  4G7Z F;  2P6V A;  1ZW3 A;  5COM A;  3QZC A;  5CIV A;  1XZQ A;  1V4A A;  1SYQ A;  1VLS A;  3LLI A;  3X2Q C;  2R7S A;  3WG7 C;  3L8I A;  1D1C A;  1JAF A;  2LSE A;  2IOQ A;  5A69 A;  5K0I A;  3Q7G A;  1RCP A;  2C03 A;  2J46 A;  3EQL F;  3MYI A;  1L3P A;  1QPU A;  2CDQ A;  1APC A;  2KNH A;  1LE4 A;  3F47 A;  3HJC A;  2LIG A;  2YZS A;  3N24 A;  2PBE A;  4HFK B;  4XEV A;  4YJW A;  1AVO B;  1OCC C;  1WN0 A;  3CQZ A;  4XPW A;  3S27 A;  1K05 A;  2VB6 A;  4LER A;  4YK5 A;  2XLM A;  2ICW G;  5L0H A;  2YLD A;  1L7C A;  3LEO A;  3JRM O;  2EIJ C;  2AWY A;  1N1C A;  4KBL A;  1NU9 C;  1OR2 A;  1ORJ A;  4MVZ A;  1IW7 F;  2R9R B;  3W2W A;  2PP4 A;  3ZVR A;  1TKN A;  1OW6 A;  4HFF B;  3UMI A;  3VF0 A;  1G5Z A;  2NSF A;  3NRH A;  3NYM A;  5FZT A;  3I5Q A;  4EUK B;  5KYX A;  3U3B A;  1PD1 A;  4GYT A;  2MYS A;  3K1I C;  2XXA A;  3DAF A;  2GAQ A;  4W8P A;  3Q7L A;  4U5B E;  4OIQ F;  1YA7 O;  1M2O A;  5A6B D;  1WGW A;  4YL3 A;  4OIR F;  3TK0 A;  1SF8 A;  3DE8 A;  1JPN A;  4CS9 A;  4DXW A;  4DVY P;  2AVK A;  2WZG A;  3V5Z A;  5COG A;  4H4K C;  2OJQ A;  3WAQ A;  2AWC A;  1O87 A;  1RXQ A;  4JCH A;  4JEA A;  4FAP B;  2Q9A A;  2HS5 A;  4IAR A;  4OIP F;  4BJ1 A;  1YJG A;  3HTK C;  1LE2 A;  1EQ1 A;  3RVY A;  2R7X A;  3JZ0 A;  3SXM A;  2L81 A;  1RKE A;  4LAC B;  2YQY A;  1VYK A;  2QY9 A;  1GQA A;  2E87 A;  4FES A;  3IQC A;  2D4U A;  3FAJ A;  5F5H A;  1YA9 A;  1D1A A;  2XLD A;  4LDK A;  1YLM A;  3U2M A;  3HNJ A;  4CIH A;  3UGO A;  4XTK A;  3K66 A;  2L7A A;  3ASN C;  1T5O A;  2HMZ A;  1QSP A;  3ZSU A;  3OWT A;  3UGP A;  2PX3 A;  2EIN C;  1A41 A;  2R03 A;  5KYY A;  1J8Y F;  1NFO A;  3BEH A;  5TJ5 E;  3EG9 B;  3C62 A;  3V5Y A;  2MWQ A;  3SXY A;  2G3V A;  5DS5 A;  1ZYR F;  1PV3 A;  2KJG A;  2X51 A;  3L0I A;  2Q9C A;  2FFH A;  3LES A;  1ORS C;  4N06 A;  2R7O A;  3ZQY A;  2NG1 A;  4D4N A;  1M6T A;  1OXK A;  1LKX A;  4DBR A;  2A1D D;  2R25 A;  2UUH A;  3AQB A;  1FMV A;  3NDB B;  3M15 A;  4BEJ A;  1LS4 A;  2RSE B;  2YWA A;  1BBH A;  1G4W R;  4NTB A;  1MMA A;  2IXM A;  3SZR A;  4AL1 A;  5DQT A;  5A6B A;  3RW0 A;  1M56 C;  1W2W A;  2LFF A;  2BL2 A;  2WVQ A;  3B71 A;  2XS1 A;  4O6N A;  4P9T A;  3V7O A;  4EIY A;  2W45 A;  4XQ1 A;  5B1A C;  2Q00 A;  2J7P D;  2VCC A;  3DM5 A;  1MMN A;  4KI2 A;  2IBF A;  3EGX A;  1Z63 A;  4MTG A;  4Q7C A;  1NBB A;  4OIN F;  3U3F A;  1FR0 A;  1DOV A;  4I3M A;  4R32 A;  2XLE A;  2Y3H A;  3NKD A;  2XLH A;  2VCB A;  2G62 A;  1VK5 A;  3EHM A;  4CIP A;  3AGT A;  256B A;  2VCA A;  3FAP B;  3GM1 A;  3AOU A;  1PD0 A;  4PK4 A;  4U5C E;  5JP7 A;  1TR2 A;  5BQG A;  1T9K A;  4DVZ A;  1V55 C; 
#chains in the Genus database with same CATH homology
 1YYJ A;  4IB4 A;  3NMK A;  3IQ5 A;  4U9D A;  1JAF A;  1CGO A;  3U8P A;  1RCP A;  3HNL A;  4D4X A;  3TOM A;  4U9E A;  1QPU A;  1APC A;  2BC5 A;  2YL7 A;  4JE9 A;  2XLM A;  3M79 A;  3TOL A;  4CDA A;  5JUA A;  2YLD A;  1E85 A;  1CGN A;  5JT4 A;  2XLO A;  3M4B A;  2J9B A;  2XLW A;  4CJO A;  4CX9 A;  3FOO A;  3ZWI A;  1CPR A;  3NMJ A;  3IQ6 A;  2XM0 A;  5JS5 A;  1CPQ A;  4CDY A;  2XL6 A;  1E83 A;  1YZA A;  1MQV A;  3DE8 A;  5JVE A;  3QW0 A;  3QVY A;  3C63 A;  4JEA A;  4IAR A;  2YL1 A;  3ZTZ A;  1E84 A;  2YL3 A;  4JKV A;  2YLG A;  5JRA A;  1GQA A;  4IAQ A;  2XLD A;  3HNK A;  3HNJ A;  2QLA A;  4JEB A;  3DE9 A;  2J8W A;  1YZC A;  3NMI A;  2CCY A;  2YLI A;  1E86 A;  5B3I A;  1EKY A;  2XL8 A;  4NC3 A;  4WGZ A;  3C62 A;  4WGY A;  4CJG A;  2XLV A;  2YKZ A;  3L1M A;  3ZQY A;  4D4N A;  1M6T A;  2XM4 A;  3QVZ A;  4ULV A;  3ZTM A;  3M4C A;  4ER9 A;  1QQ3 A;  1A7V A;  3M15 A;  1BBH A;  2YL0 A;  5AGF A;  4N4W A;  4N6H A;  4L6R A;  5JLI A;  4EIY A;  1LM3 B;  3QW1 A;  3VRC A;  3HNI A;  1NBB A;  1YYX A;  2XLE A;  2XLH A;  4CDV A;  3ZQV A;  4CIP A;  256B A;  3FOP A;  1S05 A;  5JP7 A;  5JSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...