3HNKA

Crystal structure of the dimeric assembly of the cyt cb562 variant ridc-1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hnkA00
3ZTZA 5AGFA 4U9EA 3FOOA 3TOLA 2YL0A 4CDVA 1CGNA 2QLAA 1QPUA 2XM0A 3QVZA 1YYXA 4NC3A 2XLDA 5B3IA 2XL6A 3IQ5A 3ZQYA 4JE9A 1QQ3A 2XLWA 3ZTMA 1GQAA 1YZCA 4CDYA 256BA 4D4XA 2YL3A 4CDAA 3M15A 1CPRA 1E83A 3HNIA 3QW0A 1S05A 4WGZA 3DE8A 1M6TA 4CX9A 5JP7A 2XLEA 4N4WA 2XM4A 1E85A 4JEBA 4WGYA 1RCPA 2XLVA 3HNLA 3FOPA 1EKYA 4D4NA 2YLGA 3HNJA 4ULVA 4EIYA 2YL7A 4ER9A 5JUAA 1E86A 4IB4A 2YLDA 4U9DA 3ZWIA 5JT4A 5JS5A 1A7VA 5JVEA 4JEAA 4IARA 3QW1A 4L6RA 3C63A 3M79A 3M4CA 3DE9A 3QVYA 1CPQA 1E84A 1BBHA 4JKVA 1JAFA 2YL1A 2CCYA 2J8WA 4N6HA 3U8PA 1CGOA 4IAQA 2J9BA 2XLHA 3NMJA 4CIPA 3C62A 2YLIA 3ZQVA 3HNKA 1MQVA 5JRAA 4CJGA 2XL8A 5JSLA 2XLOA 4CJOA 1APCA 1LM3B 1YZAA 5JLIA 2BC5A 1NBBA 2XLMA 2YKZA 3TOMA 3IQ6A 3M4BA 3NMIA 3NMKA 1YYJA 3L1MA 3VRCA
chains in the Genus database with same CATH superfamily
4CS7A 2O9XA 3V7OA 1YA7O 2R7UA 5T1DB 5COFA 2QUPA 4ONSA 2UUIA 4RDAA 2VCBA 1NSGB 2XM0A 5BQHA 3QVZA 2R7RA 2XLDA 5BUOA 4C7OB 1B68A 1LE4A 2NG1A 2NUTB 2P61A 3VF0A 4AX2A 3GM2A 5DS5A 1ORJA 3FXHA 2XL6A 3V5ZA 3ZQYA 4JE9A 5KYUA 2X0CA 2QTVA 4PACA 4AK9A 3ZTMA 2Y69C 4C3EA 1BR1A 4ZLCA 3DMDA 4PR9A 3DI5A 2OEVA 2XSEA 2GA0A 3RVYA 1VB5A 5KYXB 3POVA 2P7VA 2YHSA 1FR0A 2HKVA 4BJ5A 3Q7GA 2PX3A 3RIPA 4IAOA 5KYUB 2Z15A 3JRMO 3IHUA 1S05A 2XXAB 4OIRF 1QSPA 4O6YA 2GDCA 3R7CA 1A41A 2M4EA 2NSGA 5JP7A 2EIKC 4Z9JA 1KTMA 1Z6AA 2L6HA 3K6BA 5TJ5E 2LSEA 3RFYA 2PNOA 3AG4C 1JOGA 4KC9A 1ORSC 1E85A 1YVIA 4CS8A 2XLVA 4N6CA 2PP4A 4U5FE 1OCOC 3AQCA 2A6HF 2NSFA 3T4RA 3U9JA 4D4NA 4MNDA 3RVZA 4H54A 4IGGA 4JVSA 3EFOA 3FMSA 4YJWA 2Y3DA 4XQ1A 3V5YA 4YN0B 1TFKB 2HMQA 4I1MA 3ABMC 4LERA 2IXNA 1G8XA 3DWWA 4JJFA 5JUAA 3ITFA 4IB4A 2A0UA 2QNLA 3EH1A 4EBKA 4GEHA 4WJ0A 5DS4A 3CQZA 5JS5A 1A7VA 5F28E 2CNWD 1MNDA 1U0BB 3GEHA 1DOWA 2Q9BA 2R7OA 5DVWA 5K0IA 2HJ3A 2Y3GA 2GAQA 3JYYA 3ZC4A 4OIPF 1LS4A 4YT5A 3SXKA 2Q4FA 3JCUQ 1Y4CA 3AG3C 2DGJA 1HE1A 1R5ID 1UFBA 4EBBA 1BBHA 1RKCA 2H7OA 2KSFA 3AJMA 4IWBA 2J8WA 3HTKC 1N1CA 2HV7A 4N6HA 5L0FA 3A9CA 3RQEA 1BR2A 2OOCA 3Q7LA 3IQCA 1Q0DA 1M2VB 2I8BA 2R02A 2RD9A 3AG2C 2Y39A 3Q6MA 3ECSA 2PBEA 3HJCA 1C17M 4K1OA 3O55A 4W8KA 3H2UA 4JCHA 3SEOA 2EIJC 4CIPA 3B0UX 1VK5A 3IEEA 1LIHA 1L7CA 3RQGA 4J30B 2YLIA 1ZU4A 1LPEA 1MNEA 4JIOA 3ZIBA 1MQVA 1PV3A 4NTFA 4CJGA 5JRAA 5KYNA 3U8VA 2EPOA 2PF4E 2R7TA 4QDLA 4YT2A 1YAUO 3LEOA 1OXBA 1LM3B 1WWPA 3LS0A 3MYIA 5JLIA 5F5HA 2Q00A 1AVOB 3TK0A 3FDQA 4BJTA 2BC5A 1LKXA 2YWAA 2C03A 3EQLF 4JRZA 2R9RB 2MHRA 3JSZA 4LLCA 2EPKX 3RW0A 1T5OA 3X2QC 4YL3A 3E9VA 3EHMA 2R05A 2PX0A 3JT1A 4JURI 4FWVA 4OD4A 4Z9HA 4MVZA 3SXYA 2Y3HA 5A6BD 1YYJA 3NRHA 1J8YF 5COMA 1WTYA 3DXJF 2EINC 3FOOA 3QZCA 1OKKD 2A6EF 2YL0A 4XEFA 4CDVA 1RXQA 2V26A 4G0HA 2CYDA 4NTBA 5L0CA 1IZMA 2KW3C 3FAJA 4MTOA 3TULA 3ASOC 4JTDB 4AE4A 1YYXA 4NC3A 4FX5A 5A6AA 1OXKA 3SP1A 5D91A 5B3IA 1OCCC 1RKEB 2J0XA 4JC7A 3E70C 4XTKA 5DQZA 2XS1A 3IQ5A 1SR2A 2OEXA 1Z3IX 4CS9A 1QQ3A 1QLEC 3C8GB 3U2LA 4WABA 1OQCA 1YZCA 2HZ8A 3PCVA 3MYFA 4HFFB 2OU6A 1Q0KA 4PFPA 3T6JA 5DQTA 1T6UA 4AL1A 2Q9CA 3GORA 1NFNA 2OKUA 1HMDA 3EGXA 4YL0A 1ZHTA 4CIHA 3F47A 3BRJA 2G62A 2HJMA 5HV9A 1CPRA 4Q4ZF 2A68F 4YT4A 5KYWA 2FGYA 3HNIA 2ZXPA 2NPUA 3X1OA 4H4KC 1BR4A 2RSEB 2VB6A 1H9TA 3UMHA 3DJNB 3SXMA 3JTLO 2IBFA 2H7BA 3R2PA 1BDJB 3C18A 4DBQA 1G5ZA 2J0WA 4ZLDA 2CGEA 1NZEA 1VLSA 4N4WA 4E17A 3C8GD 4MW3A 2XM4A 1GGQA 5B1AC 3RF3A 1D1CA 1M2OA 2J45A 1D1AA 2R7QA 3IPMO 4YL1A 1RCPA 1NLXA 4NQFA 3VM6A 4OIOF 1AUEA 3G4ZA 4XPWA 4IRUA 2YQYA 1EA8A 2YLGA 5B3SC 5HSWA 3DAGA 3DAFA 1S7ZA 4CBEA 1TWHA 4I44A 4O79A 1D0ZA 3S29A 3GEIA 3OEOA 2UUHA 1AEPA 4A4AA 4OIQF 2LFFA 3UGPA 2D4UA 3HLZA 1Q0GA 2QE9A 4KNVA 2YLDA 1FFTC 3A11A 3GEEA 3KMIA 1EI7A 4MTFA 4U9DA 5JT4A 2R7WA 2V3CC 1A0BA 3L8JA 2YVKA 2VASA 4W8PA 3US6A 4BEJA 2YEVA 1BZ4A 5L3VA 3FHDA 4L6RA 3U2MA 2OQMA 4YWQA 3PDMP 2L6FA 3UGOA 1MMGA 5IY5C 1TKNA 4NY3A 4Q7CA 3SXZA 3PHF2 2VCCA 5F5FA 1CPQA 1E84A 3G50A 3LESA 3LNRA 3EH2A 3ZVRA 5T3TA 3N0TA 4BJ1A 1KU2A 1NG1A 3ATPA 3AGTA 2YL1A 3DJUB 3W2WA 1XZQA 5DLJA 4EHPA 3K66A 1RMVA 1CGOA 1Z7Qc 4U5GA 2KNHA 3HKKA 1TFOB 1J8MF 4K7BA 1K40A 3L0IA 1MMNA 1NU9C 3NMJA 4MVQA 3TQOA 4BJ6C 2J7PA 4G7HF 3LLKA 1ZHYA 1HMOA 4MVUA 4DVYP 1MMAA 2JD3A 3GODA 3ZQVA 3NKDA 1ZU5A 4FESA 4BEMJ 2P6VA 3EFOB 4CJOA 1WN0A 3AGUA 3DD7A 4NTAA 1WOLA 1YZAA 1FNTc 2J46A 4DJ9A 1JMWA 1FFHA 2HUJA 3JRTA 4JZAA 2HFIA 2LFDA 3NDBB 2L7AA 1NBBA 1FAPB 4MS2A 4EWCA 3N24A 1OW7A 4J32B 1MMDA 3IQ6A 5CI8A 1ZVZA 2B0JA 4E0IA 2IXMA 1HY5A 3ZDLA 4EBJA 4KBLA 3LAYA 3KH2A 3LEVA 3NMKA 3O10A 2AP3A 3K1IC 1QZXA 3KYJA 2FAPB 3L1MA 4FAPB 3VRCA 2R7SA 4CSAC 1HW2A 4PJMA 4U5BE 2WVQA 2YZSA 4E0HA 1E2XA 3ZTZA 1JPNA 2LCHA 3OWTA 2TMVP 4HE8D 2GWWA 3NYMA 2OJQA 3TOLA 3U9MA 3V5XA 3WODF 4MTGA 3U3BA 5DS6A 3TJ5A 1EQ1A 4LLEA 2J9UA 3AOUA 4AL0A 1QPUA 3T9OA 3KL4A 5L0DA 1OCRC 1Z63A 4GYTA 3F46A 5B1BC 3S27A 5KYYA 3UMIA 5AC5A 2A69F 3K1HA 5L0GA 5A6BA 1I4YA 3B71A 1O3UA 4P9FA 4G7OF 1H6GA 1ZYRF 2EPLX 3KPHA 2IM8A 2PFDA 2IXOA 5E33A 2ZXRA 4Z9IA 3C7JA 3B0PA 2XL4A 4O6NA 3O39A 2NUPA 4M63A 3EG9A 2R25A 3B29A 3UNGC 1VOMA 3C8ZA 1PD1A 2A1DD 3NKEA 2LQGA 1OR3A 3LUTB 3S84A 3QW0A 3RQFA 3NYJA 1C02A 2HMZA 4GQHA 4JTCB 3K33A 5E3AA 3UMKA 3AQBA 4G78A 1D1BA 4O7GA 4MVOA 3SZRA 1D0YA 2H8AA 3ZSUA 1G4US 1G4WR 3K7DA 3TJ6A 3FOPA 1FTSA 1NU7D 1OR2A 3KYIA 4JTAB 4MVSA 1TWCA 4G7ZF 4B6IA 3MLGA 5CI9A 3DKAA 1JPJA 5GPGB 4AE4B 4ULVA 2D5RB 4EKWA 1ORYA 4RBNA 4ER9A 2LP4A 3NYLA 1E86A 2Q9AA 1LVKA 1O5HA 3ZWIA 1Z23A 5JVEA 3S0XA 4PK4A 3H2VA 4IARA 3QW1A 2R7VA 2ICWG 4E7SA 2R7XA 1TWAA 2EPNA 3TD7A 3EGXB 2GFHA 4ULWA 1K05A 3QVYA 5FCLA 5L0JA 2G3KA 2ZPAA 1I5NA 4LDRA 3JZ0A 4EUKB 1YDIA 2QY9A 3LNMB 3EGDA 5KYWB 1VMAA 4JKVA 1WATA 1V74B 4I1OB 1OW6A 2CCYA 2W4MA 2L9JA 3GWNA 1A7EA 2E87A 4PJJA 3W8IA 2J9VA 3LS1A 3NG1A 4DRIB 1T01A 4YK5A 3RKOF 1O87A 1V4AA 3QMKA 3LLIA 2XLHA 1FMWA 3RYLA 2NUTA 4C7OA 3EGDB 1U89A 4C3BA 2XRHA 1LI7A 3C62A 2WL8A 1CGME 1JR8A 3VAYA 1LS1A 1SYQA 3DM5A 1LE2A 3EZIA 2XL8A 2IXPA 1SMYF 5JSLA 3JYHA 1Q0FA 2B0HA 2FFHA 2HS5A 2AWCA 2XLOA 5KYXA 2DYSC 1APCA 1I4ZA 1Z5ZA 2AWYA 3ASNC 4OD5A 4IJJA 3GANA 3MX3A 2AVKA 1A7DA 2AU5A 1C03A 2XLMA 1GM5A 2YKZA 4DBRA 2XXAA 1V55C 3TOMA 3OA1A 2OCCC 4BJ6A 4HEAJ 5L0HA 2ZXWC 2ASRA 2CNWA 2W9YA 3M1CB 3MBGA 3NMIA 2DYRC 1PCXA 3AG1C 2WZLA 5BQGA 2KK1A 3T6BA 1K04A 3L8IA 4MQ9F 1PD0A 2C04A 1HW1A 5AGFA 4U9EA 2DB4A 5CIVA 2KC3A 4I3MA 4J7TA 4BJ5C 2WVNA 4C3DA 5FZTA 1CGNA 3CZ6A 2QLAA 2WVOA 2OJED 3EHNA 3L34A 2BL2A 3N2ZB 3WHNA 2CW0F 1Q0MA 1T6IA 1TWGA 3FVYA 4MVRA 1TQGA 2CDQA 2M64A 3BEHA 5D92A 3W4YA 4F4BA 4QI2A 1XWJA 2HV6A 4PFOA 5EK0A 4P9TA 2XLWA 3GWLA 1GQAA 1WASA 3K1IA 3CSKA 1KNYA 3WG7C 4CDYA 4DOZA 2F22A 3RH3A 2EIMC 1YLMA 4CSAA 256BA 3CAXA 4XPXA 4CS8C 2L81A 4D4XA 2YL3A 4CDAA 2G3VA 5E3CA 1HE9A 1VYIA 2A0BA 3GM1A 3I4UA 4X0RA 2P0NA 2H7VC 2YRFA 3H65A 3M15A 1QVXA 1R4TA 3O6XA 5T3WA 4DVZA 1E83A 2MWQA 3S90A 4WGZA 4N06A 2MYSA 2KJGA 4LDKA 1ST6A 1VYKA 1UG7A 4U5EE 1L3PA 3DE8A 1V54C 4U5CE 5COGA 1H9GA 1M6TA 1SZIA 4U5HA 4CX9A 2XLEA 3I5PA 4JJGA 1H7IA 4DXWA 1M2VA 2J7PD 2Y3BA 3W2VA 4BG0A 2OG2A 4K0DA 4LACB 4YT8A 3U0CA 2W4BA 2XS8A 4JEBA 4WGYA 4MVMA 1FMVA 4Q5SF 3PMRA 3HNLA 4NCQA 4DRHB 2WB7A 1F1MA 5EHHA 2VH3A 1EKYA 2Q3TA 4XLPF 1M56C 1WGWA 4HFKB 4J7YA 4U5DE 4BPMA 3HNJA 4DRJB 3EJNA 2KYHA 3FAPB 1OKKA 4O6MA 3ABLC 4P6IC 3J06A 1YARO 4JCZA 3DZAA 4EIYA 5KYYB 2ZXOA 4PJNA 2DI3A 2YL7A 4UDVA 4PJLA 5E2QA 3UR3C 2BE5F 2L6GA 3EZHA 4JEAA 2KQ9A 3W8HA 1SF8A 1XZPA 2KGOA 2LIGA 1ZHXA 3C63A 4KNWA 2LD6A 3M79A 1JRAA 3M4CA 1ZHZA 2IYLD 3DE9A 1ZHWA 1D0XA 4XPYA 4KI2A 2JX0A 3CEXA 1T6QA 3ZG1A 2NUPB 2HSBA 2VCAA 3DM9B 3EG9B 5L3QA 5BQIA 1GS9A 3LJBA 1DOVA 3B0VC 1JAFA 2LK4A 4QI0A 1RJ9A 3VYWA 2EPMX 3U3FA 3U8PA 4XLNF 4IAQA 2R03A 1YA9A 3MFNA 2J9BA 1IW7F 1ZW3A 2JPUA 5A6KA 2J9WA 1RKEA 3Q6NA 1RJ9B 1Y6DA 4MW8A 5AC4A 1W2WA 1OCZC 3C8GA 4R32A 3S28A 3T6GB 1QKRA 2I15A 3HNKA 3I5QA 1ZZPA 2X51A 2IOQA 3QTHA 3SYNA 2HSQA 4ANJA 1M57C 2W45A 4E7ZA 1OW8A 4XEVA 3EPVA 4LDQA 4OINF 3WAQA 5A6JA 3B9QA 1VTMP 4RD9A 1T9KA 3GM3A 4E18A 1YJGA 3JSEO 1U6HA 1NFOA 2WZGA 3G4XA 3KKBA 4JW1A 5L0IA 2P1AA 2WZFA 5EGYA 4A2NB 2VC9A 2Q7RA 3SNHA 1VLTA 3ABKC 4CS9C 5A69A 3M4BA 2ETSA 4XEKA 4XWJA 2ZD9A 1LI5A 3U5SA 1TR2A 3IQTA 2EILC 1ZW2A 3S9OA
chains in the Genus database with same CATH topology
3ZTZA 5AGFA 4U9EA 3FOOA 3TOLA 2YL0A 4CDVA 1CGNA 2QLAA 1QPUA 2XM0A 3QVZA 1YYXA 4NC3A 2XLDA 5B3IA 2XL6A 3IQ5A 3ZQYA 4JE9A 1QQ3A 2XLWA 3ZTMA 1GQAA 1YZCA 4CDYA 256BA 4D4XA 2YL3A 4CDAA 3M15A 1CPRA 1E83A 3HNIA 3QW0A 1S05A 4WGZA 3DE8A 1M6TA 4CX9A 5JP7A 2XLEA 4N4WA 2XM4A 1E85A 4JEBA 4WGYA 1RCPA 2XLVA 3HNLA 3FOPA 1EKYA 4D4NA 2YLGA 3HNJA 4ULVA 4EIYA 2YL7A 4ER9A 5JUAA 1E86A 4IB4A 2YLDA 4U9DA 3ZWIA 5JT4A 5JS5A 1A7VA 5JVEA 4JEAA 4IARA 3QW1A 4L6RA 3C63A 3M79A 3M4CA 3DE9A 3QVYA 1CPQA 1E84A 1BBHA 4JKVA 1JAFA 2YL1A 2CCYA 2J8WA 4N6HA 3U8PA 1CGOA 4IAQA 2J9BA 2XLHA 3NMJA 4CIPA 3C62A 2YLIA 3ZQVA 3HNKA 1MQVA 5JRAA 4CJGA 2XL8A 5JSLA 2XLOA 4CJOA 1APCA 1LM3B 1YZAA 5JLIA 2BC5A 1NBBA 2XLMA 2YKZA 3TOMA 3IQ6A 3M4BA 3NMIA 3NMKA 1YYJA 3L1MA 3VRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTZ A;  5AGF A;  4U9E A;  3FOO A;  3TOL A;  2YL0 A;  4CDV A;  1CGN A;  2QLA A;  1QPU A;  2XM0 A;  3QVZ A;  1YYX A;  4NC3 A;  2XLD A;  5B3I A;  2XL6 A;  3IQ5 A;  3ZQY A;  4JE9 A;  1QQ3 A;  2XLW A;  3ZTM A;  1GQA A;  1YZC A;  4CDY A;  256B A;  4D4X A;  2YL3 A;  4CDA A;  3M15 A;  1CPR A;  1E83 A;  3HNI A;  3QW0 A;  1S05 A;  4WGZ A;  3DE8 A;  1M6T A;  4CX9 A;  5JP7 A;  2XLE A;  4N4W A;  2XM4 A;  1E85 A;  4JEB A;  4WGY A;  1RCP A;  2XLV A;  3HNL A;  3FOP A;  1EKY A;  4D4N A;  2YLG A;  3HNJ A;  4ULV A;  4EIY A;  2YL7 A;  4ER9 A;  5JUA A;  1E86 A;  4IB4 A;  2YLD A;  4U9D A;  3ZWI A;  5JT4 A;  5JS5 A;  1A7V A;  5JVE A;  4JEA A;  4IAR A;  3QW1 A;  4L6R A;  3C63 A;  3M79 A;  3M4C A;  3DE9 A;  3QVY A;  1CPQ A;  1E84 A;  1BBH A;  4JKV A;  1JAF A;  2YL1 A;  2CCY A;  2J8W A;  4N6H A;  3U8P A;  1CGO A;  4IAQ A;  2J9B A;  2XLH A;  3NMJ A;  4CIP A;  3C62 A;  2YLI A;  3ZQV A;  3HNK A;  1MQV A;  5JRA A;  4CJG A;  2XL8 A;  5JSL A;  2XLO A;  4CJO A;  1APC A;  1LM3 B;  1YZA A;  5JLI A;  2BC5 A;  1NBB A;  2XLM A;  2YKZ A;  3TOM A;  3IQ6 A;  3M4B A;  3NMI A;  3NMK A;  1YYJ A;  3L1M A;  3VRC A; 
#chains in the Genus database with same CATH topology
 4CS7 A;  2O9X A;  3V7O A;  1YA7 O;  2R7U A;  5T1D B;  5COF A;  2QUP A;  4ONS A;  2UUI A;  4RDA A;  2VCB A;  1NSG B;  2XM0 A;  5BQH A;  3QVZ A;  2R7R A;  2XLD A;  5BUO A;  4C7O B;  1B68 A;  1LE4 A;  2NG1 A;  2NUT B;  2P61 A;  3VF0 A;  4AX2 A;  3GM2 A;  5DS5 A;  1ORJ A;  3FXH A;  2XL6 A;  3V5Z A;  3ZQY A;  4JE9 A;  5KYU A;  2X0C A;  2QTV A;  4PAC A;  4AK9 A;  3ZTM A;  2Y69 C;  4C3E A;  1BR1 A;  4ZLC A;  3DMD A;  4PR9 A;  3DI5 A;  2OEV A;  2XSE A;  2GA0 A;  3RVY A;  1VB5 A;  5KYX B;  3POV A;  2P7V A;  2YHS A;  1FR0 A;  2HKV A;  4BJ5 A;  3Q7G A;  2PX3 A;  3RIP A;  4IAO A;  5KYU B;  2Z15 A;  3JRM O;  3IHU A;  1S05 A;  2XXA B;  4OIR F;  1QSP A;  4O6Y A;  2GDC A;  3R7C A;  1A41 A;  2M4E A;  2NSG A;  5JP7 A;  2EIK C;  4Z9J A;  1KTM A;  1Z6A A;  2L6H A;  3K6B A;  5TJ5 E;  2LSE A;  3RFY A;  2PNO A;  3AG4 C;  1JOG A;  4KC9 A;  1ORS C;  1E85 A;  1YVI A;  4CS8 A;  2XLV A;  4N6C A;  2PP4 A;  4U5F E;  1OCO C;  3AQC A;  2A6H F;  2NSF A;  3T4R A;  3U9J A;  4D4N A;  4MND A;  3RVZ A;  4H54 A;  4IGG A;  4JVS A;  3EFO A;  3FMS A;  4YJW A;  2Y3D A;  4XQ1 A;  3V5Y A;  4YN0 B;  1TFK B;  2HMQ A;  4I1M A;  3ABM C;  4LER A;  2IXN A;  1G8X A;  3DWW A;  4JJF A;  5JUA A;  3ITF A;  4IB4 A;  2A0U A;  2QNL A;  3EH1 A;  4EBK A;  4GEH A;  4WJ0 A;  5DS4 A;  3CQZ A;  5JS5 A;  1A7V A;  5F28 E;  2CNW D;  1MND A;  1U0B B;  3GEH A;  1DOW A;  2Q9B A;  2R7O A;  5DVW A;  5K0I A;  2HJ3 A;  2Y3G A;  2GAQ A;  3JYY A;  3ZC4 A;  4OIP F;  1LS4 A;  4YT5 A;  3SXK A;  2Q4F A;  3JCU Q;  1Y4C A;  3AG3 C;  2DGJ A;  1HE1 A;  1R5I D;  1UFB A;  4EBB A;  1BBH A;  1RKC A;  2H7O A;  2KSF A;  3AJM A;  4IWB A;  2J8W A;  3HTK C;  1N1C A;  2HV7 A;  4N6H A;  5L0F A;  3A9C A;  3RQE A;  1BR2 A;  2OOC A;  3Q7L A;  3IQC A;  1Q0D A;  1M2V B;  2I8B A;  2R02 A;  2RD9 A;  3AG2 C;  2Y39 A;  3Q6M A;  3ECS A;  2PBE A;  3HJC A;  1C17 M;  4K1O A;  3O55 A;  4W8K A;  3H2U A;  4JCH A;  3SEO A;  2EIJ C;  4CIP A;  3B0U X;  1VK5 A;  3IEE A;  1LIH A;  1L7C A;  3RQG A;  4J30 B;  2YLI A;  1ZU4 A;  1LPE A;  1MNE A;  4JIO A;  3ZIB A;  1MQV A;  1PV3 A;  4NTF A;  4CJG A;  5JRA A;  5KYN A;  3U8V A;  2EPO A;  2PF4 E;  2R7T A;  4QDL A;  4YT2 A;  1YAU O;  3LEO A;  1OXB A;  1LM3 B;  1WWP A;  3LS0 A;  3MYI A;  5JLI A;  5F5H A;  2Q00 A;  1AVO B;  3TK0 A;  3FDQ A;  4BJT A;  2BC5 A;  1LKX A;  2YWA A;  2C03 A;  3EQL F;  4JRZ A;  2R9R B;  2MHR A;  3JSZ A;  4LLC A;  2EPK X;  3RW0 A;  1T5O A;  3X2Q C;  4YL3 A;  3E9V A;  3EHM A;  2R05 A;  2PX0 A;  3JT1 A;  4JUR I;  4FWV A;  4OD4 A;  4Z9H A;  4MVZ A;  3SXY A;  2Y3H A;  5A6B D;  1YYJ A;  3NRH A;  1J8Y F;  5COM A;  1WTY A;  3DXJ F;  2EIN C;  3FOO A;  3QZC A;  1OKK D;  2A6E F;  2YL0 A;  4XEF A;  4CDV A;  1RXQ A;  2V26 A;  4G0H A;  2CYD A;  4NTB A;  5L0C A;  1IZM A;  2KW3 C;  3FAJ A;  4MTO A;  3TUL A;  3ASO C;  4JTD B;  4AE4 A;  1YYX A;  4NC3 A;  4FX5 A;  5A6A A;  1OXK A;  3SP1 A;  5D91 A;  5B3I A;  1OCC C;  1RKE B;  2J0X A;  4JC7 A;  3E70 C;  4XTK A;  5DQZ A;  2XS1 A;  3IQ5 A;  1SR2 A;  2OEX A;  1Z3I X;  4CS9 A;  1QQ3 A;  1QLE C;  3C8G B;  3U2L A;  4WAB A;  1OQC A;  1YZC A;  2HZ8 A;  3PCV A;  3MYF A;  4HFF B;  2OU6 A;  1Q0K A;  4PFP A;  3T6J A;  5DQT A;  1T6U A;  4AL1 A;  2Q9C A;  3GOR A;  1NFN A;  2OKU A;  1HMD A;  3EGX A;  4YL0 A;  1ZHT A;  4CIH A;  3F47 A;  3BRJ A;  2G62 A;  2HJM A;  5HV9 A;  1CPR A;  4Q4Z F;  2A68 F;  4YT4 A;  5KYW A;  2FGY A;  3HNI A;  2ZXP A;  2NPU A;  3X1O A;  4H4K C;  1BR4 A;  2RSE B;  2VB6 A;  1H9T A;  3UMH A;  3DJN B;  3SXM A;  3JTL O;  2IBF A;  2H7B A;  3R2P A;  1BDJ B;  3C18 A;  4DBQ A;  1G5Z A;  2J0W A;  4ZLD A;  2CGE A;  1NZE A;  1VLS A;  4N4W A;  4E17 A;  3C8G D;  4MW3 A;  2XM4 A;  1GGQ A;  5B1A C;  3RF3 A;  1D1C A;  1M2O A;  2J45 A;  1D1A A;  2R7Q A;  3IPM O;  4YL1 A;  1RCP A;  1NLX A;  4NQF A;  3VM6 A;  4OIO F;  1AUE A;  3G4Z A;  4XPW A;  4IRU A;  2YQY A;  1EA8 A;  2YLG A;  5B3S C;  5HSW A;  3DAG A;  3DAF A;  1S7Z A;  4CBE A;  1TWH A;  4I44 A;  4O79 A;  1D0Z A;  3S29 A;  3GEI A;  3OEO A;  2UUH A;  1AEP A;  4A4A A;  4OIQ F;  2LFF A;  3UGP A;  2D4U A;  3HLZ A;  1Q0G A;  2QE9 A;  4KNV A;  2YLD A;  1FFT C;  3A11 A;  3GEE A;  3KMI A;  1EI7 A;  4MTF A;  4U9D A;  5JT4 A;  2R7W A;  2V3C C;  1A0B A;  3L8J A;  2YVK A;  2VAS A;  4W8P A;  3US6 A;  4BEJ A;  2YEV A;  1BZ4 A;  5L3V A;  3FHD A;  4L6R A;  3U2M A;  2OQM A;  4YWQ A;  3PDM P;  2L6F A;  3UGO A;  1MMG A;  5IY5 C;  1TKN A;  4NY3 A;  4Q7C A;  3SXZ A;  3PHF 2;  2VCC A;  5F5F A;  1CPQ A;  1E84 A;  3G50 A;  3LES A;  3LNR A;  3EH2 A;  3ZVR A;  5T3T A;  3N0T A;  4BJ1 A;  1KU2 A;  1NG1 A;  3ATP A;  3AGT A;  2YL1 A;  3DJU B;  3W2W A;  1XZQ A;  5DLJ A;  4EHP A;  3K66 A;  1RMV A;  1CGO A;  1Z7Q c;  4U5G A;  2KNH A;  3HKK A;  1TFO B;  1J8M F;  4K7B A;  1K40 A;  3L0I A;  1MMN A;  1NU9 C;  3NMJ A;  4MVQ A;  3TQO A;  4BJ6 C;  2J7P A;  4G7H F;  3LLK A;  1ZHY A;  1HMO A;  4MVU A;  4DVY P;  1MMA A;  2JD3 A;  3GOD A;  3ZQV A;  3NKD A;  1ZU5 A;  4FES A;  4BEM J;  2P6V A;  3EFO B;  4CJO A;  1WN0 A;  3AGU A;  3DD7 A;  4NTA A;  1WOL A;  1YZA A;  1FNT c;  2J46 A;  4DJ9 A;  1JMW A;  1FFH A;  2HUJ A;  3JRT A;  4JZA A;  2HFI A;  2LFD A;  3NDB B;  2L7A A;  1NBB A;  1FAP B;  4MS2 A;  4EWC A;  3N24 A;  1OW7 A;  4J32 B;  1MMD A;  3IQ6 A;  5CI8 A;  1ZVZ A;  2B0J A;  4E0I A;  2IXM A;  1HY5 A;  3ZDL A;  4EBJ A;  4KBL A;  3LAY A;  3KH2 A;  3LEV A;  3NMK A;  3O10 A;  2AP3 A;  3K1I C;  1QZX A;  3KYJ A;  2FAP B;  3L1M A;  4FAP B;  3VRC A;  2R7S A;  4CSA C;  1HW2 A;  4PJM A;  4U5B E;  2WVQ A;  2YZS A;  4E0H A;  1E2X A;  3ZTZ A;  1JPN A;  2LCH A;  3OWT A;  2TMV P;  4HE8 D;  2GWW A;  3NYM A;  2OJQ A;  3TOL A;  3U9M A;  3V5X A;  3WOD F;  4MTG A;  3U3B A;  5DS6 A;  3TJ5 A;  1EQ1 A;  4LLE A;  2J9U A;  3AOU A;  4AL0 A;  1QPU A;  3T9O A;  3KL4 A;  5L0D A;  1OCR C;  1Z63 A;  4GYT A;  3F46 A;  5B1B C;  3S27 A;  5KYY A;  3UMI A;  5AC5 A;  2A69 F;  3K1H A;  5L0G A;  5A6B A;  1I4Y A;  3B71 A;  1O3U A;  4P9F A;  4G7O F;  1H6G A;  1ZYR F;  2EPL X;  3KPH A;  2IM8 A;  2PFD A;  2IXO A;  5E33 A;  2ZXR A;  4Z9I A;  3C7J A;  3B0P A;  2XL4 A;  4O6N A;  3O39 A;  2NUP A;  4M63 A;  3EG9 A;  2R25 A;  3B29 A;  3UNG C;  1VOM A;  3C8Z A;  1PD1 A;  2A1D D;  3NKE A;  2LQG A;  1OR3 A;  3LUT B;  3S84 A;  3QW0 A;  3RQF A;  3NYJ A;  1C02 A;  2HMZ A;  4GQH A;  4JTC B;  3K33 A;  5E3A A;  3UMK A;  3AQB A;  4G78 A;  1D1B A;  4O7G A;  4MVO A;  3SZR A;  1D0Y A;  2H8A A;  3ZSU A;  1G4U S;  1G4W R;  3K7D A;  3TJ6 A;  3FOP A;  1FTS A;  1NU7 D;  1OR2 A;  3KYI A;  4JTA B;  4MVS A;  1TWC A;  4G7Z F;  4B6I A;  3MLG A;  5CI9 A;  3DKA A;  1JPJ A;  5GPG B;  4AE4 B;  4ULV A;  2D5R B;  4EKW A;  1ORY A;  4RBN A;  4ER9 A;  2LP4 A;  3NYL A;  1E86 A;  2Q9A A;  1LVK A;  1O5H A;  3ZWI A;  1Z23 A;  5JVE A;  3S0X A;  4PK4 A;  3H2V A;  4IAR A;  3QW1 A;  2R7V A;  2ICW G;  4E7S A;  2R7X A;  1TWA A;  2EPN A;  3TD7 A;  3EGX B;  2GFH A;  4ULW A;  1K05 A;  3QVY A;  5FCL A;  5L0J A;  2G3K A;  2ZPA A;  1I5N A;  4LDR A;  3JZ0 A;  4EUK B;  1YDI A;  2QY9 A;  3LNM B;  3EGD A;  5KYW B;  1VMA A;  4JKV A;  1WAT A;  1V74 B;  4I1O B;  1OW6 A;  2CCY A;  2W4M A;  2L9J A;  3GWN A;  1A7E A;  2E87 A;  4PJJ A;  3W8I A;  2J9V A;  3LS1 A;  3NG1 A;  4DRI B;  1T01 A;  4YK5 A;  3RKO F;  1O87 A;  1V4A A;  3QMK A;  3LLI A;  2XLH A;  1FMW A;  3RYL A;  2NUT A;  4C7O A;  3EGD B;  1U89 A;  4C3B A;  2XRH A;  1LI7 A;  3C62 A;  2WL8 A;  1CGM E;  1JR8 A;  3VAY A;  1LS1 A;  1SYQ A;  3DM5 A;  1LE2 A;  3EZI A;  2XL8 A;  2IXP A;  1SMY F;  5JSL A;  3JYH A;  1Q0F A;  2B0H A;  2FFH A;  2HS5 A;  2AWC A;  2XLO A;  5KYX A;  2DYS C;  1APC A;  1I4Z A;  1Z5Z A;  2AWY A;  3ASN C;  4OD5 A;  4IJJ A;  3GAN A;  3MX3 A;  2AVK A;  1A7D A;  2AU5 A;  1C03 A;  2XLM A;  1GM5 A;  2YKZ A;  4DBR A;  2XXA A;  1V55 C;  3TOM A;  3OA1 A;  2OCC C;  4BJ6 A;  4HEA J;  5L0H A;  2ZXW C;  2ASR A;  2CNW A;  2W9Y A;  3M1C B;  3MBG A;  3NMI A;  2DYR C;  1PCX A;  3AG1 C;  2WZL A;  5BQG A;  2KK1 A;  3T6B A;  1K04 A;  3L8I A;  4MQ9 F;  1PD0 A;  2C04 A;  1HW1 A;  5AGF A;  4U9E A;  2DB4 A;  5CIV A;  2KC3 A;  4I3M A;  4J7T A;  4BJ5 C;  2WVN A;  4C3D A;  5FZT A;  1CGN A;  3CZ6 A;  2QLA A;  2WVO A;  2OJE D;  3EHN A;  3L34 A;  2BL2 A;  3N2Z B;  3WHN A;  2CW0 F;  1Q0M A;  1T6I A;  1TWG A;  3FVY A;  4MVR A;  1TQG A;  2CDQ A;  2M64 A;  3BEH A;  5D92 A;  3W4Y A;  4F4B A;  4QI2 A;  1XWJ A;  2HV6 A;  4PFO A;  5EK0 A;  4P9T A;  2XLW A;  3GWL A;  1GQA A;  1WAS A;  3K1I A;  3CSK A;  1KNY A;  3WG7 C;  4CDY A;  4DOZ A;  2F22 A;  3RH3 A;  2EIM C;  1YLM A;  4CSA A;  256B A;  3CAX A;  4XPX A;  4CS8 C;  2L81 A;  4D4X A;  2YL3 A;  4CDA A;  2G3V A;  5E3C A;  1HE9 A;  1VYI A;  2A0B A;  3GM1 A;  3I4U A;  4X0R A;  2P0N A;  2H7V C;  2YRF A;  3H65 A;  3M15 A;  1QVX A;  1R4T A;  3O6X A;  5T3W A;  4DVZ A;  1E83 A;  2MWQ A;  3S90 A;  4WGZ A;  4N06 A;  2MYS A;  2KJG A;  4LDK A;  1ST6 A;  1VYK A;  1UG7 A;  4U5E E;  1L3P A;  3DE8 A;  1V54 C;  4U5C E;  5COG A;  1H9G A;  1M6T A;  1SZI A;  4U5H A;  4CX9 A;  2XLE A;  3I5P A;  4JJG A;  1H7I A;  4DXW A;  1M2V A;  2J7P D;  2Y3B A;  3W2V A;  4BG0 A;  2OG2 A;  4K0D A;  4LAC B;  4YT8 A;  3U0C A;  2W4B A;  2XS8 A;  4JEB A;  4WGY A;  4MVM A;  1FMV A;  4Q5S F;  3PMR A;  3HNL A;  4NCQ A;  4DRH B;  2WB7 A;  1F1M A;  5EHH A;  2VH3 A;  1EKY A;  2Q3T A;  4XLP F;  1M56 C;  1WGW A;  4HFK B;  4J7Y A;  4U5D E;  4BPM A;  3HNJ A;  4DRJ B;  3EJN A;  2KYH A;  3FAP B;  1OKK A;  4O6M A;  3ABL C;  4P6I C;  3J06 A;  1YAR O;  4JCZ A;  3DZA A;  4EIY A;  5KYY B;  2ZXO A;  4PJN A;  2DI3 A;  2YL7 A;  4UDV A;  4PJL A;  5E2Q A;  3UR3 C;  2BE5 F;  2L6G A;  3EZH A;  4JEA A;  2KQ9 A;  3W8H A;  1SF8 A;  1XZP A;  2KGO A;  2LIG A;  1ZHX A;  3C63 A;  4KNW A;  2LD6 A;  3M79 A;  1JRA A;  3M4C A;  1ZHZ A;  2IYL D;  3DE9 A;  1ZHW A;  1D0X A;  4XPY A;  4KI2 A;  2JX0 A;  3CEX A;  1T6Q A;  3ZG1 A;  2NUP B;  2HSB A;  2VCA A;  3DM9 B;  3EG9 B;  5L3Q A;  5BQI A;  1GS9 A;  3LJB A;  1DOV A;  3B0V C;  1JAF A;  2LK4 A;  4QI0 A;  1RJ9 A;  3VYW A;  2EPM X;  3U3F A;  3U8P A;  4XLN F;  4IAQ A;  2R03 A;  1YA9 A;  3MFN A;  2J9B A;  1IW7 F;  1ZW3 A;  2JPU A;  5A6K A;  2J9W A;  1RKE A;  3Q6N A;  1RJ9 B;  1Y6D A;  4MW8 A;  5AC4 A;  1W2W A;  1OCZ C;  3C8G A;  4R32 A;  3S28 A;  3T6G B;  1QKR A;  2I15 A;  3HNK A;  3I5Q A;  1ZZP A;  2X51 A;  2IOQ A;  3QTH A;  3SYN A;  2HSQ A;  4ANJ A;  1M57 C;  2W45 A;  4E7Z A;  1OW8 A;  4XEV A;  3EPV A;  4LDQ A;  4OIN F;  3WAQ A;  5A6J A;  3B9Q A;  1VTM P;  4RD9 A;  1T9K A;  3GM3 A;  4E18 A;  1YJG A;  3JSE O;  1U6H A;  1NFO A;  2WZG A;  3G4X A;  3KKB A;  4JW1 A;  5L0I A;  2P1A A;  2WZF A;  5EGY A;  4A2N B;  2VC9 A;  2Q7R A;  3SNH A;  1VLT A;  3ABK C;  4CS9 C;  5A69 A;  3M4B A;  2ETS A;  4XEK A;  4XWJ A;  2ZD9 A;  1LI5 A;  3U5S A;  1TR2 A;  3IQT A;  2EIL C;  1ZW2 A;  3S9O A; 
#chains in the Genus database with same CATH homology
 3ZTZ A;  5AGF A;  4U9E A;  3FOO A;  3TOL A;  2YL0 A;  4CDV A;  1CGN A;  2QLA A;  1QPU A;  2XM0 A;  3QVZ A;  1YYX A;  4NC3 A;  2XLD A;  5B3I A;  2XL6 A;  3IQ5 A;  3ZQY A;  4JE9 A;  1QQ3 A;  2XLW A;  3ZTM A;  1GQA A;  1YZC A;  4CDY A;  256B A;  4D4X A;  2YL3 A;  4CDA A;  3M15 A;  1CPR A;  1E83 A;  3HNI A;  3QW0 A;  1S05 A;  4WGZ A;  3DE8 A;  1M6T A;  4CX9 A;  5JP7 A;  2XLE A;  4N4W A;  2XM4 A;  1E85 A;  4JEB A;  4WGY A;  1RCP A;  2XLV A;  3HNL A;  3FOP A;  1EKY A;  4D4N A;  2YLG A;  3HNJ A;  4ULV A;  4EIY A;  2YL7 A;  4ER9 A;  5JUA A;  1E86 A;  4IB4 A;  2YLD A;  4U9D A;  3ZWI A;  5JT4 A;  5JS5 A;  1A7V A;  5JVE A;  4JEA A;  4IAR A;  3QW1 A;  4L6R A;  3C63 A;  3M79 A;  3M4C A;  3DE9 A;  3QVY A;  1CPQ A;  1E84 A;  1BBH A;  4JKV A;  1JAF A;  2YL1 A;  2CCY A;  2J8W A;  4N6H A;  3U8P A;  1CGO A;  4IAQ A;  2J9B A;  2XLH A;  3NMJ A;  4CIP A;  3C62 A;  2YLI A;  3ZQV A;  3HNK A;  1MQV A;  5JRA A;  4CJG A;  2XL8 A;  5JSL A;  2XLO A;  4CJO A;  1APC A;  1LM3 B;  1YZA A;  5JLI A;  2BC5 A;  1NBB A;  2XLM A;  2YKZ A;  3TOM A;  3IQ6 A;  3M4B A;  3NMI A;  3NMK A;  1YYJ A;  3L1M A;  3VRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...