1ORYA

Flagellar export chaperone in complex with its cognate binding partner
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
119
structure length
119
Chain Sequence
EAYFQNQVETATPLEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYDIISALKSFLDHEKGKEIAKNLDTIYTIILNTLVKVDKTKEELQKILEILKDLREAWEEVKKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flagellar protein FliS
publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Chaperone
total genus 53
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 1oryA00
1SZIA 3K1IA 3IQCA 1ORJA 1ORYA
chains in the Genus database with same CATH superfamily
2C03A 1EA8A 3FXHA 1YDIA 3RQEA 4U5CE 1O3UA 1JOGA 1M2VA 3RQFA 1JR8A 2I8BA 3BEHA 3HJCA 4H4KC 4NTFA 2EPOA 1MNEA 2IXNA 2R25A 3I5QA 2YRFA 2EPMX 2X51A 1AEPA 3FOPA 2B0JA 1WOLA 2CNWD 4YN0B 4E7SA 1VMAA 1NFNA 3AG1C 1OCRC 1T5OA 2Y3HA 3G4ZA 3H2VA 4BJ1A 4G78A 2QE9A 5L0HA 3DE8A 2IBFA 1Q0MA 2M64A 4MVOA 2DGJA 3ABMC 1RKEA 3TD7A 4E17A 1YZCA 2YZSA 4Z9JA 3TOLA 4R32A 4GQHA 4KNVA 3W8HA 4JCHA 1ZZPA 2F22A 2J9UA 5COGA 2L81A 2J46A 3AG2C 4U9EA 4ER9A 5T3WA 1TR2A 2WZLA 3RIPA 3S27A 3ZIBA 3SNHA 4CSAC 1C02A 1FFHA 1W2WA 2NSGA 4CIHA 2EIKC 2AU5A 4JTCB 3HLZA 2YEVA 2HSQA 2QUPA 3K6BA 3FVYA 4J7TA 4NTAA 1RKEB 1CGNA 2YLDA 3ZG1A 4ANJA 2P6VA 1AVOB 4FAPB 5F5HA 1VYKA 3N24A 4PK4A 3LAYA 4CS7A 4BEJA 2KC3A 1ST6A 2CGEA 1WN0A 4MS2A 2XLOA 3ABLC 4DRJB 2J45A 2AWYA 2HKVA 5TJ5E 1CPRA 3UNGC 2A0BA 1E85A 3ZQVA 3T6BA 1FTSA 3TJ6A 1GGQA 4DRIB 1NBBA 2J9WA 3FAPB 1FMWA 4OINF 5KYNA 5JLIA 4U5GA 4HE8D 4PACA 3VM6A 4DVYP 5BQIA 3HKKA 4HEAJ 1VOMA 3ZDLA 1LPEA 1E84A 2XLDA 3AJMA 3K1IA 1HMDA 2R7SA 5DLJA 2HJMA 3RH3A 3FDQA 3Q6MA 3TULA 4ULWA 1Q0GA 3DAGA 3W2VA 4EBKA 4YT4A 2LFFA 1A41A 3L34A 3EGDA 3JSEO 4Q7CA 4G0HA 1S7ZA 2ZXPA 3AQCA 1YARO 5D92A 4C7OB 4WJ0A 3EH2A 3QTHA 3EZIA 3HNJA 1OR3A 1VK5A 3GWNA 3EGXB 3Q7LA 3ZTZA 3TJ5A 3DZAA 3ZQYA 1YVIA 2W45A 3LNRA 4PFOA 4Q5SF 1OCOC 4XLPF 4EHPA 5EGYA 5JVEA 4ZLDA 3US6A 2KK1A 1ORJA 4Z9HA 2Y39A 4W8PA 1C17M 1FR0A 4YL3A 1GQAA 2NUPA 4ONSA 2VCAA 3GANA 5L3QA 1U89A 2A6HF 3T6GB 2HMZA 3X1OA 3M4CA 1T01A 3S29A 3RF3A 4CSAA 1HE1A 4L6RA 2TMVP 5JT4A 3SP1A 2X0CA 3A9CA 2H8AA 3TQOA 2XXAB 1BBHA 3GM1A 5IY5C 1E86A 3ECSA 2P1AA 1D0XA 2E87A 2R02A 3DWWA 4AE4A 1I4YA 2GA0A 3EPVA 2GWWA 1Y6DA 4P9TA 3KL4A 3B9QA 1H9TA 1T9KA 1QQ3A 3IQ5A 2EPNA 2XL8A 4MVRA 3M15A 3EFOB 4PJMA 1VLTA 3RYLA 4E7ZA 4GEHA 5CI9A 3ABKC 1WGWA 2XSEA 1NLXA 2D4UA 3U5SA 3NYMA 1NSGB 2CDQA 2Y3DA 4JW1A 4N06A 3VYWA 2LK4A 4AE4B 3BRJA 4J32B 5CI8A 4DJ9A 1QSPA 3OEOA 1G8XA 1MMAA 2VASA 1VLSA 1TWAA 4JEAA 4PR9A 2ASRA 5A6KA 4UDVA 4JRZA 3DD7A 3VF0A 4H54A 1HW2A 2WVNA 2Y3BA 4K0DA 3W2WA 1ZHTA 1SYQA 2G3KA 2Q9BA 5JRAA 5L3VA 3K1IC 1RJ9A 1PV3A 3LLIA 3NKDA 4DOZA 1I4ZA 2XLHA 2FGYA 1UFBA 5CIVA 3UMIA 3V7OA 4F4BA 2L6HA 4U5EE 4CBEA 3L8JA 3LS0A 2OCCC 4MVZA 5A6AA 4X0RA 3AGUA 1OW8A 4KBLA 2HUJA 3U9JA 1M6TA 1XWJA 3SXKA 2YL1A 3S0XA 4JVSA 3RVZA 1V55C 2R7VA 2YQYA 3WHNA 3LESA 3Q6NA 2MWQA 5AC5A 1YAUO 2LCHA 2YLGA 4O6YA 3ZWIA 2A68F 2YL3A 2J0XA 2RD9A 4XEKA 4BG0A 1OQCA 1M2VB 3MFNA 2QLAA 4IAQA 4NTBA 3NRHA 4U9DA 1OXBA 4CJOA 4KC9A 1U0BB 2IXOA 4C3BA 3GODA 5BQHA 1TWHA 2Q7RA 2XLMA 2HSBA 3R2PA 4RBNA 3RFYA 1VTMP 5EHHA 2A6EF 1ZU4A 4JTDB 1V74B 3ZVRA 1A7DA 3WG7C 5HV9A 1KTMA 2HV6A 4YL0A 3U0CA 1YLMA 2R7OA 4IRUA 3JSZA 3QMKA 3DJUB 2NSFA 4I3MA 5DS6A 1VYIA 3B29A 3S28A 1V54C 2YWAA 4IARA 4WGYA 2ZD9A 4MNDA 4XPYA 3IHUA 5DQTA 3EHMA 3MBGA 2LD6A 1LS1A 4G7HF 3HNIA 3IQCA 1ZW2A 3N0TA 3L8IA 4DVZA 3H2UA 3MX3A 4BJ6C 1M2OA 3HTKC 3AQBA 3WODF 3B0VC 1YYXA 1YA7O 3DI5A 3QVYA 4O7GA 5L0JA 4WGZA 4J7YA 1RMVA 1G4WR 1NU9C 3Q7GA 3V5XA 4JURI 4OD5A 2VCBA 1YA9A 4BJTA 3UGOA 3O10A 4QI0A 1F1MA 2Y3GA 1RXQA 2OU6A 1GM5A 3K33A 1C03A 2CYDA 2HV7A 3ZSUA 1FAPB 1A0BA 3EG9A 3G4XA 4M63A 3GM2A 3UR3C 4AX2A 3DE9A 1ZHZA 3TK0A 2OG2A 2BL2A 4LDKA 4OIRF 2J0WA 2R7RA 1KU2A 2IXPA 4CDYA 2Q4FA 3CEXA 5FCLA 2H7OA 2LFDA 2W4BA 2XS8A 4DRHB 1HMOA 2PX0A 3AG4C 3KH2A 3SXZA 4D4NA 4E18A 5DS5A 2R9RB 2KYHA 2OQMA 5E2QA 2VCCA 1QPUA 2IYLD 4I1MA 3FHDA 3NDBB 3EHNA 3I5PA 3KPHA 2MYSA 1TWGA 4MTFA 4O79A 3QVZA 5GPGB 5KYYA 5L0IA 2LSEA 2JX0A 3PDMP 1BR4A 3U8PA 1UG7A 3J06A 4IGGA 1O5HA 3EGDB 2NPUA 3IQ6A 1LS4A 2EIMC 4JC7A 4N6CA 4ZLCA 3OWTA 5JUAA 2ZXRA 4MVSA 1LIHA 1NZEA 2KJGA 2HJ3A 5KYWA 4MVMA 5KYXA 2EPKX 2UUIA 5B3IA 4HFFB 1HE9A 1DOWA 3O6XA 2M4EA 4PFPA 4EKWA 4EIYA 2HFIA 3UMKA 2KNHA 2R7QA 1CPQA 3T4RA 3AOUA 4CDVA 1L7CA 3JZ0A 5JSLA 4IAOA 3FOOA 4XPWA 5FZTA 5BUOA 4IWBA 5DQZA 4YT2A 5JS5A 2NUTA 3L1MA 2J7PA 4XTKA 2NUPB 4JKVA 1E2XA 4BJ6A 2J7PD 2CW0F 2ZXOA 3IEEA 2DYRC 1YYJA 3HNLA 1R4TA 2J8WA 2G62A 3B0PA 1TKNA 4NY3A 3B0UX 1K04A 3IPMO 3K66A 1O87A 4OIPF 3JT1A 2KGOA 3QZCA 2W4MA 4HFKB 4AL0A 4A4AA 2R7WA 3MLGA 1Q0KA 2EPLX 3DM5A 3JRMO 4LERA 2R7XA 4QI2A 3ZTMA 4FESA 4C3EA 2PP4A 5KYUA 4YWQA 3AG3C 4LLCA 1MNDA 2XLWA 2IM8A 2PBEA 2ICWG 4KNWA 2HS5A 3GM3A 4CIPA 4CJGA 1SR2A 3R7CA 1MMNA 1ZHWA 3KMIA 3C18A 4YK5A 2L6FA 4MVQA 2R03A 1D0ZA 3H65A 3M1CB 3AGTA 2BC5A 1JRAA 4MTGA 4XLNF 1D1CA 3SEOA 4I44A 5L0CA 1A7EA 4BJ5A 5KYUB 3I4UA 3LJBA 3B71A 3JTLO 1U6HA 3ITFA 3KYIA 1FMVA 4N6HA 2XRHA 3S90A 3U2MA 3DMDA 3C8GA 1SZIA 1JPNA 3C62A 4JEBA 5T1DB 4NCQA 2QTVA 4OIQF 4OIOF 1NFOA 3C8ZA 3U3BA 3DM9B 3JCUQ 4NQFA 4FX5A 2PNOA 4JZAA 4XWJA 1OW6A 1H9GA 2LQGA 3RW0A 2V26A 1LVKA 3SZRA 3PHF2 1WASA 2WVQA 3ATPA 3LNMB 3N2ZB 2ZPAA 1LKXA 3G50A 3M79A 4PJNA 2R7UA 2YL0A 1RJ9B 3NMKA 1FFTC 2HZ8A 1H7IA 1A7VA 1ZHYA 1Z6AA 4G7OF 2XS1A 3K7DA 4K7BA 4XQ1A 5AGFA 1EQ1A 3DAFA 2ZXWC 4PJLA 4CS8C 3UMHA 4JE9A 4LDRA 1Z7Qc 2L9JA 1M56C 2R05A 2AVKA 2L7AA 1HY5A 1Z3IX 4U5DE 4KI2A 2ETSA 4MVUA 3CQZA 2G3VA 1JAFA 2DYSC 4JTAB 4DBQA 5DS4A 4FWVA 2C04A 2QNLA 1Z5ZA 2WB7A 3EZHA 2CNWA 2LP4A 3K1HA 5E3CA 2EIJC 1GS9A 2KQ9A 2A0UA 2OJQA 1S05A 2VH3A 3EQLF 4P6IC 3POVA 1T6QA 3NKEA 4DBRA 2WVOA 1LE4A 4J30B 2P61A 1Q0FA 1LM3B 3A11A 5L0DA 1ZU5A 2IXMA 4QDLA 4CS9C 4RD9A 4E0HA 4I1OB 1G4US 3PMRA 3FMSA 3NG1A 4LACB 2RSEB 4MW8A 2L6GA 3U8VA 1LI7A 3T9OA 4W8KA 4C3DA 4JJGA 2YL7A 1H6GA 3JRTA 1K05A 3F46A 1T6UA 3QW0A 4JIOA 2KW3C 1Y4CA 3GEEA 1XZPA 1NU7D 2XLEA 3RVYA 4AL1A 5A69A 2XL4A 3S9OA 1PD0A 3L0IA 3V5YA 3VAYA 2DB4A 1SMYF 1TQGA 5F5FA 2Q9CA 3VRCA 1LE2A 4K1OA 1WATA 1WWPA 1LI5A 1B68A 3GWLA 4Z9IA 2YLIA 4GYTA 4D4XA 5L0GA 1SF8A 1QVXA 3MYFA 3NYLA 4ULVA 1Z63A 4YJWA 1JPJA 2OOCA 5E33A 2XM4A 3RKOF 3GORA 2IOQA 3EH1A 4PJJA 4U5BE 2UUHA 2VC9A 3ASOC 1L3PA 4NC3A 4BJ5C 5HSWA 1BZ4A 1RCPA 4Q4ZF 1ZYRF 2Z15A 3EG9B 2LIGA 2J9VA 3EJNA 4C7OA 4BEMJ 3CAXA 1PD1A 1QZXA 2V3CC 2VB6A 4XEVA 1NG1A 2DI3A 1HW1A 4MTOA 2A1DD 4U5FE 3SYNA 2NG1A 3EGXA 2I15A 2AWCA 4CS8A 3NMIA 1KNYA 3GEHA 1IW7F 2KSFA 1OCCC 2OKUA 5AC4A 5A6BA 5A6BD 1ORSC 2A69F 3E70C 3E9VA 3U9MA 5KYYB 4EWCA 1IZMA 1AUEA 2XM0A 3C63A 3CSKA 3DJNB 1OCZC 3O55A 2OEXA 5JP7A 3W4YA 3UGPA 3W8IA 2WZFA 1V4AA 1TWCA 4RDAA 256BA 3TOMA 4E0IA 2Q3TA 4P9FA 4CS9A 1MMDA 3LLKA 1ORYA 2CCYA 1OXKA 1J8YF 1MMGA 3ASNC 1OR2A 1TFKB 4YL1A 5DVWA 2J9BA 2GFHA 4B6IA 2FAPB 2JPUA 5KYWB 2EILC 2Q9AA 1K40A 1XZQA 4U5HA 5KYXB 3S84A 2XXAA 3JYYA 1Z23A 4MW3A 1D1BA 3F47A 5BQGA 3X2QC 3KYJA 5F28E 2O9XA 3O39A 1QKRA 2PX3A 3DKAA 4JCZA 4EUKB 4WABA 4IB4A 4YT8A 1ZVZA 1G5ZA 2YVKA 3EFOA 2Q00A 3LEOA 2XL6A 1E83A 1T6IA 2H7BA 3WAQA 2NUTB 3SXMA 3RQGA 2PFDA 4BPMA 4XEFA 1TFOB 1N1CA 3PCVA 2FFHA 1DOVA 1Q0DA 2YKZA 1M57C 1YJGA 3MYIA 4YT5A 4CX9A 2R7TA 2MHRA 2W9YA 1R5ID 4IJJA 1APCA 2BE5F 2P0NA 2P7VA 2GAQA 2OEVA 5EK0A 3T6JA 1EI7A 2Y69C 4JJFA 2OJED 1OW7A 1EKYA 4CDAA 2WL8A 1WTYA 1BR2A 4LLEA 5K0IA 5COMA 5T3TA 1JMWA 2GDCA 4LDQA 2AP3A 3CZ6A 5L0FA 3U2LA 2HMQA 3C7JA 3DXJF 3NMJA 4XPXA 4A2NB 1QLEC 4O6NA 1MQVA 1RKCA 3M4BA 3V5ZA 1BR1A 3C8GD 3SXYA 1ZHXA 5A6JA 1FNTc 2XLVA 1D0YA 2B0HA 3LS1A 3ZC4A 2D5RB 4EBJA 4N4WA 3U3FA 3FAJA 4DXWA 1PCXA 4G7ZF 2H7VC 2QY9A 4AK9A 2JD3A 3GEIA 2WZGA 2EINC 1CGOA 1J8MF 3IQTA 3OA1A 3NYJA 3JYHA 5E3AA 2PF4E 1ZW3A 5D91A 4O6MA 5B1AC 1YZAA 3HNKA 4OD4A 1BDJB 3QW1A 1VB5A 1D1AA 5COFA 1I5NA 3LEVA 5B1BC 2YHSA 1CGME 3C8GB 3LUTB 1OKKA 4EBBA 5B3SC 4MQ9F 1OKKD 3KKBA
chains in the Genus database with same CATH topology
1SZIA 3K1IA 3IQCA 1ORJA 1ORYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZI A;  3K1I A;  3IQC A;  1ORJ A;  1ORY A; 
#chains in the Genus database with same CATH topology
 2C03 A;  1EA8 A;  3FXH A;  1YDI A;  3RQE A;  4U5C E;  1O3U A;  1JOG A;  1M2V A;  3RQF A;  1JR8 A;  2I8B A;  3BEH A;  3HJC A;  4H4K C;  4NTF A;  2EPO A;  1MNE A;  2IXN A;  2R25 A;  3I5Q A;  2YRF A;  2EPM X;  2X51 A;  1AEP A;  3FOP A;  2B0J A;  1WOL A;  2CNW D;  4YN0 B;  4E7S A;  1VMA A;  1NFN A;  3AG1 C;  1OCR C;  1T5O A;  2Y3H A;  3G4Z A;  3H2V A;  4BJ1 A;  4G78 A;  2QE9 A;  5L0H A;  3DE8 A;  2IBF A;  1Q0M A;  2M64 A;  4MVO A;  2DGJ A;  3ABM C;  1RKE A;  3TD7 A;  4E17 A;  1YZC A;  2YZS A;  4Z9J A;  3TOL A;  4R32 A;  4GQH A;  4KNV A;  3W8H A;  4JCH A;  1ZZP A;  2F22 A;  2J9U A;  5COG A;  2L81 A;  2J46 A;  3AG2 C;  4U9E A;  4ER9 A;  5T3W A;  1TR2 A;  2WZL A;  3RIP A;  3S27 A;  3ZIB A;  3SNH A;  4CSA C;  1C02 A;  1FFH A;  1W2W A;  2NSG A;  4CIH A;  2EIK C;  2AU5 A;  4JTC B;  3HLZ A;  2YEV A;  2HSQ A;  2QUP A;  3K6B A;  3FVY A;  4J7T A;  4NTA A;  1RKE B;  1CGN A;  2YLD A;  3ZG1 A;  4ANJ A;  2P6V A;  1AVO B;  4FAP B;  5F5H A;  1VYK A;  3N24 A;  4PK4 A;  3LAY A;  4CS7 A;  4BEJ A;  2KC3 A;  1ST6 A;  2CGE A;  1WN0 A;  4MS2 A;  2XLO A;  3ABL C;  4DRJ B;  2J45 A;  2AWY A;  2HKV A;  5TJ5 E;  1CPR A;  3UNG C;  2A0B A;  1E85 A;  3ZQV A;  3T6B A;  1FTS A;  3TJ6 A;  1GGQ A;  4DRI B;  1NBB A;  2J9W A;  3FAP B;  1FMW A;  4OIN F;  5KYN A;  5JLI A;  4U5G A;  4HE8 D;  4PAC A;  3VM6 A;  4DVY P;  5BQI A;  3HKK A;  4HEA J;  1VOM A;  3ZDL A;  1LPE A;  1E84 A;  2XLD A;  3AJM A;  3K1I A;  1HMD A;  2R7S A;  5DLJ A;  2HJM A;  3RH3 A;  3FDQ A;  3Q6M A;  3TUL A;  4ULW A;  1Q0G A;  3DAG A;  3W2V A;  4EBK A;  4YT4 A;  2LFF A;  1A41 A;  3L34 A;  3EGD A;  3JSE O;  4Q7C A;  4G0H A;  1S7Z A;  2ZXP A;  3AQC A;  1YAR O;  5D92 A;  4C7O B;  4WJ0 A;  3EH2 A;  3QTH A;  3EZI A;  3HNJ A;  1OR3 A;  1VK5 A;  3GWN A;  3EGX B;  3Q7L A;  3ZTZ A;  3TJ5 A;  3DZA A;  3ZQY A;  1YVI A;  2W45 A;  3LNR A;  4PFO A;  4Q5S F;  1OCO C;  4XLP F;  4EHP A;  5EGY A;  5JVE A;  4ZLD A;  3US6 A;  2KK1 A;  1ORJ A;  4Z9H A;  2Y39 A;  4W8P A;  1C17 M;  1FR0 A;  4YL3 A;  1GQA A;  2NUP A;  4ONS A;  2VCA A;  3GAN A;  5L3Q A;  1U89 A;  2A6H F;  3T6G B;  2HMZ A;  3X1O A;  3M4C A;  1T01 A;  3S29 A;  3RF3 A;  4CSA A;  1HE1 A;  4L6R A;  2TMV P;  5JT4 A;  3SP1 A;  2X0C A;  3A9C A;  2H8A A;  3TQO A;  2XXA B;  1BBH A;  3GM1 A;  5IY5 C;  1E86 A;  3ECS A;  2P1A A;  1D0X A;  2E87 A;  2R02 A;  3DWW A;  4AE4 A;  1I4Y A;  2GA0 A;  3EPV A;  2GWW A;  1Y6D A;  4P9T A;  3KL4 A;  3B9Q A;  1H9T A;  1T9K A;  1QQ3 A;  3IQ5 A;  2EPN A;  2XL8 A;  4MVR A;  3M15 A;  3EFO B;  4PJM A;  1VLT A;  3RYL A;  4E7Z A;  4GEH A;  5CI9 A;  3ABK C;  1WGW A;  2XSE A;  1NLX A;  2D4U A;  3U5S A;  3NYM A;  1NSG B;  2CDQ A;  2Y3D A;  4JW1 A;  4N06 A;  3VYW A;  2LK4 A;  4AE4 B;  3BRJ A;  4J32 B;  5CI8 A;  4DJ9 A;  1QSP A;  3OEO A;  1G8X A;  1MMA A;  2VAS A;  1VLS A;  1TWA A;  4JEA A;  4PR9 A;  2ASR A;  5A6K A;  4UDV A;  4JRZ A;  3DD7 A;  3VF0 A;  4H54 A;  1HW2 A;  2WVN A;  2Y3B A;  4K0D A;  3W2W A;  1ZHT A;  1SYQ A;  2G3K A;  2Q9B A;  5JRA A;  5L3V A;  3K1I C;  1RJ9 A;  1PV3 A;  3LLI A;  3NKD A;  4DOZ A;  1I4Z A;  2XLH A;  2FGY A;  1UFB A;  5CIV A;  3UMI A;  3V7O A;  4F4B A;  2L6H A;  4U5E E;  4CBE A;  3L8J A;  3LS0 A;  2OCC C;  4MVZ A;  5A6A A;  4X0R A;  3AGU A;  1OW8 A;  4KBL A;  2HUJ A;  3U9J A;  1M6T A;  1XWJ A;  3SXK A;  2YL1 A;  3S0X A;  4JVS A;  3RVZ A;  1V55 C;  2R7V A;  2YQY A;  3WHN A;  3LES A;  3Q6N A;  2MWQ A;  5AC5 A;  1YAU O;  2LCH A;  2YLG A;  4O6Y A;  3ZWI A;  2A68 F;  2YL3 A;  2J0X A;  2RD9 A;  4XEK A;  4BG0 A;  1OQC A;  1M2V B;  3MFN A;  2QLA A;  4IAQ A;  4NTB A;  3NRH A;  4U9D A;  1OXB A;  4CJO A;  4KC9 A;  1U0B B;  2IXO A;  4C3B A;  3GOD A;  5BQH A;  1TWH A;  2Q7R A;  2XLM A;  2HSB A;  3R2P A;  4RBN A;  3RFY A;  1VTM P;  5EHH A;  2A6E F;  1ZU4 A;  4JTD B;  1V74 B;  3ZVR A;  1A7D A;  3WG7 C;  5HV9 A;  1KTM A;  2HV6 A;  4YL0 A;  3U0C A;  1YLM A;  2R7O A;  4IRU A;  3JSZ A;  3QMK A;  3DJU B;  2NSF A;  4I3M A;  5DS6 A;  1VYI A;  3B29 A;  3S28 A;  1V54 C;  2YWA A;  4IAR A;  4WGY A;  2ZD9 A;  4MND A;  4XPY A;  3IHU A;  5DQT A;  3EHM A;  3MBG A;  2LD6 A;  1LS1 A;  4G7H F;  3HNI A;  3IQC A;  1ZW2 A;  3N0T A;  3L8I A;  4DVZ A;  3H2U A;  3MX3 A;  4BJ6 C;  1M2O A;  3HTK C;  3AQB A;  3WOD F;  3B0V C;  1YYX A;  1YA7 O;  3DI5 A;  3QVY A;  4O7G A;  5L0J A;  4WGZ A;  4J7Y A;  1RMV A;  1G4W R;  1NU9 C;  3Q7G A;  3V5X A;  4JUR I;  4OD5 A;  2VCB A;  1YA9 A;  4BJT A;  3UGO A;  3O10 A;  4QI0 A;  1F1M A;  2Y3G A;  1RXQ A;  2OU6 A;  1GM5 A;  3K33 A;  1C03 A;  2CYD A;  2HV7 A;  3ZSU A;  1FAP B;  1A0B A;  3EG9 A;  3G4X A;  4M63 A;  3GM2 A;  3UR3 C;  4AX2 A;  3DE9 A;  1ZHZ A;  3TK0 A;  2OG2 A;  2BL2 A;  4LDK A;  4OIR F;  2J0W A;  2R7R A;  1KU2 A;  2IXP A;  4CDY A;  2Q4F A;  3CEX A;  5FCL A;  2H7O A;  2LFD A;  2W4B A;  2XS8 A;  4DRH B;  1HMO A;  2PX0 A;  3AG4 C;  3KH2 A;  3SXZ A;  4D4N A;  4E18 A;  5DS5 A;  2R9R B;  2KYH A;  2OQM A;  5E2Q A;  2VCC A;  1QPU A;  2IYL D;  4I1M A;  3FHD A;  3NDB B;  3EHN A;  3I5P A;  3KPH A;  2MYS A;  1TWG A;  4MTF A;  4O79 A;  3QVZ A;  5GPG B;  5KYY A;  5L0I A;  2LSE A;  2JX0 A;  3PDM P;  1BR4 A;  3U8P A;  1UG7 A;  3J06 A;  4IGG A;  1O5H A;  3EGD B;  2NPU A;  3IQ6 A;  1LS4 A;  2EIM C;  4JC7 A;  4N6C A;  4ZLC A;  3OWT A;  5JUA A;  2ZXR A;  4MVS A;  1LIH A;  1NZE A;  2KJG A;  2HJ3 A;  5KYW A;  4MVM A;  5KYX A;  2EPK X;  2UUI A;  5B3I A;  4HFF B;  1HE9 A;  1DOW A;  3O6X A;  2M4E A;  4PFP A;  4EKW A;  4EIY A;  2HFI A;  3UMK A;  2KNH A;  2R7Q A;  1CPQ A;  3T4R A;  3AOU A;  4CDV A;  1L7C A;  3JZ0 A;  5JSL A;  4IAO A;  3FOO A;  4XPW A;  5FZT A;  5BUO A;  4IWB A;  5DQZ A;  4YT2 A;  5JS5 A;  2NUT A;  3L1M A;  2J7P A;  4XTK A;  2NUP B;  4JKV A;  1E2X A;  4BJ6 A;  2J7P D;  2CW0 F;  2ZXO A;  3IEE A;  2DYR C;  1YYJ A;  3HNL A;  1R4T A;  2J8W A;  2G62 A;  3B0P A;  1TKN A;  4NY3 A;  3B0U X;  1K04 A;  3IPM O;  3K66 A;  1O87 A;  4OIP F;  3JT1 A;  2KGO A;  3QZC A;  2W4M A;  4HFK B;  4AL0 A;  4A4A A;  2R7W A;  3MLG A;  1Q0K A;  2EPL X;  3DM5 A;  3JRM O;  4LER A;  2R7X A;  4QI2 A;  3ZTM A;  4FES A;  4C3E A;  2PP4 A;  5KYU A;  4YWQ A;  3AG3 C;  4LLC A;  1MND A;  2XLW A;  2IM8 A;  2PBE A;  2ICW G;  4KNW A;  2HS5 A;  3GM3 A;  4CIP A;  4CJG A;  1SR2 A;  3R7C A;  1MMN A;  1ZHW A;  3KMI A;  3C18 A;  4YK5 A;  2L6F A;  4MVQ A;  2R03 A;  1D0Z A;  3H65 A;  3M1C B;  3AGT A;  2BC5 A;  1JRA A;  4MTG A;  4XLN F;  1D1C A;  3SEO A;  4I44 A;  5L0C A;  1A7E A;  4BJ5 A;  5KYU B;  3I4U A;  3LJB A;  3B71 A;  3JTL O;  1U6H A;  3ITF A;  3KYI A;  1FMV A;  4N6H A;  2XRH A;  3S90 A;  3U2M A;  3DMD A;  3C8G A;  1SZI A;  1JPN A;  3C62 A;  4JEB A;  5T1D B;  4NCQ A;  2QTV A;  4OIQ F;  4OIO F;  1NFO A;  3C8Z A;  3U3B A;  3DM9 B;  3JCU Q;  4NQF A;  4FX5 A;  2PNO A;  4JZA A;  4XWJ A;  1OW6 A;  1H9G A;  2LQG A;  3RW0 A;  2V26 A;  1LVK A;  3SZR A;  3PHF 2;  1WAS A;  2WVQ A;  3ATP A;  3LNM B;  3N2Z B;  2ZPA A;  1LKX A;  3G50 A;  3M79 A;  4PJN A;  2R7U A;  2YL0 A;  1RJ9 B;  3NMK A;  1FFT C;  2HZ8 A;  1H7I A;  1A7V A;  1ZHY A;  1Z6A A;  4G7O F;  2XS1 A;  3K7D A;  4K7B A;  4XQ1 A;  5AGF A;  1EQ1 A;  3DAF A;  2ZXW C;  4PJL A;  4CS8 C;  3UMH A;  4JE9 A;  4LDR A;  1Z7Q c;  2L9J A;  1M56 C;  2R05 A;  2AVK A;  2L7A A;  1HY5 A;  1Z3I X;  4U5D E;  4KI2 A;  2ETS A;  4MVU A;  3CQZ A;  2G3V A;  1JAF A;  2DYS C;  4JTA B;  4DBQ A;  5DS4 A;  4FWV A;  2C04 A;  2QNL A;  1Z5Z A;  2WB7 A;  3EZH A;  2CNW A;  2LP4 A;  3K1H A;  5E3C A;  2EIJ C;  1GS9 A;  2KQ9 A;  2A0U A;  2OJQ A;  1S05 A;  2VH3 A;  3EQL F;  4P6I C;  3POV A;  1T6Q A;  3NKE A;  4DBR A;  2WVO A;  1LE4 A;  4J30 B;  2P61 A;  1Q0F A;  1LM3 B;  3A11 A;  5L0D A;  1ZU5 A;  2IXM A;  4QDL A;  4CS9 C;  4RD9 A;  4E0H A;  4I1O B;  1G4U S;  3PMR A;  3FMS A;  3NG1 A;  4LAC B;  2RSE B;  4MW8 A;  2L6G A;  3U8V A;  1LI7 A;  3T9O A;  4W8K A;  4C3D A;  4JJG A;  2YL7 A;  1H6G A;  3JRT A;  1K05 A;  3F46 A;  1T6U A;  3QW0 A;  4JIO A;  2KW3 C;  1Y4C A;  3GEE A;  1XZP A;  1NU7 D;  2XLE A;  3RVY A;  4AL1 A;  5A69 A;  2XL4 A;  3S9O A;  1PD0 A;  3L0I A;  3V5Y A;  3VAY A;  2DB4 A;  1SMY F;  1TQG A;  5F5F A;  2Q9C A;  3VRC A;  1LE2 A;  4K1O A;  1WAT A;  1WWP A;  1LI5 A;  1B68 A;  3GWL A;  4Z9I A;  2YLI A;  4GYT A;  4D4X A;  5L0G A;  1SF8 A;  1QVX A;  3MYF A;  3NYL A;  4ULV A;  1Z63 A;  4YJW A;  1JPJ A;  2OOC A;  5E33 A;  2XM4 A;  3RKO F;  3GOR A;  2IOQ A;  3EH1 A;  4PJJ A;  4U5B E;  2UUH A;  2VC9 A;  3ASO C;  1L3P A;  4NC3 A;  4BJ5 C;  5HSW A;  1BZ4 A;  1RCP A;  4Q4Z F;  1ZYR F;  2Z15 A;  3EG9 B;  2LIG A;  2J9V A;  3EJN A;  4C7O A;  4BEM J;  3CAX A;  1PD1 A;  1QZX A;  2V3C C;  2VB6 A;  4XEV A;  1NG1 A;  2DI3 A;  1HW1 A;  4MTO A;  2A1D D;  4U5F E;  3SYN A;  2NG1 A;  3EGX A;  2I15 A;  2AWC A;  4CS8 A;  3NMI A;  1KNY A;  3GEH A;  1IW7 F;  2KSF A;  1OCC C;  2OKU A;  5AC4 A;  5A6B A;  5A6B D;  1ORS C;  2A69 F;  3E70 C;  3E9V A;  3U9M A;  5KYY B;  4EWC A;  1IZM A;  1AUE A;  2XM0 A;  3C63 A;  3CSK A;  3DJN B;  1OCZ C;  3O55 A;  2OEX A;  5JP7 A;  3W4Y A;  3UGP A;  3W8I A;  2WZF A;  1V4A A;  1TWC A;  4RDA A;  256B A;  3TOM A;  4E0I A;  2Q3T A;  4P9F A;  4CS9 A;  1MMD A;  3LLK A;  1ORY A;  2CCY A;  1OXK A;  1J8Y F;  1MMG A;  3ASN C;  1OR2 A;  1TFK B;  4YL1 A;  5DVW A;  2J9B A;  2GFH A;  4B6I A;  2FAP B;  2JPU A;  5KYW B;  2EIL C;  2Q9A A;  1K40 A;  1XZQ A;  4U5H A;  5KYX B;  3S84 A;  2XXA A;  3JYY A;  1Z23 A;  4MW3 A;  1D1B A;  3F47 A;  5BQG A;  3X2Q C;  3KYJ A;  5F28 E;  2O9X A;  3O39 A;  1QKR A;  2PX3 A;  3DKA A;  4JCZ A;  4EUK B;  4WAB A;  4IB4 A;  4YT8 A;  1ZVZ A;  1G5Z A;  2YVK A;  3EFO A;  2Q00 A;  3LEO A;  2XL6 A;  1E83 A;  1T6I A;  2H7B A;  3WAQ A;  2NUT B;  3SXM A;  3RQG A;  2PFD A;  4BPM A;  4XEF A;  1TFO B;  1N1C A;  3PCV A;  2FFH A;  1DOV A;  1Q0D A;  2YKZ A;  1M57 C;  1YJG A;  3MYI A;  4YT5 A;  4CX9 A;  2R7T A;  2MHR A;  2W9Y A;  1R5I D;  4IJJ A;  1APC A;  2BE5 F;  2P0N A;  2P7V A;  2GAQ A;  2OEV A;  5EK0 A;  3T6J A;  1EI7 A;  2Y69 C;  4JJF A;  2OJE D;  1OW7 A;  1EKY A;  4CDA A;  2WL8 A;  1WTY A;  1BR2 A;  4LLE A;  5K0I A;  5COM A;  5T3T A;  1JMW A;  2GDC A;  4LDQ A;  2AP3 A;  3CZ6 A;  5L0F A;  3U2L A;  2HMQ A;  3C7J A;  3DXJ F;  3NMJ A;  4XPX A;  4A2N B;  1QLE C;  4O6N A;  1MQV A;  1RKC A;  3M4B A;  3V5Z A;  1BR1 A;  3C8G D;  3SXY A;  1ZHX A;  5A6J A;  1FNT c;  2XLV A;  1D0Y A;  2B0H A;  3LS1 A;  3ZC4 A;  2D5R B;  4EBJ A;  4N4W A;  3U3F A;  3FAJ A;  4DXW A;  1PCX A;  4G7Z F;  2H7V C;  2QY9 A;  4AK9 A;  2JD3 A;  3GEI A;  2WZG A;  2EIN C;  1CGO A;  1J8M F;  3IQT A;  3OA1 A;  3NYJ A;  3JYH A;  5E3A A;  2PF4 E;  1ZW3 A;  5D91 A;  4O6M A;  5B1A C;  1YZA A;  3HNK A;  4OD4 A;  1BDJ B;  3QW1 A;  1VB5 A;  1D1A A;  5COF A;  1I5N A;  3LEV A;  5B1B C;  2YHS A;  1CGM E;  3C8G B;  3LUT B;  1OKK A;  4EBB A;  5B3S C;  4MQ9 F;  1OKK D;  3KKB A; 
#chains in the Genus database with same CATH homology
 1SZI A;  3K1I A;  3IQC A;  1ORJ A;  1ORY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...