1ORYA

Flagellar export chaperone in complex with its cognate binding partner
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
119
structure length
119
Chain Sequence
EAYFQNQVETATPLEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYDIISALKSFLDHEKGKEIAKNLDTIYTIILNTLVKVDKTKEELQKILEILKDLREAWEEVKKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords flagellar protein FliS
publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 53
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 1oryA00
3K1IA 3IQCA 1SZIA 1ORJA 1ORYA
chains in the Genus database with same CATH superfamily
1JPNA 4MVSA 3DM5A 3AGTA 5DQTA 2XXAA 1E86A 1LKXA 4U5BE 2L81A 3UMIA 4IWBA 2J9BA 4N06A 4AL0A 4FWVA 4U5HA 3PDMP 3Q6MA 3GWNA 1A7VA 1D1BA 5JT4A 1QLEC 3O39A 3UNGC 1G8XA 4MVRA 3S84A 4H4KC 2KJGA 3T4RA 3TJ5A 2HJMA 2DI3A 4E7ZA 4HE8D 4FESA 4C7OB 2PF4E 3DI5A 4IJJA 3U3FA 1LS4A 4LACB 3FDQA 2WB7A 1UG7A 4JEAA 4MTOA 4CIHA 2ZD9A 1PV3A 3ZQVA 2R7WA 3AJMA 2QUPA 4R32A 5KYXB 5L0DA 4XLPF 4CS7A 1K05A 2VC9A 3KYIA 2BE5F 3M4BA 4JEBA 3DKAA 4JTDB 2C03A 1QSPA 4G0HA 3MBGA 3IQ5A 4OINF 1XWJA 1ZW2A 3ASOC 3Q7LA 4Q5SF 4DBQA 2A68F 2YL3A 1V74B 3WAQA 3ITFA 1XZPA 2PP4A 5T1DB 4Q7CA 3LS1A 4DRHB 3C7JA 2IXNA 4N4WA 3T6GB 4CJOA 3LNRA 4JC7A 1NSGB 2CGEA 3FHDA 3RVYA 4KBLA 2NSFA 3FOOA 4LLEA 1RJ9B 4IB4A 4YL3A 2Y69C 3SXKA 5AGFA 2XLEA 1CGOA 3K1HA 4KNVA 5B3SC 4BJTA 1VYKA 2AWCA 1TFOB 2ZXWC 3KPHA 5CI8A 1APCA 2KSFA 4A4AA 4LDQA 3TQOA 2HUJA 4FAPB 1JMWA 4O6MA 3QZCA 2AP3A 1PD0A 2Y3HA 5AC5A 4WGZA 1EKYA 4Q4ZF 4BJ5C 3LAYA 2A6EF 2HS5A 2KW3C 5IY5C 1PCXA 4JTCB 3LS0A 4L6RA 4CS8C 5DS4A 3KYJA 1LE4A 4U5EE 3C62A 4G7ZF 4K7BA 1YVIA 2ZXOA 1T6QA 2IBFA 3K66A 1OQCA 4DVYP 4LLCA 3F47A 3E9VA 5D91A 1O5HA 2LSEA 3ABMC 1A41A 3GEHA 1FTSA 3GEEA 4HFKB 4I1MA 3SYNA 4CJGA 3NMIA 3S27A 1VOMA 1Q0DA 3I5QA 1I4ZA 1NU9C 2J46A 3LNMB 2XSEA 2IOQA 2HMZA 1MMDA 2NUPA 3AG1C 1OXKA 4DXWA 4YJWA 3ZDLA 1M2VB 3LESA 1FAPB 2WVQA 2WVOA 1Z5ZA 4X0RA 2J9UA 3RW0A 4J7TA 4RDAA 2B0JA 2JX0A 1AUEA 2NUTA 1MNEA 2P0NA 3ABKC 4CDYA 2XLWA 3DMDA 1KU2A 2XLOA 1WGWA 3NG1A 2P6VA 1BDJB 1ZHZA 2A1DD 1IZMA 1RKCA 1VLSA 2GAQA 3DE8A 1DOVA 3RVZA 1NFOA 3A11A 3VM6A 3U0CA 1U0BB 2QY9A 3NDBB 4CSAC 1L7CA 3GODA 4MVOA 4MVMA 4FX5A 4F4BA 2R02A 3K1IC 4JZAA 3SEOA 2AVKA 2KGOA 5L0GA 2CW0F 3B0VC 3UMKA 4NY3A 1VTMP 1JAFA 4BJ6C 2HSBA 1O87A 5B1BC 4BG0A 2J0WA 3AG2C 4P9TA 1V55C 2HV6A 3Q7GA 4PJMA 4GQHA 4YL1A 4MNDA 5E33A 2BC5A 2VH3A 3M79A 1HE9A 5L0HA 1FNTc 1OCZC 3NYMA 4ZLCA 3KKBA 5A6BA 2EPMX 2I15A 3G4ZA 4PACA 2XLHA 1RMVA 3C8GB 1IW7F 3B0PA 3QW0A 2A6HF 3NYJA 2AWYA 3QVZA 5T3WA 4U5GA 4DBRA 3DE9A 1M56C 4N6HA 1SZIA 3JTLO 1H6GA 1ORJA 3EGDB 4IRUA 2R7VA 1HW1A 1M6TA 3A9CA 3JRMO 1J8MF 3ZTMA 3E70C 5KYWB 3L1MA 5A69A 3QW1A 2IXPA 2XM4A 3VYWA 1OR2A 3DXJF 2PBEA 3HNKA 4CS9C 3ATPA 5L3VA 4MW8A 3TJ6A 3GEIA 5KYYA 2KK1A 2OCCC 3CAXA 1H7IA 4EKWA 2Q4FA 2OU6A 2R7TA 1J8YF 2MYSA 3DM9B 2R7XA 3LJBA 4PJJA 2XLVA 3H65A 3RQGA 3EFOA 1HE1A 1R5ID 1S7ZA 3RQEA 4ZLDA 2Q3TA 5EHHA 1YA7O 1A7EA 1HMOA 4M63A 4ONSA 1GQAA 5DS6A 3EG9B 2RSEB 3L8JA 4YT4A 5BQHA 3LEOA 3FVYA 2YHSA 3B0UX 2LFDA 2YKZA 5KYUA 4BJ5A 3SNHA 4ANJA 3POVA 4C3EA 2QNLA 3AQCA 1LI5A 1WATA 4YL0A 4J7YA 2XRHA 3QMKA 3T6BA 2OOCA 1R4TA 1YARO 3BEHA 3EGXA 3HLZA 3G4XA 4O79A 2LFFA 4XEVA 5L0CA 1VYIA 2Y3BA 2XXAB 3ABLC 4J32B 1V54C 4HEAJ 4MVUA 3R2PA 4MTFA 3G50A 2Q9BA 4N6CA 2J0XA 3RH3A 2YLIA 2YRFA 1VMAA 3KH2A 2CNWA 2VASA 2EINC 2D5RB 3NRHA 4IAQA 2W45A 1TR2A 4XPWA 5DQZA 4LERA 4A2NB 2ZXRA 3H2UA 4EBBA 2XL4A 2YQYA 1ORSC 3LUTB 1LE2A 1L3PA 1OW6A 2XL6A 3R7CA 3SXYA 1D0YA 1G4US 1OKKD 1NFNA 1TWHA 1SR2A 1ZVZA 2FFHA 3DJNB 3JCUQ 4D4XA 5JRAA 1S05A 3K33A 5EGYA 2Q7RA 4PJNA 4CS8A 4JIOA 1MMGA 2WVNA 4ULVA 5HSWA 3JYHA 4YK5A 1EI7A 2NSGA 2L7AA 2X51A 1Z6AA 4PJLA 2IYLD 4U5CE 2NPUA 3L34A 5T3TA 1E2XA 4KNWA 3SXMA 4U9DA 3RFYA 4YWQA 5L0IA 5A6KA 1FMVA 2HV7A 2CYDA 1D1CA 4CX9A 2J7PD 5B1AC 3IPMO 4CSAA 2DYRC 3EHNA 3US6A 3K1IA 3ZVRA 5CIVA 2CDQA 2QLAA 3K7DA 4BPMA 3ZQYA 1LVKA 4PR9A 4PFOA 3B29A 3F46A 4CDVA 2AU5A 1I4YA 4I3MA 1HY5A 3RIPA 2H7OA 1JR8A 1FR0A 1GS9A 3N24A 2E87A 2H8AA 256BA 4XPYA 1BZ4A 1XZQA 2YLGA 3HKKA 5AC4A 1NG1A 4K1OA 4LDKA 5BQGA 5L0FA 3MYFA 2Q9AA 1VLTA 2J8WA 3AQBA 3C8GD 2MHRA 3AGUA 3I5PA 3I4UA 1Y6DA 2ZXPA 3DJUB 3U2LA 1A7DA 1OCCC 3LLIA 3OWTA 2ICWG 4XTKA 5A6JA 3EZIA 2GA0A 2F22A 3RYLA 2R25A 4ULWA 3RF3A 3FAPB 5L0JA 2PNOA 1RCPA 2YL7A 3C63A 4E0HA 1U89A 1Q0MA 1SYQA 2M64A 4G7OF 1I5NA 4CS9A 2XM0A 1PD1A 3AOUA 1AVOB 3CEXA 4AL1A 3WG7C 1QKRA 2XL8A 3TOLA 1RKEA 4QDLA 1EA8A 2HZ8A 2WL8A 2Z15A 4EBJA 4OIOF 2VCCA 2EPKX 1CPQA 2PX3A 5E2QA 2OEVA 4U9EA 4WGYA 3U2MA 4YT2A 3FMSA 1Q0FA 4CIPA 3EQLF 2XS8A 3UR3C 4DRJB 1OXBA 3NKEA 4JURI 5COFA 1T5OA 2DGJA 3JT1A 4NTFA 2OEXA 3FOPA 4JCZA 4MW3A 5GPGB 1TWCA 1YYJA 2NUTB 4DRIB 5JLIA 4JRZA 3TULA 2A69F 1JRAA 1TQGA 2ZPAA 2X0CA 4MQ9F 3AG4C 4MTGA 2HSQA 4QI2A 3ZIBA 1YA9A 4O7GA 2WZLA 1JPJA 3IQ6A 1GGQA 3M1CB 5EK0A 5BQIA 3C18A 3N0TA 3ZTZA 2LD6A 3SZRA 2LCHA 3EZHA 5B3IA 1K04A 4JVSA 3RKOF 3MYIA 3ZG1A 3QTHA 4MVZA 1YLMA 2L6FA 4JE9A 3VF0A 5DS5A 3SP1A 4IARA 2YL0A 1WTYA 1H9TA 1OR3A 4O6YA 2R05A 2H7BA 2NG1A 4BEJA 4EBKA 3ZSUA 4E17A 4NCQA 1D0XA 3N2ZB 4BJ1A 1B68A 1FFHA 2L6HA 2CCYA 2PFDA 2J9WA 2HMQA 2L9JA 3NMKA 1E83A 2Q00A 2J45A 3S9OA 2RD9A 1LS1A 2A0BA 1OW8A 1TWGA 2R7OA 4JW1A 4WJ0A 4XPXA 5CI9A 5DVWA 4Z9IA 3HNIA 1ZU4A 2XLDA 3U9MA 2TMVP 3AG3C 4CBEA 3NMJA 1HMDA 2P61A 1QVXA 1YZCA 2ETSA 2EIMC 3HNLA 4YN0B 2R7RA 2R7UA 1T6UA 1E84A 3JZ0A 4E0IA 3B71A 1M2OA 1K40A 1ZHYA 3V5XA 5KYYB 3KMIA 3EH2A 4XEFA 2I8BA 3CQZA 1ST6A 3IEEA 3HNJA 3LEVA 1LIHA 3X2QC 4P6IC 1T01A 2R7SA 2YWAA 3W2VA 5A6AA 4AE4B 4O6NA 3EG9A 4DVZA 3T6JA 1ZZPA 5COGA 3DAFA 2G62A 1SMYF 3GWLA 3U9JA 4OIPF 3EFOB 4MVQA 1WASA 1Y4CA 2OJQA 3M4CA 5F5FA 4C7OA 1VB5A 1V4AA 2EILC 3RQFA 2UUHA 1QQ3A 3EH1A 3JSZA 4AE4A 4E7SA 4C3DA 2EPLX 1GM5A 1BR1A 1JOGA 4JKVA 3U3BA 5KYXA 1C02A 4WABA 3W8HA 5KYUB 3WODF 2GFHA 5JP7A 5JS5A 1NLXA 4JTAB 3S0XA 4LDRA 4G7HF 3CSKA 3H2VA 3FAJA 3EGXB 1MNDA 1SF8A 1C03A 3HTKC 4NC3A 3PCVA 3GM1A 2KQ9A 1CGNA 4AX2A 3BRJA 3M15A 2G3VA 4JCHA 4ER9A 2JPUA 1RJ9A 3EHMA 4AK9A 1DOWA 5E3AA 2JD3A 3IQCA 3Q6NA 1FMWA 1ORYA 4B6IA 3O6XA 3DWWA 5K0IA 4EIYA 2G3KA 1H9GA 1UFBA 2QTVA 3HJCA 2Q9CA 4OIQF 3DAGA 3WHNA 2V26A 4C3BA 4PK4A 4YT5A 2Y3DA 4BJ6A 5F28E 3UMHA 2OJED 2LQGA 4EHPA 1W2WA 3EJNA 4JJGA 3GM3A 2BL2A 2M4EA 4U5FE 5HV9A 1CPRA 1ZHTA 1ZW3A 2EIJC 3DZAA 4Z9HA 4DOZA 3UGOA 2KC3A 2UUIA 2W9YA 4NQFA 3V5YA 5FZTA 1BR4A 1LM3B 2OKUA 3QVYA 4OD5A 3OEOA 4P9FA 3PHF2 4DJ9A 1KTMA 1YAUO 1N1CA 3S29A 1LPEA 4KC9A 3ECSA 1QZXA 2EPNA 4EWCA 3U8VA 3J06A 3SXZA 5JVEA 1OKKA 1WWPA 2Y3GA 1T6IA 4PFPA 3VAYA 3JRTA 3IHUA 2VCAA 1NBBA 3T9OA 2IXMA 3OA1A 1YZAA 2PX0A 3GM2A 1TKNA 4IGGA 5A6BD 2LK4A 5FCLA 1M2VA 2GWWA 3NKDA 1OCRC 2HKVA 2D4UA 4NTAA 2J9VA 2EIKC 3L8IA 1Q0KA 1ZHWA 4UDVA 1CGME 2B0HA 2YZSA 3DD7A 3O55A 1Z63A 2NUPB 1TFKB 4EUKB 2Y39A 3EPVA 4RBNA 2KYHA 2VB6A 1OCOC 4K0DA 1NZEA 2C04A 5JUAA 2J7PA 4D4NA 1VK5A 3ASNC 4KI2A 4IAOA 4XEKA 3VRCA 3B9QA 1RKEB 3TD7A 1O3UA 3U5SA 3S90A 4U5DE 3V7OA 2EPOA 3TOMA 3K6BA 2LIGA 1OW7A 1E85A 1NU7D 3ZC4A 4JJFA 2R03A 2VCBA 1WOLA 5L3QA 1FFTC 3TK0A 1T9KA 1BR2A 1YDIA 1WN0A 4RD9A 4Z9JA 2MWQA 1LI7A 2KNHA 2OG2A 4HFFB 3MFNA 5BUOA 1U6HA 4W8KA 1ZU5A 3JSEO 1Q0GA 1AEPA 2P1AA 4NTBA 4XLNF 3W8IA 4H54A 3KL4A 3S28A 4J30B 1MQVA 2YVKA 3C8GA 1MMNA 2A0UA 2DB4A 1Z23A 2OQMA 2YEVA 3X1OA 4BEMJ 2H7VC 3LLKA 1TWAA 3FXHA 4OD4A 4I1OB 3GORA 4W8PA 3EGDA 1M57C 1YYXA 1Z3IX 1G5ZA 2HFIA 2LP4A 2R9RB 2W4BA 2R7QA 2WZGA 1C17M 3L0IA 4GYTA 4XQ1A 3UGPA 3W2WA 5KYWA 1EQ1A 5JSLA 1D1AA 1ZYRF 2P7VA 5D92A 2CNWD 5F5HA 3ZWIA 2L6GA 2V3CC 4OIRF 2IM8A 2HJ3A 2DYSC 3W4YA 5KYNA 3MX3A 1HW2A 1G4WR 1KNYA 4CDAA 1RXQA 3MLGA 4G78A 5TJ5E 3U8PA 3V5ZA 4E18A 1MMAA 3C8ZA 1BBHA 2WZFA 3CZ6A 2QE9A 1QPUA 1YJGA 2IXOA 2YL1A 3JYYA 4MS2A 1Z7Qc 1ZHXA 1A0BA 3GANA 3PMRA 2XLMA 4QI0A 3O10A 5E3CA 3NYLA 2XS1A 2FAPB 2ASRA 2GDCA 2W4MA 4GEHA 4XWJA 3IQTA 5DLJA 4YT8A 1D0ZA 5COMA 4I44A 2YLDA 1F1MA 2O9XA 2FGYA
chains in the Genus database with same CATH topology
3K1IA 3IQCA 1SZIA 1ORJA 1ORYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1I A;  3IQC A;  1SZI A;  1ORJ A;  1ORY A; 
#chains in the Genus database with same CATH topology
 1JPN A;  4MVS A;  3DM5 A;  3AGT A;  5DQT A;  2XXA A;  1E86 A;  1LKX A;  4U5B E;  2L81 A;  3UMI A;  4IWB A;  2J9B A;  4N06 A;  4AL0 A;  4FWV A;  4U5H A;  3PDM P;  3Q6M A;  3GWN A;  1A7V A;  1D1B A;  5JT4 A;  1QLE C;  3O39 A;  3UNG C;  1G8X A;  4MVR A;  3S84 A;  4H4K C;  2KJG A;  3T4R A;  3TJ5 A;  2HJM A;  2DI3 A;  4E7Z A;  4HE8 D;  4FES A;  4C7O B;  2PF4 E;  3DI5 A;  4IJJ A;  3U3F A;  1LS4 A;  4LAC B;  3FDQ A;  2WB7 A;  1UG7 A;  4JEA A;  4MTO A;  4CIH A;  2ZD9 A;  1PV3 A;  3ZQV A;  2R7W A;  3AJM A;  2QUP A;  4R32 A;  5KYX B;  5L0D A;  4XLP F;  4CS7 A;  1K05 A;  2VC9 A;  3KYI A;  2BE5 F;  3M4B A;  4JEB A;  3DKA A;  4JTD B;  2C03 A;  1QSP A;  4G0H A;  3MBG A;  3IQ5 A;  4OIN F;  1XWJ A;  1ZW2 A;  3ASO C;  3Q7L A;  4Q5S F;  4DBQ A;  2A68 F;  2YL3 A;  1V74 B;  3WAQ A;  3ITF A;  1XZP A;  2PP4 A;  5T1D B;  4Q7C A;  3LS1 A;  4DRH B;  3C7J A;  2IXN A;  4N4W A;  3T6G B;  4CJO A;  3LNR A;  4JC7 A;  1NSG B;  2CGE A;  3FHD A;  3RVY A;  4KBL A;  2NSF A;  3FOO A;  4LLE A;  1RJ9 B;  4IB4 A;  4YL3 A;  2Y69 C;  3SXK A;  5AGF A;  2XLE A;  1CGO A;  3K1H A;  4KNV A;  5B3S C;  4BJT A;  1VYK A;  2AWC A;  1TFO B;  2ZXW C;  3KPH A;  5CI8 A;  1APC A;  2KSF A;  4A4A A;  4LDQ A;  3TQO A;  2HUJ A;  4FAP B;  1JMW A;  4O6M A;  3QZC A;  2AP3 A;  1PD0 A;  2Y3H A;  5AC5 A;  4WGZ A;  1EKY A;  4Q4Z F;  4BJ5 C;  3LAY A;  2A6E F;  2HS5 A;  2KW3 C;  5IY5 C;  1PCX A;  4JTC B;  3LS0 A;  4L6R A;  4CS8 C;  5DS4 A;  3KYJ A;  1LE4 A;  4U5E E;  3C62 A;  4G7Z F;  4K7B A;  1YVI A;  2ZXO A;  1T6Q A;  2IBF A;  3K66 A;  1OQC A;  4DVY P;  4LLC A;  3F47 A;  3E9V A;  5D91 A;  1O5H A;  2LSE A;  3ABM C;  1A41 A;  3GEH A;  1FTS A;  3GEE A;  4HFK B;  4I1M A;  3SYN A;  4CJG A;  3NMI A;  3S27 A;  1VOM A;  1Q0D A;  3I5Q A;  1I4Z A;  1NU9 C;  2J46 A;  3LNM B;  2XSE A;  2IOQ A;  2HMZ A;  1MMD A;  2NUP A;  3AG1 C;  1OXK A;  4DXW A;  4YJW A;  3ZDL A;  1M2V B;  3LES A;  1FAP B;  2WVQ A;  2WVO A;  1Z5Z A;  4X0R A;  2J9U A;  3RW0 A;  4J7T A;  4RDA A;  2B0J A;  2JX0 A;  1AUE A;  2NUT A;  1MNE A;  2P0N A;  3ABK C;  4CDY A;  2XLW A;  3DMD A;  1KU2 A;  2XLO A;  1WGW A;  3NG1 A;  2P6V A;  1BDJ B;  1ZHZ A;  2A1D D;  1IZM A;  1RKC A;  1VLS A;  2GAQ A;  3DE8 A;  1DOV A;  3RVZ A;  1NFO A;  3A11 A;  3VM6 A;  3U0C A;  1U0B B;  2QY9 A;  3NDB B;  4CSA C;  1L7C A;  3GOD A;  4MVO A;  4MVM A;  4FX5 A;  4F4B A;  2R02 A;  3K1I C;  4JZA A;  3SEO A;  2AVK A;  2KGO A;  5L0G A;  2CW0 F;  3B0V C;  3UMK A;  4NY3 A;  1VTM P;  1JAF A;  4BJ6 C;  2HSB A;  1O87 A;  5B1B C;  4BG0 A;  2J0W A;  3AG2 C;  4P9T A;  1V55 C;  2HV6 A;  3Q7G A;  4PJM A;  4GQH A;  4YL1 A;  4MND A;  5E33 A;  2BC5 A;  2VH3 A;  3M79 A;  1HE9 A;  5L0H A;  1FNT c;  1OCZ C;  3NYM A;  4ZLC A;  3KKB A;  5A6B A;  2EPM X;  2I15 A;  3G4Z A;  4PAC A;  2XLH A;  1RMV A;  3C8G B;  1IW7 F;  3B0P A;  3QW0 A;  2A6H F;  3NYJ A;  2AWY A;  3QVZ A;  5T3W A;  4U5G A;  4DBR A;  3DE9 A;  1M56 C;  4N6H A;  1SZI A;  3JTL O;  1H6G A;  1ORJ A;  3EGD B;  4IRU A;  2R7V A;  1HW1 A;  1M6T A;  3A9C A;  3JRM O;  1J8M F;  3ZTM A;  3E70 C;  5KYW B;  3L1M A;  5A69 A;  3QW1 A;  2IXP A;  2XM4 A;  3VYW A;  1OR2 A;  3DXJ F;  2PBE A;  3HNK A;  4CS9 C;  3ATP A;  5L3V A;  4MW8 A;  3TJ6 A;  3GEI A;  5KYY A;  2KK1 A;  2OCC C;  3CAX A;  1H7I A;  4EKW A;  2Q4F A;  2OU6 A;  2R7T A;  1J8Y F;  2MYS A;  3DM9 B;  2R7X A;  3LJB A;  4PJJ A;  2XLV A;  3H65 A;  3RQG A;  3EFO A;  1HE1 A;  1R5I D;  1S7Z A;  3RQE A;  4ZLD A;  2Q3T A;  5EHH A;  1YA7 O;  1A7E A;  1HMO A;  4M63 A;  4ONS A;  1GQA A;  5DS6 A;  3EG9 B;  2RSE B;  3L8J A;  4YT4 A;  5BQH A;  3LEO A;  3FVY A;  2YHS A;  3B0U X;  2LFD A;  2YKZ A;  5KYU A;  4BJ5 A;  3SNH A;  4ANJ A;  3POV A;  4C3E A;  2QNL A;  3AQC A;  1LI5 A;  1WAT A;  4YL0 A;  4J7Y A;  2XRH A;  3QMK A;  3T6B A;  2OOC A;  1R4T A;  1YAR O;  3BEH A;  3EGX A;  3HLZ A;  3G4X A;  4O79 A;  2LFF A;  4XEV A;  5L0C A;  1VYI A;  2Y3B A;  2XXA B;  3ABL C;  4J32 B;  1V54 C;  4HEA J;  4MVU A;  3R2P A;  4MTF A;  3G50 A;  2Q9B A;  4N6C A;  2J0X A;  3RH3 A;  2YLI A;  2YRF A;  1VMA A;  3KH2 A;  2CNW A;  2VAS A;  2EIN C;  2D5R B;  3NRH A;  4IAQ A;  2W45 A;  1TR2 A;  4XPW A;  5DQZ A;  4LER A;  4A2N B;  2ZXR A;  3H2U A;  4EBB A;  2XL4 A;  2YQY A;  1ORS C;  3LUT B;  1LE2 A;  1L3P A;  1OW6 A;  2XL6 A;  3R7C A;  3SXY A;  1D0Y A;  1G4U S;  1OKK D;  1NFN A;  1TWH A;  1SR2 A;  1ZVZ A;  2FFH A;  3DJN B;  3JCU Q;  4D4X A;  5JRA A;  1S05 A;  3K33 A;  5EGY A;  2Q7R A;  4PJN A;  4CS8 A;  4JIO A;  1MMG A;  2WVN A;  4ULV A;  5HSW A;  3JYH A;  4YK5 A;  1EI7 A;  2NSG A;  2L7A A;  2X51 A;  1Z6A A;  4PJL A;  2IYL D;  4U5C E;  2NPU A;  3L34 A;  5T3T A;  1E2X A;  4KNW A;  3SXM A;  4U9D A;  3RFY A;  4YWQ A;  5L0I A;  5A6K A;  1FMV A;  2HV7 A;  2CYD A;  1D1C A;  4CX9 A;  2J7P D;  5B1A C;  3IPM O;  4CSA A;  2DYR C;  3EHN A;  3US6 A;  3K1I A;  3ZVR A;  5CIV A;  2CDQ A;  2QLA A;  3K7D A;  4BPM A;  3ZQY A;  1LVK A;  4PR9 A;  4PFO A;  3B29 A;  3F46 A;  4CDV A;  2AU5 A;  1I4Y A;  4I3M A;  1HY5 A;  3RIP A;  2H7O A;  1JR8 A;  1FR0 A;  1GS9 A;  3N24 A;  2E87 A;  2H8A A;  256B A;  4XPY A;  1BZ4 A;  1XZQ A;  2YLG A;  3HKK A;  5AC4 A;  1NG1 A;  4K1O A;  4LDK A;  5BQG A;  5L0F A;  3MYF A;  2Q9A A;  1VLT A;  2J8W A;  3AQB A;  3C8G D;  2MHR A;  3AGU A;  3I5P A;  3I4U A;  1Y6D A;  2ZXP A;  3DJU B;  3U2L A;  1A7D A;  1OCC C;  3LLI A;  3OWT A;  2ICW G;  4XTK A;  5A6J A;  3EZI A;  2GA0 A;  2F22 A;  3RYL A;  2R25 A;  4ULW A;  3RF3 A;  3FAP B;  5L0J A;  2PNO A;  1RCP A;  2YL7 A;  3C63 A;  4E0H A;  1U89 A;  1Q0M A;  1SYQ A;  2M64 A;  4G7O F;  1I5N A;  4CS9 A;  2XM0 A;  1PD1 A;  3AOU A;  1AVO B;  3CEX A;  4AL1 A;  3WG7 C;  1QKR A;  2XL8 A;  3TOL A;  1RKE A;  4QDL A;  1EA8 A;  2HZ8 A;  2WL8 A;  2Z15 A;  4EBJ A;  4OIO F;  2VCC A;  2EPK X;  1CPQ A;  2PX3 A;  5E2Q A;  2OEV A;  4U9E A;  4WGY A;  3U2M A;  4YT2 A;  3FMS A;  1Q0F A;  4CIP A;  3EQL F;  2XS8 A;  3UR3 C;  4DRJ B;  1OXB A;  3NKE A;  4JUR I;  5COF A;  1T5O A;  2DGJ A;  3JT1 A;  4NTF A;  2OEX A;  3FOP A;  4JCZ A;  4MW3 A;  5GPG B;  1TWC A;  1YYJ A;  2NUT B;  4DRI B;  5JLI A;  4JRZ A;  3TUL A;  2A69 F;  1JRA A;  1TQG A;  2ZPA A;  2X0C A;  4MQ9 F;  3AG4 C;  4MTG A;  2HSQ A;  4QI2 A;  3ZIB A;  1YA9 A;  4O7G A;  2WZL A;  1JPJ A;  3IQ6 A;  1GGQ A;  3M1C B;  5EK0 A;  5BQI A;  3C18 A;  3N0T A;  3ZTZ A;  2LD6 A;  3SZR A;  2LCH A;  3EZH A;  5B3I A;  1K04 A;  4JVS A;  3RKO F;  3MYI A;  3ZG1 A;  3QTH A;  4MVZ A;  1YLM A;  2L6F A;  4JE9 A;  3VF0 A;  5DS5 A;  3SP1 A;  4IAR A;  2YL0 A;  1WTY A;  1H9T A;  1OR3 A;  4O6Y A;  2R05 A;  2H7B A;  2NG1 A;  4BEJ A;  4EBK A;  3ZSU A;  4E17 A;  4NCQ A;  1D0X A;  3N2Z B;  4BJ1 A;  1B68 A;  1FFH A;  2L6H A;  2CCY A;  2PFD A;  2J9W A;  2HMQ A;  2L9J A;  3NMK A;  1E83 A;  2Q00 A;  2J45 A;  3S9O A;  2RD9 A;  1LS1 A;  2A0B A;  1OW8 A;  1TWG A;  2R7O A;  4JW1 A;  4WJ0 A;  4XPX A;  5CI9 A;  5DVW A;  4Z9I A;  3HNI A;  1ZU4 A;  2XLD A;  3U9M A;  2TMV P;  3AG3 C;  4CBE A;  3NMJ A;  1HMD A;  2P61 A;  1QVX A;  1YZC A;  2ETS A;  2EIM C;  3HNL A;  4YN0 B;  2R7R A;  2R7U A;  1T6U A;  1E84 A;  3JZ0 A;  4E0I A;  3B71 A;  1M2O A;  1K40 A;  1ZHY A;  3V5X A;  5KYY B;  3KMI A;  3EH2 A;  4XEF A;  2I8B A;  3CQZ A;  1ST6 A;  3IEE A;  3HNJ A;  3LEV A;  1LIH A;  3X2Q C;  4P6I C;  1T01 A;  2R7S A;  2YWA A;  3W2V A;  5A6A A;  4AE4 B;  4O6N A;  3EG9 A;  4DVZ A;  3T6J A;  1ZZP A;  5COG A;  3DAF A;  2G62 A;  1SMY F;  3GWL A;  3U9J A;  4OIP F;  3EFO B;  4MVQ A;  1WAS A;  1Y4C A;  2OJQ A;  3M4C A;  5F5F A;  4C7O A;  1VB5 A;  1V4A A;  2EIL C;  3RQF A;  2UUH A;  1QQ3 A;  3EH1 A;  3JSZ A;  4AE4 A;  4E7S A;  4C3D A;  2EPL X;  1GM5 A;  1BR1 A;  1JOG A;  4JKV A;  3U3B A;  5KYX A;  1C02 A;  4WAB A;  3W8H A;  5KYU B;  3WOD F;  2GFH A;  5JP7 A;  5JS5 A;  1NLX A;  4JTA B;  3S0X A;  4LDR A;  4G7H F;  3CSK A;  3H2V A;  3FAJ A;  3EGX B;  1MND A;  1SF8 A;  1C03 A;  3HTK C;  4NC3 A;  3PCV A;  3GM1 A;  2KQ9 A;  1CGN A;  4AX2 A;  3BRJ A;  3M15 A;  2G3V A;  4JCH A;  4ER9 A;  2JPU A;  1RJ9 A;  3EHM A;  4AK9 A;  1DOW A;  5E3A A;  2JD3 A;  3IQC A;  3Q6N A;  1FMW A;  1ORY A;  4B6I A;  3O6X A;  3DWW A;  5K0I A;  4EIY A;  2G3K A;  1H9G A;  1UFB A;  2QTV A;  3HJC A;  2Q9C A;  4OIQ F;  3DAG A;  3WHN A;  2V26 A;  4C3B A;  4PK4 A;  4YT5 A;  2Y3D A;  4BJ6 A;  5F28 E;  3UMH A;  2OJE D;  2LQG A;  4EHP A;  1W2W A;  3EJN A;  4JJG A;  3GM3 A;  2BL2 A;  2M4E A;  4U5F E;  5HV9 A;  1CPR A;  1ZHT A;  1ZW3 A;  2EIJ C;  3DZA A;  4Z9H A;  4DOZ A;  3UGO A;  2KC3 A;  2UUI A;  2W9Y A;  4NQF A;  3V5Y A;  5FZT A;  1BR4 A;  1LM3 B;  2OKU A;  3QVY A;  4OD5 A;  3OEO A;  4P9F A;  3PHF 2;  4DJ9 A;  1KTM A;  1YAU O;  1N1C A;  3S29 A;  1LPE A;  4KC9 A;  3ECS A;  1QZX A;  2EPN A;  4EWC A;  3U8V A;  3J06 A;  3SXZ A;  5JVE A;  1OKK A;  1WWP A;  2Y3G A;  1T6I A;  4PFP A;  3VAY A;  3JRT A;  3IHU A;  2VCA A;  1NBB A;  3T9O A;  2IXM A;  3OA1 A;  1YZA A;  2PX0 A;  3GM2 A;  1TKN A;  4IGG A;  5A6B D;  2LK4 A;  5FCL A;  1M2V A;  2GWW A;  3NKD A;  1OCR C;  2HKV A;  2D4U A;  4NTA A;  2J9V A;  2EIK C;  3L8I A;  1Q0K A;  1ZHW A;  4UDV A;  1CGM E;  2B0H A;  2YZS A;  3DD7 A;  3O55 A;  1Z63 A;  2NUP B;  1TFK B;  4EUK B;  2Y39 A;  3EPV A;  4RBN A;  2KYH A;  2VB6 A;  1OCO C;  4K0D A;  1NZE A;  2C04 A;  5JUA A;  2J7P A;  4D4N A;  1VK5 A;  3ASN C;  4KI2 A;  4IAO A;  4XEK A;  3VRC A;  3B9Q A;  1RKE B;  3TD7 A;  1O3U A;  3U5S A;  3S90 A;  4U5D E;  3V7O A;  2EPO A;  3TOM A;  3K6B A;  2LIG A;  1OW7 A;  1E85 A;  1NU7 D;  3ZC4 A;  4JJF A;  2R03 A;  2VCB A;  1WOL A;  5L3Q A;  1FFT C;  3TK0 A;  1T9K A;  1BR2 A;  1YDI A;  1WN0 A;  4RD9 A;  4Z9J A;  2MWQ A;  1LI7 A;  2KNH A;  2OG2 A;  4HFF B;  3MFN A;  5BUO A;  1U6H A;  4W8K A;  1ZU5 A;  3JSE O;  1Q0G A;  1AEP A;  2P1A A;  4NTB A;  4XLN F;  3W8I A;  4H54 A;  3KL4 A;  3S28 A;  4J30 B;  1MQV A;  2YVK A;  3C8G A;  1MMN A;  2A0U A;  2DB4 A;  1Z23 A;  2OQM A;  2YEV A;  3X1O A;  4BEM J;  2H7V C;  3LLK A;  1TWA A;  3FXH A;  4OD4 A;  4I1O B;  3GOR A;  4W8P A;  3EGD A;  1M57 C;  1YYX A;  1Z3I X;  1G5Z A;  2HFI A;  2LP4 A;  2R9R B;  2W4B A;  2R7Q A;  2WZG A;  1C17 M;  3L0I A;  4GYT A;  4XQ1 A;  3UGP A;  3W2W A;  5KYW A;  1EQ1 A;  5JSL A;  1D1A A;  1ZYR F;  2P7V A;  5D92 A;  2CNW D;  5F5H A;  3ZWI A;  2L6G A;  2V3C C;  4OIR F;  2IM8 A;  2HJ3 A;  2DYS C;  3W4Y A;  5KYN A;  3MX3 A;  1HW2 A;  1G4W R;  1KNY A;  4CDA A;  1RXQ A;  3MLG A;  4G78 A;  5TJ5 E;  3U8P A;  3V5Z A;  4E18 A;  1MMA A;  3C8Z A;  1BBH A;  2WZF A;  3CZ6 A;  2QE9 A;  1QPU A;  1YJG A;  2IXO A;  2YL1 A;  3JYY A;  4MS2 A;  1Z7Q c;  1ZHX A;  1A0B A;  3GAN A;  3PMR A;  2XLM A;  4QI0 A;  3O10 A;  5E3C A;  3NYL A;  2XS1 A;  2FAP B;  2ASR A;  2GDC A;  2W4M A;  4GEH A;  4XWJ A;  3IQT A;  5DLJ A;  4YT8 A;  1D0Z A;  5COM A;  4I44 A;  2YLD A;  1F1M A;  2O9X A;  2FGY A; 
#chains in the Genus database with same CATH homology
 3K1I A;  3IQC A;  1SZI A;  1ORJ A;  1ORY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...