3LAYA

Alpha-helical barrel formed by the decamer of the zinc resistance-associated protein (stm4172) from salmonella enterica subsp. enterica serovar typhimurium str. lt2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
79
structure length
79
Chain Sequence
LTTEQQATAQKIYDDYYTQTSALRQQLISKRYEYNALLTASSPDTAKINAVAKEMESLGQKLDEQRVKRDVAMAQAGIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc resistance-associated protein
publication title Alpha-Helical barrel formed by the decamer of the zinc resistance-associated protein (STM4172) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Metal binding protein
total genus 33
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13801 Metal_resist Heavy-metal resistance
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3layA00
3ZG1A 3LAYA 3ITFA 2Y39A 3O39A 3EPVA 2Y3HA 2Y3BA 2Y3GA 3OEOA 2Y3DA 3QZCA
chains in the Genus database with same CATH superfamily
3IQTA 4C3DA 3JYYA 4PJMA 1A7DA 4MW8A 3FOPA 4R32A 4NTAA 1L3PA 4DVYP 3L8IA 3FAPB 3C8ZA 1M56C 1D0YA 2P7VA 4DXWA 3DE8A 4UDVA 2HFIA 2OCCC 3B29A 1Z3IX 3X1OA 4BEJA 4C7OA 1OQCA 2VASA 1BR2A 3KPHA 4P6IC 1YYXA 4RDAA 3DXJF 4AX2A 3HNLA 4CDYA 1J8YF 3Q7GA 2KQ9A 5DQZA 2P1AA 4AE4A 1ORSC 1L7CA 1UG7A 3U8PA 3UR3C 4OIQF 4I44A 3LEOA 2NSGA 4PACA 1GS9A 2IBFA 5L3VA 1ZVZA 3QTHA 3M15A 4E0HA 5HV9A 3ITFA 2NUTA 3LESA 4E18A 3HJCA 1XWJA 2XM4A 1K40A 3K6BA 2Y3BA 4K7BA 2J9BA 3LJBA 1CPRA 4IRUA 4NQFA 4O79A 3ZWIA 2M4EA 2C03A 1QLEC 4BJ5C 4DOZA 3FOOA 3UMKA 5F28E 5KYNA 3W4YA 2PX3A 1M2OA 4OD5A 1K05A 3KYIA 4MVUA 2WB7A 1LE2A 3AGUA 3O10A 5TJ5E 2HV6A 4JURI 5KYUB 1ZHYA 5AGFA 2R7VA 1VLTA 2EPLX 3M4CA 5L0GA 2H7OA 1FFTC 1JRAA 2EPNA 1H9GA 2A69F 2R05A 2YL7A 4DRHB 3POVA 4DRIB 4FESA 3SEOA 2DI3A 1T6IA 3S84A 4BJ6A 4H54A 2Q4FA 2FFHA 3L34A 1U6HA 2ZPAA 3NYMA 4JEBA 4OINF 3SXZA 1E84A 4JTCB 3TULA 2XL4A 3G4XA 3KYJA 3DD7A 2QLAA 4KNWA 4MTOA 1M2VB 2WVQA 5A6BD 5A6JA 1LI5A 2R02A 2YQYA 2ZXPA 4JTDB 1LIHA 3B0VC 3RKOF 2AWYA 4DBQA 2DYRC 3PHF2 2Y69C 3Q6MA 4XEKA 4CDAA 1E85A 4IB4A 4N6HA 3AG3C 5JS5A 1VOMA 2CYDA 4CS8C 1WASA 4U5GA 3U2MA 1HW2A 3E9VA 3SXMA 2G3KA 3FMSA 2XLVA 5L0DA 4NTFA 2XLWA 2L6GA 2YL1A 5E3AA 1OXBA 2GAQA 3SXYA 2QUPA 3JYHA 4AL1A 2HUJA 4YT8A 5L3QA 2HJ3A 1JOGA 4JVSA 4G7ZF 1YAUO 3K66A 3KL4A 1G5ZA 4F4BA 1YVIA 1ZHXA 3QW1A 4KI2A 3B71A 3B0PA 4OIRF 3JSZA 4PJJA 4IARA 2MYSA 1ZW2A 4QI0A 2HZ8A 1I4YA 3TQOA 2P6VA 1D0ZA 1WN0A 1T6UA 4C7OB 1CPQA 2R7XA 1ZHWA 2V3CC 3GEHA 1BDJB 4PR9A 1IW7F 2ASRA 3X2QC 2FGYA 4AE4B 4CIPA 3HNKA 3J06A 2IXPA 3EGXA 3LUTB 1PD0A 4YN0B 3JT1A 2GFHA 2IXOA 2NUTB 3JTLO 2YHSA 4EBBA 1OW8A 4XPYA 4U5CE 5T3WA 5FCLA 5L0HA 1O87A 1YA7O 3UGOA 2A68F 1WTYA 3LLKA 3RFYA 1LE4A 1OKKD 1A7EA 3HNIA 5DS6A 5A6BA 1A0BA 2KSFA 4BG0A 1DOWA 4CJGA 1OR3A 5AC4A 3OWTA 4CX9A 3EJNA 1EKYA 2VC9A 1WWPA 4PJNA 4XLPF 5E33A 4CS7A 3NRHA 4KBLA 4CJOA 4EHPA 1H9TA 1OCRC 4OIOF 3S29A 3NYLA 2DB4A 1OCZC 4DVZA 2D4UA 3F46A 2P0NA 2XLEA 1T01A 2EIKC 4BJ6C 3RH3A 3ASOC 1HE9A 2W45A 2VCCA 4MVMA 1E83A 4W8PA 5AC5A 4J7YA 3RIPA 2R7WA 1H6GA 3I5QA 3LNRA 1FMVA 3QVYA 4XPWA 4DRJB 4ZLDA 2VH3A 3DZAA 3NKDA 3EHMA 4PFPA 5B3IA 1YZAA 2BL2A 2LK4A 3DJNB 3EZHA 4XPXA 1SYQA 3T6BA 3N2ZB 3ZVRA 4E0IA 3S90A 2OQMA 3ABMC 2LP4A 3DAGA 1YDIA 2HMZA 1FTSA 4YWQA 1I4ZA 5L0CA 4PFOA 2YRFA 2WZGA 2PF4E 2KNHA 2Q9AA 4JIOA 2EPKX 3IQ6A 3WODF 3NMKA 3B9QA 2X51A 3GM2A 2H7BA 5T1DB 3LS0A 3PCVA 2J45A 3TJ5A 4G7OF 3GORA 5F5FA 1EA8A 4PJLA 1MMGA 1SMYF 1DOVA 4LDRA 4MVRA 2CW0F 3KH2A 2KJGA 4J30B 1HE1A 1OR2A 5F5HA 3VRCA 3T6GB 1CGNA 4LERA 3ZDLA 1MNEA 1OKKA 1V54C 3Q7LA 3M1CB 4EBJA 2H7VC 4JW1A 4O6YA 3LLIA 1TWHA 3T6JA 1MQVA 2BC5A 3V5XA 1UFBA 3QW0A 5B1BC 1Z7Qc 1XZQA 1ZYRF 2HSQA 3EGXB 2HMQA 3C8GD 3AG2C 3FAJA 1TQGA 3MYIA 4HFFB 2X0CA 5B1AC 1JMWA 2AVKA 1FNTc 3FDQA 2EILC 2HJMA 4J7TA 4JCHA 2LCHA 4WGYA 3UGPA 2GWWA 3LNMB 4PK4A 3ZG1A 2GDCA 5BUOA 5KYYA 2OU6A 2MHRA 1NG1A 1QPUA 2OOCA 3R2PA 2Q9BA 1B68A 2WVOA 3EH1A 4KC9A 5BQHA 1Y6DA 3NDBB 3C62A 3OEOA 1T9KA 1BR1A 3IQ5A 5L0JA 5A69A 2XL8A 5COFA 1MMNA 1YARO 4P9FA 5DVWA 3TOMA 2CGEA 4H4KC 1MMAA 4LACB 4X0RA 4CDVA 3UNGC 4YL1A 3US6A 2QTVA 4A2NB 2H8AA 1TWGA 2HKVA 1RKEA 4NCQA 1ZU5A 3RF3A 2PP4A 3EG9A 2OJED 1VMAA 4GEHA 2P61A 2HSBA 4XQ1A 3PDMP 5CI9A 5COGA 2AP3A 1Z6AA 5L0FA 4QDLA 1G8XA 5KYXB 3U3BA 4JC7A 4O6MA 2EIJC 1WATA 2B0HA 4D4XA 5JT4A 2LFFA 1HW1A 1TKNA 3ATPA 2QY9A 3GWNA 2EIMC 2YL0A 4LDQA 4G7HF 3NYJA 1GQAA 2UUIA 2DYSC 2B0JA 4YT5A 3I5PA 1ZW3A 3IEEA 4HEAJ 4ULWA 4DJ9A 1YYJA 4NC3A 5L0IA 1O3UA 2EPMX 4XEFA 5KYXA 4C3EA 3C8GA 3DKAA 2RD9A 3EFOA 1Z5ZA 2CNWD 2AU5A 1NLXA 1RKCA 2LIGA 3FVYA 4JE9A 4Q4ZF 2YEVA 1D1CA 3E70C 4MVSA 3W8HA 5DLJA 5HSWA 1GGQA 4YK5A 4EIYA 2L81A 1C03A 3K7DA 1AVOB 2AWCA 4MQ9F 4Q7CA 4OD4A 4RBNA 3S9OA 3H2UA 4EBKA 1ST6A 4E17A 1JAFA 2ETSA 5K0IA 4JJGA 2IM8A 2CDQA 2Q00A 5JSLA 1ZHTA 3QMKA 2OEVA 3KKBA 1RMVA 5JRAA 4Z9HA 3T4RA 3RVYA 1OCOC 2LSEA 5GPGB 3GEEA 4MW3A 3O55A 4BEMJ 1S05A 3TOLA 3L0IA 2HV7A 3IPMO 1BBHA 1D0XA 2NUPA 4IJJA 1QQ3A 2A0BA 4E7SA 3GANA 5E3CA 4E7ZA 2LFDA 2JX0A 3A9CA 1AUEA 3CAXA 2KW3C 2WVNA 3DI5A 1ZZPA 2YVKA 3JZ0A 1SR2A 1APCA 1N1CA 4U5HA 1BZ4A 1TR2A 1NFOA 1PCXA 1VYKA 2YKZA 1PV3A 4FWVA 4D4NA 4EKWA 5A6AA 3NMJA 3A11A 3JSEO 3ZC4A 4BJ5A 4JJFA 3BRJA 2IYLD 3U8VA 1MNDA 2OKUA 3W8IA 1OCCC 1RCPA 1T6QA 2J9VA 5FZTA 5B3SC 1RKEB 1S7ZA 3LS1A 1QZXA 2UUHA 3DM5A 3Q6NA 4WGZA 5CI8A 2R7RA 3EG9B 3DWWA 2ZD9A 2Q7RA 4BJTA 5JVEA 1G4WR 2I8BA 1JPNA 2WZFA 2L6FA 3N0TA 4MNDA 2CNWA 1VYIA 2RSEB 3GODA 3V7OA 1EQ1A 5EGYA 1M57C 4WABA 1Z23A 1CGOA 3IQCA 3GM1A 4WJ0A 5EHHA 1Q0FA 3AG4C 2EINC 4W8KA 1CGME 3ZQVA 1I5NA 2Y3HA 2I15A 2O9XA 2G3VA 2Q3TA 3FHDA 4FX5A 4IAOA 1EI7A 4RD9A 5EK0A 3RYLA 1RJ9A 3SYNA 2OJQA 2XS8A 3NKEA 1LKXA 3V5YA 1O5HA 3RQFA 1F1MA 1HMOA 3EGDA 3WAQA 4A4AA 3C8GB 1JPJA 2YLIA 3O6XA 1Q0GA 5JP7A 1U89A 3ZTZA 4LLCA 4KNVA 1XZPA 4IWBA 1Q0MA 4FAPB 4CS8A 2YL3A 1OW7A 3H2VA 3H65A 4J32B 2YWAA 2R7OA 5IY5C 2J8WA 1VB5A 3K1IA 2MWQA 3I4UA 3VYWA 3B0UX 1LI7A 3AJMA 4MVOA 5DQTA 1ORJA 4GYTA 3WG7C 1VTMP 3ZSUA 2PBEA 2EPOA 3CEXA 5D91A 2Q9CA 2J46A 1G4US 1YLMA 2WL8A 4N06A 3FXHA 3LAYA 2JD3A 2W4BA 1IZMA 3K33A 3MX3A 2HS5A 3GEIA 4L6RA 3RQEA 2W4MA 2OEXA 3NG1A 2TMVP 3KMIA 3HNJA 1NFNA 2LQGA 4HE8D 1R5ID 1K04A 2L9JA 2VB6A 1Q0DA 2NUPB 3LEVA 4JRZA 4BJ1A 3U2LA 1C02A 3L1MA 4BPMA 4CS9A 2DGJA 4ANJA 2PFDA 2ZXOA 3DM9B 2J9UA 1LM3B 4GQHA 2R25A 2A0UA 4OIPF 3U9JA 2OG2A 1NZEA 4IGGA 1FR0A 3R7CA 1PD1A 3RW0A 4C3BA 1SF8A 1VK5A 2L7AA 4XEVA 2IXNA 1TWCA 4Z9JA 3ZQYA 2A6EF 4XWJA 5BQIA 3W2WA 2M64A 4U5EE 4LDKA 4JTAB 4MS2A 4P9TA 1ZU4A 3PMRA 3QZCA 1ZHZA 4CSAA 3SP1A 3CZ6A 2XSEA 3TD7A 2J7PD 4YT2A 3TJ6A 2A6HF 2FAPB 4YL0A 3EPVA 3HKKA 1LPEA 3DJUB 4U9EA 3UMHA 5A6KA 1KTMA 3C18A 4Z9IA 1A7VA 1HMDA 3AOUA 4MVQA 4N4WA 5COMA 4EUKB 1WGWA 2ZXRA 4YL3A 3SXKA 1OW6A 1YJGA 2F22A 3C63A 2XXAA 1TFKB 3L8JA 3M4BA 4G78A 1QKRA 2YLGA 4U5BE 1H7IA 1HY5A 3RQGA 5T3TA 4XLNF 3SZRA 1YZCA 4ULVA 4LLEA 1RJ9B 1TWAA 2Y39A 3OA1A 3QVZA 2A1DD 1KU2A 3G4ZA 2C04A 4XTKA 1OXKA 1KNYA 3EGDB 5BQGA 2PNOA 2XS1A 1NSGB 1BR4A 2R7SA 2R7UA 3BEHA 5DS5A 4Q5SF 1E2XA 2Z15A 3JCUQ 4O7GA 2Y3GA 4DBRA 2J0XA 5JLIA 2NSFA 4N6CA 3K1IC 3VF0A 2KGOA 5KYWA 1D1BA 3AQCA 4NY3A 3HTKC 1MMDA 3NMIA 4M63A 4JZAA 3WHNA 1M6TA 2ZXWC 3U3FA 1C17M 4JKVA 2XRHA 1A41A 3IHUA 4U5DE 1V55C 2LD6A 3VAYA 2NG1A 3AQBA 5D92A 5CIVA 1VLSA 2VCAA 3ASNC 2J0WA 2KC3A 1NU9C 3ECSA 4JCZA 1Z63A 3U5SA 3K1HA 5KYYB 2J7PA 2XL6A 2JPUA 3ABLC 4AL0A 3U0CA 3GWLA 4CS9C 3S28A 1T5OA 3SNHA 2BE5F 1R4TA 1RXQA 4B6IA 3TK0A 4CIHA 5E2QA 1W2WA 2R03A 4K1OA 3DE9A 1LS4A 2KYHA 2QE9A 2VCBA 3CQZA 4YJWA 4AK9A 3EZIA 1FAPB 3DAFA 1NBBA 4QI2A 2W9YA 1FMWA 1V74B 2WZLA 3EQLF 3O39A 4CBEA 4CSAC 1YA9A 4I1OB 3AGTA 5KYUA 3G50A 4K0DA 5DS4A 2QNLA 2CCYA 2YLDA 3S0XA 2G62A 1FFHA 3MFNA 3JRTA 1TFOB 4MTFA 4YT4A 2KK1A 3MYFA 2IXMA 2YZSA 3EH2A 2IOQA 4ONSA 3ABKC 4ER9A 1AEPA 4NTBA 4U5FE 2XXAB 4I1MA 1QSPA 4IAQA 3ZTMA 1JR8A 2ICWG 3JRMO 1D1AA 4I3MA 2D5RB 1M2VA 1SZIA 1Y4CA 3MLGA 3V5ZA 1J8MF 1NU7D 4MTGA 4U9DA 1E86A 1GM5A 2XM0A 3EHNA 3U9MA 3N24A 1WOLA 3VM6A 3C7JA 4ZLCA 3GM3A 3T9OA 2PX0A 3S27A 2XLDA 3EFOB 1LS1A 2NPUA 2R7TA 1QVXA 2J9WA 3DMDA 1U0BB 1ORYA 2L6HA 256BA 2R9RB 3MBGA 2XLMA 2XLOA 3UMIA 3ZIBA 2V26A 1LVKA 2Y3DA 4JEAA 3RVZA 4EWCA 3F47A 1Q0KA 2E87A 2XLHA 4G0HA 2GA0A 3HLZA 3M79A 2R7QA 3CSKA 4MVZA 5JUAA 4HFKB 1V4AA 4O6NA 5KYWB 3W2VA 3AG1C
chains in the Genus database with same CATH topology
4C3DA 4PJMA 4DVYP 1M56C 1D0YA 2P7VA 2OCCC 3X1OA 1Z3IX 4BEJA 4C7OA 2VASA 1BR2A 4P6IC 4RDAA 3DXJF 4AX2A 1J8YF 3Q7GA 2KQ9A 5DQZA 4AE4A 3UR3C 4OIQF 4I44A 5L3VA 3ITFA 2NUTA 3LESA 3HJCA 3K6BA 2Y3BA 4K7BA 3LJBA 4O79A 4IRUA 4DOZA 4BJ5C 2M4EA 2C03A 1QLEC 5KYNA 3UMKA 2PX3A 1M2OA 4OD5A 2WB7A 2HV6A 4JURI 5KYUB 1ZHYA 2R7VA 2H7OA 1FFTC 2A69F 4FESA 3SEOA 4BJ6A 2FFHA 3L34A 3NYMA 2ZPAA 4OINF 2XL4A 4KNWA 3DD7A 1M2VB 2WVQA 2ZXPA 3B0VC 3RKOF 3PHF2 4DBQA 2DYRC 2Y69C 3Q6MA 3AG3C 1VOMA 4CS8C 4U5GA 3E9VA 2G3KA 5E3AA 3JYHA 4YT8A 5L3QA 4JVSA 4G7ZF 3K66A 3KL4A 4F4BA 1ZHXA 4KI2A 3B0PA 4OIRF 3JSZA 4PJJA 2MYSA 4QI0A 2P6VA 1D0ZA 4C7OB 2R7XA 1ZHWA 2V3CC 1IW7F 3X2QC 2FGYA 4AE4B 2IXPA 3EGXA 1PD0A 4YN0B 3JT1A 2GFHA 2IXOA 2NUTB 2YHSA 4EBBA 4U5CE 5T3WA 5FCLA 1O87A 3UGOA 2A68F 3LLKA 3RFYA 1OKKD 5DS6A 4BG0A 3OWTA 3EJNA 4PJNA 4XLPF 5E33A 4CS7A 3NRHA 4KBLA 1OCRC 4OIOF 3S29A 3NYLA 1OCZC 4DVZA 3F46A 4BJ6C 2EIKC 3RH3A 3ASOC 2W45A 2R7WA 3RIPA 3I5QA 3LNRA 1FMVA 4ZLDA 2VH3A 3DZAA 3NKDA 3EHMA 4PFPA 3T6BA 3EZHA 3DJNB 3ZVRA 3N2ZB 3ABMC 3DAGA 1FTSA 4YWQA 4PFOA 2WZGA 2PF4E 2KNHA 2Q9AA 3WODF 3B9QA 2X51A 2H7BA 5T1DB 3LS0A 4G7OF 2J45A 5F5FA 4PJLA 1MMGA 1SMYF 2CW0F 3KH2A 2KJGA 4J30B 5F5HA 4LERA 1MNEA 1OKKA 1V54C 3Q7LA 3M1CB 2H7VC 4JW1A 4O6YA 3LLIA 1TWHA 3T6JA 5B1BC 1ZYRF 3EGXB 3AG2C 3FAJA 4HFFB 5B1AC 3FDQA 2EILC 4JCHA 3UGPA 4PK4A 3ZG1A 5BUOA 5KYYA 1NG1A 2Q9BA 2WVOA 3EH1A 4KC9A 3NDBB 3OEOA 1BR1A 1MMNA 5DVWA 2CGEA 4H4KC 1MMAA 4LACB 4X0RA 3UNGC 2QTVA 4A2NB 1TWGA 1ZU5A 2PP4A 3EG9A 1VMAA 4GEHA 5CI9A 1Z6AA 4QDLA 1G8XA 4O6MA 2EIJC 1TKNA 2QY9A 2EIMC 4G7HF 3NYJA 2DYSC 2B0JA 4YT5A 3I5PA 3IEEA 4HEAJ 4ULWA 5KYXA 4C3EA 3EFOA 1Z5ZA 2CNWD 3FVYA 4Q4ZF 2YEVA 3E70C 1D1CA 3W8HA 5DLJA 5HSWA 2L81A 3K7DA 4Q7CA 4MQ9F 4RBNA 4OD4A 1ST6A 4JJGA 2CDQA 1ZHTA 3QMKA 3KKBA 3T4RA 1OCOC 2LSEA 3L0IA 2HV7A 1D0XA 4IJJA 2NUPA 4E7SA 3GANA 5E3CA 4E7ZA 2KW3C 2WVNA 1N1CA 4U5HA 1TR2A 1VYKA 1PCXA 4FWVA 3ZC4A 4BJ5A 4JJFA 2IYLD 3W8IA 1MNDA 1OCCC 5B3SC 2J9VA 1S7ZA 3LS1A 5CI8A 1QZXA 3DM5A 3Q6NA 2R7RA 3EG9B 2I8BA 4MNDA 1JPNA 2WZFA 3N0TA 3POVA 3V7OA 2CNWA 1VYIA 3GODA 5EGYA 1M57C 1Z23A 5EHHA 4WJ0A 3AG4C 2EINC 4W8KA 2Y3HA 2O9XA 3FHDA 2G3VA 2Q3TA 4FX5A 4IAOA 4RD9A 3RYLA 4BJTA 1RJ9A 3SYNA 3NKEA 1LKXA 1O5HA 3EGDA 5KYXB 3O6XA 1JPJA 4LLCA 4KNVA 4IWBA 4CS8A 4J32B 3H65A 2R7OA 5IY5C 2MWQA 3I4UA 3VYWA 3B0UX 5DQTA 4GYTA 3WG7C 3ZSUA 5D91A 2Q9CA 2J46A 2WL8A 4N06A 3MX3A 3LAYA 2JD3A 2W4BA 1IZMA 3K33A 2W4MA 3NG1A 3KMIA 4HE8D 2L9JA 2VB6A 2NUPB 3LEVA 4BJ1A 4CS9A 2DGJA 4ANJA 2PFDA 2ZXOA 3DM9B 2J9UA 4OIPF 2OG2A 1NZEA 1PD1A 4C3BA 1SF8A 1VK5A 2IXNA 1TWCA 2A6EF 4XWJA 3W2WA 4U5EE 1ZU4A 3PMRA 3QZCA 1ZHZA 4CSAA 3SP1A 3CZ6A 2XSEA 3TD7A 2J7PD 4YT2A 2A6HF 3EPVA 3DJUB 3UMHA 1WGWA 2ZXRA 2XXAA 4U5BE 5T3TA 4XLNF 3SZRA 4LLEA 1RJ9B 1TWAA 2Y39A 3OA1A 2A1DD 1KU2A 2C04A 4XTKA 3EGDB 1BR4A 2R7SA 2R7UA 5DS5A 4Q5SF 2Z15A 3JCUQ 4O7GA 2Y3GA 4DBRA 2J0XA 3K1IC 5KYWA 2KGOA 1D1BA 3AQCA 4NY3A 3HTKC 1MMDA 4M63A 4JZAA 2ZXWC 2XRHA 4U5DE 1V55C 3VAYA 2NG1A 3AQBA 5D92A 3ASNC 2J0WA 3ECSA 1NU9C 1Z63A 3K1HA 5KYYB 2J7PA 3ABLC 4CS9C 3S28A 3SNHA 2BE5F 4B6IA 4CIHA 5E2QA 1W2WA 4AK9A 4YJWA 3CQZA 3EZIA 3DAFA 4QI2A 2W9YA 1FMWA 2WZLA 3EQLF 3O39A 4CBEA 4CSAC 4I1OB 5KYUA 4K0DA 5DS4A 3S0XA 2G62A 1FFHA 3JRTA 4YT4A 2IXMA 2YZSA 3EH2A 2IOQA 3ABKC 4U5FE 2XXAB 4I1MA 4I3MA 1D1AA 2D5RB 1M2VA 1SZIA 3MLGA 1J8MF 1NU7D 3EHNA 3N24A 4ZLCA 2PX0A 3S27A 3EFOB 1LS1A 2R7TA 2J9WA 3DMDA 3ZIBA 3UMIA 2V26A 1LVKA 2Y3DA 4EWCA 3F47A 2E87A 4G0HA 3HLZA 2R7QA 3CSKA 4HFKB 5KYWB 4O6NA 3W2VA 3AG1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZG1 A;  3LAY A;  3ITF A;  2Y39 A;  3O39 A;  3EPV A;  2Y3H A;  2Y3B A;  2Y3G A;  3OEO A;  2Y3D A;  3QZC A; 
#chains in the Genus database with same CATH topology
 3IQT A;  4C3D A;  3JYY A;  4PJM A;  1A7D A;  4MW8 A;  3FOP A;  4R32 A;  4NTA A;  1L3P A;  4DVY P;  3L8I A;  3FAP B;  3C8Z A;  1M56 C;  1D0Y A;  2P7V A;  4DXW A;  3DE8 A;  4UDV A;  2HFI A;  2OCC C;  3B29 A;  1Z3I X;  3X1O A;  4BEJ A;  4C7O A;  1OQC A;  2VAS A;  1BR2 A;  3KPH A;  4P6I C;  1YYX A;  4RDA A;  3DXJ F;  4AX2 A;  3HNL A;  4CDY A;  1J8Y F;  3Q7G A;  2KQ9 A;  5DQZ A;  2P1A A;  4AE4 A;  1ORS C;  1L7C A;  1UG7 A;  3U8P A;  3UR3 C;  4OIQ F;  4I44 A;  3LEO A;  2NSG A;  4PAC A;  1GS9 A;  2IBF A;  5L3V A;  1ZVZ A;  3QTH A;  3M15 A;  4E0H A;  5HV9 A;  3ITF A;  2NUT A;  3LES A;  4E18 A;  3HJC A;  1XWJ A;  2XM4 A;  1K40 A;  3K6B A;  2Y3B A;  4K7B A;  2J9B A;  3LJB A;  1CPR A;  4IRU A;  4NQF A;  4O79 A;  3ZWI A;  2M4E A;  2C03 A;  1QLE C;  4BJ5 C;  4DOZ A;  3FOO A;  3UMK A;  5F28 E;  5KYN A;  3W4Y A;  2PX3 A;  1M2O A;  4OD5 A;  1K05 A;  3KYI A;  4MVU A;  2WB7 A;  1LE2 A;  3AGU A;  3O10 A;  5TJ5 E;  2HV6 A;  4JUR I;  5KYU B;  1ZHY A;  5AGF A;  2R7V A;  1VLT A;  2EPL X;  3M4C A;  5L0G A;  2H7O A;  1FFT C;  1JRA A;  2EPN A;  1H9G A;  2A69 F;  2R05 A;  2YL7 A;  4DRH B;  3POV A;  4DRI B;  4FES A;  3SEO A;  2DI3 A;  1T6I A;  3S84 A;  4BJ6 A;  4H54 A;  2Q4F A;  2FFH A;  3L34 A;  1U6H A;  2ZPA A;  3NYM A;  4JEB A;  4OIN F;  3SXZ A;  1E84 A;  4JTC B;  3TUL A;  2XL4 A;  3G4X A;  3KYJ A;  3DD7 A;  2QLA A;  4KNW A;  4MTO A;  1M2V B;  2WVQ A;  5A6B D;  5A6J A;  1LI5 A;  2R02 A;  2YQY A;  2ZXP A;  4JTD B;  1LIH A;  3B0V C;  3RKO F;  2AWY A;  4DBQ A;  2DYR C;  3PHF 2;  2Y69 C;  3Q6M A;  4XEK A;  4CDA A;  1E85 A;  4IB4 A;  4N6H A;  3AG3 C;  5JS5 A;  1VOM A;  2CYD A;  4CS8 C;  1WAS A;  4U5G A;  3U2M A;  1HW2 A;  3E9V A;  3SXM A;  2G3K A;  3FMS A;  2XLV A;  5L0D A;  4NTF A;  2XLW A;  2L6G A;  2YL1 A;  5E3A A;  1OXB A;  2GAQ A;  3SXY A;  2QUP A;  3JYH A;  4AL1 A;  2HUJ A;  4YT8 A;  5L3Q A;  2HJ3 A;  1JOG A;  4JVS A;  4G7Z F;  1YAU O;  3K66 A;  3KL4 A;  1G5Z A;  4F4B A;  1YVI A;  1ZHX A;  3QW1 A;  4KI2 A;  3B71 A;  3B0P A;  4OIR F;  3JSZ A;  4PJJ A;  4IAR A;  2MYS A;  1ZW2 A;  4QI0 A;  2HZ8 A;  1I4Y A;  3TQO A;  2P6V A;  1D0Z A;  1WN0 A;  1T6U A;  4C7O B;  1CPQ A;  2R7X A;  1ZHW A;  2V3C C;  3GEH A;  1BDJ B;  4PR9 A;  1IW7 F;  2ASR A;  3X2Q C;  2FGY A;  4AE4 B;  4CIP A;  3HNK A;  3J06 A;  2IXP A;  3EGX A;  3LUT B;  1PD0 A;  4YN0 B;  3JT1 A;  2GFH A;  2IXO A;  2NUT B;  3JTL O;  2YHS A;  4EBB A;  1OW8 A;  4XPY A;  4U5C E;  5T3W A;  5FCL A;  5L0H A;  1O87 A;  1YA7 O;  3UGO A;  2A68 F;  1WTY A;  3LLK A;  3RFY A;  1LE4 A;  1OKK D;  1A7E A;  3HNI A;  5DS6 A;  5A6B A;  1A0B A;  2KSF A;  4BG0 A;  1DOW A;  4CJG A;  1OR3 A;  5AC4 A;  3OWT A;  4CX9 A;  3EJN A;  1EKY A;  2VC9 A;  1WWP A;  4PJN A;  4XLP F;  5E33 A;  4CS7 A;  3NRH A;  4KBL A;  4CJO A;  4EHP A;  1H9T A;  1OCR C;  4OIO F;  3S29 A;  3NYL A;  2DB4 A;  1OCZ C;  4DVZ A;  2D4U A;  3F46 A;  2P0N A;  2XLE A;  1T01 A;  2EIK C;  4BJ6 C;  3RH3 A;  3ASO C;  1HE9 A;  2W45 A;  2VCC A;  4MVM A;  1E83 A;  4W8P A;  5AC5 A;  4J7Y A;  3RIP A;  2R7W A;  1H6G A;  3I5Q A;  3LNR A;  1FMV A;  3QVY A;  4XPW A;  4DRJ B;  4ZLD A;  2VH3 A;  3DZA A;  3NKD A;  3EHM A;  4PFP A;  5B3I A;  1YZA A;  2BL2 A;  2LK4 A;  3DJN B;  3EZH A;  4XPX A;  1SYQ A;  3T6B A;  3N2Z B;  3ZVR A;  4E0I A;  3S90 A;  2OQM A;  3ABM C;  2LP4 A;  3DAG A;  1YDI A;  2HMZ A;  1FTS A;  4YWQ A;  1I4Z A;  5L0C A;  4PFO A;  2YRF A;  2WZG A;  2PF4 E;  2KNH A;  2Q9A A;  4JIO A;  2EPK X;  3IQ6 A;  3WOD F;  3NMK A;  3B9Q A;  2X51 A;  3GM2 A;  2H7B A;  5T1D B;  3LS0 A;  3PCV A;  2J45 A;  3TJ5 A;  4G7O F;  3GOR A;  5F5F A;  1EA8 A;  4PJL A;  1MMG A;  1SMY F;  1DOV A;  4LDR A;  4MVR A;  2CW0 F;  3KH2 A;  2KJG A;  4J30 B;  1HE1 A;  1OR2 A;  5F5H A;  3VRC A;  3T6G B;  1CGN A;  4LER A;  3ZDL A;  1MNE A;  1OKK A;  1V54 C;  3Q7L A;  3M1C B;  4EBJ A;  2H7V C;  4JW1 A;  4O6Y A;  3LLI A;  1TWH A;  3T6J A;  1MQV A;  2BC5 A;  3V5X A;  1UFB A;  3QW0 A;  5B1B C;  1Z7Q c;  1XZQ A;  1ZYR F;  2HSQ A;  3EGX B;  2HMQ A;  3C8G D;  3AG2 C;  3FAJ A;  1TQG A;  3MYI A;  4HFF B;  2X0C A;  5B1A C;  1JMW A;  2AVK A;  1FNT c;  3FDQ A;  2EIL C;  2HJM A;  4J7T A;  4JCH A;  2LCH A;  4WGY A;  3UGP A;  2GWW A;  3LNM B;  4PK4 A;  3ZG1 A;  2GDC A;  5BUO A;  5KYY A;  2OU6 A;  2MHR A;  1NG1 A;  1QPU A;  2OOC A;  3R2P A;  2Q9B A;  1B68 A;  2WVO A;  3EH1 A;  4KC9 A;  5BQH A;  1Y6D A;  3NDB B;  3C62 A;  3OEO A;  1T9K A;  1BR1 A;  3IQ5 A;  5L0J A;  5A69 A;  2XL8 A;  5COF A;  1MMN A;  1YAR O;  4P9F A;  5DVW A;  3TOM A;  2CGE A;  4H4K C;  1MMA A;  4LAC B;  4X0R A;  4CDV A;  3UNG C;  4YL1 A;  3US6 A;  2QTV A;  4A2N B;  2H8A A;  1TWG A;  2HKV A;  1RKE A;  4NCQ A;  1ZU5 A;  3RF3 A;  2PP4 A;  3EG9 A;  2OJE D;  1VMA A;  4GEH A;  2P61 A;  2HSB A;  4XQ1 A;  3PDM P;  5CI9 A;  5COG A;  2AP3 A;  1Z6A A;  5L0F A;  4QDL A;  1G8X A;  5KYX B;  3U3B A;  4JC7 A;  4O6M A;  2EIJ C;  1WAT A;  2B0H A;  4D4X A;  5JT4 A;  2LFF A;  1HW1 A;  1TKN A;  3ATP A;  2QY9 A;  3GWN A;  2EIM C;  2YL0 A;  4LDQ A;  4G7H F;  3NYJ A;  1GQA A;  2UUI A;  2DYS C;  2B0J A;  4YT5 A;  3I5P A;  1ZW3 A;  3IEE A;  4HEA J;  4ULW A;  4DJ9 A;  1YYJ A;  4NC3 A;  5L0I A;  1O3U A;  2EPM X;  4XEF A;  5KYX A;  4C3E A;  3C8G A;  3DKA A;  2RD9 A;  3EFO A;  1Z5Z A;  2CNW D;  2AU5 A;  1NLX A;  1RKC A;  2LIG A;  3FVY A;  4JE9 A;  4Q4Z F;  2YEV A;  1D1C A;  3E70 C;  4MVS A;  3W8H A;  5DLJ A;  5HSW A;  1GGQ A;  4YK5 A;  4EIY A;  2L81 A;  1C03 A;  3K7D A;  1AVO B;  2AWC A;  4MQ9 F;  4Q7C A;  4OD4 A;  4RBN A;  3S9O A;  3H2U A;  4EBK A;  1ST6 A;  4E17 A;  1JAF A;  2ETS A;  5K0I A;  4JJG A;  2IM8 A;  2CDQ A;  2Q00 A;  5JSL A;  1ZHT A;  3QMK A;  2OEV A;  3KKB A;  1RMV A;  5JRA A;  4Z9H A;  3T4R A;  3RVY A;  1OCO C;  2LSE A;  5GPG B;  3GEE A;  4MW3 A;  3O55 A;  4BEM J;  1S05 A;  3TOL A;  3L0I A;  2HV7 A;  3IPM O;  1BBH A;  1D0X A;  2NUP A;  4IJJ A;  1QQ3 A;  2A0B A;  4E7S A;  3GAN A;  5E3C A;  4E7Z A;  2LFD A;  2JX0 A;  3A9C A;  1AUE A;  3CAX A;  2KW3 C;  2WVN A;  3DI5 A;  1ZZP A;  2YVK A;  3JZ0 A;  1SR2 A;  1APC A;  1N1C A;  4U5H A;  1BZ4 A;  1TR2 A;  1NFO A;  1PCX A;  1VYK A;  2YKZ A;  1PV3 A;  4FWV A;  4D4N A;  4EKW A;  5A6A A;  3NMJ A;  3A11 A;  3JSE O;  3ZC4 A;  4BJ5 A;  4JJF A;  3BRJ A;  2IYL D;  3U8V A;  1MND A;  2OKU A;  3W8I A;  1OCC C;  1RCP A;  1T6Q A;  2J9V A;  5FZT A;  5B3S C;  1RKE B;  1S7Z A;  3LS1 A;  1QZX A;  2UUH A;  3DM5 A;  3Q6N A;  4WGZ A;  5CI8 A;  2R7R A;  3EG9 B;  3DWW A;  2ZD9 A;  2Q7R A;  4BJT A;  5JVE A;  1G4W R;  2I8B A;  1JPN A;  2WZF A;  2L6F A;  3N0T A;  4MND A;  2CNW A;  1VYI A;  2RSE B;  3GOD A;  3V7O A;  1EQ1 A;  5EGY A;  1M57 C;  4WAB A;  1Z23 A;  1CGO A;  3IQC A;  3GM1 A;  4WJ0 A;  5EHH A;  1Q0F A;  3AG4 C;  2EIN C;  4W8K A;  1CGM E;  3ZQV A;  1I5N A;  2Y3H A;  2I15 A;  2O9X A;  2G3V A;  2Q3T A;  3FHD A;  4FX5 A;  4IAO A;  1EI7 A;  4RD9 A;  5EK0 A;  3RYL A;  1RJ9 A;  3SYN A;  2OJQ A;  2XS8 A;  3NKE A;  1LKX A;  3V5Y A;  1O5H A;  3RQF A;  1F1M A;  1HMO A;  3EGD A;  3WAQ A;  4A4A A;  3C8G B;  1JPJ A;  2YLI A;  3O6X A;  1Q0G A;  5JP7 A;  1U89 A;  3ZTZ A;  4LLC A;  4KNV A;  1XZP A;  4IWB A;  1Q0M A;  4FAP B;  4CS8 A;  2YL3 A;  1OW7 A;  3H2V A;  3H65 A;  4J32 B;  2YWA A;  2R7O A;  5IY5 C;  2J8W A;  1VB5 A;  3K1I A;  2MWQ A;  3I4U A;  3VYW A;  3B0U X;  1LI7 A;  3AJM A;  4MVO A;  5DQT A;  1ORJ A;  4GYT A;  3WG7 C;  1VTM P;  3ZSU A;  2PBE A;  2EPO A;  3CEX A;  5D91 A;  2Q9C A;  2J46 A;  1G4U S;  1YLM A;  2WL8 A;  4N06 A;  3FXH A;  3LAY A;  2JD3 A;  2W4B A;  1IZM A;  3K33 A;  3MX3 A;  2HS5 A;  3GEI A;  4L6R A;  3RQE A;  2W4M A;  2OEX A;  3NG1 A;  2TMV P;  3KMI A;  3HNJ A;  1NFN A;  2LQG A;  4HE8 D;  1R5I D;  1K04 A;  2L9J A;  2VB6 A;  1Q0D A;  2NUP B;  3LEV A;  4JRZ A;  4BJ1 A;  3U2L A;  1C02 A;  3L1M A;  4BPM A;  4CS9 A;  2DGJ A;  4ANJ A;  2PFD A;  2ZXO A;  3DM9 B;  2J9U A;  1LM3 B;  4GQH A;  2R25 A;  2A0U A;  4OIP F;  3U9J A;  2OG2 A;  1NZE A;  4IGG A;  1FR0 A;  3R7C A;  1PD1 A;  3RW0 A;  4C3B A;  1SF8 A;  1VK5 A;  2L7A A;  4XEV A;  2IXN A;  1TWC A;  4Z9J A;  3ZQY A;  2A6E F;  4XWJ A;  5BQI A;  3W2W A;  2M64 A;  4U5E E;  4LDK A;  4JTA B;  4MS2 A;  4P9T A;  1ZU4 A;  3PMR A;  3QZC A;  1ZHZ A;  4CSA A;  3SP1 A;  3CZ6 A;  2XSE A;  3TD7 A;  2J7P D;  4YT2 A;  3TJ6 A;  2A6H F;  2FAP B;  4YL0 A;  3EPV A;  3HKK A;  1LPE A;  3DJU B;  4U9E A;  3UMH A;  5A6K A;  1KTM A;  3C18 A;  4Z9I A;  1A7V A;  1HMD A;  3AOU A;  4MVQ A;  4N4W A;  5COM A;  4EUK B;  1WGW A;  2ZXR A;  4YL3 A;  3SXK A;  1OW6 A;  1YJG A;  2F22 A;  3C63 A;  2XXA A;  1TFK B;  3L8J A;  3M4B A;  4G78 A;  1QKR A;  2YLG A;  4U5B E;  1H7I A;  1HY5 A;  3RQG A;  5T3T A;  4XLN F;  3SZR A;  1YZC A;  4ULV A;  4LLE A;  1RJ9 B;  1TWA A;  2Y39 A;  3OA1 A;  3QVZ A;  2A1D D;  1KU2 A;  3G4Z A;  2C04 A;  4XTK A;  1OXK A;  1KNY A;  3EGD B;  5BQG A;  2PNO A;  2XS1 A;  1NSG B;  1BR4 A;  2R7S A;  2R7U A;  3BEH A;  5DS5 A;  4Q5S F;  1E2X A;  2Z15 A;  3JCU Q;  4O7G A;  2Y3G A;  4DBR A;  2J0X A;  5JLI A;  2NSF A;  4N6C A;  3K1I C;  3VF0 A;  2KGO A;  5KYW A;  1D1B A;  3AQC A;  4NY3 A;  3HTK C;  1MMD A;  3NMI A;  4M63 A;  4JZA A;  3WHN A;  1M6T A;  2ZXW C;  3U3F A;  1C17 M;  4JKV A;  2XRH A;  1A41 A;  3IHU A;  4U5D E;  1V55 C;  2LD6 A;  3VAY A;  2NG1 A;  3AQB A;  5D92 A;  5CIV A;  1VLS A;  2VCA A;  3ASN C;  2J0W A;  2KC3 A;  1NU9 C;  3ECS A;  4JCZ A;  1Z63 A;  3U5S A;  3K1H A;  5KYY B;  2J7P A;  2XL6 A;  2JPU A;  3ABL C;  4AL0 A;  3U0C A;  3GWL A;  4CS9 C;  3S28 A;  1T5O A;  3SNH A;  2BE5 F;  1R4T A;  1RXQ A;  4B6I A;  3TK0 A;  4CIH A;  5E2Q A;  1W2W A;  2R03 A;  4K1O A;  3DE9 A;  1LS4 A;  2KYH A;  2QE9 A;  2VCB A;  3CQZ A;  4YJW A;  4AK9 A;  3EZI A;  1FAP B;  3DAF A;  1NBB A;  4QI2 A;  2W9Y A;  1FMW A;  1V74 B;  2WZL A;  3EQL F;  3O39 A;  4CBE A;  4CSA C;  1YA9 A;  4I1O B;  3AGT A;  5KYU A;  3G50 A;  4K0D A;  5DS4 A;  2QNL A;  2CCY A;  2YLD A;  3S0X A;  2G62 A;  1FFH A;  3MFN A;  3JRT A;  1TFO B;  4MTF A;  4YT4 A;  2KK1 A;  3MYF A;  2IXM A;  2YZS A;  3EH2 A;  2IOQ A;  4ONS A;  3ABK C;  4ER9 A;  1AEP A;  4NTB A;  4U5F E;  2XXA B;  4I1M A;  1QSP A;  4IAQ A;  3ZTM A;  1JR8 A;  2ICW G;  3JRM O;  1D1A A;  4I3M A;  2D5R B;  1M2V A;  1SZI A;  1Y4C A;  3MLG A;  3V5Z A;  1J8M F;  1NU7 D;  4MTG A;  4U9D A;  1E86 A;  1GM5 A;  2XM0 A;  3EHN A;  3U9M A;  3N24 A;  1WOL A;  3VM6 A;  3C7J A;  4ZLC A;  3GM3 A;  3T9O A;  2PX0 A;  3S27 A;  2XLD A;  3EFO B;  1LS1 A;  2NPU A;  2R7T A;  1QVX A;  2J9W A;  3DMD A;  1U0B B;  1ORY A;  2L6H A;  256B A;  2R9R B;  3MBG A;  2XLM A;  2XLO A;  3UMI A;  3ZIB A;  2V26 A;  1LVK A;  2Y3D A;  4JEA A;  3RVZ A;  4EWC A;  3F47 A;  1Q0K A;  2E87 A;  2XLH A;  4G0H A;  2GA0 A;  3HLZ A;  3M79 A;  2R7Q A;  3CSK A;  4MVZ A;  5JUA A;  4HFK B;  1V4A A;  4O6N A;  5KYW B;  3W2V A;  3AG1 C; 
#chains in the Genus database with same CATH homology
 4C3D A;  4PJM A;  4DVY P;  1M56 C;  1D0Y A;  2P7V A;  2OCC C;  3X1O A;  1Z3I X;  4BEJ A;  4C7O A;  2VAS A;  1BR2 A;  4P6I C;  4RDA A;  3DXJ F;  4AX2 A;  1J8Y F;  3Q7G A;  2KQ9 A;  5DQZ A;  4AE4 A;  3UR3 C;  4OIQ F;  4I44 A;  5L3V A;  3ITF A;  2NUT A;  3LES A;  3HJC A;  3K6B A;  2Y3B A;  4K7B A;  3LJB A;  4O79 A;  4IRU A;  4DOZ A;  4BJ5 C;  2M4E A;  2C03 A;  1QLE C;  5KYN A;  3UMK A;  2PX3 A;  1M2O A;  4OD5 A;  2WB7 A;  2HV6 A;  4JUR I;  5KYU B;  1ZHY A;  2R7V A;  2H7O A;  1FFT C;  2A69 F;  4FES A;  3SEO A;  4BJ6 A;  2FFH A;  3L34 A;  3NYM A;  2ZPA A;  4OIN F;  2XL4 A;  4KNW A;  3DD7 A;  1M2V B;  2WVQ A;  2ZXP A;  3B0V C;  3RKO F;  3PHF 2;  4DBQ A;  2DYR C;  2Y69 C;  3Q6M A;  3AG3 C;  1VOM A;  4CS8 C;  4U5G A;  3E9V A;  2G3K A;  5E3A A;  3JYH A;  4YT8 A;  5L3Q A;  4JVS A;  4G7Z F;  3K66 A;  3KL4 A;  4F4B A;  1ZHX A;  4KI2 A;  3B0P A;  4OIR F;  3JSZ A;  4PJJ A;  2MYS A;  4QI0 A;  2P6V A;  1D0Z A;  4C7O B;  2R7X A;  1ZHW A;  2V3C C;  1IW7 F;  3X2Q C;  2FGY A;  4AE4 B;  2IXP A;  3EGX A;  1PD0 A;  4YN0 B;  3JT1 A;  2GFH A;  2IXO A;  2NUT B;  2YHS A;  4EBB A;  4U5C E;  5T3W A;  5FCL A;  1O87 A;  3UGO A;  2A68 F;  3LLK A;  3RFY A;  1OKK D;  5DS6 A;  4BG0 A;  3OWT A;  3EJN A;  4PJN A;  4XLP F;  5E33 A;  4CS7 A;  3NRH A;  4KBL A;  1OCR C;  4OIO F;  3S29 A;  3NYL A;  1OCZ C;  4DVZ A;  3F46 A;  4BJ6 C;  2EIK C;  3RH3 A;  3ASO C;  2W45 A;  2R7W A;  3RIP A;  3I5Q A;  3LNR A;  1FMV A;  4ZLD A;  2VH3 A;  3DZA A;  3NKD A;  3EHM A;  4PFP A;  3T6B A;  3EZH A;  3DJN B;  3ZVR A;  3N2Z B;  3ABM C;  3DAG A;  1FTS A;  4YWQ A;  4PFO A;  2WZG A;  2PF4 E;  2KNH A;  2Q9A A;  3WOD F;  3B9Q A;  2X51 A;  2H7B A;  5T1D B;  3LS0 A;  4G7O F;  2J45 A;  5F5F A;  4PJL A;  1MMG A;  1SMY F;  2CW0 F;  3KH2 A;  2KJG A;  4J30 B;  5F5H A;  4LER A;  1MNE A;  1OKK A;  1V54 C;  3Q7L A;  3M1C B;  2H7V C;  4JW1 A;  4O6Y A;  3LLI A;  1TWH A;  3T6J A;  5B1B C;  1ZYR F;  3EGX B;  3AG2 C;  3FAJ A;  4HFF B;  5B1A C;  3FDQ A;  2EIL C;  4JCH A;  3UGP A;  4PK4 A;  3ZG1 A;  5BUO A;  5KYY A;  1NG1 A;  2Q9B A;  2WVO A;  3EH1 A;  4KC9 A;  3NDB B;  3OEO A;  1BR1 A;  1MMN A;  5DVW A;  2CGE A;  4H4K C;  1MMA A;  4LAC B;  4X0R A;  3UNG C;  2QTV A;  4A2N B;  1TWG A;  1ZU5 A;  2PP4 A;  3EG9 A;  1VMA A;  4GEH A;  5CI9 A;  1Z6A A;  4QDL A;  1G8X A;  4O6M A;  2EIJ C;  1TKN A;  2QY9 A;  2EIM C;  4G7H F;  3NYJ A;  2DYS C;  2B0J A;  4YT5 A;  3I5P A;  3IEE A;  4HEA J;  4ULW A;  5KYX A;  4C3E A;  3EFO A;  1Z5Z A;  2CNW D;  3FVY A;  4Q4Z F;  2YEV A;  3E70 C;  1D1C A;  3W8H A;  5DLJ A;  5HSW A;  2L81 A;  3K7D A;  4Q7C A;  4MQ9 F;  4RBN A;  4OD4 A;  1ST6 A;  4JJG A;  2CDQ A;  1ZHT A;  3QMK A;  3KKB A;  3T4R A;  1OCO C;  2LSE A;  3L0I A;  2HV7 A;  1D0X A;  4IJJ A;  2NUP A;  4E7S A;  3GAN A;  5E3C A;  4E7Z A;  2KW3 C;  2WVN A;  1N1C A;  4U5H A;  1TR2 A;  1VYK A;  1PCX A;  4FWV A;  3ZC4 A;  4BJ5 A;  4JJF A;  2IYL D;  3W8I A;  1MND A;  1OCC C;  5B3S C;  2J9V A;  1S7Z A;  3LS1 A;  5CI8 A;  1QZX A;  3DM5 A;  3Q6N A;  2R7R A;  3EG9 B;  2I8B A;  4MND A;  1JPN A;  2WZF A;  3N0T A;  3POV A;  3V7O A;  2CNW A;  1VYI A;  3GOD A;  5EGY A;  1M57 C;  1Z23 A;  5EHH A;  4WJ0 A;  3AG4 C;  2EIN C;  4W8K A;  2Y3H A;  2O9X A;  3FHD A;  2G3V A;  2Q3T A;  4FX5 A;  4IAO A;  4RD9 A;  3RYL A;  4BJT A;  1RJ9 A;  3SYN A;  3NKE A;  1LKX A;  1O5H A;  3EGD A;  5KYX B;  3O6X A;  1JPJ A;  4LLC A;  4KNV A;  4IWB A;  4CS8 A;  4J32 B;  3H65 A;  2R7O A;  5IY5 C;  2MWQ A;  3I4U A;  3VYW A;  3B0U X;  5DQT A;  4GYT A;  3WG7 C;  3ZSU A;  5D91 A;  2Q9C A;  2J46 A;  2WL8 A;  4N06 A;  3MX3 A;  3LAY A;  2JD3 A;  2W4B A;  1IZM A;  3K33 A;  2W4M A;  3NG1 A;  3KMI A;  4HE8 D;  2L9J A;  2VB6 A;  2NUP B;  3LEV A;  4BJ1 A;  4CS9 A;  2DGJ A;  4ANJ A;  2PFD A;  2ZXO A;  3DM9 B;  2J9U A;  4OIP F;  2OG2 A;  1NZE A;  1PD1 A;  4C3B A;  1SF8 A;  1VK5 A;  2IXN A;  1TWC A;  2A6E F;  4XWJ A;  3W2W A;  4U5E E;  1ZU4 A;  3PMR A;  3QZC A;  1ZHZ A;  4CSA A;  3SP1 A;  3CZ6 A;  2XSE A;  3TD7 A;  2J7P D;  4YT2 A;  2A6H F;  3EPV A;  3DJU B;  3UMH A;  1WGW A;  2ZXR A;  2XXA A;  4U5B E;  5T3T A;  4XLN F;  3SZR A;  4LLE A;  1RJ9 B;  1TWA A;  2Y39 A;  3OA1 A;  2A1D D;  1KU2 A;  2C04 A;  4XTK A;  3EGD B;  1BR4 A;  2R7S A;  2R7U A;  5DS5 A;  4Q5S F;  2Z15 A;  3JCU Q;  4O7G A;  2Y3G A;  4DBR A;  2J0X A;  3K1I C;  5KYW A;  2KGO A;  1D1B A;  3AQC A;  4NY3 A;  3HTK C;  1MMD A;  4M63 A;  4JZA A;  2ZXW C;  2XRH A;  4U5D E;  1V55 C;  3VAY A;  2NG1 A;  3AQB A;  5D92 A;  3ASN C;  2J0W A;  3ECS A;  1NU9 C;  1Z63 A;  3K1H A;  5KYY B;  2J7P A;  3ABL C;  4CS9 C;  3S28 A;  3SNH A;  2BE5 F;  4B6I A;  4CIH A;  5E2Q A;  1W2W A;  4AK9 A;  4YJW A;  3CQZ A;  3EZI A;  3DAF A;  4QI2 A;  2W9Y A;  1FMW A;  2WZL A;  3EQL F;  3O39 A;  4CBE A;  4CSA C;  4I1O B;  5KYU A;  4K0D A;  5DS4 A;  3S0X A;  2G62 A;  1FFH A;  3JRT A;  4YT4 A;  2IXM A;  2YZS A;  3EH2 A;  2IOQ A;  3ABK C;  4U5F E;  2XXA B;  4I1M A;  4I3M A;  1D1A A;  2D5R B;  1M2V A;  1SZI A;  3MLG A;  1J8M F;  1NU7 D;  3EHN A;  3N24 A;  4ZLC A;  2PX0 A;  3S27 A;  3EFO B;  1LS1 A;  2R7T A;  2J9W A;  3DMD A;  3ZIB A;  3UMI A;  2V26 A;  1LVK A;  2Y3D A;  4EWC A;  3F47 A;  2E87 A;  4G0H A;  3HLZ A;  2R7Q A;  3CSK A;  4HFK B;  5KYW B;  4O6N A;  3W2V A;  3AG1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...