3LAYA

Alpha-helical barrel formed by the decamer of the zinc resistance-associated protein (stm4172) from salmonella enterica subsp. enterica serovar typhimurium str. lt2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
79
structure length
79
Chain Sequence
LTTEQQATAQKIYDDYYTQTSALRQQLISKRYEYNALLTASSPDTAKINAVAKEMESLGQKLDEQRVKRDVAMAQAGIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Zinc resistance-associated protein
publication title Alpha-Helical barrel formed by the decamer of the zinc resistance-associated protein (STM4172) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 33
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13801 Metal_resist Heavy-metal resistance
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3layA00
2Y3GA 2Y39A 2Y3BA 2Y3HA 3ZG1A 3OEOA 3EPVA 2Y3DA 3QZCA 3O39A 3ITFA 3LAYA
chains in the Genus database with same CATH superfamily
4D4NA 1Y6DA 2R7RA 3ZC4A 1NFOA 1FFTC 4YT2A 1JPJA 5A6AA 1RKEA 2XLWA 2QE9A 3VM6A 1E84A 1S05A 2R7WA 2XXAB 1WOLA 3B9QA 3U3BA 4CS9A 2ETSA 4DVYP 2XLOA 1NU9C 4NC3A 4QDLA 4XLPF 4AE4B 3UMIA 2EIKC 5EGYA 3RQEA 1I4YA 2YRFA 2YLDA 3G4ZA 1M2VA 3ZQVA 4WGYA 1H7IA 3JYYA 2IOQA 3T4RA 3W8HA 4CDAA 2C04A 5L0CA 3QVYA 3EZIA 4J32B 1A7VA 4CS8A 1CGOA 3DJUB 3O10A 2UUHA 2YEVA 5HSWA 1TWAA 2ICWG 2VCAA 3K66A 3NKEA 4U5FE 5B1BC 2PP4A 3TK0A 5DLJA 3AGTA 3FAJA 2HSQA 1HW2A 1V4AA 4EBKA 2R7QA 4DXWA 1U6HA 2HZ8A 2Y39A 4HE8D 3NYLA 3GWNA 5CI9A 3QZCA 1Q0FA 3X2QC 2R7OA 2L6GA 2OJED 4YT8A 2YKZA 5FCLA 3B0UX 5KYXA 2AP3A 2HMZA 3ABKC 4J30B 1GS9A 3OEOA 1A41A 3U5SA 5DQTA 2J45A 4JZAA 1CGNA 1HY5A 4BEMJ 4BJ6A 1G4WR 1YLMA 2C03A 4NTAA 2LQGA 2G3KA 4P6IC 3RYLA 3U8PA 3U3FA 2NUPA 2Q4FA 3EPVA 4JE9A 2YVKA 2H7BA 3ABLC 3U8VA 4WJ0A 3C63A 3FOPA 5EHHA 3SYNA 4D4XA 2WZGA 3E9VA 3K6BA 4YN0B 3QVZA 5L0GA 3R7CA 3HLZA 2R02A 2PF4E 1LE2A 1GGQA 3KYJA 4BJ5C 1J8MF 3A9CA 2R03A 4PJMA 1XWJA 4ANJA 3LUTB 2AVKA 4EKWA 4U5HA 1VTMP 3JRTA 2XLVA 2HMQA 2VH3A 2XM0A 3PMRA 2QY9A 3CSKA 1IZMA 4N4WA 3LAYA 5B3IA 1BZ4A 2F22A 1TKNA 4U9DA 3WODF 4G7OF 2R05A 5AC4A 1RMVA 1NU7D 2HV6A 1BBHA 3T9OA 3V5ZA 2EIJC 4N6CA 4CJGA 3FXHA 5A69A 4JEBA 4X0RA 3RVZA 2B0JA 2OU6A 1QZXA 1OQCA 2XL8A 2XLMA 4C3EA 2ZXPA 4CS7A 1D1AA 1ST6A 3I5PA 1T01A 1OR3A 3EZHA 4ULWA 3EGXA 3CQZA 4KI2A 1LVKA 3K7DA 2XM4A 1Z63A 3JSEO 3IQ5A 4DBRA 4JTDB 3SZRA 5E3CA 1WN0A 2VC9A 2KNHA 2PFDA 2WB7A 1YJGA 3ZQYA 2MHRA 1OCCC 4YT5A 1QPUA 4IRUA 3Q7GA 3ZTMA 1B68A 1O3UA 3SP1A 3S84A 3R2PA 1Y4CA 3SXKA 2RSEB 5GPGB 1MMDA 1TWCA 1CPRA 1KTMA 1ZHZA 5DVWA 2ZXRA 2VCBA 5A6BA 3L1MA 5JT4A 2FGYA 2L9JA 3EGDA 2IYLD 3RF3A 4U5CE 2EPNA 2Y3BA 2XL4A 3ZDLA 3JTLO 1E2XA 1R4TA 1VOMA 1YYXA 1FMWA 1LS4A 5KYNA 4NTBA 2Q9BA 3GM2A 4LDQA 5KYWB 2LFDA 2YLGA 2IXOA 2XRHA 1JAFA 3Q7LA 2WL8A 3KH2A 5JUAA 1Q0GA 2R7TA 3M4BA 1YYJA 1TFKB 2LK4A 1TQGA 1BR1A 4G78A 4RDAA 4OIOF 5JRAA 2LSEA 1ZHYA 1QKRA 1NBBA 1SF8A 2BC5A 1QLEC 2CDQA 3FOOA 3DXJF 3ZIBA 3EFOA 1VLSA 4CJOA 4MW3A 1OXBA 2YZSA 3FVYA 3N0TA 4YWQA 2GDCA 2OG2A 2J46A 3ATPA 5KYYB 4I3MA 1TWHA 2LD6A 2Y3DA 3E70C 3PCVA 1HE9A 2X51A 4MVSA 2HFIA 1N1CA 4H4KC 4DOZA 1NSGB 4CSAC 3SNHA 4J7TA 3L8IA 1JRAA 3DE8A 3EG9B 4LERA 3ZTZA 3EHNA 2DYRC 2DB4A 4Z9HA 3POVA 1U0BB 1H6GA 1BDJB 2PNOA 3FDQA 2YL3A 4NTFA 1K40A 2IXMA 3CAXA 3IHUA 1Z6AA 4N06A 4BPMA 3DD7A 3JZ0A 2V3CC 4XPYA 2KSFA 3CEXA 4RBNA 1LKXA 1VYKA 3GEHA 1Z7Qc 2L6FA 3FHDA 4HFFB 3LS0A 3K33A 4Q5SF 2HKVA 1SMYF 2OQMA 3W2WA 2CW0F 1NLXA 3AG3C 4MVQA 3GWLA 2KW3C 2P61A 2OCCC 2XLHA 4JW1A 5B1AC 2CNWD 1VK5A 4G7HF 3LESA 5DS5A 4Z9IA 4AE4A 3F47A 1G8XA 3NMIA 1JOGA 3C8GB 2GA0A 3L0IA 5DQZA 3U0CA 1LM3B 2W4MA 4OIRF 2QLAA 4MVRA 3GM3A 2J7PD 2ZPAA 4MQ9F 1T6IA 2CGEA 2EPMX 3LLIA 3V5YA 1V55C 4DRIB 2J8WA 4E0HA 4ZLDA 3DJNB 2OOCA 5DS6A 3ITFA 1ZZPA 3DMDA 2WVQA 3L8JA 1RKEB 3H2VA 3LEOA 3DKAA 3G50A 4LLCA 4DVZA 1V54C 1HW1A 1YZCA 3GODA 5HV9A 4CSAA 2NUTB 2M64A 2CCYA 3LNRA 5F5FA 1LE4A 2LFFA 4P9FA 1M6TA 3ASNC 4JCZA 2Q9CA 3GEIA 1TR2A 4JTAB 5K0IA 4PK4A 4JEAA 3U2MA 2TMVP 2ASRA 3NYMA 4FAPB 1UFBA 4MVUA 3GM1A 3HNKA 4W8KA 3SXMA 4BG0A 4EIYA 2WVNA 2LCHA 1QVXA 2P0NA 4JJFA 5L0DA 5L0HA 1ORJA 4JTCB 1LI7A 4U5EE 5BQGA 1A0BA 2JX0A 2YQYA 3IQ6A 3KL4A 1OW6A 4IWBA 3UMKA 5COGA 2B0HA 4PR9A 2H7VC 2QNLA 1ZHWA 1LS1A 2ZD9A 1OW8A 1G5ZA 4I44A 1MMAA 4JURI 4O79A 3S0XA 1NG1A 3TD7A 3MYIA 4DRHB 3C8ZA 5FZTA 3PHF2 4KBLA 2KYHA 3C7JA 1E83A 2Y3HA 4JRZA 3UGOA 4IGGA 2RD9A 1S7ZA 2OKUA 3RIPA 1OXKA 3DWWA 2FAPB 3WAQA 1FMVA 2QTVA 4MS2A 2KQ9A 1QQ3A 3I4UA 3PDMP 4ONSA 1YA9A 2DYSC 1ZHXA 3U9MA 3M79A 4CX9A 1VMAA 1WTYA 1SZIA 2J9VA 1D0YA 2OJQA 3BRJA 3JCUQ 3O39A 1DOVA 4JJGA 4PJLA 1MMGA 2G3VA 3DM5A 1Q0KA 2FFHA 2Y3GA 3EJNA 4E18A 4EUKB 3JT1A 1A7EA 2YWAA 3HNIA 5E3AA 3O6XA 1UG7A 3N24A 3US6A 4KNWA 5JP7A 1AUEA 1TFOB 2M4EA 4R32A 3QW0A 3B0PA 1RJ9A 2JPUA 5JVEA 1T5OA 2DI3A 4C3BA 1JPNA 1M2OA 1MNEA 3K1HA 1A7DA 1K05A 1OCOC 2OEVA 3QMKA 3RH3A 2ZXOA 3FMSA 3JRMO 1Z23A 3H65A 5D91A 2A68F 2IXPA 4MW8A 3S9OA 3HKKA 4CDVA 4XQ1A 4OIPF 4IAOA 2GAQA 1EKYA 2BL2A 4BEJA 2YHSA 4RD9A 3JSZA 5D92A 4OINF 3EGXB 3SXYA 4BJ5A 5AGFA 1W2WA 2R25A 2W9YA 1G4US 3VYWA 4C7OB 1K04A 3EH2A 5KYWA 3ZSUA 3G4XA 1VLTA 2DGJA 4XPXA 3TOMA 4OIQF 1I4ZA 3DM9B 2AU5A 4LDRA 4U5DE 2G62A 4XLNF 3MX3A 3AG2C 3ZVRA 4LDKA 5COMA 1QSPA 2Y69C 2GFHA 4O7GA 5E2QA 4YL1A 3KMIA 3S27A 2A0BA 1AEPA 3LS1A 2CNWA 3EGDB 1EI7A 5KYYA 3VAYA 1C17M 1T6QA 1MQVA 1DOWA 1D0ZA 2HSBA 2VASA 3MBGA 2Q7RA 2XLDA 2I15A 2EILC 2ZXWC 4IAQA 2J9BA 1PD0A 4YL0A 1SR2A 4PFPA 3AJMA 3TJ6A 1ORSC 4YJWA 3AOUA 5COFA 4A4AA 1XZPA 4EBJA 2MWQA 3EG9A 4MVZA 1C02A 3WG7C 1EQ1A 2J7PA 1KNYA 1L7CA 3X1OA 1WWPA 4JKVA 1WATA 3F46A 5IY5C 4N6HA 5L3VA 2A6HF 1E86A 4WABA 5T3WA 3DAGA 3UNGC 1BR2A 2NG1A 4MVMA 2H8AA 2PX3A 3DE9A 3DI5A 3EFOB 3W4YA 4PJNA 3O55A 3T6GB 3Q6NA 2H7OA 3LLKA 4FESA 3MYFA 1BR4A 3K1IC 4GEHA 5KYUB 4U5BE 4NQFA 4E7ZA 4M63A 4O6YA 2XXAA 1LPEA 2WVOA 2XS8A 3M1CB 5BUOA 1J8YF 3GANA 1ZW2A 3M15A 4LACB 2L6HA 4EHPA 2A6EF 2X0CA 3V5XA 1FR0A 3C62A 2EPKX 2L81A 4MTGA 2NSFA 2W45A 1SYQA 4E7SA 3HJCA 1O87A 2Z15A 1ZVZA 1M56C 3VRCA 3IPMO 4AK9A 4ZLCA 1MMNA 3QW1A 1LI5A 1U89A 2P6VA 4GQHA 4XPWA 4YL3A 3S90A 2I8BA 3TJ5A 1OKKD 5TJ5E 3RVYA 3LNMB 3TOLA 4DBQA 4EWCA 3NMKA 2JD3A 2A1DD 4I1MA 4XTKA 3T6BA 5A6JA 2GWWA 2MYSA 2EINC 3CZ6A 3KYIA 3NG1A 1VB5A 2Q9AA 4AL1A 1LIHA 5L0JA 3IQCA 1RKCA 1C03A 2NUTA 2VCCA 4MVOA 3IEEA 4XWJA 3ECSA 3T6JA 2EPOA 1M2VB 2KK1A 4J7YA 1NFNA 2V26A 3W2VA 1RCPA 2EIMC 3J06A 4FX5A 3SEOA 3RQFA 5A6KA 2D4UA 2J0WA 2D5RB 3DAFA 4G0HA 4PACA 3C8GD 2YL1A 3BEHA 3C18A 1H9TA 2O9XA 3EH1A 3JYHA 5AC5A 3W8IA 1D0XA 1APCA 3HNLA 4HFKB 2R7SA 1YAUO 4KNVA 4YT4A 4XEKA 4K0DA 2LP4A 4GYTA 4P9TA 3NRHA 3K1IA 4A2NB 2OEXA 4K7BA 4W8PA 1NZEA 2BE5F 2WZLA 3L34A 1FNTc 4G7ZF 1H9GA 4IB4A 2KJGA 5CI8A 3NYJA 4DJ9A 5KYXB 1PD1A 5JS5A 2L7AA 4NY3A 3U2LA 1Q0DA 1HMOA 4L6RA 4B6IA 4ER9A 5L3QA 3AQBA 1GM5A 3RFYA 4PFOA 4IJJA 4AX2A 2KC3A 3B0VC 1AVOB 1ZU5A 2KGOA 2CYDA 2NUPB 3I5QA 5JLIA 4CDYA 4U5GA 3HTKC 2QUPA 4O6NA 1JR8A 5T3TA 2PBEA 1R5ID 3B71A 1ZW3A 1F1MA 1VYIA 4BJTA 1EA8A 1FTSA 4I1OB 1T6UA 2HS5A 2J9UA 4UDVA 1M57C 3EQLF 3AG4C 2IXNA 2A69F 1T9KA 2Q00A 2R9RB 3H2UA 1YDIA 2HV7A 3MLGA 5B3SC 3V7OA 1OW7A 3S29A 3UGPA 1FAPB 1OCZC 1V74B 4H54A 4JIOA 5L0FA 3AGUA 4MTOA 3UR3C 3LEVA 2AWYA 1PCXA 2NSGA 2XSEA 4PJJA 3SXZA 4QI0A 1OR2A 2UUIA 4Q4ZF 2HJMA 4YK5A 4C3DA 2NPUA 1WGWA 3A11A 2W4BA 4CIPA 1ZU4A 3DZAA 4C7OA 2E87A 4HEAJ 4XEFA 1YARO 3AQCA 2IM8A 3EHMA 3IQTA 4K1OA 4ULVA 1RJ9B 4QI2A 1D1CA 4JCHA 3RKOF 4U9EA 3QTHA 4LLEA 1JMWA 5BQIA 3OA1A 3ASOC 1MNDA 3FAPB 5CIVA 1ZHTA 3U9JA 3LJBA 4FWVA 2Q3TA 1OCRC 3AG1C 5T1DB 4CBEA 3MFNA 4AL0A 4E0IA 4CS9C 2AWCA 3M4CA 1O5HA 1E85A 256BA 1XZQA 3TQOA 3TULA 1CPQA 3KPHA 4OD4A 4Q7CA 5BQHA 4IARA 3NDBB 5E33A 1Z5ZA 4E17A 2J0XA 1PV3A 2R7VA 2IBFA 2YL0A 3Q6MA 5JSLA 3WHNA 1OKKA 2XL6A 3OWTA 1ORYA 3ZWIA 2A0UA 2HJ3A 4OD5A 4EBBA 3UMHA 2XS1A 3B29A 4MNDA 4CS8C 1IW7F 2YL7A 4WGZA 3ZG1A 4CIHA 4O6MA 2PX0A 4XEVA 1I5NA 4BJ1A 5DS4A 3RW0A 2LIGA 1KU2A 3VF0A 5KYUA 1L3PA 1RXQA 1YVIA 2P1AA 2P7VA 2VB6A 2HUJA 5A6BD 4MTFA 1D1BA 3KKBA 1Q0MA 1YA7O 3NMJA 3GORA 1FFHA 4JVSA 1TWGA 3C8GA 1ZYRF 3ABMC 4DRJB 1CGME 2R7UA 3HNJA 5F5HA 3GEEA 1HE1A 3NKDA 5EK0A 3RQGA 4BJ6C 2YLIA 4JC7A 4NCQA 4KC9A 1HMDA 4F4BA 5L0IA 2J9WA 2R7XA 4Z9JA 3S28A 1WASA 1GQAA 1YZAA 2XLEA 5F28E 1Z3IX 2EPLX 2WZFA 3N2ZB
chains in the Genus database with same CATH topology
2R7RA 3ZC4A 1FFTC 4YT2A 1JPJA 2XXAB 2R7WA 3B9QA 4CS9A 4DVYP 1NU9C 4QDLA 4XLPF 4AE4B 3UMIA 2EIKC 5EGYA 1M2VA 3W8HA 2IOQA 3T4RA 2C04A 3EZIA 4J32B 4CS8A 3DJUB 5HSWA 2YEVA 1TWAA 3K66A 3NKEA 4U5FE 5B1BC 2PP4A 5DLJA 3FAJA 2R7QA 4HE8D 2Y39A 3NYLA 5CI9A 3QZCA 3X2QC 2R7OA 3B0UX 4YT8A 5FCLA 5KYXA 3ABKC 4J30B 3OEOA 5DQTA 2J45A 4JZAA 4BJ6A 2C03A 4P6IC 2G3KA 3RYLA 2NUPA 3EPVA 2H7BA 3ABLC 4WJ0A 5EHHA 3SYNA 2WZGA 3E9VA 3K6BA 4YN0B 3HLZA 2PF4E 4BJ5C 1J8MF 4PJMA 4U5HA 3JRTA 2VH3A 3PMRA 2QY9A 3CSKA 1IZMA 3LAYA 1TKNA 4G7OF 3WODF 1NU7D 2HV6A 2EIJC 4X0RA 2B0JA 1QZXA 4C3EA 4CS7A 2ZXPA 1D1AA 1ST6A 3I5PA 3EZHA 4ULWA 3EGXA 3CQZA 4KI2A 1LVKA 3K7DA 1Z63A 4DBRA 3SZRA 5E3CA 2KNHA 2PFDA 2WB7A 1OCCC 4YT5A 4IRUA 3Q7GA 3SP1A 1MMDA 1TWCA 1ZHZA 5DVWA 2ZXRA 2FGYA 2L9JA 3EGDA 2IYLD 4U5CE 2Y3BA 2XL4A 1VOMA 1FMWA 5KYNA 2Q9BA 5KYWB 2IXOA 2XRHA 3Q7LA 2WL8A 3KH2A 2R7TA 4OIOF 1BR1A 4RDAA 2LSEA 1ZHYA 1SF8A 2CDQA 1QLEC 3DXJF 3ZIBA 3EFOA 2YZSA 3FVYA 5KYYB 3N0TA 4YWQA 2OG2A 2J46A 4I3MA 1TWHA 2Y3DA 3E70C 2X51A 1N1CA 4H4KC 4DOZA 4CSAC 3SNHA 4LERA 3EG9B 3EHNA 2DYRC 3POVA 3FDQA 2IXMA 1Z6AA 4N06A 3DD7A 2V3CC 4RBNA 1LKXA 1VYKA 3FHDA 4HFFB 3LS0A 3K33A 4Q5SF 1SMYF 3W2WA 2CW0F 3AG3C 2KW3C 2OCCC 4JW1A 5B1AC 2CNWD 1VK5A 4G7HF 3LESA 5DS5A 4AE4A 3F47A 1G8XA 3L0IA 5DQZA 2W4MA 4OIRF 2J7PD 2ZPAA 4MQ9F 3LLIA 2CGEA 1V55C 4ZLDA 3DJNB 5DS6A 3ITFA 3DMDA 2WVQA 4LLCA 4DVZA 1V54C 3GODA 4CSAA 2NUTB 3LNRA 5F5FA 3ASNC 2Q9CA 1TR2A 4PK4A 3NYMA 4W8KA 4BG0A 2WVNA 4JJFA 4U5EE 3UMKA 3KL4A 4IWBA 2H7VC 1ZHWA 1LS1A 4I44A 1MMAA 4JURI 4O79A 3S0XA 1NG1A 3TD7A 3PHF2 4KBLA 2Y3HA 3UGOA 3RIPA 1S7ZA 1FMVA 2QTVA 2KQ9A 3I4UA 2DYSC 1ZHXA 1VMAA 1SZIA 2J9VA 1D0YA 3JCUQ 4JJGA 4PJLA 3O39A 1MMGA 2G3VA 3DM5A 2FFHA 2Y3GA 3EJNA 3JT1A 4ANJA 5E3AA 3O6XA 3N24A 4KNWA 2M4EA 3B0PA 1RJ9A 4C3BA 1JPNA 1M2OA 1MNEA 3K1HA 1OCOC 3QMKA 3RH3A 2ZXOA 1Z23A 3H65A 5D91A 2A68F 2IXPA 4OIPF 4IAOA 4BEJA 2YHSA 4RD9A 3JSZA 5D92A 4OINF 3EGXB 4BJ5A 3VYWA 1W2WA 2W9YA 4C7OB 3EH2A 5KYWA 3ZSUA 2DGJA 4OIQF 3DM9B 4U5DE 2G62A 4XLNF 3MX3A 3AG2C 3ZVRA 2Y69C 2GFHA 4O7GA 5E2QA 3KMIA 3S27A 3LS1A 2CNWA 3EGDB 5KYYA 3VAYA 1D0ZA 2VASA 2ZXWC 2EILC 1PD0A 4PFPA 4YJWA 2MWQA 3EG9A 3WG7C 2J7PA 3X1OA 3F46A 5IY5C 5L3VA 2A6HF 5T3WA 3DAGA 3UNGC 1BR2A 2NG1A 2PX3A 3EFOB 4PJNA 3Q6NA 2H7OA 3LLKA 4FESA 4GEHA 1BR4A 3K1IC 5KYUB 4U5BE 4E7ZA 4M63A 4O6YA 2XXAA 2WVOA 3M1CB 5BUOA 1J8YF 3GANA 4LACB 2A6EF 2L81A 4E7SA 2W45A 3HJCA 1O87A 2Z15A 1M56C 4AK9A 4ZLCA 1MMNA 2P6VA 2I8BA 1OKKD 4DBQA 4EWCA 2JD3A 2A1DD 4I1MA 4XTKA 3T6BA 2MYSA 2EINC 3CZ6A 3NG1A 2Q9AA 2NUTA 3IEEA 4XWJA 3ECSA 3T6JA 1M2VB 2V26A 3W2VA 2EIMC 4FX5A 3SEOA 2J0WA 2D5RB 3DAFA 4G0HA 2O9XA 3EH1A 3JYHA 3W8IA 1D0XA 4HFKB 2R7SA 4KNVA 4YT4A 4K0DA 4GYTA 4A2NB 3NRHA 4K7BA 1NZEA 2BE5F 2WZLA 3L34A 4G7ZF 2KJGA 5CI8A 3NYJA 5KYXB 1PD1A 4NY3A 4B6IA 5L3QA 3AQBA 3RFYA 4PFOA 4IJJA 4AX2A 3B0VC 2KGOA 1ZU5A 2NUPB 3I5QA 4U5GA 3HTKC 4O6NA 5T3TA 1VYIA 4BJTA 1FTSA 4I1OB 2J9UA 1M57C 3EQLF 3AG4C 2IXNA 2A69F 2HV7A 3MLGA 5B3SC 3V7OA 3S29A 3UGPA 1OCZC 3UR3C 3LEVA 1PCXA 2XSEA 4PJJA 4QI0A 4Q4ZF 4C3DA 1WGWA 2W4BA 1ZU4A 3DZAA 4C7OA 2E87A 4HEAJ 3AQCA 3EHMA 1RJ9B 4QI2A 1D1CA 4JCHA 3RKOF 4LLEA 3OA1A 3ASOC 1MNDA 1ZHTA 3LJBA 4FWVA 2Q3TA 1OCRC 3AG1C 5T1DB 4CBEA 4CS9C 1O5HA 4Q7CA 4OD4A 3NDBB 5E33A 1Z5ZA 2J0XA 2R7VA 3Q6MA 1OKKA 3OWTA 4OD5A 4EBBA 3UMHA 4MNDA 4CS8C 1IW7F 3ZG1A 4CIHA 4O6MA 2PX0A 4BJ1A 5DS4A 1KU2A 5KYUA 2P7VA 2VB6A 1D1BA 3KKBA 1FFHA 4JVSA 1TWGA 1ZYRF 3ABMC 2R7UA 5F5HA 3NKDA 4BJ6C 4F4BA 4KC9A 2J9WA 2R7XA 3S28A 1Z3IX 2WZFA 3N2ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3G A;  2Y39 A;  2Y3B A;  2Y3H A;  3ZG1 A;  3OEO A;  3EPV A;  2Y3D A;  3QZC A;  3O39 A;  3ITF A;  3LAY A; 
#chains in the Genus database with same CATH topology
 4D4N A;  1Y6D A;  2R7R A;  3ZC4 A;  1NFO A;  1FFT C;  4YT2 A;  1JPJ A;  5A6A A;  1RKE A;  2XLW A;  2QE9 A;  3VM6 A;  1E84 A;  1S05 A;  2R7W A;  2XXA B;  1WOL A;  3B9Q A;  3U3B A;  4CS9 A;  2ETS A;  4DVY P;  2XLO A;  1NU9 C;  4NC3 A;  4QDL A;  4XLP F;  4AE4 B;  3UMI A;  2EIK C;  5EGY A;  3RQE A;  1I4Y A;  2YRF A;  2YLD A;  3G4Z A;  1M2V A;  3ZQV A;  4WGY A;  1H7I A;  3JYY A;  2IOQ A;  3T4R A;  3W8H A;  4CDA A;  2C04 A;  5L0C A;  3QVY A;  3EZI A;  4J32 B;  1A7V A;  4CS8 A;  1CGO A;  3DJU B;  3O10 A;  2UUH A;  2YEV A;  5HSW A;  1TWA A;  2ICW G;  2VCA A;  3K66 A;  3NKE A;  4U5F E;  5B1B C;  2PP4 A;  3TK0 A;  5DLJ A;  3AGT A;  3FAJ A;  2HSQ A;  1HW2 A;  1V4A A;  4EBK A;  2R7Q A;  4DXW A;  1U6H A;  2HZ8 A;  2Y39 A;  4HE8 D;  3NYL A;  3GWN A;  5CI9 A;  3QZC A;  1Q0F A;  3X2Q C;  2R7O A;  2L6G A;  2OJE D;  4YT8 A;  2YKZ A;  5FCL A;  3B0U X;  5KYX A;  2AP3 A;  2HMZ A;  3ABK C;  4J30 B;  1GS9 A;  3OEO A;  1A41 A;  3U5S A;  5DQT A;  2J45 A;  4JZA A;  1CGN A;  1HY5 A;  4BEM J;  4BJ6 A;  1G4W R;  1YLM A;  2C03 A;  4NTA A;  2LQG A;  2G3K A;  4P6I C;  3RYL A;  3U8P A;  3U3F A;  2NUP A;  2Q4F A;  3EPV A;  4JE9 A;  2YVK A;  2H7B A;  3ABL C;  3U8V A;  4WJ0 A;  3C63 A;  3FOP A;  5EHH A;  3SYN A;  4D4X A;  2WZG A;  3E9V A;  3K6B A;  4YN0 B;  3QVZ A;  5L0G A;  3R7C A;  3HLZ A;  2R02 A;  2PF4 E;  1LE2 A;  1GGQ A;  3KYJ A;  4BJ5 C;  1J8M F;  3A9C A;  2R03 A;  4PJM A;  1XWJ A;  4ANJ A;  3LUT B;  2AVK A;  4EKW A;  4U5H A;  1VTM P;  3JRT A;  2XLV A;  2HMQ A;  2VH3 A;  2XM0 A;  3PMR A;  2QY9 A;  3CSK A;  1IZM A;  4N4W A;  3LAY A;  5B3I A;  1BZ4 A;  2F22 A;  1TKN A;  4U9D A;  3WOD F;  4G7O F;  2R05 A;  5AC4 A;  1RMV A;  1NU7 D;  2HV6 A;  1BBH A;  3T9O A;  3V5Z A;  2EIJ C;  4N6C A;  4CJG A;  3FXH A;  5A69 A;  4JEB A;  4X0R A;  3RVZ A;  2B0J A;  2OU6 A;  1QZX A;  1OQC A;  2XL8 A;  2XLM A;  4C3E A;  2ZXP A;  4CS7 A;  1D1A A;  1ST6 A;  3I5P A;  1T01 A;  1OR3 A;  3EZH A;  4ULW A;  3EGX A;  3CQZ A;  4KI2 A;  1LVK A;  3K7D A;  2XM4 A;  1Z63 A;  3JSE O;  3IQ5 A;  4DBR A;  4JTD B;  3SZR A;  5E3C A;  1WN0 A;  2VC9 A;  2KNH A;  2PFD A;  2WB7 A;  1YJG A;  3ZQY A;  2MHR A;  1OCC C;  4YT5 A;  1QPU A;  4IRU A;  3Q7G A;  3ZTM A;  1B68 A;  1O3U A;  3SP1 A;  3S84 A;  3R2P A;  1Y4C A;  3SXK A;  2RSE B;  5GPG B;  1MMD A;  1TWC A;  1CPR A;  1KTM A;  1ZHZ A;  5DVW A;  2ZXR A;  2VCB A;  5A6B A;  3L1M A;  5JT4 A;  2FGY A;  2L9J A;  3EGD A;  2IYL D;  3RF3 A;  4U5C E;  2EPN A;  2Y3B A;  2XL4 A;  3ZDL A;  3JTL O;  1E2X A;  1R4T A;  1VOM A;  1YYX A;  1FMW A;  1LS4 A;  5KYN A;  4NTB A;  2Q9B A;  3GM2 A;  4LDQ A;  5KYW B;  2LFD A;  2YLG A;  2IXO A;  2XRH A;  1JAF A;  3Q7L A;  2WL8 A;  3KH2 A;  5JUA A;  1Q0G A;  2R7T A;  3M4B A;  1YYJ A;  1TFK B;  2LK4 A;  1TQG A;  1BR1 A;  4G78 A;  4RDA A;  4OIO F;  5JRA A;  2LSE A;  1ZHY A;  1QKR A;  1NBB A;  1SF8 A;  2BC5 A;  1QLE C;  2CDQ A;  3FOO A;  3DXJ F;  3ZIB A;  3EFO A;  1VLS A;  4CJO A;  4MW3 A;  1OXB A;  2YZS A;  3FVY A;  3N0T A;  4YWQ A;  2GDC A;  2OG2 A;  2J46 A;  3ATP A;  5KYY B;  4I3M A;  1TWH A;  2LD6 A;  2Y3D A;  3E70 C;  3PCV A;  1HE9 A;  2X51 A;  4MVS A;  2HFI A;  1N1C A;  4H4K C;  4DOZ A;  1NSG B;  4CSA C;  3SNH A;  4J7T A;  3L8I A;  1JRA A;  3DE8 A;  3EG9 B;  4LER A;  3ZTZ A;  3EHN A;  2DYR C;  2DB4 A;  4Z9H A;  3POV A;  1U0B B;  1H6G A;  1BDJ B;  2PNO A;  3FDQ A;  2YL3 A;  4NTF A;  1K40 A;  2IXM A;  3CAX A;  3IHU A;  1Z6A A;  4N06 A;  4BPM A;  3DD7 A;  3JZ0 A;  2V3C C;  4XPY A;  2KSF A;  3CEX A;  4RBN A;  1LKX A;  1VYK A;  3GEH A;  1Z7Q c;  2L6F A;  3FHD A;  4HFF B;  3LS0 A;  3K33 A;  4Q5S F;  2HKV A;  1SMY F;  2OQM A;  3W2W A;  2CW0 F;  1NLX A;  3AG3 C;  4MVQ A;  3GWL A;  2KW3 C;  2P61 A;  2OCC C;  2XLH A;  4JW1 A;  5B1A C;  2CNW D;  1VK5 A;  4G7H F;  3LES A;  5DS5 A;  4Z9I A;  4AE4 A;  3F47 A;  1G8X A;  3NMI A;  1JOG A;  3C8G B;  2GA0 A;  3L0I A;  5DQZ A;  3U0C A;  1LM3 B;  2W4M A;  4OIR F;  2QLA A;  4MVR A;  3GM3 A;  2J7P D;  2ZPA A;  4MQ9 F;  1T6I A;  2CGE A;  2EPM X;  3LLI A;  3V5Y A;  1V55 C;  4DRI B;  2J8W A;  4E0H A;  4ZLD A;  3DJN B;  2OOC A;  5DS6 A;  3ITF A;  1ZZP A;  3DMD A;  2WVQ A;  3L8J A;  1RKE B;  3H2V A;  3LEO A;  3DKA A;  3G50 A;  4LLC A;  4DVZ A;  1V54 C;  1HW1 A;  1YZC A;  3GOD A;  5HV9 A;  4CSA A;  2NUT B;  2M64 A;  2CCY A;  3LNR A;  5F5F A;  1LE4 A;  2LFF A;  4P9F A;  1M6T A;  3ASN C;  4JCZ A;  2Q9C A;  3GEI A;  1TR2 A;  4JTA B;  5K0I A;  4PK4 A;  4JEA A;  3U2M A;  2TMV P;  2ASR A;  3NYM A;  4FAP B;  1UFB A;  4MVU A;  3GM1 A;  3HNK A;  4W8K A;  3SXM A;  4BG0 A;  4EIY A;  2WVN A;  2LCH A;  1QVX A;  2P0N A;  4JJF A;  5L0D A;  5L0H A;  1ORJ A;  4JTC B;  1LI7 A;  4U5E E;  5BQG A;  1A0B A;  2JX0 A;  2YQY A;  3IQ6 A;  3KL4 A;  1OW6 A;  4IWB A;  3UMK A;  5COG A;  2B0H A;  4PR9 A;  2H7V C;  2QNL A;  1ZHW A;  1LS1 A;  2ZD9 A;  1OW8 A;  1G5Z A;  4I44 A;  1MMA A;  4JUR I;  4O79 A;  3S0X A;  1NG1 A;  3TD7 A;  3MYI A;  4DRH B;  3C8Z A;  5FZT A;  3PHF 2;  4KBL A;  2KYH A;  3C7J A;  1E83 A;  2Y3H A;  4JRZ A;  3UGO A;  4IGG A;  2RD9 A;  1S7Z A;  2OKU A;  3RIP A;  1OXK A;  3DWW A;  2FAP B;  3WAQ A;  1FMV A;  2QTV A;  4MS2 A;  2KQ9 A;  1QQ3 A;  3I4U A;  3PDM P;  4ONS A;  1YA9 A;  2DYS C;  1ZHX A;  3U9M A;  3M79 A;  4CX9 A;  1VMA A;  1WTY A;  1SZI A;  2J9V A;  1D0Y A;  2OJQ A;  3BRJ A;  3JCU Q;  3O39 A;  1DOV A;  4JJG A;  4PJL A;  1MMG A;  2G3V A;  3DM5 A;  1Q0K A;  2FFH A;  2Y3G A;  3EJN A;  4E18 A;  4EUK B;  3JT1 A;  1A7E A;  2YWA A;  3HNI A;  5E3A A;  3O6X A;  1UG7 A;  3N24 A;  3US6 A;  4KNW A;  5JP7 A;  1AUE A;  1TFO B;  2M4E A;  4R32 A;  3QW0 A;  3B0P A;  1RJ9 A;  2JPU A;  5JVE A;  1T5O A;  2DI3 A;  4C3B A;  1JPN A;  1M2O A;  1MNE A;  3K1H A;  1A7D A;  1K05 A;  1OCO C;  2OEV A;  3QMK A;  3RH3 A;  2ZXO A;  3FMS A;  3JRM O;  1Z23 A;  3H65 A;  5D91 A;  2A68 F;  2IXP A;  4MW8 A;  3S9O A;  3HKK A;  4CDV A;  4XQ1 A;  4OIP F;  4IAO A;  2GAQ A;  1EKY A;  2BL2 A;  4BEJ A;  2YHS A;  4RD9 A;  3JSZ A;  5D92 A;  4OIN F;  3EGX B;  3SXY A;  4BJ5 A;  5AGF A;  1W2W A;  2R25 A;  2W9Y A;  1G4U S;  3VYW A;  4C7O B;  1K04 A;  3EH2 A;  5KYW A;  3ZSU A;  3G4X A;  1VLT A;  2DGJ A;  4XPX A;  3TOM A;  4OIQ F;  1I4Z A;  3DM9 B;  2AU5 A;  4LDR A;  4U5D E;  2G62 A;  4XLN F;  3MX3 A;  3AG2 C;  3ZVR A;  4LDK A;  5COM A;  1QSP A;  2Y69 C;  2GFH A;  4O7G A;  5E2Q A;  4YL1 A;  3KMI A;  3S27 A;  2A0B A;  1AEP A;  3LS1 A;  2CNW A;  3EGD B;  1EI7 A;  5KYY A;  3VAY A;  1C17 M;  1T6Q A;  1MQV A;  1DOW A;  1D0Z A;  2HSB A;  2VAS A;  3MBG A;  2Q7R A;  2XLD A;  2I15 A;  2EIL C;  2ZXW C;  4IAQ A;  2J9B A;  1PD0 A;  4YL0 A;  1SR2 A;  4PFP A;  3AJM A;  3TJ6 A;  1ORS C;  4YJW A;  3AOU A;  5COF A;  4A4A A;  1XZP A;  4EBJ A;  2MWQ A;  3EG9 A;  4MVZ A;  1C02 A;  3WG7 C;  1EQ1 A;  2J7P A;  1KNY A;  1L7C A;  3X1O A;  1WWP A;  4JKV A;  1WAT A;  3F46 A;  5IY5 C;  4N6H A;  5L3V A;  2A6H F;  1E86 A;  4WAB A;  5T3W A;  3DAG A;  3UNG C;  1BR2 A;  2NG1 A;  4MVM A;  2H8A A;  2PX3 A;  3DE9 A;  3DI5 A;  3EFO B;  3W4Y A;  4PJN A;  3O55 A;  3T6G B;  3Q6N A;  2H7O A;  3LLK A;  4FES A;  3MYF A;  1BR4 A;  3K1I C;  4GEH A;  5KYU B;  4U5B E;  4NQF A;  4E7Z A;  4M63 A;  4O6Y A;  2XXA A;  1LPE A;  2WVO A;  2XS8 A;  3M1C B;  5BUO A;  1J8Y F;  3GAN A;  1ZW2 A;  3M15 A;  4LAC B;  2L6H A;  4EHP A;  2A6E F;  2X0C A;  3V5X A;  1FR0 A;  3C62 A;  2EPK X;  2L81 A;  4MTG A;  2NSF A;  2W45 A;  1SYQ A;  4E7S A;  3HJC A;  1O87 A;  2Z15 A;  1ZVZ A;  1M56 C;  3VRC A;  3IPM O;  4AK9 A;  4ZLC A;  1MMN A;  3QW1 A;  1LI5 A;  1U89 A;  2P6V A;  4GQH A;  4XPW A;  4YL3 A;  3S90 A;  2I8B A;  3TJ5 A;  1OKK D;  5TJ5 E;  3RVY A;  3LNM B;  3TOL A;  4DBQ A;  4EWC A;  3NMK A;  2JD3 A;  2A1D D;  4I1M A;  4XTK A;  3T6B A;  5A6J A;  2GWW A;  2MYS A;  2EIN C;  3CZ6 A;  3KYI A;  3NG1 A;  1VB5 A;  2Q9A A;  4AL1 A;  1LIH A;  5L0J A;  3IQC A;  1RKC A;  1C03 A;  2NUT A;  2VCC A;  4MVO A;  3IEE A;  4XWJ A;  3ECS A;  3T6J A;  2EPO A;  1M2V B;  2KK1 A;  4J7Y A;  1NFN A;  2V26 A;  3W2V A;  1RCP A;  2EIM C;  3J06 A;  4FX5 A;  3SEO A;  3RQF A;  5A6K A;  2D4U A;  2J0W A;  2D5R B;  3DAF A;  4G0H A;  4PAC A;  3C8G D;  2YL1 A;  3BEH A;  3C18 A;  1H9T A;  2O9X A;  3EH1 A;  3JYH A;  5AC5 A;  3W8I A;  1D0X A;  1APC A;  3HNL A;  4HFK B;  2R7S A;  1YAU O;  4KNV A;  4YT4 A;  4XEK A;  4K0D A;  2LP4 A;  4GYT A;  4P9T A;  3NRH A;  3K1I A;  4A2N B;  2OEX A;  4K7B A;  4W8P A;  1NZE A;  2BE5 F;  2WZL A;  3L34 A;  1FNT c;  4G7Z F;  1H9G A;  4IB4 A;  2KJG A;  5CI8 A;  3NYJ A;  4DJ9 A;  5KYX B;  1PD1 A;  5JS5 A;  2L7A A;  4NY3 A;  3U2L A;  1Q0D A;  1HMO A;  4L6R A;  4B6I A;  4ER9 A;  5L3Q A;  3AQB A;  1GM5 A;  3RFY A;  4PFO A;  4IJJ A;  4AX2 A;  2KC3 A;  3B0V C;  1AVO B;  1ZU5 A;  2KGO A;  2CYD A;  2NUP B;  3I5Q A;  5JLI A;  4CDY A;  4U5G A;  3HTK C;  2QUP A;  4O6N A;  1JR8 A;  5T3T A;  2PBE A;  1R5I D;  3B71 A;  1ZW3 A;  1F1M A;  1VYI A;  4BJT A;  1EA8 A;  1FTS A;  4I1O B;  1T6U A;  2HS5 A;  2J9U A;  4UDV A;  1M57 C;  3EQL F;  3AG4 C;  2IXN A;  2A69 F;  1T9K A;  2Q00 A;  2R9R B;  3H2U A;  1YDI A;  2HV7 A;  3MLG A;  5B3S C;  3V7O A;  1OW7 A;  3S29 A;  3UGP A;  1FAP B;  1OCZ C;  1V74 B;  4H54 A;  4JIO A;  5L0F A;  3AGU A;  4MTO A;  3UR3 C;  3LEV A;  2AWY A;  1PCX A;  2NSG A;  2XSE A;  4PJJ A;  3SXZ A;  4QI0 A;  1OR2 A;  2UUI A;  4Q4Z F;  2HJM A;  4YK5 A;  4C3D A;  2NPU A;  1WGW A;  3A11 A;  2W4B A;  4CIP A;  1ZU4 A;  3DZA A;  4C7O A;  2E87 A;  4HEA J;  4XEF A;  1YAR O;  3AQC A;  2IM8 A;  3EHM A;  3IQT A;  4K1O A;  4ULV A;  1RJ9 B;  4QI2 A;  1D1C A;  4JCH A;  3RKO F;  4U9E A;  3QTH A;  4LLE A;  1JMW A;  5BQI A;  3OA1 A;  3ASO C;  1MND A;  3FAP B;  5CIV A;  1ZHT A;  3U9J A;  3LJB A;  4FWV A;  2Q3T A;  1OCR C;  3AG1 C;  5T1D B;  4CBE A;  3MFN A;  4AL0 A;  4E0I A;  4CS9 C;  2AWC A;  3M4C A;  1O5H A;  1E85 A;  256B A;  1XZQ A;  3TQO A;  3TUL A;  1CPQ A;  3KPH A;  4OD4 A;  4Q7C A;  5BQH A;  4IAR A;  3NDB B;  5E33 A;  1Z5Z A;  4E17 A;  2J0X A;  1PV3 A;  2R7V A;  2IBF A;  2YL0 A;  3Q6M A;  5JSL A;  3WHN A;  1OKK A;  2XL6 A;  3OWT A;  1ORY A;  3ZWI A;  2A0U A;  2HJ3 A;  4OD5 A;  4EBB A;  3UMH A;  2XS1 A;  3B29 A;  4MND A;  4CS8 C;  1IW7 F;  2YL7 A;  4WGZ A;  3ZG1 A;  4CIH A;  4O6M A;  2PX0 A;  4XEV A;  1I5N A;  4BJ1 A;  5DS4 A;  3RW0 A;  2LIG A;  1KU2 A;  3VF0 A;  5KYU A;  1L3P A;  1RXQ A;  1YVI A;  2P1A A;  2P7V A;  2VB6 A;  2HUJ A;  5A6B D;  4MTF A;  1D1B A;  3KKB A;  1Q0M A;  1YA7 O;  3NMJ A;  3GOR A;  1FFH A;  4JVS A;  1TWG A;  3C8G A;  1ZYR F;  3ABM C;  4DRJ B;  1CGM E;  2R7U A;  3HNJ A;  5F5H A;  3GEE A;  1HE1 A;  3NKD A;  5EK0 A;  3RQG A;  4BJ6 C;  2YLI A;  4JC7 A;  4NCQ A;  4KC9 A;  1HMD A;  4F4B A;  5L0I A;  2J9W A;  2R7X A;  4Z9J A;  3S28 A;  1WAS A;  1GQA A;  1YZA A;  2XLE A;  5F28 E;  1Z3I X;  2EPL X;  2WZF A;  3N2Z B; 
#chains in the Genus database with same CATH homology
 2R7R A;  3ZC4 A;  1FFT C;  4YT2 A;  1JPJ A;  2XXA B;  2R7W A;  3B9Q A;  4CS9 A;  4DVY P;  1NU9 C;  4QDL A;  4XLP F;  4AE4 B;  3UMI A;  2EIK C;  5EGY A;  1M2V A;  3W8H A;  2IOQ A;  3T4R A;  2C04 A;  3EZI A;  4J32 B;  4CS8 A;  3DJU B;  5HSW A;  2YEV A;  1TWA A;  3K66 A;  3NKE A;  4U5F E;  5B1B C;  2PP4 A;  5DLJ A;  3FAJ A;  2R7Q A;  4HE8 D;  2Y39 A;  3NYL A;  5CI9 A;  3QZC A;  3X2Q C;  2R7O A;  3B0U X;  4YT8 A;  5FCL A;  5KYX A;  3ABK C;  4J30 B;  3OEO A;  5DQT A;  2J45 A;  4JZA A;  4BJ6 A;  2C03 A;  4P6I C;  2G3K A;  3RYL A;  2NUP A;  3EPV A;  2H7B A;  3ABL C;  4WJ0 A;  5EHH A;  3SYN A;  2WZG A;  3E9V A;  3K6B A;  4YN0 B;  3HLZ A;  2PF4 E;  4BJ5 C;  1J8M F;  4PJM A;  4U5H A;  3JRT A;  2VH3 A;  3PMR A;  2QY9 A;  3CSK A;  1IZM A;  3LAY A;  1TKN A;  4G7O F;  3WOD F;  1NU7 D;  2HV6 A;  2EIJ C;  4X0R A;  2B0J A;  1QZX A;  4C3E A;  4CS7 A;  2ZXP A;  1D1A A;  1ST6 A;  3I5P A;  3EZH A;  4ULW A;  3EGX A;  3CQZ A;  4KI2 A;  1LVK A;  3K7D A;  1Z63 A;  4DBR A;  3SZR A;  5E3C A;  2KNH A;  2PFD A;  2WB7 A;  1OCC C;  4YT5 A;  4IRU A;  3Q7G A;  3SP1 A;  1MMD A;  1TWC A;  1ZHZ A;  5DVW A;  2ZXR A;  2FGY A;  2L9J A;  3EGD A;  2IYL D;  4U5C E;  2Y3B A;  2XL4 A;  1VOM A;  1FMW A;  5KYN A;  2Q9B A;  5KYW B;  2IXO A;  2XRH A;  3Q7L A;  2WL8 A;  3KH2 A;  2R7T A;  4OIO F;  1BR1 A;  4RDA A;  2LSE A;  1ZHY A;  1SF8 A;  2CDQ A;  1QLE C;  3DXJ F;  3ZIB A;  3EFO A;  2YZS A;  3FVY A;  5KYY B;  3N0T A;  4YWQ A;  2OG2 A;  2J46 A;  4I3M A;  1TWH A;  2Y3D A;  3E70 C;  2X51 A;  1N1C A;  4H4K C;  4DOZ A;  4CSA C;  3SNH A;  4LER A;  3EG9 B;  3EHN A;  2DYR C;  3POV A;  3FDQ A;  2IXM A;  1Z6A A;  4N06 A;  3DD7 A;  2V3C C;  4RBN A;  1LKX A;  1VYK A;  3FHD A;  4HFF B;  3LS0 A;  3K33 A;  4Q5S F;  1SMY F;  3W2W A;  2CW0 F;  3AG3 C;  2KW3 C;  2OCC C;  4JW1 A;  5B1A C;  2CNW D;  1VK5 A;  4G7H F;  3LES A;  5DS5 A;  4AE4 A;  3F47 A;  1G8X A;  3L0I A;  5DQZ A;  2W4M A;  4OIR F;  2J7P D;  2ZPA A;  4MQ9 F;  3LLI A;  2CGE A;  1V55 C;  4ZLD A;  3DJN B;  5DS6 A;  3ITF A;  3DMD A;  2WVQ A;  4LLC A;  4DVZ A;  1V54 C;  3GOD A;  4CSA A;  2NUT B;  3LNR A;  5F5F A;  3ASN C;  2Q9C A;  1TR2 A;  4PK4 A;  3NYM A;  4W8K A;  4BG0 A;  2WVN A;  4JJF A;  4U5E E;  3UMK A;  3KL4 A;  4IWB A;  2H7V C;  1ZHW A;  1LS1 A;  4I44 A;  1MMA A;  4JUR I;  4O79 A;  3S0X A;  1NG1 A;  3TD7 A;  3PHF 2;  4KBL A;  2Y3H A;  3UGO A;  3RIP A;  1S7Z A;  1FMV A;  2QTV A;  2KQ9 A;  3I4U A;  2DYS C;  1ZHX A;  1VMA A;  1SZI A;  2J9V A;  1D0Y A;  3JCU Q;  4JJG A;  4PJL A;  3O39 A;  1MMG A;  2G3V A;  3DM5 A;  2FFH A;  2Y3G A;  3EJN A;  3JT1 A;  4ANJ A;  5E3A A;  3O6X A;  3N24 A;  4KNW A;  2M4E A;  3B0P A;  1RJ9 A;  4C3B A;  1JPN A;  1M2O A;  1MNE A;  3K1H A;  1OCO C;  3QMK A;  3RH3 A;  2ZXO A;  1Z23 A;  3H65 A;  5D91 A;  2A68 F;  2IXP A;  4OIP F;  4IAO A;  4BEJ A;  2YHS A;  4RD9 A;  3JSZ A;  5D92 A;  4OIN F;  3EGX B;  4BJ5 A;  3VYW A;  1W2W A;  2W9Y A;  4C7O B;  3EH2 A;  5KYW A;  3ZSU A;  2DGJ A;  4OIQ F;  3DM9 B;  4U5D E;  2G62 A;  4XLN F;  3MX3 A;  3AG2 C;  3ZVR A;  2Y69 C;  2GFH A;  4O7G A;  5E2Q A;  3KMI A;  3S27 A;  3LS1 A;  2CNW A;  3EGD B;  5KYY A;  3VAY A;  1D0Z A;  2VAS A;  2ZXW C;  2EIL C;  1PD0 A;  4PFP A;  4YJW A;  2MWQ A;  3EG9 A;  3WG7 C;  2J7P A;  3X1O A;  3F46 A;  5IY5 C;  5L3V A;  2A6H F;  5T3W A;  3DAG A;  3UNG C;  1BR2 A;  2NG1 A;  2PX3 A;  3EFO B;  4PJN A;  3Q6N A;  2H7O A;  3LLK A;  4FES A;  4GEH A;  1BR4 A;  3K1I C;  5KYU B;  4U5B E;  4E7Z A;  4M63 A;  4O6Y A;  2XXA A;  2WVO A;  3M1C B;  5BUO A;  1J8Y F;  3GAN A;  4LAC B;  2A6E F;  2L81 A;  4E7S A;  2W45 A;  3HJC A;  1O87 A;  2Z15 A;  1M56 C;  4AK9 A;  4ZLC A;  1MMN A;  2P6V A;  2I8B A;  1OKK D;  4DBQ A;  4EWC A;  2JD3 A;  2A1D D;  4I1M A;  4XTK A;  3T6B A;  2MYS A;  2EIN C;  3CZ6 A;  3NG1 A;  2Q9A A;  2NUT A;  3IEE A;  4XWJ A;  3ECS A;  3T6J A;  1M2V B;  2V26 A;  3W2V A;  2EIM C;  4FX5 A;  3SEO A;  2J0W A;  2D5R B;  3DAF A;  4G0H A;  2O9X A;  3EH1 A;  3JYH A;  3W8I A;  1D0X A;  4HFK B;  2R7S A;  4KNV A;  4YT4 A;  4K0D A;  4GYT A;  4A2N B;  3NRH A;  4K7B A;  1NZE A;  2BE5 F;  2WZL A;  3L34 A;  4G7Z F;  2KJG A;  5CI8 A;  3NYJ A;  5KYX B;  1PD1 A;  4NY3 A;  4B6I A;  5L3Q A;  3AQB A;  3RFY A;  4PFO A;  4IJJ A;  4AX2 A;  3B0V C;  2KGO A;  1ZU5 A;  2NUP B;  3I5Q A;  4U5G A;  3HTK C;  4O6N A;  5T3T A;  1VYI A;  4BJT A;  1FTS A;  4I1O B;  2J9U A;  1M57 C;  3EQL F;  3AG4 C;  2IXN A;  2A69 F;  2HV7 A;  3MLG A;  5B3S C;  3V7O A;  3S29 A;  3UGP A;  1OCZ C;  3UR3 C;  3LEV A;  1PCX A;  2XSE A;  4PJJ A;  4QI0 A;  4Q4Z F;  4C3D A;  1WGW A;  2W4B A;  1ZU4 A;  3DZA A;  4C7O A;  2E87 A;  4HEA J;  3AQC A;  3EHM A;  1RJ9 B;  4QI2 A;  1D1C A;  4JCH A;  3RKO F;  4LLE A;  3OA1 A;  3ASO C;  1MND A;  1ZHT A;  3LJB A;  4FWV A;  2Q3T A;  1OCR C;  3AG1 C;  5T1D B;  4CBE A;  4CS9 C;  1O5H A;  4Q7C A;  4OD4 A;  3NDB B;  5E33 A;  1Z5Z A;  2J0X A;  2R7V A;  3Q6M A;  1OKK A;  3OWT A;  4OD5 A;  4EBB A;  3UMH A;  4MND A;  4CS8 C;  1IW7 F;  3ZG1 A;  4CIH A;  4O6M A;  2PX0 A;  4BJ1 A;  5DS4 A;  1KU2 A;  5KYU A;  2P7V A;  2VB6 A;  1D1B A;  3KKB A;  1FFH A;  4JVS A;  1TWG A;  1ZYR F;  3ABM C;  2R7U A;  5F5H A;  3NKD A;  4BJ6 C;  4F4B A;  4KC9 A;  2J9W A;  2R7X A;  3S28 A;  1Z3I X;  2WZF A;  3N2Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...