3LAYA

Alpha-helical barrel formed by the decamer of the zinc resistance-associated protein (stm4172) from salmonella enterica subsp. enterica serovar typhimurium str. lt2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
79
structure length
79
Chain Sequence
LTTEQQATAQKIYDDYYTQTSALRQQLISKRYEYNALLTASSPDTAKINAVAKEMESLGQKLDEQRVKRDVAMAQAGIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc resistance-associated protein
publication title Alpha-Helical barrel formed by the decamer of the zinc resistance-associated protein (STM4172) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Metal binding protein
total genus 33
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13801 Metal_resist Heavy-metal resistance
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3layA00
3LAYA 2Y3DA 3ITFA 3OEOA 2Y3HA 2Y3GA 2Y3BA 3ZG1A 3EPVA 3QZCA 3O39A 2Y39A
chains in the Genus database with same CATH superfamily
2KGOA 2XLHA 4LDKA 2HSQA 3UMKA 3Q7GA 3VRCA 2L9JA 2VCBA 2A68F 2J9VA 3IHUA 1L7CA 3K66A 2V3CC 4M63A 3B0VC 3MLGA 1R5ID 4CJGA 3NKDA 3K6BA 1C17M 2J9UA 3ZDLA 1D0XA 1O87A 2AVKA 3ASOC 2A0BA 3QW0A 3FVYA 1NG1A 2WVOA 5B1AC 5D92A 4BEMJ 4Q4ZF 3O39A 3US6A 3MX3A 4OD5A 2HV7A 5T1DB 3ZWIA 5KYWA 2EINC 2F22A 2XL8A 2XM0A 1AEPA 3C18A 4L6RA 4I3MA 4E18A 3SXKA 5EGYA 3ZVRA 1T6QA 2R7QA 4N06A 1KTMA 2Y3GA 2HFIA 2R9RB 1U6HA 3HNLA 4MVMA 1I5NA 3E9VA 1NU7D 2A1DD 4YK5A 1A41A 4MVRA 5COMA 3MYFA 4DRHB 3QMKA 1ZHZA 2XLEA 3PCVA 5CI9A 2VASA 5DVWA 3F47A 1GM5A 1SMYF 3NMIA 1LE4A 4XEKA 4JJFA 4YJWA 4XTKA 1A0BA 4Q7CA 2FGYA 4LDRA 4I1OB 2E87A 4X0RA 5BQGA 1E86A 2J0XA 3VF0A 2OQMA 3FDQA 2J8WA 3DD7A 4KNVA 3TULA 4PFOA 2HS5A 2R7OA 2YLDA 5DLJA 4OIOF 2PF4E 3AGTA 2IXNA 1QSPA 2ZXRA 2OKUA 1LM3B 1LI7A 5COGA 3S9OA 4DOZA 4J30B 1SF8A 4W8PA 4MVUA 1E83A 3S27A 2YVKA 2G3VA 1VOMA 2ICWG 3DE9A 2A0UA 2Y39A 3DXJF 4GQHA 1TR2A 2JD3A 3SNHA 2XRHA 3SXMA 3SYNA 3FOPA 3N0TA 3SXYA 3TJ5A 4F4BA 2Y3HA 2Q9CA 3HNIA 3O6XA 1G8XA 3TJ6A 1AUEA 3E70C 3L8IA 2NSFA 3AG3C 3JRMO 4MS2A 3ZQVA 2DI3A 2QY9A 3W2WA 4NCQA 3VM6A 1H9GA 256BA 1RKEB 3GORA 2J0WA 4O6YA 4C7OB 3AGUA 5E3AA 2TMVP 1T6IA 3UNGC 5GPGB 1NFOA 2R03A 3CEXA 5JSLA 3S29A 2A69F 4CDVA 3TOMA 4MTGA 5EHHA 5KYWB 3ZQYA 3DMDA 2GWWA 1ZU4A 2KC3A 2YKZA 4I44A 4RDAA 5DS6A 1TWAA 3NYJA 2Q7RA 1NZEA 2CCYA 2LFFA 4JVSA 4G7ZF 2Y3DA 4AL0A 3ABMC 3V5XA 1A7VA 1TQGA 1FTSA 1RCPA 1EI7A 2C03A 3LLIA 1D1AA 4JJGA 3L34A 5CI8A 3U8PA 1OKKD 3F46A 1O3UA 3WODF 3NKEA 3M1CB 4P9FA 4CIHA 1MNDA 4U5CE 3RKOF 1EQ1A 3N2ZB 4R32A 5DQTA 2YLGA 1ZVZA 2XM4A 4CBEA 4QDLA 3HNKA 4BJTA 4JTAB 5A6BD 1QQ3A 4JCZA 5CIVA 3MYIA 5KYUB 1M56C 1G4US 2IXOA 5E33A 4P9TA 5BUOA 5KYXB 1J8YF 4H54A 4JTDB 2L7AA 3LNMB 3LS1A 4BJ5C 3C62A 1XWJA 1TWCA 1ZW2A 3GODA 2AP3A 2C04A 1T5OA 4C3DA 1ZHWA 3QVZA 1JMWA 1QZXA 4MW8A 5L3QA 2ZPAA 2OCCC 4CS9C 5T3WA 2QLAA 2ZXWC 3LJBA 4W8KA 2YL1A 4JCHA 2XXAA 2CW0F 1JRAA 4MQ9F 2G62A 4JC7A 1TFKB 1ORSC 3SZRA 1NU9C 3U3BA 2PFDA 4UDVA 2FAPB 2PX3A 3C7JA 3I5PA 4U5DE 2Y69C 4DBQA 1F1MA 1RJ9A 1VYKA 2LFDA 3U9JA 2LCHA 4AL1A 4OINF 1VLSA 4U5BE 2HSBA 4KC9A 2XLVA 4YL3A 1D0YA 2Q3TA 1ORJA 2BC5A 1EKYA 1Z7Qc 4ER9A 1B68A 3RYLA 2OG2A 1LI5A 3GM2A 5JP7A 3LAYA 2Q9BA 2X51A 4O6MA 1LPEA 4N4WA 4Z9JA 1OXBA 2CDQA 2LSEA 4ONSA 2W4BA 1JPNA 3U3FA 3W4YA 2YL3A 1VK5A 5L0CA 1C02A 3AG2C 3M79A 2J7PA 3TOLA 1T6UA 1VTMP 2JPUA 3V7OA 1C03A 1PD1A 3KKBA 5KYYA 1T01A 1ZHXA 3WHNA 5L0FA 1K40A 4JW1A 4U9DA 4JE9A 1OR2A 4QI2A 1BBHA 1YARO 1M2VA 3U2MA 4E0IA 5B3SC 1YLMA 1JR8A 2H7VC 2DB4A 3T6BA 4N6CA 5K0IA 4OIQF 3DJUB 3WG7C 1OXKA 1PV3A 1ZU5A 3JYHA 3QTHA 5F28E 1FMWA 3K1HA 2R7SA 2OJED 5FZTA 3GANA 3S0XA 1BR2A 3JSZA 2DYRC 1MMGA 3L8JA 2YL0A 1G4WR 1XZQA 1V55C 3OWTA 1HMDA 5JS5A 5HSWA 1KNYA 3EH2A 1OW8A 2Y3BA 1E84A 2KW3C 2XXAB 3JRTA 1AVOB 1FAPB 1Q0KA 1MNEA 4U9EA 2W9YA 2W45A 3TK0A 3C8GA 1LKXA 4GEHA 4FESA 2WL8A 4P6IC 4XPWA 3JZ0A 3AOUA 3DWWA 3O10A 4WABA 5AGFA 4XQ1A 3GEIA 3OEOA 2ZXOA 2FFHA 2I15A 3ATPA 2OU6A 1YA7O 5L0DA 4DRIB 1D1CA 3WAQA 1H6GA 1V54C 3DM5A 3EG9A 4IWBA 5JT4A 1SYQA 4G78A 3T6GB 1QKRA 5A69A 3CQZA 3RW0A 2DYSC 4IJJA 1WASA 4PK4A 1H9TA 3EHNA 4DVZA 4PACA 2HKVA 1CGME 1CGNA 2P7VA 3UMHA 1ZZPA 3UGOA 1R4TA 1HE9A 4Z9HA 2XLMA 2GDCA 5DQZA 2P0NA 2MWQA 3V5ZA 1QPUA 2EPLX 1ST6A 4JZAA 2GA0A 1YZCA 4U5HA 1WWPA 1MQVA 3G50A 4YN0B 5TJ5E 2Q9AA 3VYWA 4MVQA 1M2VB 1EA8A 2CNWD 2PNOA 3H2VA 2G3KA 4BJ5A 4ZLCA 5BQHA 4G7HF 3JSEO 3AG1C 3LS0A 4G7OF 3ZG1A 3RFYA 4NTBA 2R02A 4J7TA 2ZXPA 2UUIA 3C63A 4IAQA 3ABLC 3EH1A 1YYJA 1GQAA 2EPNA 2YHSA 2EIJC 3NYMA 1D1BA 3R7CA 1E2XA 4CS9A 1H7IA 1OQCA 3EGXA 5L3VA 1RKCA 5JUAA 2EILC 3RH3A 3S84A 4EBJA 4MTOA 4XWJA 1FNTc 1MMNA 3M4BA 3NMJA 2OEVA 4LACB 1ZHYA 2YL7A 4B6IA 4BJ1A 3SEOA 4E17A 4U5GA 3UR3C 3NMKA 1U89A 2IXPA 3RIPA 5L0GA 4CDAA 2UUHA 4N6HA 5F5HA 2R25A 1BR1A 4OIPF 2PX0A 2I8BA 1OCZC 1HE1A 3A11A 2EPMX 4YT8A 2WZFA 1HW2A 2YZSA 3CZ6A 1V4AA 3PMRA 3ASNC 2YRFA 1BZ4A 2J9WA 1RXQA 3NDBB 1IW7F 3EG9B 1WTYA 1GGQA 2P6VA 1YVIA 1DOVA 3EGDA 3L0IA 1TWGA 2M64A 3V5YA 2R7UA 4CX9A 5E3CA 2HZ8A 3R2PA 3Q6NA 4PJLA 4JTCB 4NQFA 2XLOA 2NUPA 3JTLO 4JURI 4E7SA 2D4UA 2PBEA 1YZAA 3AG4C 3LEOA 4ZLDA 3KYIA 3ZC4A 3KL4A 4CS8A 2LIGA 3SP1A 2IOQA 4WJ0A 4QI0A 1M2OA 2NSGA 3RVZA 2HUJA 3B0PA 3GWNA 4ULVA 3K7DA 1Q0FA 3LLKA 2M4EA 1WATA 4IB4A 1OW7A 3MBGA 4ANJA 3K1IA 2CGEA 2YWAA 1FMVA 2KNHA 3FAJA 3U5SA 3UGPA 4DRJB 2R7VA 4E0HA 2H7OA 1OCRC 1E85A 3DI5A 3ZIBA 4XPYA 1NBBA 2V26A 2AWCA 4C3BA 1A7EA 3FAPB 2J46A 2L6FA 4EKWA 4LDQA 2R7TA 1KU2A 2AU5A 1Z5ZA 5EK0A 2QTVA 4K0DA 2CYDA 5E2QA 2QUPA 1Q0MA 1UFBA 3A9CA 1ZYRF 4CJOA 4MVOA 3J06A 1FFTC 3IPMO 3QW1A 1VB5A 3SXZA 2HJMA 5BQIA 2L6GA 3CSKA 1Z6AA 4WGZA 4EIYA 1G5ZA 4G0HA 1TWHA 5B1BC 3JCUQ 5B3IA 2NUTA 2KJGA 2ZD9A 2VCAA 1APCA 2QNLA 4AE4A 3JYYA 4CS8C 1OCCC 1S05A 3BEHA 2Z15A 1FR0A 3Q7LA 3QVYA 1GS9A 5D91A 1VMAA 3EGDB 1BDJB 1VYIA 4D4NA 1TFOB 2EIMC 1FFHA 1I4ZA 2EPOA 2L6HA 2VH3A 3B71A 3NG1A 4YWQA 3L1MA 5JLIA 3RF3A 2NUPB 4O6NA 3ZSUA 2BE5F 1ZHTA 3K1IC 4CSAA 2A6HF 2VCCA 3T6JA 1OKKA 5AC5A 4Q5SF 3FHDA 1N1CA 1XZPA 2LK4A 1SR2A 3EFOA 3EHMA 1CPRA 3B9QA 1RJ9B 5A6BA 2HJ3A 1RKEA 3JT1A 2P61A 2WZGA 4U5EE 4BJ6A 4C7OA 4YT4A 3NRHA 2XLWA 4EBBA 3PDMP 3LUTB 3AQCA 3EZIA 2OJQA 1YJGA 2NG1A 4HE8D 2WZLA 4MW3A 4IRUA 3KH2A 2OEXA 3HKKA 4D4XA 2ASRA 1HY5A 1LS4A 3TQOA 4I1MA 1WGWA 2MYSA 1V74B 2Q4FA 3G4XA 3H2UA 3HTKC 4EHPA 3DJNB 3RQFA 5AC4A 5IY5C 2R7RA 4NTAA 2IYLD 4EBKA 1NLXA 2KQ9A 5DS4A 3T4RA 4HFKB 2B0HA 1SZIA 2H7BA 5L0HA 4CS7A 3RVYA 1YYXA 1ORYA 3GEHA 1PD0A 5KYYB 2AWYA 2XL6A 4PJNA 2ETSA 2W4MA 4DXWA 2P1AA 4AK9A 2NPUA 5KYUA 4DBRA 4FWVA 1LIHA 3H65A 1K05A 2XLDA 4CSAC 5FCLA 1NSGB 2MHRA 3M15A 5KYXA 4ULWA 4KI2A 4AX2A 2GAQA 2LP4A 2NUTB 3HNJA 4AE4B 2RSEB 4O79A 3RQEA 4BJ6C 2LD6A 1WOLA 3EZHA 1LE2A 3IQCA 2A6EF 4LLCA 3W8HA 1I4YA 1LS1A 2KSFA 3ABKC 2XS1A 4NY3A 2XS8A 3U2LA 5T3TA 4XLNF 2J7PD 3IEEA 2R7XA 3IQ5A 4A2NB 1PCXA 1DOWA 4IARA 4J32B 2J9BA 4LERA 3U0CA 3LEVA 2B0JA 3N24A 2YLIA 1VLTA 1Z3IX 2DGJA 1YAUO 3I4UA 2VC9A 2LQGA 2VB6A 2XL4A 3X2QC 3IQ6A 4JIOA 4XEFA 2XSEA 3B29A 2YQYA 2HV6A 3ZTMA 3EFOB 2Q00A 3FXHA 1YDIA 4HEAJ 1W2WA 4PJMA 5JRAA 1Z63A 1CPQA 1OW6A 1YA9A 1HW1A 2YEVA 3C8GB 3GWLA 1A7DA 2WVNA 4A4AA 1JAFA 4LLEA 3MFNA 1MMDA 2OOCA 1M57C 3O55A 1ZW3A 2R05A 3LNRA 3DZAA 4WGYA 2R7WA 3RQGA 4MNDA 1HMOA 2KK1A 3X1OA 4RBNA 2O9XA 2H8AA 3C8ZA 3K33A 3KYJA 3DAGA 1S7ZA 4IGGA 4RD9A 4BEJA 5F5FA 1LVKA 4JKVA 4DJ9A 4KNWA 2D5RB 4CIPA 3GM1A 4CDYA 3DM9B 2IM8A 4IAOA 3EJNA 5L0JA 3GEEA 4JRZA 4YT2A 1CGOA 4H4KC 3T9OA 1L3PA 3FMSA 5A6KA 3EPVA 4NTFA 1M6TA 3C8GD 5KYNA 3U8VA 4O7GA 2WB7A 3IQTA 4C3EA 3AJMA 1MMAA 2JX0A 3KPHA 5DS5A 1TKNA 4KBLA 3CAXA 1D0ZA 3ITFA 3EQLF 4E7ZA 1RMVA 2IBFA 2BL2A 4Z9IA 5A6JA 5JVEA 3VAYA 4YT5A 1O5HA 4DVYP 2WVQA 3BRJA 5COFA 1Q0GA 3FOOA 4JEAA 3EGXB 3I5QA 2PP4A 4U5FE 2X0CA 4K7BA 5A6AA 3UMIA 4FAPB 4HFFB 4OIRF 4PJJA 1JOGA 1WN0A 4YL1A 1Q0DA 3GM3A 5HV9A 4FX5A 1NFNA 4XLPF 4EUKB 1QVXA 1QLEC 1T9KA 2L81A 3OA1A 4MVSA 3U9MA 3AQBA 2QE9A 4MTFA 1OCOC 2HMZA 2RD9A 3POVA 3KMIA 4YL0A 1IZMA 4PR9A 2EIKC 1K04A 4NC3A 3HLZA 3TD7A 1Z23A 4BG0A 3PHF2 1J8MF 1Y6DA 4J7YA 4XPXA 2GFHA 3B0UX 3M4CA 4PFPA 2CNWA 3W2VA 3DE8A 3W8IA 4JEBA 3S28A 3G4ZA 1OR3A 1BR4A 4BPMA 3Q6MA 3S90A 2KYHA 4OD4A 2HMQA 1JPJA 2EPKX 1UG7A 4MVZA 1Y4CA 4XEVA 3ZTZA 4K1OA 3QZCA 3DAFA 1U0BB 2J45A 3HJCA 4EWCA 3ECSA 2IXMA 5L0IA 3DKAA 4GYTA 3LESA 3NYLA
chains in the Genus database with same CATH topology
2KGOA 3UMKA 3Q7GA 2L9JA 2A68F 2J9VA 3K66A 2V3CC 4M63A 3B0VC 3MLGA 3NKDA 3K6BA 2J9UA 1D0XA 1O87A 3ASOC 3FVYA 1NG1A 2WVOA 5B1AC 5D92A 4Q4ZF 3O39A 3MX3A 4OD5A 2HV7A 5T1DB 5KYWA 2EINC 4I3MA 5EGYA 3ZVRA 2R7QA 4N06A 2Y3GA 3E9VA 1NU7D 2A1DD 3QMKA 1ZHZA 5DVWA 5CI9A 2VASA 3F47A 1SMYF 4JJFA 4YJWA 4XTKA 4Q7CA 2FGYA 4I1OB 2E87A 2J0XA 3FDQA 3DD7A 4KNVA 4PFOA 2R7OA 5DLJA 4OIOF 2PF4E 2IXNA 2ZXRA 4DOZA 4J30B 1SF8A 3S27A 2G3VA 1VOMA 4X0RA 3DXJF 2Y39A 3SNHA 3SYNA 1TR2A 2JD3A 2XRHA 5IY5C 3N0TA 4F4BA 2Y3HA 2Q9CA 3O6XA 1G8XA 3E70C 3AG3C 2QY9A 3W2WA 4O6YA 2J0WA 4C7OB 5E3AA 3UNGC 3S29A 2A69F 5EHHA 5KYWB 3DMDA 1ZU4A 4RDAA 4I44A 5DS6A 1TWAA 3NYJA 1NZEA 4JVSA 4G7ZF 2Y3DA 3ABMC 3LLIA 2C03A 1FTSA 4JJGA 5CI8A 1D1AA 3L34A 3WODF 1OKKD 3F46A 3NKEA 3M1CB 4CIHA 1MNDA 4U5CE 3RKOF 3N2ZB 5DQTA 4CBEA 4QDLA 4BJTA 5KYUB 1M56C 2IXOA 5E33A 5BUOA 5KYXB 1J8YF 3LS1A 4BJ5C 1TWCA 3GODA 2C04A 4C3DA 1ZHWA 1QZXA 5L3QA 2ZPAA 2OCCC 4CS9C 5T3WA 2ZXWC 3LJBA 4W8KA 4JCHA 2XXAA 2CW0F 4MQ9F 2G62A 3SZRA 1NU9C 2PFDA 2PX3A 3I5PA 4U5DE 2Y69C 4DBQA 1VYKA 1RJ9A 4OINF 4U5BE 4KC9A 1D0YA 2Q3TA 3RYLA 2OG2A 3LAYA 2Q9BA 2X51A 4O6MA 2CDQA 2LSEA 2W4BA 1JPNA 1VK5A 3AG2C 2J7PA 3V7OA 1PD1A 3KKBA 5KYYA 1ZHXA 4JW1A 4QI2A 5B3SC 1M2VA 2H7VC 3T6BA 4OIQF 3DJUB 3WG7C 1ZU5A 3JYHA 1FMWA 3K1HA 2R7SA 3S0XA 3GANA 1BR2A 3JSZA 2DYRC 1MMGA 3OWTA 5HSWA 1V55C 3EH2A 2Y3BA 2KW3C 2XXAB 3JRTA 1MNEA 2W9YA 2W45A 1LKXA 4GEHA 4FESA 2WL8A 4P6IC 3OEOA 2ZXOA 2FFHA 1D1CA 1V54C 3DM5A 3EG9A 4IWBA 3CQZA 2DYSC 4IJJA 4PK4A 3EHNA 4DVZA 2P7VA 3UMHA 3UGOA 5DQZA 2MWQA 4JZAA 1ST6A 4U5HA 3VYWA 4YN0B 2Q9AA 1M2VB 2CNWD 4BJ5A 4G7HF 2G3KA 4ZLCA 3AG1C 3LS0A 4G7OF 3ZG1A 3RFYA 2ZXPA 3ABLC 3EH1A 2YHSA 3NYMA 2EIJC 4CS9A 1D1BA 3EGXA 5L3VA 2EILC 3RH3A 4XWJA 1MMNA 4LACB 1ZHYA 4B6IA 4BJ1A 3SEOA 4U5GA 3UR3C 2IXPA 3RIPA 5F5HA 1BR1A 4OIPF 2PX0A 2I8BA 1OCZC 4YT8A 2WZFA 2YZSA 3CZ6A 3PMRA 3ASNC 2J9WA 3NDBB 1IW7F 3EG9B 2P6VA 3EGDA 3L0IA 1TWGA 2R7UA 5E3CA 3Q6NA 4PJLA 2NUPA 4JURI 3AG4C 4ZLDA 3ZC4A 3KL4A 4CS8A 3SP1A 2IOQA 4WJ0A 4QI0A 1M2OA 3B0PA 3K7DA 3LLKA 2M4EA 4ANJA 2CGEA 1FMVA 2KNHA 3FAJA 2R7VA 3UGPA 2H7OA 1OCRC 3ZIBA 2V26A 4C3BA 2J46A 1KU2A 1Z5ZA 2QTVA 4K0DA 5E2QA 1ZYRF 1FFTC 3CSKA 1Z6AA 4G0HA 1TWHA 5B1BC 3JCUQ 2NUTA 2KJGA 4AE4A 4CS8C 1OCCC 2Z15A 3Q7LA 5D91A 1VMAA 3EGDB 1VYIA 2EIMC 1FFHA 4YWQA 2VH3A 3NG1A 3ZSUA 2NUPB 4O6NA 2BE5F 1ZHTA 3K1IC 4CSAA 2A6HF 3T6JA 1OKKA 4Q5SF 3FHDA 1N1CA 3EFOA 3EHMA 3B9QA 1RJ9B 3JT1A 4BJ6A 2WZGA 4U5EE 4C7OA 4YT4A 3NRHA 4EBBA 3AQCA 3EZIA 2NG1A 4HE8D 2WZLA 4IRUA 3KH2A 4I1MA 1WGWA 2MYSA 3HTKC 2R7TA 2R7RA 3DJNB 2IYLD 2KQ9A 5DS4A 3T4RA 4HFKB 1SZIA 2H7BA 4CS7A 1PD0A 5KYYB 4PJNA 2W4MA 4AK9A 5KYUA 4DBRA 4FWVA 3H65A 4CSAC 5FCLA 5KYXA 4ULWA 4KI2A 4AX2A 2NUTB 4AE4B 4O79A 4BJ6C 3EZHA 4LLCA 3W8HA 2A6EF 1LS1A 3ABKC 4NY3A 5T3TA 4XLNF 2J7PD 3IEEA 2R7XA 4A2NB 1PCXA 4J32B 4LERA 3LEVA 2B0JA 3N24A 1Z3IX 2DGJA 3I4UA 2VB6A 2XL4A 3X2QC 2XSEA 2HV6A 3EFOB 4PJMA 4HEAJ 1W2WA 1Z63A 2YEVA 2WVNA 4LLEA 1MMDA 1M57C 3LNRA 3DZAA 2R7WA 4MNDA 3X1OA 4RBNA 2O9XA 4E7SA 3K33A 4BEJA 4RD9A 3DAGA 1S7ZA 5F5FA 1LVKA 4KNWA 2D5RB 3DM9B 4IAOA 3EJNA 4YT2A 4H4KC 3EPVA 5KYNA 4O7GA 2WB7A 4C3EA 1MMAA 5DS5A 1TKNA 4KBLA 1D0ZA 3ITFA 3EQLF 4E7ZA 3VAYA 4YT5A 1O5HA 4DVYP 2WVQA 3EGXB 3I5QA 2PP4A 4U5FE 4K7BA 3UMIA 4HFFB 4OIRF 4PJJA 4FX5A 4XLPF 1QLEC 2L81A 3OA1A 3AQBA 1OCOC 3POVA 3KMIA 1IZMA 3PHF2 2EIKC 3TD7A 4BG0A 3HLZA 1Z23A 1J8MF 2GFHA 3B0UX 3W8IA 4PFPA 2CNWA 3W2VA 3S28A 1BR4A 3Q6MA 4OD4A 1JPJA 3QZCA 3DAFA 2J45A 3HJCA 4EWCA 3ECSA 2IXMA 4GYTA 3LESA 3NYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAY A;  2Y3D A;  3ITF A;  3OEO A;  2Y3H A;  2Y3G A;  2Y3B A;  3ZG1 A;  3EPV A;  3QZC A;  3O39 A;  2Y39 A; 
#chains in the Genus database with same CATH topology
 2KGO A;  2XLH A;  4LDK A;  2HSQ A;  3UMK A;  3Q7G A;  3VRC A;  2L9J A;  2VCB A;  2A68 F;  2J9V A;  3IHU A;  1L7C A;  3K66 A;  2V3C C;  4M63 A;  3B0V C;  3MLG A;  1R5I D;  4CJG A;  3NKD A;  3K6B A;  1C17 M;  2J9U A;  3ZDL A;  1D0X A;  1O87 A;  2AVK A;  3ASO C;  2A0B A;  3QW0 A;  3FVY A;  1NG1 A;  2WVO A;  5B1A C;  5D92 A;  4BEM J;  4Q4Z F;  3O39 A;  3US6 A;  3MX3 A;  4OD5 A;  2HV7 A;  5T1D B;  3ZWI A;  5KYW A;  2EIN C;  2F22 A;  2XL8 A;  2XM0 A;  1AEP A;  3C18 A;  4L6R A;  4I3M A;  4E18 A;  3SXK A;  5EGY A;  3ZVR A;  1T6Q A;  2R7Q A;  4N06 A;  1KTM A;  2Y3G A;  2HFI A;  2R9R B;  1U6H A;  3HNL A;  4MVM A;  1I5N A;  3E9V A;  1NU7 D;  2A1D D;  4YK5 A;  1A41 A;  4MVR A;  5COM A;  3MYF A;  4DRH B;  3QMK A;  1ZHZ A;  2XLE A;  3PCV A;  5CI9 A;  2VAS A;  5DVW A;  3F47 A;  1GM5 A;  1SMY F;  3NMI A;  1LE4 A;  4XEK A;  4JJF A;  4YJW A;  4XTK A;  1A0B A;  4Q7C A;  2FGY A;  4LDR A;  4I1O B;  2E87 A;  4X0R A;  5BQG A;  1E86 A;  2J0X A;  3VF0 A;  2OQM A;  3FDQ A;  2J8W A;  3DD7 A;  4KNV A;  3TUL A;  4PFO A;  2HS5 A;  2R7O A;  2YLD A;  5DLJ A;  4OIO F;  2PF4 E;  3AGT A;  2IXN A;  1QSP A;  2ZXR A;  2OKU A;  1LM3 B;  1LI7 A;  5COG A;  3S9O A;  4DOZ A;  4J30 B;  1SF8 A;  4W8P A;  4MVU A;  1E83 A;  3S27 A;  2YVK A;  2G3V A;  1VOM A;  2ICW G;  3DE9 A;  2A0U A;  2Y39 A;  3DXJ F;  4GQH A;  1TR2 A;  2JD3 A;  3SNH A;  2XRH A;  3SXM A;  3SYN A;  3FOP A;  3N0T A;  3SXY A;  3TJ5 A;  4F4B A;  2Y3H A;  2Q9C A;  3HNI A;  3O6X A;  1G8X A;  3TJ6 A;  1AUE A;  3E70 C;  3L8I A;  2NSF A;  3AG3 C;  3JRM O;  4MS2 A;  3ZQV A;  2DI3 A;  2QY9 A;  3W2W A;  4NCQ A;  3VM6 A;  1H9G A;  256B A;  1RKE B;  3GOR A;  2J0W A;  4O6Y A;  4C7O B;  3AGU A;  5E3A A;  2TMV P;  1T6I A;  3UNG C;  5GPG B;  1NFO A;  2R03 A;  3CEX A;  5JSL A;  3S29 A;  2A69 F;  4CDV A;  3TOM A;  4MTG A;  5EHH A;  5KYW B;  3ZQY A;  3DMD A;  2GWW A;  1ZU4 A;  2KC3 A;  2YKZ A;  4I44 A;  4RDA A;  5DS6 A;  1TWA A;  3NYJ A;  2Q7R A;  1NZE A;  2CCY A;  2LFF A;  4JVS A;  4G7Z F;  2Y3D A;  4AL0 A;  3ABM C;  3V5X A;  1A7V A;  1TQG A;  1FTS A;  1RCP A;  1EI7 A;  2C03 A;  3LLI A;  1D1A A;  4JJG A;  3L34 A;  5CI8 A;  3U8P A;  1OKK D;  3F46 A;  1O3U A;  3WOD F;  3NKE A;  3M1C B;  4P9F A;  4CIH A;  1MND A;  4U5C E;  3RKO F;  1EQ1 A;  3N2Z B;  4R32 A;  5DQT A;  2YLG A;  1ZVZ A;  2XM4 A;  4CBE A;  4QDL A;  3HNK A;  4BJT A;  4JTA B;  5A6B D;  1QQ3 A;  4JCZ A;  5CIV A;  3MYI A;  5KYU B;  1M56 C;  1G4U S;  2IXO A;  5E33 A;  4P9T A;  5BUO A;  5KYX B;  1J8Y F;  4H54 A;  4JTD B;  2L7A A;  3LNM B;  3LS1 A;  4BJ5 C;  3C62 A;  1XWJ A;  1TWC A;  1ZW2 A;  3GOD A;  2AP3 A;  2C04 A;  1T5O A;  4C3D A;  1ZHW A;  3QVZ A;  1JMW A;  1QZX A;  4MW8 A;  5L3Q A;  2ZPA A;  2OCC C;  4CS9 C;  5T3W A;  2QLA A;  2ZXW C;  3LJB A;  4W8K A;  2YL1 A;  4JCH A;  2XXA A;  2CW0 F;  1JRA A;  4MQ9 F;  2G62 A;  4JC7 A;  1TFK B;  1ORS C;  3SZR A;  1NU9 C;  3U3B A;  2PFD A;  4UDV A;  2FAP B;  2PX3 A;  3C7J A;  3I5P A;  4U5D E;  2Y69 C;  4DBQ A;  1F1M A;  1RJ9 A;  1VYK A;  2LFD A;  3U9J A;  2LCH A;  4AL1 A;  4OIN F;  1VLS A;  4U5B E;  2HSB A;  4KC9 A;  2XLV A;  4YL3 A;  1D0Y A;  2Q3T A;  1ORJ A;  2BC5 A;  1EKY A;  1Z7Q c;  4ER9 A;  1B68 A;  3RYL A;  2OG2 A;  1LI5 A;  3GM2 A;  5JP7 A;  3LAY A;  2Q9B A;  2X51 A;  4O6M A;  1LPE A;  4N4W A;  4Z9J A;  1OXB A;  2CDQ A;  2LSE A;  4ONS A;  2W4B A;  1JPN A;  3U3F A;  3W4Y A;  2YL3 A;  1VK5 A;  5L0C A;  1C02 A;  3AG2 C;  3M79 A;  2J7P A;  3TOL A;  1T6U A;  1VTM P;  2JPU A;  3V7O A;  1C03 A;  1PD1 A;  3KKB A;  5KYY A;  1T01 A;  1ZHX A;  3WHN A;  5L0F A;  1K40 A;  4JW1 A;  4U9D A;  4JE9 A;  1OR2 A;  4QI2 A;  1BBH A;  1YAR O;  1M2V A;  3U2M A;  4E0I A;  5B3S C;  1YLM A;  1JR8 A;  2H7V C;  2DB4 A;  3T6B A;  4N6C A;  5K0I A;  4OIQ F;  3DJU B;  3WG7 C;  1OXK A;  1PV3 A;  1ZU5 A;  3JYH A;  3QTH A;  5F28 E;  1FMW A;  3K1H A;  2R7S A;  2OJE D;  5FZT A;  3GAN A;  3S0X A;  1BR2 A;  3JSZ A;  2DYR C;  1MMG A;  3L8J A;  2YL0 A;  1G4W R;  1XZQ A;  1V55 C;  3OWT A;  1HMD A;  5JS5 A;  5HSW A;  1KNY A;  3EH2 A;  1OW8 A;  2Y3B A;  1E84 A;  2KW3 C;  2XXA B;  3JRT A;  1AVO B;  1FAP B;  1Q0K A;  1MNE A;  4U9E A;  2W9Y A;  2W45 A;  3TK0 A;  3C8G A;  1LKX A;  4GEH A;  4FES A;  2WL8 A;  4P6I C;  4XPW A;  3JZ0 A;  3AOU A;  3DWW A;  3O10 A;  4WAB A;  5AGF A;  4XQ1 A;  3GEI A;  3OEO A;  2ZXO A;  2FFH A;  2I15 A;  3ATP A;  2OU6 A;  1YA7 O;  5L0D A;  4DRI B;  1D1C A;  3WAQ A;  1H6G A;  1V54 C;  3DM5 A;  3EG9 A;  4IWB A;  5JT4 A;  1SYQ A;  4G78 A;  3T6G B;  1QKR A;  5A69 A;  3CQZ A;  3RW0 A;  2DYS C;  4IJJ A;  1WAS A;  4PK4 A;  1H9T A;  3EHN A;  4DVZ A;  4PAC A;  2HKV A;  1CGM E;  1CGN A;  2P7V A;  3UMH A;  1ZZP A;  3UGO A;  1R4T A;  1HE9 A;  4Z9H A;  2XLM A;  2GDC A;  5DQZ A;  2P0N A;  2MWQ A;  3V5Z A;  1QPU A;  2EPL X;  1ST6 A;  4JZA A;  2GA0 A;  1YZC A;  4U5H A;  1WWP A;  1MQV A;  3G50 A;  4YN0 B;  5TJ5 E;  2Q9A A;  3VYW A;  4MVQ A;  1M2V B;  1EA8 A;  2CNW D;  2PNO A;  3H2V A;  2G3K A;  4BJ5 A;  4ZLC A;  5BQH A;  4G7H F;  3JSE O;  3AG1 C;  3LS0 A;  4G7O F;  3ZG1 A;  3RFY A;  4NTB A;  2R02 A;  4J7T A;  2ZXP A;  2UUI A;  3C63 A;  4IAQ A;  3ABL C;  3EH1 A;  1YYJ A;  1GQA A;  2EPN A;  2YHS A;  2EIJ C;  3NYM A;  1D1B A;  3R7C A;  1E2X A;  4CS9 A;  1H7I A;  1OQC A;  3EGX A;  5L3V A;  1RKC A;  5JUA A;  2EIL C;  3RH3 A;  3S84 A;  4EBJ A;  4MTO A;  4XWJ A;  1FNT c;  1MMN A;  3M4B A;  3NMJ A;  2OEV A;  4LAC B;  1ZHY A;  2YL7 A;  4B6I A;  4BJ1 A;  3SEO A;  4E17 A;  4U5G A;  3UR3 C;  3NMK A;  1U89 A;  2IXP A;  3RIP A;  5L0G A;  4CDA A;  2UUH A;  4N6H A;  5F5H A;  2R25 A;  1BR1 A;  4OIP F;  2PX0 A;  2I8B A;  1OCZ C;  1HE1 A;  3A11 A;  2EPM X;  4YT8 A;  2WZF A;  1HW2 A;  2YZS A;  3CZ6 A;  1V4A A;  3PMR A;  3ASN C;  2YRF A;  1BZ4 A;  2J9W A;  1RXQ A;  3NDB B;  1IW7 F;  3EG9 B;  1WTY A;  1GGQ A;  2P6V A;  1YVI A;  1DOV A;  3EGD A;  3L0I A;  1TWG A;  2M64 A;  3V5Y A;  2R7U A;  4CX9 A;  5E3C A;  2HZ8 A;  3R2P A;  3Q6N A;  4PJL A;  4JTC B;  4NQF A;  2XLO A;  2NUP A;  3JTL O;  4JUR I;  4E7S A;  2D4U A;  2PBE A;  1YZA A;  3AG4 C;  3LEO A;  4ZLD A;  3KYI A;  3ZC4 A;  3KL4 A;  4CS8 A;  2LIG A;  3SP1 A;  2IOQ A;  4WJ0 A;  4QI0 A;  1M2O A;  2NSG A;  3RVZ A;  2HUJ A;  3B0P A;  3GWN A;  4ULV A;  3K7D A;  1Q0F A;  3LLK A;  2M4E A;  1WAT A;  4IB4 A;  1OW7 A;  3MBG A;  4ANJ A;  3K1I A;  2CGE A;  2YWA A;  1FMV A;  2KNH A;  3FAJ A;  3U5S A;  3UGP A;  4DRJ B;  2R7V A;  4E0H A;  2H7O A;  1OCR C;  1E85 A;  3DI5 A;  3ZIB A;  4XPY A;  1NBB A;  2V26 A;  2AWC A;  4C3B A;  1A7E A;  3FAP B;  2J46 A;  2L6F A;  4EKW A;  4LDQ A;  2R7T A;  1KU2 A;  2AU5 A;  1Z5Z A;  5EK0 A;  2QTV A;  4K0D A;  2CYD A;  5E2Q A;  2QUP A;  1Q0M A;  1UFB A;  3A9C A;  1ZYR F;  4CJO A;  4MVO A;  3J06 A;  1FFT C;  3IPM O;  3QW1 A;  1VB5 A;  3SXZ A;  2HJM A;  5BQI A;  2L6G A;  3CSK A;  1Z6A A;  4WGZ A;  4EIY A;  1G5Z A;  4G0H A;  1TWH A;  5B1B C;  3JCU Q;  5B3I A;  2NUT A;  2KJG A;  2ZD9 A;  2VCA A;  1APC A;  2QNL A;  4AE4 A;  3JYY A;  4CS8 C;  1OCC C;  1S05 A;  3BEH A;  2Z15 A;  1FR0 A;  3Q7L A;  3QVY A;  1GS9 A;  5D91 A;  1VMA A;  3EGD B;  1BDJ B;  1VYI A;  4D4N A;  1TFO B;  2EIM C;  1FFH A;  1I4Z A;  2EPO A;  2L6H A;  2VH3 A;  3B71 A;  3NG1 A;  4YWQ A;  3L1M A;  5JLI A;  3RF3 A;  2NUP B;  4O6N A;  3ZSU A;  2BE5 F;  1ZHT A;  3K1I C;  4CSA A;  2A6H F;  2VCC A;  3T6J A;  1OKK A;  5AC5 A;  4Q5S F;  3FHD A;  1N1C A;  1XZP A;  2LK4 A;  1SR2 A;  3EFO A;  3EHM A;  1CPR A;  3B9Q A;  1RJ9 B;  5A6B A;  2HJ3 A;  1RKE A;  3JT1 A;  2P61 A;  2WZG A;  4U5E E;  4BJ6 A;  4C7O A;  4YT4 A;  3NRH A;  2XLW A;  4EBB A;  3PDM P;  3LUT B;  3AQC A;  3EZI A;  2OJQ A;  1YJG A;  2NG1 A;  4HE8 D;  2WZL A;  4MW3 A;  4IRU A;  3KH2 A;  2OEX A;  3HKK A;  4D4X A;  2ASR A;  1HY5 A;  1LS4 A;  3TQO A;  4I1M A;  1WGW A;  2MYS A;  1V74 B;  2Q4F A;  3G4X A;  3H2U A;  3HTK C;  4EHP A;  3DJN B;  3RQF A;  5AC4 A;  5IY5 C;  2R7R A;  4NTA A;  2IYL D;  4EBK A;  1NLX A;  2KQ9 A;  5DS4 A;  3T4R A;  4HFK B;  2B0H A;  1SZI A;  2H7B A;  5L0H A;  4CS7 A;  3RVY A;  1YYX A;  1ORY A;  3GEH A;  1PD0 A;  5KYY B;  2AWY A;  2XL6 A;  4PJN A;  2ETS A;  2W4M A;  4DXW A;  2P1A A;  4AK9 A;  2NPU A;  5KYU A;  4DBR A;  4FWV A;  1LIH A;  3H65 A;  1K05 A;  2XLD A;  4CSA C;  5FCL A;  1NSG B;  2MHR A;  3M15 A;  5KYX A;  4ULW A;  4KI2 A;  4AX2 A;  2GAQ A;  2LP4 A;  2NUT B;  3HNJ A;  4AE4 B;  2RSE B;  4O79 A;  3RQE A;  4BJ6 C;  2LD6 A;  1WOL A;  3EZH A;  1LE2 A;  3IQC A;  2A6E F;  4LLC A;  3W8H A;  1I4Y A;  1LS1 A;  2KSF A;  3ABK C;  2XS1 A;  4NY3 A;  2XS8 A;  3U2L A;  5T3T A;  4XLN F;  2J7P D;  3IEE A;  2R7X A;  3IQ5 A;  4A2N B;  1PCX A;  1DOW A;  4IAR A;  4J32 B;  2J9B A;  4LER A;  3U0C A;  3LEV A;  2B0J A;  3N24 A;  2YLI A;  1VLT A;  1Z3I X;  2DGJ A;  1YAU O;  3I4U A;  2VC9 A;  2LQG A;  2VB6 A;  2XL4 A;  3X2Q C;  3IQ6 A;  4JIO A;  4XEF A;  2XSE A;  3B29 A;  2YQY A;  2HV6 A;  3ZTM A;  3EFO B;  2Q00 A;  3FXH A;  1YDI A;  4HEA J;  1W2W A;  4PJM A;  5JRA A;  1Z63 A;  1CPQ A;  1OW6 A;  1YA9 A;  1HW1 A;  2YEV A;  3C8G B;  3GWL A;  1A7D A;  2WVN A;  4A4A A;  1JAF A;  4LLE A;  3MFN A;  1MMD A;  2OOC A;  1M57 C;  3O55 A;  1ZW3 A;  2R05 A;  3LNR A;  3DZA A;  4WGY A;  2R7W A;  3RQG A;  4MND A;  1HMO A;  2KK1 A;  3X1O A;  4RBN A;  2O9X A;  2H8A A;  3C8Z A;  3K33 A;  3KYJ A;  3DAG A;  1S7Z A;  4IGG A;  4RD9 A;  4BEJ A;  5F5F A;  1LVK A;  4JKV A;  4DJ9 A;  4KNW A;  2D5R B;  4CIP A;  3GM1 A;  4CDY A;  3DM9 B;  2IM8 A;  4IAO A;  3EJN A;  5L0J A;  3GEE A;  4JRZ A;  4YT2 A;  1CGO A;  4H4K C;  3T9O A;  1L3P A;  3FMS A;  5A6K A;  3EPV A;  4NTF A;  1M6T A;  3C8G D;  5KYN A;  3U8V A;  4O7G A;  2WB7 A;  3IQT A;  4C3E A;  3AJM A;  1MMA A;  2JX0 A;  3KPH A;  5DS5 A;  1TKN A;  4KBL A;  3CAX A;  1D0Z A;  3ITF A;  3EQL F;  4E7Z A;  1RMV A;  2IBF A;  2BL2 A;  4Z9I A;  5A6J A;  5JVE A;  3VAY A;  4YT5 A;  1O5H A;  4DVY P;  2WVQ A;  3BRJ A;  5COF A;  1Q0G A;  3FOO A;  4JEA A;  3EGX B;  3I5Q A;  2PP4 A;  4U5F E;  2X0C A;  4K7B A;  5A6A A;  3UMI A;  4FAP B;  4HFF B;  4OIR F;  4PJJ A;  1JOG A;  1WN0 A;  4YL1 A;  1Q0D A;  3GM3 A;  5HV9 A;  4FX5 A;  1NFN A;  4XLP F;  4EUK B;  1QVX A;  1QLE C;  1T9K A;  2L81 A;  3OA1 A;  4MVS A;  3U9M A;  3AQB A;  2QE9 A;  4MTF A;  1OCO C;  2HMZ A;  2RD9 A;  3POV A;  3KMI A;  4YL0 A;  1IZM A;  4PR9 A;  2EIK C;  1K04 A;  4NC3 A;  3HLZ A;  3TD7 A;  1Z23 A;  4BG0 A;  3PHF 2;  1J8M F;  1Y6D A;  4J7Y A;  4XPX A;  2GFH A;  3B0U X;  3M4C A;  4PFP A;  2CNW A;  3W2V A;  3DE8 A;  3W8I A;  4JEB A;  3S28 A;  3G4Z A;  1OR3 A;  1BR4 A;  4BPM A;  3Q6M A;  3S90 A;  2KYH A;  4OD4 A;  2HMQ A;  1JPJ A;  2EPK X;  1UG7 A;  4MVZ A;  1Y4C A;  4XEV A;  3ZTZ A;  4K1O A;  3QZC A;  3DAF A;  1U0B B;  2J45 A;  3HJC A;  4EWC A;  3ECS A;  2IXM A;  5L0I A;  3DKA A;  4GYT A;  3LES A;  3NYL A; 
#chains in the Genus database with same CATH homology
 2KGO A;  3UMK A;  3Q7G A;  2L9J A;  2A68 F;  2J9V A;  3K66 A;  2V3C C;  4M63 A;  3B0V C;  3MLG A;  3NKD A;  3K6B A;  2J9U A;  1D0X A;  1O87 A;  3ASO C;  3FVY A;  1NG1 A;  2WVO A;  5B1A C;  5D92 A;  4Q4Z F;  3O39 A;  3MX3 A;  4OD5 A;  2HV7 A;  5T1D B;  5KYW A;  2EIN C;  4I3M A;  5EGY A;  3ZVR A;  2R7Q A;  4N06 A;  2Y3G A;  3E9V A;  1NU7 D;  2A1D D;  3QMK A;  1ZHZ A;  5DVW A;  5CI9 A;  2VAS A;  3F47 A;  1SMY F;  4JJF A;  4YJW A;  4XTK A;  4Q7C A;  2FGY A;  4I1O B;  2E87 A;  2J0X A;  3FDQ A;  3DD7 A;  4KNV A;  4PFO A;  2R7O A;  5DLJ A;  4OIO F;  2PF4 E;  2IXN A;  2ZXR A;  4DOZ A;  4J30 B;  1SF8 A;  3S27 A;  2G3V A;  1VOM A;  4X0R A;  3DXJ F;  2Y39 A;  3SNH A;  3SYN A;  1TR2 A;  2JD3 A;  2XRH A;  5IY5 C;  3N0T A;  4F4B A;  2Y3H A;  2Q9C A;  3O6X A;  1G8X A;  3E70 C;  3AG3 C;  2QY9 A;  3W2W A;  4O6Y A;  2J0W A;  4C7O B;  5E3A A;  3UNG C;  3S29 A;  2A69 F;  5EHH A;  5KYW B;  3DMD A;  1ZU4 A;  4RDA A;  4I44 A;  5DS6 A;  1TWA A;  3NYJ A;  1NZE A;  4JVS A;  4G7Z F;  2Y3D A;  3ABM C;  3LLI A;  2C03 A;  1FTS A;  4JJG A;  5CI8 A;  1D1A A;  3L34 A;  3WOD F;  1OKK D;  3F46 A;  3NKE A;  3M1C B;  4CIH A;  1MND A;  4U5C E;  3RKO F;  3N2Z B;  5DQT A;  4CBE A;  4QDL A;  4BJT A;  5KYU B;  1M56 C;  2IXO A;  5E33 A;  5BUO A;  5KYX B;  1J8Y F;  3LS1 A;  4BJ5 C;  1TWC A;  3GOD A;  2C04 A;  4C3D A;  1ZHW A;  1QZX A;  5L3Q A;  2ZPA A;  2OCC C;  4CS9 C;  5T3W A;  2ZXW C;  3LJB A;  4W8K A;  4JCH A;  2XXA A;  2CW0 F;  4MQ9 F;  2G62 A;  3SZR A;  1NU9 C;  2PFD A;  2PX3 A;  3I5P A;  4U5D E;  2Y69 C;  4DBQ A;  1VYK A;  1RJ9 A;  4OIN F;  4U5B E;  4KC9 A;  1D0Y A;  2Q3T A;  3RYL A;  2OG2 A;  3LAY A;  2Q9B A;  2X51 A;  4O6M A;  2CDQ A;  2LSE A;  2W4B A;  1JPN A;  1VK5 A;  3AG2 C;  2J7P A;  3V7O A;  1PD1 A;  3KKB A;  5KYY A;  1ZHX A;  4JW1 A;  4QI2 A;  5B3S C;  1M2V A;  2H7V C;  3T6B A;  4OIQ F;  3DJU B;  3WG7 C;  1ZU5 A;  3JYH A;  1FMW A;  3K1H A;  2R7S A;  3S0X A;  3GAN A;  1BR2 A;  3JSZ A;  2DYR C;  1MMG A;  3OWT A;  5HSW A;  1V55 C;  3EH2 A;  2Y3B A;  2KW3 C;  2XXA B;  3JRT A;  1MNE A;  2W9Y A;  2W45 A;  1LKX A;  4GEH A;  4FES A;  2WL8 A;  4P6I C;  3OEO A;  2ZXO A;  2FFH A;  1D1C A;  1V54 C;  3DM5 A;  3EG9 A;  4IWB A;  3CQZ A;  2DYS C;  4IJJ A;  4PK4 A;  3EHN A;  4DVZ A;  2P7V A;  3UMH A;  3UGO A;  5DQZ A;  2MWQ A;  4JZA A;  1ST6 A;  4U5H A;  3VYW A;  4YN0 B;  2Q9A A;  1M2V B;  2CNW D;  4BJ5 A;  4G7H F;  2G3K A;  4ZLC A;  3AG1 C;  3LS0 A;  4G7O F;  3ZG1 A;  3RFY A;  2ZXP A;  3ABL C;  3EH1 A;  2YHS A;  3NYM A;  2EIJ C;  4CS9 A;  1D1B A;  3EGX A;  5L3V A;  2EIL C;  3RH3 A;  4XWJ A;  1MMN A;  4LAC B;  1ZHY A;  4B6I A;  4BJ1 A;  3SEO A;  4U5G A;  3UR3 C;  2IXP A;  3RIP A;  5F5H A;  1BR1 A;  4OIP F;  2PX0 A;  2I8B A;  1OCZ C;  4YT8 A;  2WZF A;  2YZS A;  3CZ6 A;  3PMR A;  3ASN C;  2J9W A;  3NDB B;  1IW7 F;  3EG9 B;  2P6V A;  3EGD A;  3L0I A;  1TWG A;  2R7U A;  5E3C A;  3Q6N A;  4PJL A;  2NUP A;  4JUR I;  3AG4 C;  4ZLD A;  3ZC4 A;  3KL4 A;  4CS8 A;  3SP1 A;  2IOQ A;  4WJ0 A;  4QI0 A;  1M2O A;  3B0P A;  3K7D A;  3LLK A;  2M4E A;  4ANJ A;  2CGE A;  1FMV A;  2KNH A;  3FAJ A;  2R7V A;  3UGP A;  2H7O A;  1OCR C;  3ZIB A;  2V26 A;  4C3B A;  2J46 A;  1KU2 A;  1Z5Z A;  2QTV A;  4K0D A;  5E2Q A;  1ZYR F;  1FFT C;  3CSK A;  1Z6A A;  4G0H A;  1TWH A;  5B1B C;  3JCU Q;  2NUT A;  2KJG A;  4AE4 A;  4CS8 C;  1OCC C;  2Z15 A;  3Q7L A;  5D91 A;  1VMA A;  3EGD B;  1VYI A;  2EIM C;  1FFH A;  4YWQ A;  2VH3 A;  3NG1 A;  3ZSU A;  2NUP B;  4O6N A;  2BE5 F;  1ZHT A;  3K1I C;  4CSA A;  2A6H F;  3T6J A;  1OKK A;  4Q5S F;  3FHD A;  1N1C A;  3EFO A;  3EHM A;  3B9Q A;  1RJ9 B;  3JT1 A;  4BJ6 A;  2WZG A;  4U5E E;  4C7O A;  4YT4 A;  3NRH A;  4EBB A;  3AQC A;  3EZI A;  2NG1 A;  4HE8 D;  2WZL A;  4IRU A;  3KH2 A;  4I1M A;  1WGW A;  2MYS A;  3HTK C;  2R7T A;  2R7R A;  3DJN B;  2IYL D;  2KQ9 A;  5DS4 A;  3T4R A;  4HFK B;  1SZI A;  2H7B A;  4CS7 A;  1PD0 A;  5KYY B;  4PJN A;  2W4M A;  4AK9 A;  5KYU A;  4DBR A;  4FWV A;  3H65 A;  4CSA C;  5FCL A;  5KYX A;  4ULW A;  4KI2 A;  4AX2 A;  2NUT B;  4AE4 B;  4O79 A;  4BJ6 C;  3EZH A;  4LLC A;  3W8H A;  2A6E F;  1LS1 A;  3ABK C;  4NY3 A;  5T3T A;  4XLN F;  2J7P D;  3IEE A;  2R7X A;  4A2N B;  1PCX A;  4J32 B;  4LER A;  3LEV A;  2B0J A;  3N24 A;  1Z3I X;  2DGJ A;  3I4U A;  2VB6 A;  2XL4 A;  3X2Q C;  2XSE A;  2HV6 A;  3EFO B;  4PJM A;  4HEA J;  1W2W A;  1Z63 A;  2YEV A;  2WVN A;  4LLE A;  1MMD A;  1M57 C;  3LNR A;  3DZA A;  2R7W A;  4MND A;  3X1O A;  4RBN A;  2O9X A;  4E7S A;  3K33 A;  4BEJ A;  4RD9 A;  3DAG A;  1S7Z A;  5F5F A;  1LVK A;  4KNW A;  2D5R B;  3DM9 B;  4IAO A;  3EJN A;  4YT2 A;  4H4K C;  3EPV A;  5KYN A;  4O7G A;  2WB7 A;  4C3E A;  1MMA A;  5DS5 A;  1TKN A;  4KBL A;  1D0Z A;  3ITF A;  3EQL F;  4E7Z A;  3VAY A;  4YT5 A;  1O5H A;  4DVY P;  2WVQ A;  3EGX B;  3I5Q A;  2PP4 A;  4U5F E;  4K7B A;  3UMI A;  4HFF B;  4OIR F;  4PJJ A;  4FX5 A;  4XLP F;  1QLE C;  2L81 A;  3OA1 A;  3AQB A;  1OCO C;  3POV A;  3KMI A;  1IZM A;  3PHF 2;  2EIK C;  3TD7 A;  4BG0 A;  3HLZ A;  1Z23 A;  1J8M F;  2GFH A;  3B0U X;  3W8I A;  4PFP A;  2CNW A;  3W2V A;  3S28 A;  1BR4 A;  3Q6M A;  4OD4 A;  1JPJ A;  3QZC A;  3DAF A;  2J45 A;  3HJC A;  4EWC A;  3ECS A;  2IXM A;  4GYT A;  3LES A;  3NYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...