3IEEA

Crystal structure of an alpha helical protein (bf3319) from bacteroides fragilis nctc 9343 at 1.70 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
256
structure length
256
Chain Sequence
VSTADIENAAEVIKYYNTSLGVLKDMVKEKDVNAVLDYMEQKGKTPALSAIVPPAVVSKDSAIVLNPGNCFNEETRRNLKQNYTGLFQARTEFYANFDTYLSYLKKKDVTNAKKLLDVNYQLSTQMSEYKQNIFDILSPFTEQAELVLLVDNPLKAQIMSVRKMSSTMQSILNLYARKHRMDGPRIDLKVAELTKQLDAAKKLPVVNGHEGEMKSYQAFLSQVETFIKQVKKVREKGEYSDADYDMLTSAFETSII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein BF3319 from Bacteroides fragilis (YP_212931.1) from Bacteroides fragilis NCTC 9343 at 1.70 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Structural genomics, unknown function
molecule keywords Putative exported protein
total genus 104
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ieeA02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ieeA01
3IEEA 4YJWA 3RH3A
chains in the Genus database with same CATH superfamily
4MTFA 1ZV4X 2P1AA 4U2YA 2J8WA 3LJBA 3PUGA 3U9JA 1KU2A 1OW7A 2G3KA 3FHDA 4FAPB 1HNXT 4TWDA 1T01A 2KSRA 2WB5A 1O5HA 4ULWA 2FFHA 2XLVA 4X1IE 2W4XA 3EAMA 4PFOA 5AQIB 4J2CA 4HWFA 1MIYA 3SS1A 3SXZA 3LUTB 2A72A 2E2AA 4CXYA 3K3OA 2ZXRA 3ZPOA 5CA1E 4DOZA 4Q7CA 4O2BE 5F5HA 3MBGA 1ZYRF 2UUIA 2PF4E 3V5YA 2NSGA 5HEJA 4JI3T 1FEWA 3IA3A 2LIGA 1DOWA 3N2KE 5CI9A 3J06A 1VRBA 5LP6E 3DJUB 2FGYA 1D0ZA 3PU8A 3S84A 3GM3A 4NCQA 3ZEFB 3TK0A 5GPGB 4PNIA 4G7HF 2NG1A 2BL2A 4X64T 4P9FA 5HEUA 4BJMA 3AG1C 5HCMA 5DQVA 3CX7B 4JURI 2IOQA 2Q00A 1Z6AA 1BR4A 3CQZA 2V1DB 1QVXA 2VCBA 1VMAA 4COFA 4DRHB 4DV5T 2YHSA 3LBXA 2B0JA 3PTRB 4FI5A 2CDQA 5LGTB 2QLAA 4IDZA 4CDYA 1T72A 3AE4A 2SPCA 2VKHA 2ZLYA 4DR3T 4HFCA 3K33A 4EWCA 2X0YA 3ZT5A 1ZHXA 5C2TA 3KL4A 2B1EA 3ZLIA 3MA9A 4TNVA 3SNHA 2H89A 1PV3A 2XAFB 3IF8B 4I50E 3UGOA 2XAHB 5LG3A 3T1YT 1Q0KA 2J9BA 2PJQA 2RD9A 3V5UA 2Q9CA 1ORSC 1HW1A 2C03A 4UVAB 3AA6B 3CQXC 4GEHA 4YTPA 3LAYA 5EK4A 1H9TA 2HN2A 5JVEA 4JV5T 2L6GA 5JRAA 2YKSA 4PFPA 2XQ6A 1LRZA 3VHLA 1YD8G 3K1IA 4O7GA 3JC6C 1VOMA 3NZQA 2J9WA 2BG9C 4JEBA 5JR9C 5JTGA 3GORA 3FZMB 4B3ST 3C8GD 4B3TT 4NPPA 3NKEA 4BJNA 2CHOA 3N2GE 2EHOA 2Y69C 4EAHA 3UMHA 3AE8A 2QUPA 2Y39A 3LK42 2Y6XA 3PUVF 3MZKB 2R7UA 4CIHA 5KYXA 3C7JA 3HNLA 2IW5B 1PD0A 4WYVA 3EHMA 3KBUA 1Q0GA 1MNEA 4DIDB 2HH7A 3K3NA 4EZ4A 4UV8B 2E5LT 1WASA 3C8GB 4UVBB 2XQ5A 2CLYB 4GYRA 2OCCC 1VLTA 5ABEA 4A5XA 4GYTA 1OXZA 4AQGA 3C8GA 4IDNA 2MYSA 3DI5A 4X66T 4H9RC 2CBJA 4HFDA 2PX3A 4EYUA 2Y3GA 3WAQA 1SUMB 2UXXB 4C7OA 1E2XA 2K24A 5DQWA 1SA0E 1YDIA 2Y48B 1TFKB 1ORYA 4EBBA 1U6HA 4H9QC 1TKNA 3BK9A 1OWAA 2BDEA 3L1MA 2AVKA 4KBLA 5EHHA 5L3FB 3WAKA 3S90A 4YT8A 1CHUA 4IDOA 3MACA 1T5OA 3UT5E 4N06A 3U3IA 4QXCB 4TNWA 2D5RB 5L0JA 2YK0A 3HNJA 4QXHB 1M2OA 5COMA 3B57A 2XJ7A 1C02A 3M65A 3NMKA 4MNDA 2VASA 4ZS2A 3QZCA 2XXAB 4I3MA 5AQNB 2I0MA 3F2EA 5EZYE 3B13A 1VCSA 5AQUB 4X5TA 5AQTB 2KLQA 3DXJF 2LSGA 3PURA 4A98A 1M2VB 1F1MA 3I0OA 4GIWA 2VK9A 2HUJA 5F5FA 2A69F 1OEDE 2YQYA 4G78A 3K1IC 2OV9A 2D5UA 2PG8A 4TWHA 3UU4A 2LRLA 3AEAA 3JSEO 4WNKA 3T6JA 1NLXA 2HJMA 1KEYA 1E83A 4Q25A 2LFFA 3DAFA 2GWWA 4J32B 2A6HF 3I5PA 4CN4A 1H7CA 4QH5A 2P7VA 3ETUA 3EI0A 4OIOF 3HJCA 2OG2A 1LIHA 1N32T 1NENA 2W63A 3U9MA 4G7ZF 3M4BA 2DGJA 5A6BD 1E2AA 1W9RA 2E9XD 3A11A 2XZEA 2CNWD 3NKZA 4C3EA 3RPUA 4HFHA 5HWYA 3F31A 4YHJA 1E85A 3OTOT 4JI2T 1VCTA 4XBFB 3UR3C 2TMVP 4AKGA 2KINB 5ABFB 2XHEB 1JMWA 2BS2A 4PJNA 2XSEA 1CGNA 5C8YE 1BDJB 3MK7C 2L81A 5H6QB 4H63V 5HAXA 3ANWA 2WVOA 3W4YA 4JIOA 1RJ9B 1NFOA 4X20E 3N9PA 2PP4A 2VQET 1OCOC 3IQCA 3CKDA 3PUAA 2BG9B 2QNLA 5HEGA 1CPQA 5B1BC 4I55E 3QUJA 4O8SA 2KWHA 4UIGA 3Q2MA 3CZ6A 3B9QA 2JPFA 3FVYA 1JRAA 3VYWA 4DR7T 3JAFA 4OIQF 3SP1A 2A3DA 2A9UA 5A6JA 3JT1A 3JYHA 2NW7A 3AE9A 2RPAA 2PBEA 3TLUA 3ONLC 1LM3B 1SZIA 2VCCA 3G50A 4U3CA 3H65A 3T9OA 4PJJA 3UULA 5HXEA 1OR3A 5L0CA 3C4WA 4JI5T 2YL1A 2BVMA 4R32A 5LYJE 5LBQB 3RKGA 3VKHA 4ASKA 3L09A 2H8AA 5FY0A 1KNYA 4YL3A 1CPRA 2YLDA 3T1HT 5A6AA 4LF7T 2MTQA 3LESA 5KYUB 4PK4A 4MVUA 4IT4A 3VR8A 3QOFA 1QUUA 5AQGB 3RKOA 3DWWA 1MMAA 4KP3C 4B6IA 3HTKC 3CEXA 3N9OA 3LS0A 2CPTA 5A6BA 3KV5A 1S35A 1V55C 3VR9A 3EQLF 2WU5A 1XZYA 4LF9T 2IXNA 3AG2C 4KI0F 3UUBA 4JI0T 3KFWX 3C8ZA 4ZXLA 4DMVA 4G0HA 4J7YA 3Q6NA 3O39A 2K3WA 4MVRA 4HFFB 2EPMX 5L0DA 3M3ZB 2FJDA 4G63A 4YSZA 4Q4ZF 4U2ZA 2Q9BA 3JZ0A 1LVKA 2WVNA 2L9JA 4UDVA 4YT5A 4K0UA 1Z3IX 3LDQB 3HL6A 3EGDA 1R8IA 1ST6A 2XSBA 3O1IA 3PUZF 1WN0A 2ZM6T 1CGME 3N0TA 3AE6A 4X62T 2H7BA 4MVOA 2NP9A 4JI7T 1OW8A 5J1GA 2Q9QC 5LG4A 3ZN1B 3FXDB 4P9TA 1MIWA 2J47A 3FBZA 2PNOA 5IWAT 1YA9A 2R9RB 2BKNA 2KYHA 1YYJA 2CXLA 3EDVA 2XXAA 2P6VA 4O79A 4ZLCA 3KINB 3EH1A 2MHRA 4U5FE 1ZW2A 4IE0A 4X0RA 4M63A 3HA4A 1GQEA 4CXWA 3CK6A 4XAXB 1YA7O 1UURA 5CA0E 3Q9DA 1QPUA 4JE9A 2HN1A 3UFEA 4FESA 4WBNE 2OEVA 3AE1A 4ZI2C 3EGXB 3AE5A 2KW3C 3U2MA 4I1MA 5BUOA 1OEDA 2Q9QB 2LM9A 2A68F 3MFNA 3RX6A 1WRDA 5KYYA 4IREA 5JQGE 3GA8A 3AG4C 3Q5EA 1TWCA 1Z23A 3RKOF 3ANWB 2ODUA 5ADXL 1K40A 4EXTA 5EK3A 1YQ4A 4DUZT 2D2SA 2EINC 2HPLA 1LI7A 2AU5A 4B6XA 4MTOA 2KGOA 3PV0F 3W15B 3AAAB 2LHNA 1ZHCA 2HS5A 2K5BB 2XM0A 1D0YA 3WHNA 4GOUA 1FNTc 3X1DA 4A97A 3PJAJ 3ZN0B 2HSBA 2PX0A 5DJQC 5KYXB 4NTFA 3RIFA 3RYLA 2QA7A 1V74B 1HS7A 4GK0E 1LS4A 3ZCJA 3W2WA 4MFRA 2KZ7B 3OPCA 4CIPA 3ZG1A 2B0HA 5F3JA 2KK1A 2L6HA 4W8PA 2V7KA 1UX4A 2CYDA 3LEVA 4LFBT 5KYWB 4F4BA 1Z7Qc 2HFIA 4IGGA 3QVYA 3NRYA 3EH2A 2HKVA 1SE7A 4CN6A 4NXMT 4IE4A 3CIRA 4OX9T 4QX8B 4NXNT 1U0BB 3ZJ2A 3H2VA 2R25A 3IQ5A 1A0BA 4DJ9A 2WZFA 2JQQA 5DS6A 4U74A 4I43B 3IEEA 4E17A 2VVSA 3RF1A 2IMLA 1WFDA 2D0UA 3ZT7A 3IHUA 2R05A 3KPHA 3UFGA 4G2AA 1VB5A 2NR4A 5BR8T 4XLNF 3ZQYA 2R7TA 4GQHA 2LSJA 3SFDA 2UUBT 2N1GA 4H9PC 3DKAA 3NVOA 3U78A 3KDSE 3N9NA 1SF8A 5CJ5A 1I4ZA 4JTDB 2M64A 2C0SA 2VB6A 1TWGA 4ZEYA 1DOVA 3JADA 4NTBA 2NTYA 4OYKA 3AA7B 4XPXA 4F6RC 4GKKT 1D1AA 3EG9A 2GFHA 3VU7H 4HWCA 5JSLA 1FR0A 2R6GF 1IW7F 2EPNA 3I9WA 1ZKEA 3ABLC 3QW1A 1T8BA 2ICWG 2XM2A 2OEXA 4PK6A 2LSIA 4TWFA 4EBKA 5L0HA 1LI5A 3ETVA 4UF0B 5LJMA 3HKBE 3PUQA 4EV6A 2Q7RA 2ZMAA 2E9XB 4O4HE 2CCQA 4MLKA 2J7PA 4IGUA 4WJ0A 2J0WA 3N9MA 2HJ3A 2G0UA 2H3RA 2W00A 2R7QA 4HN9A 4U5HA 1XZPA 3EFOA 4CDAA 2WWUA 1YLMA 3EGXA 1JOGA 3RF3A 3AJMA 2WWVA 1AEPA 4A2NB 4EUKB 2XQ7A 4TUYE 1BZ4A 4N78D 5CGMA 1J1JA 3UUXB 3L3PA 3AQBA 4OD4A 2LSKA 4H4KC 1NBBA 3ECSA 2HHHT 3Q5WA 4I4TE 3JAEA 2Q9AA 1MNDA 1KK7A 3AA0B 2WDRA 2DNXA 4DR4T 4JRZA 4IWBA 2WP9A 4JUYA 1HW2A 2NWBA 3UUNA 4JI1T 4IRUA 1FMVA 3DE8A 4QXBB 2Q9QD 4GYSA 2LSYA 2XLHA 3PDMP 3AAIA 3GODA 3SYNA 5JREA 2E9XC 2PFDA 4EB6E 1UUSA 1MQVA 5AC5A 5L0FA 1FTSA 1MMGA 2X51A 4MVQA 4C3DA 4AKHA 3HKCE 3C63A 1GQAA 4AE4B 2VVNA 3K66A 1RKEB 1CUNA 4TX5A 3M15A 1RMVA 3BRJA 3U0CA 4HFBA 3AEBA 3CQGB 5JDQA 4J7TA 3ABKC 2P61A 1YARO 1IJ6A 4EHPA 5L3GB 3O4XE 4AKRB 1H6GA 4ER9A 5AQRB 4N4WA 2I8BA 3O10A 2PBIA 2VL8A 3I0QA 3S0XA 2XQ9A 1HG2A 1Z5ZA 1IJ5A 3MXZA 2D0TA 2XSAA 3ATPA 5JDFA 3QTHA 3U8PA 4JI8T 4YJ2E 1FMWA 4UF0A 2X67A 1RJ9A 3CSKA 5KMGP 4V1Av 3RVZA 2ZM2A 3DM9B 3O9XA 5BQHA 4FX5A 2CWYA 2XQ4A 2J0XA 3QB5A 4DR6T 4W8KA 3LLKA 2MAWA 2X0LB 2LD6A 3VAYA 2DB4A 3VRAA 1NAFA 4CSAC 1QSPA 4UV9B 2MPKA 4NQFA 2JJ9A 4UVCB 4YJ3E 5E3CA 1YYXA 1Y6DA 3DE9A 5KYUA 4EIWA 2LCHA 4MBQA 3JTLO 2Q3TA 4QDLA 3GEHA 1VK5A 2LE8A 5A1LA 2YLIA 4WBOA 4D4NA 3EVYA 3ZSUA 2J4GA 2X0CA 1E84A 1C17M 3F46A 3AGTA 1YQ3A 3TLWA 3ZJ1A 3ZMUB 3TJ5A 4K0DA 2YDSA 2W66A 2DYSC 3RRWA 4JCHA 4L0RA 4JYAT 2QE9A 2XLDA 4MALA 1HFAA 3EJNA 5L47A 2W45A 2XQ8A 2UUAT 4WGYA 4IHJE 4KX6A 3UMIA 4ISTA 3LFMA 4EEBA 2BS3A 1HY5A 2XQYA 3RYIE 1SMYF 3MYIA 3Q5XA 4CS9C 4PK5A 4EKWA 2ODVA 5JRCB 5CB4E 4LDRA 4JI6T 4KNWA 4CJGA 3LNRA 1BBHA 5FY7A 1M6TA 5ABGA 1APCA 3AE3A 1SR2A 3RIUA 4KC9A 5JP7A 3RGLA 5AQPB 2LLYA 2LT3A 5JDLA 5LJNA 3UNGC 5AFUL 4C90A 1J8YF 3SXKA 1E86A 2HPJA 3AECA 2A0BA 5COFA 3ESLA 2LK4A 5AQFB 4IAOA 1KTMA 2XY8B 2KQ9A 3US6A 4CS9A 2J45A 2X68A 4DV3T 4I1OB 2XTLA 4DR1T 4AISA 5AGFA 3LS1A 2W4MA 1ZP0A 4U7YA 3FXHA 3RYFE 5HXRA 5LMUT 4NY3A 4BEJA 5DS4A 2V6XA 3GN5A 4OK0A 2QY9A 3W2VA 3N24A 2VH3A 2LSEA 5JS5A 1G73A 4JJFA 3T4RA 3AEFA 4HE8A 4YL0A 5HEHA 2Q9QA 3GMIA 3SZRA 2FBWA 2YU1A 1KF6A 2E5VA 5JDHA 3IBPA 2KNDA 2OLTA 4DR5T 3S4UA 2JQKA 3ABVA 2WB7A 3FAPB 4DNDA 5FNVE 1VYIA 4ZI7E 3OYZA 3AVSA 3NMJA 1ZHYA 2D4UA 1I94T 2EPOA 5HXSA 3EG9B 3LNMB 3E08A 4H63H 2IC6A 2K48A 3PJAA 2O9XA 5T3TA 3ZKRA 3F47A 2UXDT 2Z15A 2A0UA 3FBLA 3UU5A 1J5ET 2JPUA 4ANJA 4IL9A 2UUHA 4A4AA 1AUEA 3FXEB 2QVAA 4F8HA 4BJ1A 3A5XA 2X66A 2ZM8A 2W67A 1GS9A 1M57C 1AJ3A 3KH2A 3FMSA 1XMOT 4BG0A 1VLSA 4PJMA 4ZS3A 4MHCA 3C4ZA 2WU2A 1T98A 1WYBA 2W2UA 5FXXA 3EZIA 4CX9A 2L7AA 4EBJA 1I6ZA 3IHRA 1KFYA 3PUSA 3NYJA 1ZHZA 4JVSA 4IE6A 1BR0A 1LKXA 1KNZA 3AEGA 4ZOLE 4XPYA 4DRIB 2LOSA 4LMLA 1XNQT 3JRMO 2Z6EA 2XLEA 4DV7T 3G4ZA 1LVFA 3KMIA 2XASB 2E8IA 3HKDE 2IDOB 3GWHA 2YEVC 1D0XA 2EPLX 3H2UA 3NKDA 4CBEA 2ES0A 2QYWA 2V5CA 1UG7A 5L3DB 3HI2A 2WBLA 5KYWA 5KYNA 2R7SA 3N5LA 3ZC0A 2VKDA 4JI4T 4AXPA 4HFIA 1ZZPA 2BZBA 1NWMX 3A9CA 3ITFA 2JX0A 2KWIB 5E0OA 2K9AA 1W0AA 3MKDA 3RHWA 3J7Yq 5HSWA 3J9X1 4H9OC 4Z90A 3DM5A 1OQCA 2WDVA 5JLIA 3BEHA 2IUBA 2VCAA 1X79A 1XDPA 5JT4A 4IDQA 2L3LA 2WZHA 4KI2A 5AQQB 4WGZA 4E0IA 1S94A 2AE9A 2DI3A 4DR2T 3IQ6A 2WCAA 2GA0A 4LLEA 2W4BA 3Q5DA 2J7PD 1ZEEA 4H54A 3KBTA 1PD1A 2HV7A 1YXRA 2DWKA 4EEDA 5FXWA 4RDAA 4DMWA 2X9WA 5FXZA 3TULA 3CVRA 1ZHTA 3ZQVA 3AEDA 5IY5C 2IYLD 5EK0A 1UX5A 1N34T 2YDQA 2D9DA 1S05A 2LJLA 5FP3A 3ZIBA 2H7OA 2ASRA 2XRHA 2EHOC 3ONJA 2XAJB 4ERRA 1LE4A 5LCYA 3PUWF 1HNWT 4JLEA 2IAKA 1HR0T 1KNPA 5JR9A 2XLMA 5J2TE 2FJEA 3FB2A 3I1AA 3NMIA 1OXBA 3TD7A 1KNRA 4DVYP 2J1DG 1SYQA 4NUVA 4I44A 1A7DA 3H3MA 4U5DE 1QSDA 3EGDB 3I5QA 2ACXA 3RW0A 4LMKA 3SWHA 3M4CA 2X9HA 5A6KA 4IB4A 5TAOA 2F4VT 3CPZA 2BBJA 3CQCB 4TV8E 2F22A 3F57A 1U4QA 1AVOB 2IXMA 2XLOA 4CQIA 2C5JA 4Q5SF 4HFVA 4H9SE 3GEEA 5AC4A 3O55A 4O4JE 4IE7A 3QNUA 3ZSTA 3AEEA 3T8OA 2YZSA 4MVMA 4Z9IA 1XWMA 3RRCA 3TQOA 5L3QA 3CWZB 3K7DA 2R7VA 3U3BA 3Q7GA 3SXMA 1T7SA 2JMHA 5IUXA 4U7IA 1HMDA 3JYYA 1Z0PA 4L9IA 5AQSB 4RBNA 1Y01A 5L3BB 4CI2B 5DQZA 1N1CA 2IC9A 2CXDA 4HFEA 2YOEA 3U2LA 5JDNA 3O6XA 3VRBA 1N36T 2EILC 5JR9B 5EK2A 5FL1A 2M67A 3RFYA 4YTMA 5FYMA 2KXPB 3C98B 1M2VA 3JC6D 3P4WA 1OCZC 1LE2A 4YXDA 2RP4A 2UXNB 4P0BA 1V9DA 3HKEE 3BQLA 2B76A 3TKLB 3UU3A 3GWLA 4QH4A 4PACA 3R7CA 3FZFB 4OHFA 2V8SV 5CI8A 2JQHA 4DV1T 4U9EA 1W0BA 5FVKA 1CGOA 5T1DB 5L3VA 3QB5K 3SFEA 5KX5E 2EIJC 4DBQA 5LXTE 2WY2A 1TR2A 2HMZA 3AG3C 2CEAA 3MJXA 1JNZA 4P1NA 4BJTA 3AXJB 3RQWA 4DUYT 4YY3T 2C5IT 4HWDA 2JIWA 3KYJA 3LK3B 2IM8A 2WL8A 1BR1A 4BJ5C 2YEVA 3A8YC 3N2OA 5D92A 1O87A 2GAQA 4AIUA 4ZI2D 4CXXA 2BG9A 1R5ID 1TFOB 2V6YA 4YSXA 1MMNA 3Q6MA 2EIKC 2EIMC 2YVKA 1ZVZA 3KVAA 2OJQA 2R7RA 5J0ZA 5IHYA 3S29A 1O3UA 5L3EB 1H9GA 1ZU4A 4OINF 3DTOA 5B3IA 2OA5A 1JAFA 3CAXA 1GGQA 5FCLA 2XLWA 3FHNA 5L0IA 4KHZF 2X9YA 4ILBA 3S28A 3UMKA 1Y64B 1ZOYA 4PAGA 4OYJA 5JUAA 2BE5F 4YT2A 2NUPA 5AQHB 1WGWA 1GM5A 1OKKA 4OIRF 3LJCA 4WZXA 4LFCT 2R7XA 3M1CB 1B7TA 1WWPA 1DU2A 1B68A 3K1HA 4XEFA 2ZPAA 4CJOA 3E0ZA 2WZGA 5LHGB 2LP4A 2ETSA 3EHNA 3PCVA 4MVZA 2FJBA 4WABA 4YLHA 3VM6A 2VQFT 1W2WA 3BQIA 2BKPA 2LOPA 4IAQA 3PUXF 5E2QA 5E33A 2V26A 4X65T 5AQOB 2ZXPA 1HG5A 2PFVA 1C03A 1JR8A 3VKGA 3KVBA 2YWAA 4O6MA 2XL4A 3W8HA 5HXHA 5COGA 3R2PA 1OKKD 2OJED 4DVZA 3PE0A 1OCRC 3C4XA 4ILAA 3ZC4A 5B3SC 2V7JA 3ZYMA 1G8XA 1IBMT 3RQEA 4H9NC 4HKAA 1YKEB 1Q0DA 1QLBA 1TQGA 4LERA 2LM2A 3P4PA 2NUTA 2KJGA 2YL7A 2YRFA 3NBXX 4AKIA 2N2NA 3HNIA 1W09A 3M79A 2CLYC 2X9XA 5GONE 3RIPA 1WLXA 2LKHA 2WZLA 2PTFA 2P9BA 5LA6E 4CS8C 3ONXA 2GDCA 2BG9E 3RIUC 4YSYA 3U5SA 3ZYLA 2WZIA 1WR0A 5FXVA 1A7EA 1HE1A 1V54C 2BC5A 3SEOA 2V7IA 1YAUO 3HR0A 2LEHA 3V5XA 2CA5A 3VF0A 4NIQA 4C3BA 3T6BA 1G4US 3ZDLA 3C50A 2WAUA 1OEDC 3JSZA 5LMNT 3TOMA 4U72A 4ZZBA 2ACZA 4JEAA 5DS5A 2XQ3A 5BMVE 2WMNA 2WS3A 1LPEA 2J62A 4LF5T 3CX8B 1TWHA 5HCJA 2I59A 1U89A 3RH3A 3UU8A 2EPKX 3EHZA 2V7MA 3WAJA 3OKQA 5D91A 4IL4A 1XNRT 3DJNB 3QMKA 2AXDS 4O6YA 5M4YA 2Y3BA 1VTMP 2A6EF 3AOUA 4LFAT 3LG7A 1M56C 2RA1A 3NRHA 5LOVE 3U3FA 2C5KT 4MTGA 4KUMB 1Q0MA 3C62A 1Y4CA 1TWAA 4B3MT 2LRKA 3MX3A 1K04A 4XQ1A 3UQ7A 2MOZA 2XQAA 4GKJT 1R4TA 3ZWIA 2LQGA 4O6NA 3OBVE 3QW0A 4QI2A 1OEDB 1HTJF 5T3WA 3E9VA 3L8IA 4XWJA 2CMRA 2QTVA 1HCIA 5AQJB 3C51A 4IJJA 1M62A 2DLRA 1FAPB 3V5SA 4ZI3D 2MBGA 1RCPA 4I0UA 4XLPF 4O4IE 3S9OA 3FOOA 3UQ4A 1YVIA 2R02A 3ABMC 1ZW3A 3G4XA 1I4YA 5LBMA 4CI1B 1FIOA 5J2UE 5CFBA 3GM2A 4YT0A 5L4HA 1E1HB 2I15A 4QHOA 3OA1A 3IPMO 1Z8UA 1D1BA 2IXOA 2FUPA 5JRCA 3UUMA 5LHHB 3I9YA 4JBWF 2NW8A 1RKCA 3K1SA 2KNHA 5AQVB 5L2LA 1QKRA 5LNKA 3Q7LA 5LHIB 2IBFA 4MS2A 5C3JA 3O1JA 4KHPT 2CGEA 5BQGA 3P50A 1T6QA 2M6BA 4P6IC 4ZLDA 2C04A 1RXQA 3OEOA 4JCZA 3DJBA 5DVWA 4DV4T 2DCFA 3E22E 3L8RA 5AQKB 4L5GA 1YZAA 4G7OF 4CS8A 5JDGA 3EDUA 4LACB 1A7VA 4HWHA 2KC3A 4YFSA 3RQUA 1S7ZA 5L3CB 2OU6A 3B71A 5TJ5E 4K0KT 2H88A 5F5WA 1XMQT 4ZI3C 4XEVA 3FZLB 4UXNB 3L39A 2ZD9A 3GM1A 3AAEB 2AWCA 2RSEB 4IE5A 3DAGA 2HV6A 3GN5B 2XPKA 4XPWA 2XS8A 5B1AC 2J9UA 4NC3A 2ZXOA 2Q4FA 4YK5A 5ABHA 4U9DA 3WODF 3JCFA 3FDQA 1T9KA 2CE7A 3L0IA 3ZTMA 1Q0FA 1OR2A 1V4AA 4CDVA 3A7MA 3B5MA 4CZZB 3KV4A 2FAPB 2NPUA 3WG7C 4N6HA 4RD9A 4WW0A 2AWYA 3TJ6A 3BQKA 1IBKT 4E7SA 2UXCT 3NWIA 1XDOA 2VC9A 2CWOA 3GANA 5KYYB 5IYZE 4AX2A 1NG1A 5F28E 4PJLA 4BPMA 4AL0A 4UEMA 2VWAA 1L3PA 4ILUA 2V3CC 4ADZA 4CSAA 2N9DA 2J46A 4LDQA 4N6CA 3TLSA 2HZ8A 4AL1A 2VKJA 1YJGA 3ZCIA 4HGAA 4K7BA 2UU9T 1OCCC 1Z63A 5F8PA 2DI4A 5JDMA 1JNRA 3PHF2 4YTNA 3UU6A 4QI0A 5EGYA 4E7ZA 2EHOD 1WCRA 4NTAA 3DZAA 1NU9C 4U5CE 4C91A 1HF8A 2LHRA 1IAPA 3UGPA 3N2ZB 4J30B 2ZXWC 1HX8A 3DD7A 3NDBB 2JD3A 1YW0A 1O3XA 2YKZA 4JEHB 4Z9JA 3W8IA 4PR9A 3EZHA 5E3AA 2BS4A 4JTCB 3ZMVB 3VRCA 2MWQA 1MIVA 1N33T 2BKOA 4HEAJ 2IXPA 4EIYA 2HSQA 3EFOB 1XZQA 3CX6B 3ZT6A 4YL1A 2V5DA 4BJ5A 3RYHE 2XL6A 3AQCA 3LEOA 4BAYB 2WM9A 4FWVA 3QK6A 3JRTA 1JPJA 1EZ3A 2CRBA 4JJGA 1T6IA 4MW8A 2CNWA 2IIUA 4AK9A 1IZNB 2JQ9A 2E9XA 4HEAA 3FZKB 4ULVA 2H7VC 3ZVRA 2CM0A 4O4LE 2KMFA 3AB3B 2VL0A 3CMLA 1I5NA 3QC9A 1XWJA 1MMDA 2G62A 3MYFA 3ZMSB 2CXFA 3RC8A 1IZMA 4QX7B 1UGOA 3RQGA 2L6FA 3R6NA 3IQTA 4LMJA 1J5WA 3I4UA 3RI5A 4X1KE 3N9QA 1ORJA 3JCUQ 1EA8A 1OW6A 2CW0F 4U5BE 4P0AA 2XM4A 2YLGA 1FJGT 3B29A 4OFZA 3OYXA 1K05A 4P09A 4QH1A 3EUHA 4HTEA 3UTKA 5DLJA 2KT9A 3LK2B 5HWXA 1OXKA 3L8JA 3SXYA 4U33A 4TZ4C 2X0HA 2J9VA 3RLFF 4CI3B 1PCXA 1E7PA 3ZTZA 2VURA 4CS7A 256BA 4HFKB 3POVA 3FAJA 4CN1A 2L8KA 2CBIA 4ZZCA 3D0TA 3PU3A 2WDQA 5LGUB 4OIPF 3NZPA 3ZYKA 5L0GA 2XUEA 2W9YA 4LLCA 3NG1A 5FL0A 4DRJB 5FZTA 1QZXA 4YWQA 4QKNA 2FJAA 1YZCA 5JVDE 3AA1B 3KV6A 4ONSA 4C7OB 4IDPA 1G5ZA 1US7B 3G06A 2W0GA 5ETWA 2DHRA 2DWGA 4B3RT 3SRZA 2R03A 2KSFA 4HE8D 5HV9A 2YDRA 1WATA 3MLGA 5BQIA 3X1OA 3HNKA 4D4XA 3K3QC 5HEOA 5FKYA 4EOZB 3FOPA 3T6GB 1D1CA 2NUPB 3H37A 2WVQA 2NTXA 3AGUA 3AE7A 4KBMB 4DVDA 1HMOA 2R7OA 3AE2A 4M1PA 4DBRA 2XAGB 2YU2A 2CHNA 4DV2T 2ZM0A 2NOXA 1UFBA 2M4EA 4DXWA 4U31A 5DABA 1HE9A 3RYCE 1HX1B 1A41A 2Y3DA 4BEMJ 3ASOC 3NYLA 5H6RB 4DV0T 2WMOA 5A69A 3KV9A 3ZC1A 2QGSA 3SOLA 2E87A 5FY1A 3DMDA 3EABA 2LKGA 3AXJA 4K1OA 4Z9HA 3TLTA 4JZAA 2JRKA 3P4SA 2V6YB 3X2QC 2NUTB 1NEKA 2YINA 1FFHA 1H7IA 3B0VC 3EPVA 3TOLA 5HYAA 2YL3A 3QVZA 4L6RA 1J8MF 2GK9A 1U5PA 3AVRA 4IIJE 2EHOB 2QRXA 4BJ6A 1WYCA 1EKYA 4YT4A 2OOCA 2XAQB 4UELA 1EI7A 3ZMZB 3V7OA 3NRXA 2AP3A 3LBXB 3L34A 2XL8A 3K8PC 2I6HA 1SHZC 4NUUA 1WR6A 3OVUA 3U8VA 5KDMC 3P8CD 3O1HA 3PUYF 2XS1A 3KYIA 3K6BA 1M7KA 4Z91A 3R84B 3C64A 3OWTA 4YJWA 4KNVA 2Y8DA 2W62A 3DP7A 3LSVA 1NSGB 3RVYA 4XZCA 4PW8A 1T6UA 4LF4T 5KXJA 1EQ1A 4DO0A 3C18A 5AQLB 2DL1A 5LB7B 5DQTA 2HMQA 4Z8XA 4EGWA 5AQMB 4JC7A 1WTYA 1L0VA 4JKVA 4XEKA 1QQ3A 4MVSA 1LS1A 3GEIA 2G3VA 4DV6T 4MW3A 3WI3A 3S27A 2UXBT 2A1DD 3KKBA 4MQ9F 3V5ZA 3ZMTB 4QWNB 5K0IA 2NW9A 3H3AA 3P7IA 5JH7E 4O2AE 4AQFC 2CCYA 2A2FX 4TV9E 2OQMA 4OD5A 4GK5E 3ZSSA 2BBHA 4YN0B 4U5GA 1HNZT 3ASNC 4JW1A 1UCUA 3TLVA 3RQFA 4E18A 3GWNA 3RIAA 2JMKA 2M6IA 3OJAA 4YHHT 1ZU5A 4AI6A 4ISSA 4UR9A 4BJ6C 3HKKA 1JPNA 2LFDA 1L7CA 4AE4A 1X9BA 2L9QA 4TN7B 1UK5A 3P4RA 4X1YE 1WOLA 4LF6T 5LGNB 2P0NA 4IARA 2IHR1 3LLIA 1QLEC 4EYYR 2DYRC 4KMCA 5HXCA 1ZHWA 4HWIB 4LF8T 4ZHQE 4JEUB 4LDKA 4U5EE 1FFTC 1VYKA 4JTAB 1G4WR 2VKOA 4EZHA 4ILCA 1IBLT 4XTKA 2WQYA 2BVLA 4FJOA 3FZHB 1RKEA 2YL0A 2NSFA 3E70C 1NZEA 4A56A 5L4EA 3NYMA 1BR2A 3P4QA 5CIVA 3N9LA 3HLZA 2OKUA 2XM1A 2Y3HA 3PMRA 2W61A 4AQFA 5FMNA 5FVLA 1NFNA 2V7LA 2YN6A 3PDYA 4BA9A 3B0PA 2UUCT 3RC3A 1YKHB 4AKLA 4AQYT 2R7WA 5ABFA 4E0HA 3B0UX 1NU7D 2WSSV
chains in the Genus database with same CATH topology
2KNHA 2Q9QB 4PJMA 4ZS3A 4MHCA 3C4ZA 2LM9A 1T98A 1WYBA 1ZV4X 5FXXA 2A68F 3LJBA 5L2LA 3PUGA 3EZIA 3RX6A 5LNKA 3Q7LA 1WRDA 3IHRA 5LHIB 3PUSA 1KU2A 3O1JA 1ZHZA 4IE6A 1BR0A 2G3KA 5JQGE 1LKXA 3FHDA 4JVSA 2CGEA 3GA8A 1KNZA 3AG4C 3HJCA 1TWCA 4P6IC 4ZOLE 4ZLDA 1Z23A 2C04A 1O5HA 4ULWA 3RKOF 2LOSA 3ANWB 2ODUA 5ADXL 3OEOA 4EXTA 3DJBA 5EK3A 2FFHA 5DVWA 2DCFA 3E22E 2Z6EA 4L5GA 2D2SA 4X1IE 2HPLA 4PFOA 5JDGA 1LVFA 3EDUA 4J2CA 2EINC 1MIYA 2E8IA 2XASB 3HKDE 4B6XA 3KMIA 4LACB 3GWHA 3SS1A 2YEVC 1D0XA 2KGOA 2A72A 4YFSA 3W15B 4CXYA 3K3OA 3AAAB 2LHNA 1ZHCA 5L3CB 1S7ZA 3NKDA 2K5BB 4CBEA 2ES0A 1D0YA 2ZXRA 5L3DB 4GOUA 3ZPOA 5CA1E 3UMKA 3AQBA 4ZI3C 4Q7CA 4DOZA 3HI2A 2WBLA 4O2BE 4UXNB 5KYWA 5F5HA 5KYNA 3AAEB 3ZN0B 1ZYRF 2PX0A 2R7SA 5DJQC 4IE5A 3DAGA 3N5LA 3ZC0A 2HV6A 2PF4E 3GN5B 5KYXB 2VKDA 3RYLA 1FEWA 5B1AC 2QA7A 4AXPA 1HS7A 2BZBA 1NWMX 3N2KE 2J9UA 3ITFA 2ZXOA 4GK0E 5CI9A 1VRBA 5LP6E 3WODF 3DJUB 2KWIB 3FDQA 2CE7A 2FGYA 1D0ZA 5E0OA 3L0IA 2K9AA 3MKDA 3ZCJA 3W2WA 4MFRA 2KZ7B 3J7Yq 3PU8A 5HSWA 3J9X1 3ZEFB 4H9OC 4CZZB 3KV4A 4PNIA 3DM5A 5F3JA 2NG1A 3ZG1A 4G7HF 3NYJA 3WG7C 2V7KA 1UX4A 4BJMA 3AG1C 4RD9A 4WW0A 3BQKA 1X79A 5DQVA 2L3LA 3CX7B 4JURI 3LEVA 4E7SA 2IOQA 5KYWB 4KI2A 4F4BA 5DS6A 1Z6AA 1BR4A 3CQZA 2CWOA 2V1DB 3GANA 1S94A 1VMAA 2YHSA 5KYYB 3NRYA 3LBXA 2B0JA 3EH2A 3PTRB 4FI5A 5IYZE 2CDQA 4LLEA 4AX2A 1NG1A 5LGTB 2W4BA 4PJLA 2J7PD 1ZEEA 4IDZA 4UEMA 2VWAA 4IE4A 4QX8B 4ILUA 2V3CC 4ADZA 3KBTA 4CSAA 4G7OF 2N9DA 2J46A 1PD1A 2SPCA 3ZJ2A 2VKHA 2ZLYA 2HV7A 2VKJA 2WZFA 3ZCIA 2DWKA 2JQQA 4HGAA 4U74A 3K33A 4K7BA 4I43B 5FXWA 1OCCC 4RDAA 3IEEA 4DMWA 2X9WA 4EWCA 1Z63A 5F8PA 5FXZA 2DI4A 1ZHXA 5JDMA 3PHF2 2D0UA 3CVRA 3KL4A 2B1EA 3ZLIA 3MA9A 3SNHA 1ZHTA 4QI0A 4G2AA 5EGYA 2IYLD 4E7ZA 5IY5C 2EHOD 1UX5A 2XAFB 4XLNF 3IF8B 4I50E 3UGOA 2XAHB 2LJLA 5FP3A 3DZAA 2H7OA 2PJQA 3ZIBA 1NU9C 2R7TA 3V5UA 2Q9CA 4U5CE 4C91A 2C03A 2XRHA 4UVAB 3AA6B 2EHOC 2LSJA 1HF8A 3CQXC 2XAJB 2LHRA 4ERRA 4GEHA 2N1GA 5LCYA 4H9PC 3LAYA 3U78A 1IAPA 4JLEA 2IAKA 5EK4A 5JR9A 3UGPA 5J2TE 3N2ZB 3KDSE 4J30B 2ZXWC 1HX8A 3FB2A 3I1AA 3N9NA 2JD3A 3DD7A 1YW0A 3TD7A 4DVYP 2J1DG 3NDBB 4PFPA 1SF8A 1O3XA 1LRZA 4JEHB 4NUVA 3VHLA 4I44A 1YD8G 3W8IA 2C0SA 3EZHA 2VB6A 5E3AA 1TWGA 4U5DE 4O7GA 3JC6C 1QSDA 1VOMA 3NZQA 3EGDB 2ACXA 2J9WA 3SWHA 3I5QA 3ZMVB 2X9HA 2MWQA 5JR9C 5TAOA 1MIVA 3NKEA 3CQCB 3CPZA 4TV8E 2IXPA 4BJNA 2NTYA 4HEAJ 4OYKA 3F57A 3AA7B 1U4QA 3EFOB 3N2GE 2EHOA 3CX6B 4F6RC 2IXMA 2Y69C 1D1AA 3EG9A 4CQIA 3VU7H 2C5JA 3RYHE 2GFHA 3AQCA 4BJ5A 4BAYB 1IW7F 3I9WA 1ZKEA 2WM9A 4FWVA 3QK6A 4HFVA 4EAHA 3JRTA 4H9SE 1JPJA 3ABLC 3UMHA 4Q5SF 1EZ3A 4JJGA 2Y39A 4O4JE 3LK42 4IE7A 4OD4A 2Y6XA 2CNWA 3MZKB 4PK6A 4AK9A 2R7UA 1IZNB 4CIHA 2LSIA 5KYXA 2IW5B 2E9XA 1PD0A 3EHMA 3KBUA 4HEAA 3ETVA 3T8OA 1MNEA 2YZSA 2H7VC 4UF0B 3RRCA 5LJMA 3HKBE 3PUQA 2ZXPA 3ZVRA 2CM0A 2HH7A 2ZMAA 2E9XB 3K3NA 4O4HE 4EZ4A 2CCQA 3CWZB 4MLKA 4IGUA 4O4LE 4UV8B 2J7PA 3K7DA 3Q7GA 4WJ0A 2J0WA 2R7VA 4UVBB 3N9MA 2CLYB 4GYRA 2KMFA 3AB3B 2OCCC 3CMLA 2JMHA 3QC9A 1MMDA 2G0UA 4GYTA 2H3RA 2W00A 1OXZA 1Z0PA 3ZMSB 4AQGA 4L9IA 2G62A 2R7QA 4HN9A 2CXFA 2MYSA 4U5HA 3RC8A 3EFOA 4RBNA 1IZMA 4QX7B 2WWUA 4H9RC 3EGXA 3R6NA 5L3BB 4CI2B 5DQZA 1N1CA 2PX3A 4EYUA 2Y3GA 3I4UA 2IC9A 3N9QA 4X1KE 4A2NB 2CXDA 3JCUQ 2UXXB 4TUYE 4C7OA 2CW0F 2K24A 4N78D 5DQWA 1SA0E 5JDNA 4P0AA 2Y48B 2EILC 3O6XA 4U5BE 4EBBA 4OFZA 3L3PA 3UUXB 5EK2A 2LSKA 2M67A 3OYXA 4H9QC 5FYMA 5JR9B 1TKNA 4H4KC 2KXPB 3C98B 1M2VA 3JC6D 4P09A 1OCZC 3Q5WA 3BK9A 3ECSA 4I4TE 2Q9AA 1MNDA 1OWAA 2RP4A 3EUHA 2UXNB 4P0BA 1V9DA 3HKEE 1KK7A 2BDEA 4HTEA 4KBLA 3AA0B 3BQLA 3TKLB 3UTKA 5DLJA 2DNXA 2KT9A 3LK2B 5HWXA 5L3FB 5EHHA 3WAKA 4OHFA 4IWBA 4JUYA 4YT8A 2NWBA 3MACA 3UUNA 5CI8A 3UT5E 4TZ4C 4N06A 3U3IA 4IRUA 1FMVA 4QXBB 5T1DB 5L3VA 2Q9QD 1PCXA 4GYSA 2LSYA 4QXCB 4CI3B 5KX5E 2D5RB 2EIJC 4DBQA 5LXTE 3AAIA 4CS7A 2YK0A 4QXHB 3GODA 1TR2A 1M2OA 5JREA 2E9XC 3B57A 3AG3C 4HFKB 2CEAA 3SYNA 3MJXA 3POVA 3M65A 2PFDA 3FAJA 2L8KA 2VASA 4EB6E 4MNDA 4BJTA 1FTSA 1MMGA 2X51A 4C3DA 5KYYA 2C5IT 4AKHA 3X2QC 4ZS2A 3QZCA 3HKCE 2XXAB 4I3MA 3D0TA 3LK3B 3PU3A 4AE4B 3K66A 2WL8A 3F2EA 5LGUB 3B13A 5EZYE 1BR1A 4BJ5C 1CUNA 4TX5A 4OIPF 2YEVA 2KLQA 3N2OA 3DXJF 2LSGA 3NZPA 5D92A 1O87A 3PURA 3ZYKA 1M2VB 3I0OA 4ZI2D 4GIWA 2VK9A 3CQGB 4CXXA 2XUEA 5JDQA 2W9YA 4LLCA 2A69F 3ABKC 5F5FA 3NG1A 5BUOA 3Q6MA 1MMNA 3K1IC 2EIKC 2EIMC 1QZXA 1IJ6A 2D5UA 2PG8A 3KVAA 4QKNA 4YWQA 4WNKA 2R7RA 5JVDE 5L3GB 3O4XE 3AA1B 5IHYA 3KV6A 4AKRB 3S29A 4C7OB 3T6JA 1US7B 5L3EB 2W0GA 5ETWA 2DHRA 1ZU4A 2I8BA 2DWGA 2PBIA 2VL8A 3SRZA 3I0QA 4OINF 3S0XA 3DTOA 4HE8D 2OA5A 3DAFA 4J32B 1HG2A 2A6HF 1Z5ZA 5L3QA 1IJ5A 3MXZA 3MLGA 5FCLA 2D0TA 3I5PA 3FHNA 5JDFA 3X1OA 1H7CA 3K3QC 2X9YA 4YJ2E 1FMWA 3ETUA 4UF0A 2X67A 1Y64B 4PAGA 4EOZB 1RJ9A 2P7VA 3CSKA 1D1CA 2NUPB 5KMGP 3H37A 4V1Av 4OYJA 2OG2A 2ZM2A 2NTXA 2WVQA 3O9XA 2BE5F 3DM9B 2W63A 4YT2A 4KBMB 2NUPA 1WGWA 4DVDA 4G7ZF 4FX5A 2CWYA 1OKKA 2J0XA 2R7OA 2DGJA 3LJCA 4OIRF 4W8KA 4M1PA 2R7XA 4DBRA 2E9XD 3LLKA 3M1CB 1B7TA 2XAGB 2YU2A 2X0LB 3VAYA 2ZM0A 2NOXA 2CNWD 2M4EA 4C3EA 3RPUA 3B0UX 5HWYA 3F31A 4YHJA 3K1HA 1NAFA 4CSAC 5DABA 3RYCE 4XBFB 2Y3DA 2ZPAA 3UR3C 4UV9B 3ASOC 3E0ZA 2JJ9A 4AKGA 4UVCB 5LHGB 2WZGA 3NYLA 4YJ3E 2KINB 3EHNA 2XHEB 5H6RB 3B0VC 4YLHA 5E3CA 2WMOA 4PJNA 3KV9A 3ZC1A 2XSEA 2QGSA 3SOLA 5C8YE 2E87A 1W2WA 5FY1A 3BQIA 3DMDA 2LOPA 3MK7C 2L81A 5H6QB 4H63V 5HAXA 5E2QA 5KYUA 4EIWA 3ANWA 2WVOA 2JRKA 4MBQA 4JZAA 4QDLA 2NUTB 1RJ9B 2V26A 2YINA 1FFHA 1VK5A 1HG5A 4X20E 2Q3TA 2PFVA 3N9PA 2LE8A 5A1LA 2PP4A 3EPVA 1OCOC 4WBOA 5HYAA 3EVYA 3CKDA 3VKGA 3KVBA 3ZSUA 1J8MF 2GK9A 1U5PA 3PUAA 4O6MA 3AVRA 4IIJE 2XL4A 2EHOB 3F46A 3W8HA 5HXHA 3ZJ1A 3ZMUB 4BJ6A 1WYCA 4K0DA 5B1BC 4I55E 4YT4A 2XAQB 3QUJA 4O8SA 1OKKD 2DYSC 2KWHA 3RRWA 4UIGA 4DVZA 4CS8A 4UELA 3PE0A 1OCRC 3C4XA 3ZC4A 5B3SC 2V7JA 3Q2MA 3ZMZB 3ZYMA 1G8XA 4JCHA 3V7OA 3NRXA 4L0RA 4H9NC 4HKAA 4MALA 1YKEB 3LBXB 3L34A 1HFAA 3CZ6A 3B9QA 3K8PC 2JPFA 3EJNA 3FVYA 4LERA 1SHZC 4NUUA 2W45A 1WR6A 4IHJE 3VYWA 5KDMC 2NUTA 3UMIA 3P8CD 3O1HA 4ISTA 3LFMA 2KJGA 4OIQF 3SP1A 3K6BA 2A3DA 3R84B 3JT1A 3NBXX 3C64A 2NW7A 3JYHA 4AKIA 3OWTA 4YJWA 2XQYA 4KNVA 2N2NA 3RYIE 1SMYF 1SZIA 2Y8DA 2J9VA 2W62A 3DP7A 3Q5XA 4PK5A 3H65A 3RFYA 4CS9C 2CLYC 2X9XA 4PJJA 2ODVA 5GONE 3UULA 5JRCB 5HXEA 1WLXA 3RIPA 4XZCA 2WZLA 5CB4E 4PW8A 4O6YA 2P9BA 5LA6E 4CS8C 3C4WA 2BVMA 3ONXA 5LYJE 5LBQB 4DO0A 4KNWA 3VKHA 4ASKA 3L09A 3LNRA 5FY0A 3ZYLA 4OIOF 5DQTA 5FXVA 5FY7A 3SEOA 1V54C 2V7IA 2MTQA 4Z8XA 3HR0A 2LEHA 3LESA 2CA5A 5KYUB 4C3BA 1LS1A 4KC9A 3T6BA 2G3VA 5LJNA 4PK4A 3UNGC 2LT3A 5JDLA 5AFUL 3WI3A 4C90A 3C50A 1J8YF 2HPJA 2WAUA 3S27A 3ESLA 3JSZA 4U72A 1QUUA 2A1DD 4IAOA 5DS5A 3KKBA 5BMVE 4MQ9F 3ZMTB 2WMNA 3RKOA 1MMAA 3S28A 4KP3C 2KQ9A 4QWNB 4B6IA 2J45A 2X68A 3HTKC 2NW9A 4CS9A 4I1OB 3H3AA 3P7IA 2XTLA 3N9OA 3LS0A 5JH7E 3CX8B 3KV5A 1S35A 1V55C 1TWHA 4O2AE 2W4MA 4AQFC 3LS1A 2A2FX 4TV9E 3RYFE 5HXRA 4GK5E 3EQLF 4OD5A 2I59A 4NY3A 4BEJA 4YN0B 5DS4A 4U5GA 3RH3A 2IXNA 3ASNC 3AG2C 4JW1A 3GN5A 4OK0A 1UCUA 2V7MA 2QY9A 3W2VA 3KFWX 3N24A 3WAJA 2LSEA 2VH3A 1G73A 3OKQA 4JJFA 5D91A 3T4RA 3DJNB 3QMKA 4DMVA 4G0HA 2JMKA 4HE8A 5M4YA 3OJAA 2Y3BA 1ZU5A 3O39A 3Q6NA 4AI6A 4ISSA 2Q9QA 3GMIA 2A6EF 4HFFB 3SZRA 3LG7A 4BJ6C 2YU1A 5JDHA 1M56C 2RA1A 3NRHA 4G63A 1JPNA 5LOVE 4Q4ZF 2C5KT 3IBPA 2Q9BA 4KUMB 4AE4A 1LVKA 2L9QA 4TN7B 4X1YE 1TWAA 2KNDA 2L9JA 2WVNA 4YT5A 3S4UA 5LGNB 3MX3A 4K0UA 1Z3IX 2WB7A 4DNDA 5FNVE 3HL6A 3EGDA 3LLIA 1VYIA 2MOZA 1ST6A 1QLEC 3O1IA 4ZI7E 4EYYR 4O6NA 2DYRC 3OYZA 3AVSA 3OBVE 4KMCA 5HXCA 1ZHWA 4QI2A 4ZHQE 4U5EE 4JEUB 1ZHYA 1HTJF 5T3WA 3E9VA 3N0TA 5HXSA 3EG9B 4XWJA 1FFTC 2CMRA 2QTVA 1VYKA 2H7BA 3E08A 1HCIA 2NP9A 2VKOA 3C51A 4EZHA 5J1GA 2Q9QC 4IJJA 5LG4A 4XTKA 4H63H 2DLRA 2BVLA 3FXDB 4FJOA 3V5SA 3ZN1B 4ZI3D 2MBGA 1MIWA 2IC6A 2K48A 3FBZA 2O9XA 5T3TA 5E33A 4XLPF 3F47A 4O4IE 3E70C 2XXAA 2CXLA 3EDVA 1NZEA 4A56A 2P6VA 3NYMA 3ABMC 2Z15A 1BR2A 4O79A 4ZLCA 3FBLA 3KINB 3EH1A 4ANJA 3N9LA 3HLZA 4U5FE 4IE0A 4X0RA 5LBMA 4CI1B 4M63A 3HA4A 2Y3HA 3PMRA 1FIOA 2W61A 4CXWA 5J2UE 4AQFA 1E1HB 4QHOA 3OA1A 3FXEB 4XAXB 5FMNA 5CA0E 1D1BA 3Q9DA 3UFEA 2IXOA 4FESA 2V7LA 4WBNE 3PDYA 4BA9A 5JRCA 4BJ1A 3B0PA 3UUMA 4ZI2C 3A5XA 3RC3A 2X66A 3EGXB 1YKHB 4AKLA 5LHHB 2ZM8A 3I9YA 2KW3C 1M57C 2R7WA 2NW8A 1AJ3A 3KH2A 4I1MA 1NU7D 4BG0A 2WSSV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEE A;  4YJW A;  3RH3 A; 
#chains in the Genus database with same CATH topology
 4MTF A;  1ZV4 X;  2P1A A;  4U2Y A;  2J8W A;  3LJB A;  3PUG A;  3U9J A;  1KU2 A;  1OW7 A;  2G3K A;  3FHD A;  4FAP B;  1HNX T;  4TWD A;  1T01 A;  2KSR A;  2WB5 A;  1O5H A;  4ULW A;  2FFH A;  2XLV A;  4X1I E;  2W4X A;  3EAM A;  4PFO A;  5AQI B;  4J2C A;  4HWF A;  1MIY A;  3SS1 A;  3SXZ A;  3LUT B;  2A72 A;  2E2A A;  4CXY A;  3K3O A;  2ZXR A;  3ZPO A;  5CA1 E;  4DOZ A;  4Q7C A;  4O2B E;  5F5H A;  3MBG A;  1ZYR F;  2UUI A;  2PF4 E;  3V5Y A;  2NSG A;  5HEJ A;  4JI3 T;  1FEW A;  3IA3 A;  2LIG A;  1DOW A;  3N2K E;  5CI9 A;  3J06 A;  1VRB A;  5LP6 E;  3DJU B;  2FGY A;  1D0Z A;  3PU8 A;  3S84 A;  3GM3 A;  4NCQ A;  3ZEF B;  3TK0 A;  5GPG B;  4PNI A;  4G7H F;  2NG1 A;  2BL2 A;  4X64 T;  4P9F A;  5HEU A;  4BJM A;  3AG1 C;  5HCM A;  5DQV A;  3CX7 B;  4JUR I;  2IOQ A;  2Q00 A;  1Z6A A;  1BR4 A;  3CQZ A;  2V1D B;  1QVX A;  2VCB A;  1VMA A;  4COF A;  4DRH B;  4DV5 T;  2YHS A;  3LBX A;  2B0J A;  3PTR B;  4FI5 A;  2CDQ A;  5LGT B;  2QLA A;  4IDZ A;  4CDY A;  1T72 A;  3AE4 A;  2SPC A;  2VKH A;  2ZLY A;  4DR3 T;  4HFC A;  3K33 A;  4EWC A;  2X0Y A;  3ZT5 A;  1ZHX A;  5C2T A;  3KL4 A;  2B1E A;  3ZLI A;  3MA9 A;  4TNV A;  3SNH A;  2H89 A;  1PV3 A;  2XAF B;  3IF8 B;  4I50 E;  3UGO A;  2XAH B;  5LG3 A;  3T1Y T;  1Q0K A;  2J9B A;  2PJQ A;  2RD9 A;  3V5U A;  2Q9C A;  1ORS C;  1HW1 A;  2C03 A;  4UVA B;  3AA6 B;  3CQX C;  4GEH A;  4YTP A;  3LAY A;  5EK4 A;  1H9T A;  2HN2 A;  5JVE A;  4JV5 T;  2L6G A;  5JRA A;  2YKS A;  4PFP A;  2XQ6 A;  1LRZ A;  3VHL A;  1YD8 G;  3K1I A;  4O7G A;  3JC6 C;  1VOM A;  3NZQ A;  2J9W A;  2BG9 C;  4JEB A;  5JR9 C;  5JTG A;  3GOR A;  3FZM B;  4B3S T;  3C8G D;  4B3T T;  4NPP A;  3NKE A;  4BJN A;  2CHO A;  3N2G E;  2EHO A;  2Y69 C;  4EAH A;  3UMH A;  3AE8 A;  2QUP A;  2Y39 A;  3LK4 2;  2Y6X A;  3PUV F;  3MZK B;  2R7U A;  4CIH A;  5KYX A;  3C7J A;  3HNL A;  2IW5 B;  1PD0 A;  4WYV A;  3EHM A;  3KBU A;  1Q0G A;  1MNE A;  4DID B;  2HH7 A;  3K3N A;  4EZ4 A;  4UV8 B;  2E5L T;  1WAS A;  3C8G B;  4UVB B;  2XQ5 A;  2CLY B;  4GYR A;  2OCC C;  1VLT A;  5ABE A;  4A5X A;  4GYT A;  1OXZ A;  4AQG A;  3C8G A;  4IDN A;  2MYS A;  3DI5 A;  4X66 T;  4H9R C;  2CBJ A;  4HFD A;  2PX3 A;  4EYU A;  2Y3G A;  3WAQ A;  1SUM B;  2UXX B;  4C7O A;  1E2X A;  2K24 A;  5DQW A;  1SA0 E;  1YDI A;  2Y48 B;  1TFK B;  1ORY A;  4EBB A;  1U6H A;  4H9Q C;  1TKN A;  3BK9 A;  1OWA A;  2BDE A;  3L1M A;  2AVK A;  4KBL A;  5EHH A;  5L3F B;  3WAK A;  3S90 A;  4YT8 A;  1CHU A;  4IDO A;  3MAC A;  1T5O A;  3UT5 E;  4N06 A;  3U3I A;  4QXC B;  4TNW A;  2D5R B;  5L0J A;  2YK0 A;  3HNJ A;  4QXH B;  1M2O A;  5COM A;  3B57 A;  2XJ7 A;  1C02 A;  3M65 A;  3NMK A;  4MND A;  2VAS A;  4ZS2 A;  3QZC A;  2XXA B;  4I3M A;  5AQN B;  2I0M A;  3F2E A;  5EZY E;  3B13 A;  1VCS A;  5AQU B;  4X5T A;  5AQT B;  2KLQ A;  3DXJ F;  2LSG A;  3PUR A;  4A98 A;  1M2V B;  1F1M A;  3I0O A;  4GIW A;  2VK9 A;  2HUJ A;  5F5F A;  2A69 F;  1OED E;  2YQY A;  4G78 A;  3K1I C;  2OV9 A;  2D5U A;  2PG8 A;  4TWH A;  3UU4 A;  2LRL A;  3AEA A;  3JSE O;  4WNK A;  3T6J A;  1NLX A;  2HJM A;  1KEY A;  1E83 A;  4Q25 A;  2LFF A;  3DAF A;  2GWW A;  4J32 B;  2A6H F;  3I5P A;  4CN4 A;  1H7C A;  4QH5 A;  2P7V A;  3ETU A;  3EI0 A;  4OIO F;  3HJC A;  2OG2 A;  1LIH A;  1N32 T;  1NEN A;  2W63 A;  3U9M A;  4G7Z F;  3M4B A;  2DGJ A;  5A6B D;  1E2A A;  1W9R A;  2E9X D;  3A11 A;  2XZE A;  2CNW D;  3NKZ A;  4C3E A;  3RPU A;  4HFH A;  5HWY A;  3F31 A;  4YHJ A;  1E85 A;  3OTO T;  4JI2 T;  1VCT A;  4XBF B;  3UR3 C;  2TMV P;  4AKG A;  2KIN B;  5ABF B;  2XHE B;  1JMW A;  2BS2 A;  4PJN A;  2XSE A;  1CGN A;  5C8Y E;  1BDJ B;  3MK7 C;  2L81 A;  5H6Q B;  4H63 V;  5HAX A;  3ANW A;  2WVO A;  3W4Y A;  4JIO A;  1RJ9 B;  1NFO A;  4X20 E;  3N9P A;  2PP4 A;  2VQE T;  1OCO C;  3IQC A;  3CKD A;  3PUA A;  2BG9 B;  2QNL A;  5HEG A;  1CPQ A;  5B1B C;  4I55 E;  3QUJ A;  4O8S A;  2KWH A;  4UIG A;  3Q2M A;  3CZ6 A;  3B9Q A;  2JPF A;  3FVY A;  1JRA A;  3VYW A;  4DR7 T;  3JAF A;  4OIQ F;  3SP1 A;  2A3D A;  2A9U A;  5A6J A;  3JT1 A;  3JYH A;  2NW7 A;  3AE9 A;  2RPA A;  2PBE A;  3TLU A;  3ONL C;  1LM3 B;  1SZI A;  2VCC A;  3G50 A;  4U3C A;  3H65 A;  3T9O A;  4PJJ A;  3UUL A;  5HXE A;  1OR3 A;  5L0C A;  3C4W A;  4JI5 T;  2YL1 A;  2BVM A;  4R32 A;  5LYJ E;  5LBQ B;  3RKG A;  3VKH A;  4ASK A;  3L09 A;  2H8A A;  5FY0 A;  1KNY A;  4YL3 A;  1CPR A;  2YLD A;  3T1H T;  5A6A A;  4LF7 T;  2MTQ A;  3LES A;  5KYU B;  4PK4 A;  4MVU A;  4IT4 A;  3VR8 A;  3QOF A;  1QUU A;  5AQG B;  3RKO A;  3DWW A;  1MMA A;  4KP3 C;  4B6I A;  3HTK C;  3CEX A;  3N9O A;  3LS0 A;  2CPT A;  5A6B A;  3KV5 A;  1S35 A;  1V55 C;  3VR9 A;  3EQL F;  2WU5 A;  1XZY A;  4LF9 T;  2IXN A;  3AG2 C;  4KI0 F;  3UUB A;  4JI0 T;  3KFW X;  3C8Z A;  4ZXL A;  4DMV A;  4G0H A;  4J7Y A;  3Q6N A;  3O39 A;  2K3W A;  4MVR A;  4HFF B;  2EPM X;  5L0D A;  3M3Z B;  2FJD A;  4G63 A;  4YSZ A;  4Q4Z F;  4U2Z A;  2Q9B A;  3JZ0 A;  1LVK A;  2WVN A;  2L9J A;  4UDV A;  4YT5 A;  4K0U A;  1Z3I X;  3LDQ B;  3HL6 A;  3EGD A;  1R8I A;  1ST6 A;  2XSB A;  3O1I A;  3PUZ F;  1WN0 A;  2ZM6 T;  1CGM E;  3N0T A;  3AE6 A;  4X62 T;  2H7B A;  4MVO A;  2NP9 A;  4JI7 T;  1OW8 A;  5J1G A;  2Q9Q C;  5LG4 A;  3ZN1 B;  3FXD B;  4P9T A;  1MIW A;  2J47 A;  3FBZ A;  2PNO A;  5IWA T;  1YA9 A;  2R9R B;  2BKN A;  2KYH A;  1YYJ A;  2CXL A;  3EDV A;  2XXA A;  2P6V A;  4O79 A;  4ZLC A;  3KIN B;  3EH1 A;  2MHR A;  4U5F E;  1ZW2 A;  4IE0 A;  4X0R A;  4M63 A;  3HA4 A;  1GQE A;  4CXW A;  3CK6 A;  4XAX B;  1YA7 O;  1UUR A;  5CA0 E;  3Q9D A;  1QPU A;  4JE9 A;  2HN1 A;  3UFE A;  4FES A;  4WBN E;  2OEV A;  3AE1 A;  4ZI2 C;  3EGX B;  3AE5 A;  2KW3 C;  3U2M A;  4I1M A;  5BUO A;  1OED A;  2Q9Q B;  2LM9 A;  2A68 F;  3MFN A;  3RX6 A;  1WRD A;  5KYY A;  4IRE A;  5JQG E;  3GA8 A;  3AG4 C;  3Q5E A;  1TWC A;  1Z23 A;  3RKO F;  3ANW B;  2ODU A;  5ADX L;  1K40 A;  4EXT A;  5EK3 A;  1YQ4 A;  4DUZ T;  2D2S A;  2EIN C;  2HPL A;  1LI7 A;  2AU5 A;  4B6X A;  4MTO A;  2KGO A;  3PV0 F;  3W15 B;  3AAA B;  2LHN A;  1ZHC A;  2HS5 A;  2K5B B;  2XM0 A;  1D0Y A;  3WHN A;  4GOU A;  1FNT c;  3X1D A;  4A97 A;  3PJA J;  3ZN0 B;  2HSB A;  2PX0 A;  5DJQ C;  5KYX B;  4NTF A;  3RIF A;  3RYL A;  2QA7 A;  1V74 B;  1HS7 A;  4GK0 E;  1LS4 A;  3ZCJ A;  3W2W A;  4MFR A;  2KZ7 B;  3OPC A;  4CIP A;  3ZG1 A;  2B0H A;  5F3J A;  2KK1 A;  2L6H A;  4W8P A;  2V7K A;  1UX4 A;  2CYD A;  3LEV A;  4LFB T;  5KYW B;  4F4B A;  1Z7Q c;  2HFI A;  4IGG A;  3QVY A;  3NRY A;  3EH2 A;  2HKV A;  1SE7 A;  4CN6 A;  4NXM T;  4IE4 A;  3CIR A;  4OX9 T;  4QX8 B;  4NXN T;  1U0B B;  3ZJ2 A;  3H2V A;  2R25 A;  3IQ5 A;  1A0B A;  4DJ9 A;  2WZF A;  2JQQ A;  5DS6 A;  4U74 A;  4I43 B;  3IEE A;  4E17 A;  2VVS A;  3RF1 A;  2IML A;  1WFD A;  2D0U A;  3ZT7 A;  3IHU A;  2R05 A;  3KPH A;  3UFG A;  4G2A A;  1VB5 A;  2NR4 A;  5BR8 T;  4XLN F;  3ZQY A;  2R7T A;  4GQH A;  2LSJ A;  3SFD A;  2UUB T;  2N1G A;  4H9P C;  3DKA A;  3NVO A;  3U78 A;  3KDS E;  3N9N A;  1SF8 A;  5CJ5 A;  1I4Z A;  4JTD B;  2M64 A;  2C0S A;  2VB6 A;  1TWG A;  4ZEY A;  1DOV A;  3JAD A;  4NTB A;  2NTY A;  4OYK A;  3AA7 B;  4XPX A;  4F6R C;  4GKK T;  1D1A A;  3EG9 A;  2GFH A;  3VU7 H;  4HWC A;  5JSL A;  1FR0 A;  2R6G F;  1IW7 F;  2EPN A;  3I9W A;  1ZKE A;  3ABL C;  3QW1 A;  1T8B A;  2ICW G;  2XM2 A;  2OEX A;  4PK6 A;  2LSI A;  4TWF A;  4EBK A;  5L0H A;  1LI5 A;  3ETV A;  4UF0 B;  5LJM A;  3HKB E;  3PUQ A;  4EV6 A;  2Q7R A;  2ZMA A;  2E9X B;  4O4H E;  2CCQ A;  4MLK A;  2J7P A;  4IGU A;  4WJ0 A;  2J0W A;  3N9M A;  2HJ3 A;  2G0U A;  2H3R A;  2W00 A;  2R7Q A;  4HN9 A;  4U5H A;  1XZP A;  3EFO A;  4CDA A;  2WWU A;  1YLM A;  3EGX A;  1JOG A;  3RF3 A;  3AJM A;  2WWV A;  1AEP A;  4A2N B;  4EUK B;  2XQ7 A;  4TUY E;  1BZ4 A;  4N78 D;  5CGM A;  1J1J A;  3UUX B;  3L3P A;  3AQB A;  4OD4 A;  2LSK A;  4H4K C;  1NBB A;  3ECS A;  2HHH T;  3Q5W A;  4I4T E;  3JAE A;  2Q9A A;  1MND A;  1KK7 A;  3AA0 B;  2WDR A;  2DNX A;  4DR4 T;  4JRZ A;  4IWB A;  2WP9 A;  4JUY A;  1HW2 A;  2NWB A;  3UUN A;  4JI1 T;  4IRU A;  1FMV A;  3DE8 A;  4QXB B;  2Q9Q D;  4GYS A;  2LSY A;  2XLH A;  3PDM P;  3AAI A;  3GOD A;  3SYN A;  5JRE A;  2E9X C;  2PFD A;  4EB6 E;  1UUS A;  1MQV A;  5AC5 A;  5L0F A;  1FTS A;  1MMG A;  2X51 A;  4MVQ A;  4C3D A;  4AKH A;  3HKC E;  3C63 A;  1GQA A;  4AE4 B;  2VVN A;  3K66 A;  1RKE B;  1CUN A;  4TX5 A;  3M15 A;  1RMV A;  3BRJ A;  3U0C A;  4HFB A;  3AEB A;  3CQG B;  5JDQ A;  4J7T A;  3ABK C;  2P61 A;  1YAR O;  1IJ6 A;  4EHP A;  5L3G B;  3O4X E;  4AKR B;  1H6G A;  4ER9 A;  5AQR B;  4N4W A;  2I8B A;  3O10 A;  2PBI A;  2VL8 A;  3I0Q A;  3S0X A;  2XQ9 A;  1HG2 A;  1Z5Z A;  1IJ5 A;  3MXZ A;  2D0T A;  2XSA A;  3ATP A;  5JDF A;  3QTH A;  3U8P A;  4JI8 T;  4YJ2 E;  1FMW A;  4UF0 A;  2X67 A;  1RJ9 A;  3CSK A;  5KMG P;  4V1A v;  3RVZ A;  2ZM2 A;  3DM9 B;  3O9X A;  5BQH A;  4FX5 A;  2CWY A;  2XQ4 A;  2J0X A;  3QB5 A;  4DR6 T;  4W8K A;  3LLK A;  2MAW A;  2X0L B;  2LD6 A;  3VAY A;  2DB4 A;  3VRA A;  1NAF A;  4CSA C;  1QSP A;  4UV9 B;  2MPK A;  4NQF A;  2JJ9 A;  4UVC B;  4YJ3 E;  5E3C A;  1YYX A;  1Y6D A;  3DE9 A;  5KYU A;  4EIW A;  2LCH A;  4MBQ A;  3JTL O;  2Q3T A;  4QDL A;  3GEH A;  1VK5 A;  2LE8 A;  5A1L A;  2YLI A;  4WBO A;  4D4N A;  3EVY A;  3ZSU A;  2J4G A;  2X0C A;  1E84 A;  1C17 M;  3F46 A;  3AGT A;  1YQ3 A;  3TLW A;  3ZJ1 A;  3ZMU B;  3TJ5 A;  4K0D A;  2YDS A;  2W66 A;  2DYS C;  3RRW A;  4JCH A;  4L0R A;  4JYA T;  2QE9 A;  2XLD A;  4MAL A;  1HFA A;  3EJN A;  5L47 A;  2W45 A;  2XQ8 A;  2UUA T;  4WGY A;  4IHJ E;  4KX6 A;  3UMI A;  4IST A;  3LFM A;  4EEB A;  2BS3 A;  1HY5 A;  2XQY A;  3RYI E;  1SMY F;  3MYI A;  3Q5X A;  4CS9 C;  4PK5 A;  4EKW A;  2ODV A;  5JRC B;  5CB4 E;  4LDR A;  4JI6 T;  4KNW A;  4CJG A;  3LNR A;  1BBH A;  5FY7 A;  1M6T A;  5ABG A;  1APC A;  3AE3 A;  1SR2 A;  3RIU A;  4KC9 A;  5JP7 A;  3RGL A;  5AQP B;  2LLY A;  2LT3 A;  5JDL A;  5LJN A;  3UNG C;  5AFU L;  4C90 A;  1J8Y F;  3SXK A;  1E86 A;  2HPJ A;  3AEC A;  2A0B A;  5COF A;  3ESL A;  2LK4 A;  5AQF B;  4IAO A;  1KTM A;  2XY8 B;  2KQ9 A;  3US6 A;  4CS9 A;  2J45 A;  2X68 A;  4DV3 T;  4I1O B;  2XTL A;  4DR1 T;  4AIS A;  5AGF A;  3LS1 A;  2W4M A;  1ZP0 A;  4U7Y A;  3FXH A;  3RYF E;  5HXR A;  5LMU T;  4NY3 A;  4BEJ A;  5DS4 A;  2V6X A;  3GN5 A;  4OK0 A;  2QY9 A;  3W2V A;  3N24 A;  2VH3 A;  2LSE A;  5JS5 A;  1G73 A;  4JJF A;  3T4R A;  3AEF A;  4HE8 A;  4YL0 A;  5HEH A;  2Q9Q A;  3GMI A;  3SZR A;  2FBW A;  2YU1 A;  1KF6 A;  2E5V A;  5JDH A;  3IBP A;  2KND A;  2OLT A;  4DR5 T;  3S4U A;  2JQK A;  3ABV A;  2WB7 A;  3FAP B;  4DND A;  5FNV E;  1VYI A;  4ZI7 E;  3OYZ A;  3AVS A;  3NMJ A;  1ZHY A;  2D4U A;  1I94 T;  2EPO A;  5HXS A;  3EG9 B;  3LNM B;  3E08 A;  4H63 H;  2IC6 A;  2K48 A;  3PJA A;  2O9X A;  5T3T A;  3ZKR A;  3F47 A;  2UXD T;  2Z15 A;  2A0U A;  3FBL A;  3UU5 A;  1J5E T;  2JPU A;  4ANJ A;  4IL9 A;  2UUH A;  4A4A A;  1AUE A;  3FXE B;  2QVA A;  4F8H A;  4BJ1 A;  3A5X A;  2X66 A;  2ZM8 A;  2W67 A;  1GS9 A;  1M57 C;  1AJ3 A;  3KH2 A;  3FMS A;  1XMO T;  4BG0 A;  1VLS A;  4PJM A;  4ZS3 A;  4MHC A;  3C4Z A;  2WU2 A;  1T98 A;  1WYB A;  2W2U A;  5FXX A;  3EZI A;  4CX9 A;  2L7A A;  4EBJ A;  1I6Z A;  3IHR A;  1KFY A;  3PUS A;  3NYJ A;  1ZHZ A;  4JVS A;  4IE6 A;  1BR0 A;  1LKX A;  1KNZ A;  3AEG A;  4ZOL E;  4XPY A;  4DRI B;  2LOS A;  4LML A;  1XNQ T;  3JRM O;  2Z6E A;  2XLE A;  4DV7 T;  3G4Z A;  1LVF A;  3KMI A;  2XAS B;  2E8I A;  3HKD E;  2IDO B;  3GWH A;  2YEV C;  1D0X A;  2EPL X;  3H2U A;  3NKD A;  4CBE A;  2ES0 A;  2QYW A;  2V5C A;  1UG7 A;  5L3D B;  3HI2 A;  2WBL A;  5KYW A;  5KYN A;  2R7S A;  3N5L A;  3ZC0 A;  2VKD A;  4JI4 T;  4AXP A;  4HFI A;  1ZZP A;  2BZB A;  1NWM X;  3A9C A;  3ITF A;  2JX0 A;  2KWI B;  5E0O A;  2K9A A;  1W0A A;  3MKD A;  3RHW A;  3J7Y q;  5HSW A;  3J9X 1;  4H9O C;  4Z90 A;  3DM5 A;  1OQC A;  2WDV A;  5JLI A;  3BEH A;  2IUB A;  2VCA A;  1X79 A;  1XDP A;  5JT4 A;  4IDQ A;  2L3L A;  2WZH A;  4KI2 A;  5AQQ B;  4WGZ A;  4E0I A;  1S94 A;  2AE9 A;  2DI3 A;  4DR2 T;  3IQ6 A;  2WCA A;  2GA0 A;  4LLE A;  2W4B A;  3Q5D A;  2J7P D;  1ZEE A;  4H54 A;  3KBT A;  1PD1 A;  2HV7 A;  1YXR A;  2DWK A;  4EED A;  5FXW A;  4RDA A;  4DMW A;  2X9W A;  5FXZ A;  3TUL A;  3CVR A;  1ZHT A;  3ZQV A;  3AED A;  5IY5 C;  2IYL D;  5EK0 A;  1UX5 A;  1N34 T;  2YDQ A;  2D9D A;  1S05 A;  2LJL A;  5FP3 A;  3ZIB A;  2H7O A;  2ASR A;  2XRH A;  2EHO C;  3ONJ A;  2XAJ B;  4ERR A;  1LE4 A;  5LCY A;  3PUW F;  1HNW T;  4JLE A;  2IAK A;  1HR0 T;  1KNP A;  5JR9 A;  2XLM A;  5J2T E;  2FJE A;  3FB2 A;  3I1A A;  3NMI A;  1OXB A;  3TD7 A;  1KNR A;  4DVY P;  2J1D G;  1SYQ A;  4NUV A;  4I44 A;  1A7D A;  3H3M A;  4U5D E;  1QSD A;  3EGD B;  3I5Q A;  2ACX A;  3RW0 A;  4LMK A;  3SWH A;  3M4C A;  2X9H A;  5A6K A;  4IB4 A;  5TAO A;  2F4V T;  3CPZ A;  2BBJ A;  3CQC B;  4TV8 E;  2F22 A;  3F57 A;  1U4Q A;  1AVO B;  2IXM A;  2XLO A;  4CQI A;  2C5J A;  4Q5S F;  4HFV A;  4H9S E;  3GEE A;  5AC4 A;  3O55 A;  4O4J E;  4IE7 A;  3QNU A;  3ZST A;  3AEE A;  3T8O A;  2YZS A;  4MVM A;  4Z9I A;  1XWM A;  3RRC A;  3TQO A;  5L3Q A;  3CWZ B;  3K7D A;  2R7V A;  3U3B A;  3Q7G A;  3SXM A;  1T7S A;  2JMH A;  5IUX A;  4U7I A;  1HMD A;  3JYY A;  1Z0P A;  4L9I A;  5AQS B;  4RBN A;  1Y01 A;  5L3B B;  4CI2 B;  5DQZ A;  1N1C A;  2IC9 A;  2CXD A;  4HFE A;  2YOE A;  3U2L A;  5JDN A;  3O6X A;  3VRB A;  1N36 T;  2EIL C;  5JR9 B;  5EK2 A;  5FL1 A;  2M67 A;  3RFY A;  4YTM A;  5FYM A;  2KXP B;  3C98 B;  1M2V A;  3JC6 D;  3P4W A;  1OCZ C;  1LE2 A;  4YXD A;  2RP4 A;  2UXN B;  4P0B A;  1V9D A;  3HKE E;  3BQL A;  2B76 A;  3TKL B;  3UU3 A;  3GWL A;  4QH4 A;  4PAC A;  3R7C A;  3FZF B;  4OHF A;  2V8S V;  5CI8 A;  2JQH A;  4DV1 T;  4U9E A;  1W0B A;  5FVK A;  1CGO A;  5T1D B;  5L3V A;  3QB5 K;  3SFE A;  5KX5 E;  2EIJ C;  4DBQ A;  5LXT E;  2WY2 A;  1TR2 A;  2HMZ A;  3AG3 C;  2CEA A;  3MJX A;  1JNZ A;  4P1N A;  4BJT A;  3AXJ B;  3RQW A;  4DUY T;  4YY3 T;  2C5I T;  4HWD A;  2JIW A;  3KYJ A;  3LK3 B;  2IM8 A;  2WL8 A;  1BR1 A;  4BJ5 C;  2YEV A;  3A8Y C;  3N2O A;  5D92 A;  1O87 A;  2GAQ A;  4AIU A;  4ZI2 D;  4CXX A;  2BG9 A;  1R5I D;  1TFO B;  2V6Y A;  4YSX A;  1MMN A;  3Q6M A;  2EIK C;  2EIM C;  2YVK A;  1ZVZ A;  3KVA A;  2OJQ A;  2R7R A;  5J0Z A;  5IHY A;  3S29 A;  1O3U A;  5L3E B;  1H9G A;  1ZU4 A;  4OIN F;  3DTO A;  5B3I A;  2OA5 A;  1JAF A;  3CAX A;  1GGQ A;  5FCL A;  2XLW A;  3FHN A;  5L0I A;  4KHZ F;  2X9Y A;  4ILB A;  3S28 A;  3UMK A;  1Y64 B;  1ZOY A;  4PAG A;  4OYJ A;  5JUA A;  2BE5 F;  4YT2 A;  2NUP A;  5AQH B;  1WGW A;  1GM5 A;  1OKK A;  4OIR F;  3LJC A;  4WZX A;  4LFC T;  2R7X A;  3M1C B;  1B7T A;  1WWP A;  1DU2 A;  1B68 A;  3K1H A;  4XEF A;  2ZPA A;  4CJO A;  3E0Z A;  2WZG A;  5LHG B;  2LP4 A;  2ETS A;  3EHN A;  3PCV A;  4MVZ A;  2FJB A;  4WAB A;  4YLH A;  3VM6 A;  2VQF T;  1W2W A;  3BQI A;  2BKP A;  2LOP A;  4IAQ A;  3PUX F;  5E2Q A;  5E33 A;  2V26 A;  4X65 T;  5AQO B;  2ZXP A;  1HG5 A;  2PFV A;  1C03 A;  1JR8 A;  3VKG A;  3KVB A;  2YWA A;  4O6M A;  2XL4 A;  3W8H A;  5HXH A;  5COG A;  3R2P A;  1OKK D;  2OJE D;  4DVZ A;  3PE0 A;  1OCR C;  3C4X A;  4ILA A;  3ZC4 A;  5B3S C;  2V7J A;  3ZYM A;  1G8X A;  1IBM T;  3RQE A;  4H9N C;  4HKA A;  1YKE B;  1Q0D A;  1QLB A;  1TQG A;  4LER A;  2LM2 A;  3P4P A;  2NUT A;  2KJG A;  2YL7 A;  2YRF A;  3NBX X;  4AKI A;  2N2N A;  3HNI A;  1W09 A;  3M79 A;  2CLY C;  2X9X A;  5GON E;  3RIP A;  1WLX A;  2LKH A;  2WZL A;  2PTF A;  2P9B A;  5LA6 E;  4CS8 C;  3ONX A;  2GDC A;  2BG9 E;  3RIU C;  4YSY A;  3U5S A;  3ZYL A;  2WZI A;  1WR0 A;  5FXV A;  1A7E A;  1HE1 A;  1V54 C;  2BC5 A;  3SEO A;  2V7I A;  1YAU O;  3HR0 A;  2LEH A;  3V5X A;  2CA5 A;  3VF0 A;  4NIQ A;  4C3B A;  3T6B A;  1G4U S;  3ZDL A;  3C50 A;  2WAU A;  1OED C;  3JSZ A;  5LMN T;  3TOM A;  4U72 A;  4ZZB A;  2ACZ A;  4JEA A;  5DS5 A;  2XQ3 A;  5BMV E;  2WMN A;  2WS3 A;  1LPE A;  2J62 A;  4LF5 T;  3CX8 B;  1TWH A;  5HCJ A;  2I59 A;  1U89 A;  3RH3 A;  3UU8 A;  2EPK X;  3EHZ A;  2V7M A;  3WAJ A;  3OKQ A;  5D91 A;  4IL4 A;  1XNR T;  3DJN B;  3QMK A;  2AXD S;  4O6Y A;  5M4Y A;  2Y3B A;  1VTM P;  2A6E F;  3AOU A;  4LFA T;  3LG7 A;  1M56 C;  2RA1 A;  3NRH A;  5LOV E;  3U3F A;  2C5K T;  4MTG A;  4KUM B;  1Q0M A;  3C62 A;  1Y4C A;  1TWA A;  4B3M T;  2LRK A;  3MX3 A;  1K04 A;  4XQ1 A;  3UQ7 A;  2MOZ A;  2XQA A;  4GKJ T;  1R4T A;  3ZWI A;  2LQG A;  4O6N A;  3OBV E;  3QW0 A;  4QI2 A;  1OED B;  1HTJ F;  5T3W A;  3E9V A;  3L8I A;  4XWJ A;  2CMR A;  2QTV A;  1HCI A;  5AQJ B;  3C51 A;  4IJJ A;  1M62 A;  2DLR A;  1FAP B;  3V5S A;  4ZI3 D;  2MBG A;  1RCP A;  4I0U A;  4XLP F;  4O4I E;  3S9O A;  3FOO A;  3UQ4 A;  1YVI A;  2R02 A;  3ABM C;  1ZW3 A;  3G4X A;  1I4Y A;  5LBM A;  4CI1 B;  1FIO A;  5J2U E;  5CFB A;  3GM2 A;  4YT0 A;  5L4H A;  1E1H B;  2I15 A;  4QHO A;  3OA1 A;  3IPM O;  1Z8U A;  1D1B A;  2IXO A;  2FUP A;  5JRC A;  3UUM A;  5LHH B;  3I9Y A;  4JBW F;  2NW8 A;  1RKC A;  3K1S A;  2KNH A;  5AQV B;  5L2L A;  1QKR A;  5LNK A;  3Q7L A;  5LHI B;  2IBF A;  4MS2 A;  5C3J A;  3O1J A;  4KHP T;  2CGE A;  5BQG A;  3P50 A;  1T6Q A;  2M6B A;  4P6I C;  4ZLD A;  2C04 A;  1RXQ A;  3OEO A;  4JCZ A;  3DJB A;  5DVW A;  4DV4 T;  2DCF A;  3E22 E;  3L8R A;  5AQK B;  4L5G A;  1YZA A;  4G7O F;  4CS8 A;  5JDG A;  3EDU A;  4LAC B;  1A7V A;  4HWH A;  2KC3 A;  4YFS A;  3RQU A;  1S7Z A;  5L3C B;  2OU6 A;  3B71 A;  5TJ5 E;  4K0K T;  2H88 A;  5F5W A;  1XMQ T;  4ZI3 C;  4XEV A;  3FZL B;  4UXN B;  3L39 A;  2ZD9 A;  3GM1 A;  3AAE B;  2AWC A;  2RSE B;  4IE5 A;  3DAG A;  2HV6 A;  3GN5 B;  2XPK A;  4XPW A;  2XS8 A;  5B1A C;  2J9U A;  4NC3 A;  2ZXO A;  2Q4F A;  4YK5 A;  5ABH A;  4U9D A;  3WOD F;  3JCF A;  3FDQ A;  1T9K A;  2CE7 A;  3L0I A;  3ZTM A;  1Q0F A;  1OR2 A;  1V4A A;  4CDV A;  3A7M A;  3B5M A;  4CZZ B;  3KV4 A;  2FAP B;  2NPU A;  3WG7 C;  4N6H A;  4RD9 A;  4WW0 A;  2AWY A;  3TJ6 A;  3BQK A;  1IBK T;  4E7S A;  2UXC T;  3NWI A;  1XDO A;  2VC9 A;  2CWO A;  3GAN A;  5KYY B;  5IYZ E;  4AX2 A;  1NG1 A;  5F28 E;  4PJL A;  4BPM A;  4AL0 A;  4UEM A;  2VWA A;  1L3P A;  4ILU A;  2V3C C;  4ADZ A;  4CSA A;  2N9D A;  2J46 A;  4LDQ A;  4N6C A;  3TLS A;  2HZ8 A;  4AL1 A;  2VKJ A;  1YJG A;  3ZCI A;  4HGA A;  4K7B A;  2UU9 T;  1OCC C;  1Z63 A;  5F8P A;  2DI4 A;  5JDM A;  1JNR A;  3PHF 2;  4YTN A;  3UU6 A;  4QI0 A;  5EGY A;  4E7Z A;  2EHO D;  1WCR A;  4NTA A;  3DZA A;  1NU9 C;  4U5C E;  4C91 A;  1HF8 A;  2LHR A;  1IAP A;  3UGP A;  3N2Z B;  4J30 B;  2ZXW C;  1HX8 A;  3DD7 A;  3NDB B;  2JD3 A;  1YW0 A;  1O3X A;  2YKZ A;  4JEH B;  4Z9J A;  3W8I A;  4PR9 A;  3EZH A;  5E3A A;  2BS4 A;  4JTC B;  3ZMV B;  3VRC A;  2MWQ A;  1MIV A;  1N33 T;  2BKO A;  4HEA J;  2IXP A;  4EIY A;  2HSQ A;  3EFO B;  1XZQ A;  3CX6 B;  3ZT6 A;  4YL1 A;  2V5D A;  4BJ5 A;  3RYH E;  2XL6 A;  3AQC A;  3LEO A;  4BAY B;  2WM9 A;  4FWV A;  3QK6 A;  3JRT A;  1JPJ A;  1EZ3 A;  2CRB A;  4JJG A;  1T6I A;  4MW8 A;  2CNW A;  2IIU A;  4AK9 A;  1IZN B;  2JQ9 A;  2E9X A;  4HEA A;  3FZK B;  4ULV A;  2H7V C;  3ZVR A;  2CM0 A;  4O4L E;  2KMF A;  3AB3 B;  2VL0 A;  3CML A;  1I5N A;  3QC9 A;  1XWJ A;  1MMD A;  2G62 A;  3MYF A;  3ZMS B;  2CXF A;  3RC8 A;  1IZM A;  4QX7 B;  1UGO A;  3RQG A;  2L6F A;  3R6N A;  3IQT A;  4LMJ A;  1J5W A;  3I4U A;  3RI5 A;  4X1K E;  3N9Q A;  1ORJ A;  3JCU Q;  1EA8 A;  1OW6 A;  2CW0 F;  4U5B E;  4P0A A;  2XM4 A;  2YLG A;  1FJG T;  3B29 A;  4OFZ A;  3OYX A;  1K05 A;  4P09 A;  4QH1 A;  3EUH A;  4HTE A;  3UTK A;  5DLJ A;  2KT9 A;  3LK2 B;  5HWX A;  1OXK A;  3L8J A;  3SXY A;  4U33 A;  4TZ4 C;  2X0H A;  2J9V A;  3RLF F;  4CI3 B;  1PCX A;  1E7P A;  3ZTZ A;  2VUR A;  4CS7 A;  256B A;  4HFK B;  3POV A;  3FAJ A;  4CN1 A;  2L8K A;  2CBI A;  4ZZC A;  3D0T A;  3PU3 A;  2WDQ A;  5LGU B;  4OIP F;  3NZP A;  3ZYK A;  5L0G A;  2XUE A;  2W9Y A;  4LLC A;  3NG1 A;  5FL0 A;  4DRJ B;  5FZT A;  1QZX A;  4YWQ A;  4QKN A;  2FJA A;  1YZC A;  5JVD E;  3AA1 B;  3KV6 A;  4ONS A;  4C7O B;  4IDP A;  1G5Z A;  1US7 B;  3G06 A;  2W0G A;  5ETW A;  2DHR A;  2DWG A;  4B3R T;  3SRZ A;  2R03 A;  2KSF A;  4HE8 D;  5HV9 A;  2YDR A;  1WAT A;  3MLG A;  5BQI A;  3X1O A;  3HNK A;  4D4X A;  3K3Q C;  5HEO A;  5FKY A;  4EOZ B;  3FOP A;  3T6G B;  1D1C A;  2NUP B;  3H37 A;  2WVQ A;  2NTX A;  3AGU A;  3AE7 A;  4KBM B;  4DVD A;  1HMO A;  2R7O A;  3AE2 A;  4M1P A;  4DBR A;  2XAG B;  2YU2 A;  2CHN A;  4DV2 T;  2ZM0 A;  2NOX A;  1UFB A;  2M4E A;  4DXW A;  4U31 A;  5DAB A;  1HE9 A;  3RYC E;  1HX1 B;  1A41 A;  2Y3D A;  4BEM J;  3ASO C;  3NYL A;  5H6R B;  4DV0 T;  2WMO A;  5A69 A;  3KV9 A;  3ZC1 A;  2QGS A;  3SOL A;  2E87 A;  5FY1 A;  3DMD A;  3EAB A;  2LKG A;  3AXJ A;  4K1O A;  4Z9H A;  3TLT A;  4JZA A;  2JRK A;  3P4S A;  2V6Y B;  3X2Q C;  2NUT B;  1NEK A;  2YIN A;  1FFH A;  1H7I A;  3B0V C;  3EPV A;  3TOL A;  5HYA A;  2YL3 A;  3QVZ A;  4L6R A;  1J8M F;  2GK9 A;  1U5P A;  3AVR A;  4IIJ E;  2EHO B;  2QRX A;  4BJ6 A;  1WYC A;  1EKY A;  4YT4 A;  2OOC A;  2XAQ B;  4UEL A;  1EI7 A;  3ZMZ B;  3V7O A;  3NRX A;  2AP3 A;  3LBX B;  3L34 A;  2XL8 A;  3K8P C;  2I6H A;  1SHZ C;  4NUU A;  1WR6 A;  3OVU A;  3U8V A;  5KDM C;  3P8C D;  3O1H A;  3PUY F;  2XS1 A;  3KYI A;  3K6B A;  1M7K A;  4Z91 A;  3R84 B;  3C64 A;  3OWT A;  4YJW A;  4KNV A;  2Y8D A;  2W62 A;  3DP7 A;  3LSV A;  1NSG B;  3RVY A;  4XZC A;  4PW8 A;  1T6U A;  4LF4 T;  5KXJ A;  1EQ1 A;  4DO0 A;  3C18 A;  5AQL B;  2DL1 A;  5LB7 B;  5DQT A;  2HMQ A;  4Z8X A;  4EGW A;  5AQM B;  4JC7 A;  1WTY A;  1L0V A;  4JKV A;  4XEK A;  1QQ3 A;  4MVS A;  1LS1 A;  3GEI A;  2G3V A;  4DV6 T;  4MW3 A;  3WI3 A;  3S27 A;  2UXB T;  2A1D D;  3KKB A;  4MQ9 F;  3V5Z A;  3ZMT B;  4QWN B;  5K0I A;  2NW9 A;  3H3A A;  3P7I A;  5JH7 E;  4O2A E;  4AQF C;  2CCY A;  2A2F X;  4TV9 E;  2OQM A;  4OD5 A;  4GK5 E;  3ZSS A;  2BBH A;  4YN0 B;  4U5G A;  1HNZ T;  3ASN C;  4JW1 A;  1UCU A;  3TLV A;  3RQF A;  4E18 A;  3GWN A;  3RIA A;  2JMK A;  2M6I A;  3OJA A;  4YHH T;  1ZU5 A;  4AI6 A;  4ISS A;  4UR9 A;  4BJ6 C;  3HKK A;  1JPN A;  2LFD A;  1L7C A;  4AE4 A;  1X9B A;  2L9Q A;  4TN7 B;  1UK5 A;  3P4R A;  4X1Y E;  1WOL A;  4LF6 T;  5LGN B;  2P0N A;  4IAR A;  2IHR 1;  3LLI A;  1QLE C;  4EYY R;  2DYR C;  4KMC A;  5HXC A;  1ZHW A;  4HWI B;  4LF8 T;  4ZHQ E;  4JEU B;  4LDK A;  4U5E E;  1FFT C;  1VYK A;  4JTA B;  1G4W R;  2VKO A;  4EZH A;  4ILC A;  1IBL T;  4XTK A;  2WQY A;  2BVL A;  4FJO A;  3FZH B;  1RKE A;  2YL0 A;  2NSF A;  3E70 C;  1NZE A;  4A56 A;  5L4E A;  3NYM A;  1BR2 A;  3P4Q A;  5CIV A;  3N9L A;  3HLZ A;  2OKU A;  2XM1 A;  2Y3H A;  3PMR A;  2W61 A;  4AQF A;  5FMN A;  5FVL A;  1NFN A;  2V7L A;  2YN6 A;  3PDY A;  4BA9 A;  3B0P A;  2UUC T;  3RC3 A;  1YKH B;  4AKL A;  4AQY T;  2R7W A;  5ABF A;  4E0H A;  3B0U X;  1NU7 D;  2WSS V; 
#chains in the Genus database with same CATH homology
 2KNH A;  2Q9Q B;  4PJM A;  4ZS3 A;  4MHC A;  3C4Z A;  2LM9 A;  1T98 A;  1WYB A;  1ZV4 X;  5FXX A;  2A68 F;  3LJB A;  5L2L A;  3PUG A;  3EZI A;  3RX6 A;  5LNK A;  3Q7L A;  1WRD A;  3IHR A;  5LHI B;  3PUS A;  1KU2 A;  3O1J A;  1ZHZ A;  4IE6 A;  1BR0 A;  2G3K A;  5JQG E;  1LKX A;  3FHD A;  4JVS A;  2CGE A;  3GA8 A;  1KNZ A;  3AG4 C;  3HJC A;  1TWC A;  4P6I C;  4ZOL E;  4ZLD A;  1Z23 A;  2C04 A;  1O5H A;  4ULW A;  3RKO F;  2LOS A;  3ANW B;  2ODU A;  5ADX L;  3OEO A;  4EXT A;  3DJB A;  5EK3 A;  2FFH A;  5DVW A;  2DCF A;  3E22 E;  2Z6E A;  4L5G A;  2D2S A;  4X1I E;  2HPL A;  4PFO A;  5JDG A;  1LVF A;  3EDU A;  4J2C A;  2EIN C;  1MIY A;  2E8I A;  2XAS B;  3HKD E;  4B6X A;  3KMI A;  4LAC B;  3GWH A;  3SS1 A;  2YEV C;  1D0X A;  2KGO A;  2A72 A;  4YFS A;  3W15 B;  4CXY A;  3K3O A;  3AAA B;  2LHN A;  1ZHC A;  5L3C B;  1S7Z A;  3NKD A;  2K5B B;  4CBE A;  2ES0 A;  1D0Y A;  2ZXR A;  5L3D B;  4GOU A;  3ZPO A;  5CA1 E;  3UMK A;  3AQB A;  4ZI3 C;  4Q7C A;  4DOZ A;  3HI2 A;  2WBL A;  4O2B E;  4UXN B;  5KYW A;  5F5H A;  5KYN A;  3AAE B;  3ZN0 B;  1ZYR F;  2PX0 A;  2R7S A;  5DJQ C;  4IE5 A;  3DAG A;  3N5L A;  3ZC0 A;  2HV6 A;  2PF4 E;  3GN5 B;  5KYX B;  2VKD A;  3RYL A;  1FEW A;  5B1A C;  2QA7 A;  4AXP A;  1HS7 A;  2BZB A;  1NWM X;  3N2K E;  2J9U A;  3ITF A;  2ZXO A;  4GK0 E;  5CI9 A;  1VRB A;  5LP6 E;  3WOD F;  3DJU B;  2KWI B;  3FDQ A;  2CE7 A;  2FGY A;  1D0Z A;  5E0O A;  3L0I A;  2K9A A;  3MKD A;  3ZCJ A;  3W2W A;  4MFR A;  2KZ7 B;  3J7Y q;  3PU8 A;  5HSW A;  3J9X 1;  3ZEF B;  4H9O C;  4CZZ B;  3KV4 A;  4PNI A;  3DM5 A;  5F3J A;  2NG1 A;  3ZG1 A;  4G7H F;  3NYJ A;  3WG7 C;  2V7K A;  1UX4 A;  4BJM A;  3AG1 C;  4RD9 A;  4WW0 A;  3BQK A;  1X79 A;  5DQV A;  2L3L A;  3CX7 B;  4JUR I;  3LEV A;  4E7S A;  2IOQ A;  5KYW B;  4KI2 A;  4F4B A;  5DS6 A;  1Z6A A;  1BR4 A;  3CQZ A;  2CWO A;  2V1D B;  3GAN A;  1S94 A;  1VMA A;  2YHS A;  5KYY B;  3NRY A;  3LBX A;  2B0J A;  3EH2 A;  3PTR B;  4FI5 A;  5IYZ E;  2CDQ A;  4LLE A;  4AX2 A;  1NG1 A;  5LGT B;  2W4B A;  4PJL A;  2J7P D;  1ZEE A;  4IDZ A;  4UEM A;  2VWA A;  4IE4 A;  4QX8 B;  4ILU A;  2V3C C;  4ADZ A;  3KBT A;  4CSA A;  4G7O F;  2N9D A;  2J46 A;  1PD1 A;  2SPC A;  3ZJ2 A;  2VKH A;  2ZLY A;  2HV7 A;  2VKJ A;  2WZF A;  3ZCI A;  2DWK A;  2JQQ A;  4HGA A;  4U74 A;  3K33 A;  4K7B A;  4I43 B;  5FXW A;  1OCC C;  4RDA A;  3IEE A;  4DMW A;  2X9W A;  4EWC A;  1Z63 A;  5F8P A;  5FXZ A;  2DI4 A;  1ZHX A;  5JDM A;  3PHF 2;  2D0U A;  3CVR A;  3KL4 A;  2B1E A;  3ZLI A;  3MA9 A;  3SNH A;  1ZHT A;  4QI0 A;  4G2A A;  5EGY A;  2IYL D;  4E7Z A;  5IY5 C;  2EHO D;  1UX5 A;  2XAF B;  4XLN F;  3IF8 B;  4I50 E;  3UGO A;  2XAH B;  2LJL A;  5FP3 A;  3DZA A;  2H7O A;  2PJQ A;  3ZIB A;  1NU9 C;  2R7T A;  3V5U A;  2Q9C A;  4U5C E;  4C91 A;  2C03 A;  2XRH A;  4UVA B;  3AA6 B;  2EHO C;  2LSJ A;  1HF8 A;  3CQX C;  2XAJ B;  2LHR A;  4ERR A;  4GEH A;  2N1G A;  5LCY A;  4H9P C;  3LAY A;  3U78 A;  1IAP A;  4JLE A;  2IAK A;  5EK4 A;  5JR9 A;  3UGP A;  5J2T E;  3N2Z B;  3KDS E;  4J30 B;  2ZXW C;  1HX8 A;  3FB2 A;  3I1A A;  3N9N A;  2JD3 A;  3DD7 A;  1YW0 A;  3TD7 A;  4DVY P;  2J1D G;  3NDB B;  4PFP A;  1SF8 A;  1O3X A;  1LRZ A;  4JEH B;  4NUV A;  3VHL A;  4I44 A;  1YD8 G;  3W8I A;  2C0S A;  3EZH A;  2VB6 A;  5E3A A;  1TWG A;  4U5D E;  4O7G A;  3JC6 C;  1QSD A;  1VOM A;  3NZQ A;  3EGD B;  2ACX A;  2J9W A;  3SWH A;  3I5Q A;  3ZMV B;  2X9H A;  2MWQ A;  5JR9 C;  5TAO A;  1MIV A;  3NKE A;  3CQC B;  3CPZ A;  4TV8 E;  2IXP A;  4BJN A;  2NTY A;  4HEA J;  4OYK A;  3F57 A;  3AA7 B;  1U4Q A;  3EFO B;  3N2G E;  2EHO A;  3CX6 B;  4F6R C;  2IXM A;  2Y69 C;  1D1A A;  3EG9 A;  4CQI A;  3VU7 H;  2C5J A;  3RYH E;  2GFH A;  3AQC A;  4BJ5 A;  4BAY B;  1IW7 F;  3I9W A;  1ZKE A;  2WM9 A;  4FWV A;  3QK6 A;  4HFV A;  4EAH A;  3JRT A;  4H9S E;  1JPJ A;  3ABL C;  3UMH A;  4Q5S F;  1EZ3 A;  4JJG A;  2Y39 A;  4O4J E;  3LK4 2;  4IE7 A;  4OD4 A;  2Y6X A;  2CNW A;  3MZK B;  4PK6 A;  4AK9 A;  2R7U A;  1IZN B;  4CIH A;  2LSI A;  5KYX A;  2IW5 B;  2E9X A;  1PD0 A;  3EHM A;  3KBU A;  4HEA A;  3ETV A;  3T8O A;  1MNE A;  2YZS A;  2H7V C;  4UF0 B;  3RRC A;  5LJM A;  3HKB E;  3PUQ A;  2ZXP A;  3ZVR A;  2CM0 A;  2HH7 A;  2ZMA A;  2E9X B;  3K3N A;  4O4H E;  4EZ4 A;  2CCQ A;  3CWZ B;  4MLK A;  4IGU A;  4O4L E;  4UV8 B;  2J7P A;  3K7D A;  3Q7G A;  4WJ0 A;  2J0W A;  2R7V A;  4UVB B;  3N9M A;  2CLY B;  4GYR A;  2KMF A;  3AB3 B;  2OCC C;  3CML A;  2JMH A;  3QC9 A;  1MMD A;  2G0U A;  4GYT A;  2H3R A;  2W00 A;  1OXZ A;  1Z0P A;  3ZMS B;  4AQG A;  4L9I A;  2G62 A;  2R7Q A;  4HN9 A;  2CXF A;  2MYS A;  4U5H A;  3RC8 A;  3EFO A;  4RBN A;  1IZM A;  4QX7 B;  2WWU A;  4H9R C;  3EGX A;  3R6N A;  5L3B B;  4CI2 B;  5DQZ A;  1N1C A;  2PX3 A;  4EYU A;  2Y3G A;  3I4U A;  2IC9 A;  3N9Q A;  4X1K E;  4A2N B;  2CXD A;  3JCU Q;  2UXX B;  4TUY E;  4C7O A;  2CW0 F;  2K24 A;  4N78 D;  5DQW A;  1SA0 E;  5JDN A;  4P0A A;  2Y48 B;  2EIL C;  3O6X A;  4U5B E;  4EBB A;  4OFZ A;  3L3P A;  3UUX B;  5EK2 A;  2LSK A;  2M67 A;  3OYX A;  4H9Q C;  5FYM A;  5JR9 B;  1TKN A;  4H4K C;  2KXP B;  3C98 B;  1M2V A;  3JC6 D;  4P09 A;  1OCZ C;  3Q5W A;  3BK9 A;  3ECS A;  4I4T E;  2Q9A A;  1MND A;  1OWA A;  2RP4 A;  3EUH A;  2UXN B;  4P0B A;  1V9D A;  3HKE E;  1KK7 A;  2BDE A;  4HTE A;  4KBL A;  3AA0 B;  3BQL A;  3TKL B;  3UTK A;  5DLJ A;  2DNX A;  2KT9 A;  3LK2 B;  5HWX A;  5L3F B;  5EHH A;  3WAK A;  4OHF A;  4IWB A;  4JUY A;  4YT8 A;  2NWB A;  3MAC A;  3UUN A;  5CI8 A;  3UT5 E;  4TZ4 C;  4N06 A;  3U3I A;  4IRU A;  1FMV A;  4QXB B;  5T1D B;  5L3V A;  2Q9Q D;  1PCX A;  4GYS A;  2LSY A;  4QXC B;  4CI3 B;  5KX5 E;  2D5R B;  2EIJ C;  4DBQ A;  5LXT E;  3AAI A;  4CS7 A;  2YK0 A;  4QXH B;  3GOD A;  1TR2 A;  1M2O A;  5JRE A;  2E9X C;  3B57 A;  3AG3 C;  4HFK B;  2CEA A;  3SYN A;  3MJX A;  3POV A;  3M65 A;  2PFD A;  3FAJ A;  2L8K A;  2VAS A;  4EB6 E;  4MND A;  4BJT A;  1FTS A;  1MMG A;  2X51 A;  4C3D A;  5KYY A;  2C5I T;  4AKH A;  3X2Q C;  4ZS2 A;  3QZC A;  3HKC E;  2XXA B;  4I3M A;  3D0T A;  3LK3 B;  3PU3 A;  4AE4 B;  3K66 A;  2WL8 A;  3F2E A;  5LGU B;  3B13 A;  5EZY E;  1BR1 A;  4BJ5 C;  1CUN A;  4TX5 A;  4OIP F;  2YEV A;  2KLQ A;  3N2O A;  3DXJ F;  2LSG A;  3NZP A;  5D92 A;  1O87 A;  3PUR A;  3ZYK A;  1M2V B;  3I0O A;  4ZI2 D;  4GIW A;  2VK9 A;  3CQG B;  4CXX A;  2XUE A;  5JDQ A;  2W9Y A;  4LLC A;  2A69 F;  3ABK C;  5F5F A;  3NG1 A;  5BUO A;  3Q6M A;  1MMN A;  3K1I C;  2EIK C;  2EIM C;  1QZX A;  1IJ6 A;  2D5U A;  2PG8 A;  3KVA A;  4QKN A;  4YWQ A;  4WNK A;  2R7R A;  5JVD E;  5L3G B;  3O4X E;  3AA1 B;  5IHY A;  3KV6 A;  4AKR B;  3S29 A;  4C7O B;  3T6J A;  1US7 B;  5L3E B;  2W0G A;  5ETW A;  2DHR A;  1ZU4 A;  2I8B A;  2DWG A;  2PBI A;  2VL8 A;  3SRZ A;  3I0Q A;  4OIN F;  3S0X A;  3DTO A;  4HE8 D;  2OA5 A;  3DAF A;  4J32 B;  1HG2 A;  2A6H F;  1Z5Z A;  5L3Q A;  1IJ5 A;  3MXZ A;  3MLG A;  5FCL A;  2D0T A;  3I5P A;  3FHN A;  5JDF A;  3X1O A;  1H7C A;  3K3Q C;  2X9Y A;  4YJ2 E;  1FMW A;  3ETU A;  4UF0 A;  2X67 A;  1Y64 B;  4PAG A;  4EOZ B;  1RJ9 A;  2P7V A;  3CSK A;  1D1C A;  2NUP B;  5KMG P;  3H37 A;  4V1A v;  4OYJ A;  2OG2 A;  2ZM2 A;  2NTX A;  2WVQ A;  3O9X A;  2BE5 F;  3DM9 B;  2W63 A;  4YT2 A;  4KBM B;  2NUP A;  1WGW A;  4DVD A;  4G7Z F;  4FX5 A;  2CWY A;  1OKK A;  2J0X A;  2R7O A;  2DGJ A;  3LJC A;  4OIR F;  4W8K A;  4M1P A;  2R7X A;  4DBR A;  2E9X D;  3LLK A;  3M1C B;  1B7T A;  2XAG B;  2YU2 A;  2X0L B;  3VAY A;  2ZM0 A;  2NOX A;  2CNW D;  2M4E A;  4C3E A;  3RPU A;  3B0U X;  5HWY A;  3F31 A;  4YHJ A;  3K1H A;  1NAF A;  4CSA C;  5DAB A;  3RYC E;  4XBF B;  2Y3D A;  2ZPA A;  3UR3 C;  4UV9 B;  3ASO C;  3E0Z A;  2JJ9 A;  4AKG A;  4UVC B;  5LHG B;  2WZG A;  3NYL A;  4YJ3 E;  2KIN B;  3EHN A;  2XHE B;  5H6R B;  3B0V C;  4YLH A;  5E3C A;  2WMO A;  4PJN A;  3KV9 A;  3ZC1 A;  2XSE A;  2QGS A;  3SOL A;  5C8Y E;  2E87 A;  1W2W A;  5FY1 A;  3BQI A;  3DMD A;  2LOP A;  3MK7 C;  2L81 A;  5H6Q B;  4H63 V;  5HAX A;  5E2Q A;  5KYU A;  4EIW A;  3ANW A;  2WVO A;  2JRK A;  4MBQ A;  4JZA A;  4QDL A;  2NUT B;  1RJ9 B;  2V26 A;  2YIN A;  1FFH A;  1VK5 A;  1HG5 A;  4X20 E;  2Q3T A;  2PFV A;  3N9P A;  2LE8 A;  5A1L A;  2PP4 A;  3EPV A;  1OCO C;  4WBO A;  5HYA A;  3EVY A;  3CKD A;  3VKG A;  3KVB A;  3ZSU A;  1J8M F;  2GK9 A;  1U5P A;  3PUA A;  4O6M A;  3AVR A;  4IIJ E;  2XL4 A;  2EHO B;  3F46 A;  3W8H A;  5HXH A;  3ZJ1 A;  3ZMU B;  4BJ6 A;  1WYC A;  4K0D A;  5B1B C;  4I55 E;  4YT4 A;  2XAQ B;  3QUJ A;  4O8S A;  1OKK D;  2DYS C;  2KWH A;  3RRW A;  4UIG A;  4DVZ A;  4CS8 A;  4UEL A;  3PE0 A;  1OCR C;  3C4X A;  3ZC4 A;  5B3S C;  2V7J A;  3Q2M A;  3ZMZ B;  3ZYM A;  1G8X A;  4JCH A;  3V7O A;  3NRX A;  4L0R A;  4H9N C;  4HKA A;  4MAL A;  1YKE B;  3LBX B;  3L34 A;  1HFA A;  3CZ6 A;  3B9Q A;  3K8P C;  2JPF A;  3EJN A;  3FVY A;  4LER A;  1SHZ C;  4NUU A;  2W45 A;  1WR6 A;  4IHJ E;  3VYW A;  5KDM C;  2NUT A;  3UMI A;  3P8C D;  3O1H A;  4IST A;  3LFM A;  2KJG A;  4OIQ F;  3SP1 A;  3K6B A;  2A3D A;  3R84 B;  3JT1 A;  3NBX X;  3C64 A;  2NW7 A;  3JYH A;  4AKI A;  3OWT A;  4YJW A;  2XQY A;  4KNV A;  2N2N A;  3RYI E;  1SMY F;  1SZI A;  2Y8D A;  2J9V A;  2W62 A;  3DP7 A;  3Q5X A;  4PK5 A;  3H65 A;  3RFY A;  4CS9 C;  2CLY C;  2X9X A;  4PJJ A;  2ODV A;  5GON E;  3UUL A;  5JRC B;  5HXE A;  1WLX A;  3RIP A;  4XZC A;  2WZL A;  5CB4 E;  4PW8 A;  4O6Y A;  2P9B A;  5LA6 E;  4CS8 C;  3C4W A;  2BVM A;  3ONX A;  5LYJ E;  5LBQ B;  4DO0 A;  4KNW A;  3VKH A;  4ASK A;  3L09 A;  3LNR A;  5FY0 A;  3ZYL A;  4OIO F;  5DQT A;  5FXV A;  5FY7 A;  3SEO A;  1V54 C;  2V7I A;  2MTQ A;  4Z8X A;  3HR0 A;  2LEH A;  3LES A;  2CA5 A;  5KYU B;  4C3B A;  1LS1 A;  4KC9 A;  3T6B A;  2G3V A;  5LJN A;  4PK4 A;  3UNG C;  2LT3 A;  5JDL A;  5AFU L;  3WI3 A;  4C90 A;  3C50 A;  1J8Y F;  2HPJ A;  2WAU A;  3S27 A;  3ESL A;  3JSZ A;  4U72 A;  1QUU A;  2A1D D;  4IAO A;  5DS5 A;  3KKB A;  5BMV E;  4MQ9 F;  3ZMT B;  2WMN A;  3RKO A;  1MMA A;  3S28 A;  4KP3 C;  2KQ9 A;  4QWN B;  4B6I A;  2J45 A;  2X68 A;  3HTK C;  2NW9 A;  4CS9 A;  4I1O B;  3H3A A;  3P7I A;  2XTL A;  3N9O A;  3LS0 A;  5JH7 E;  3CX8 B;  3KV5 A;  1S35 A;  1V55 C;  1TWH A;  4O2A E;  2W4M A;  4AQF C;  3LS1 A;  2A2F X;  4TV9 E;  3RYF E;  5HXR A;  4GK5 E;  3EQL F;  4OD5 A;  2I59 A;  4NY3 A;  4BEJ A;  4YN0 B;  5DS4 A;  4U5G A;  3RH3 A;  2IXN A;  3ASN C;  3AG2 C;  4JW1 A;  3GN5 A;  4OK0 A;  1UCU A;  2V7M A;  2QY9 A;  3W2V A;  3KFW X;  3N24 A;  3WAJ A;  2LSE A;  2VH3 A;  1G73 A;  3OKQ A;  4JJF A;  5D91 A;  3T4R A;  3DJN B;  3QMK A;  4DMV A;  4G0H A;  2JMK A;  4HE8 A;  5M4Y A;  3OJA A;  2Y3B A;  1ZU5 A;  3O39 A;  3Q6N A;  4AI6 A;  4ISS A;  2Q9Q A;  3GMI A;  2A6E F;  4HFF B;  3SZR A;  3LG7 A;  4BJ6 C;  2YU1 A;  5JDH A;  1M56 C;  2RA1 A;  3NRH A;  4G63 A;  1JPN A;  5LOV E;  4Q4Z F;  2C5K T;  3IBP A;  2Q9B A;  4KUM B;  4AE4 A;  1LVK A;  2L9Q A;  4TN7 B;  4X1Y E;  1TWA A;  2KND A;  2L9J A;  2WVN A;  4YT5 A;  3S4U A;  5LGN B;  3MX3 A;  4K0U A;  1Z3I X;  2WB7 A;  4DND A;  5FNV E;  3HL6 A;  3EGD A;  3LLI A;  1VYI A;  2MOZ A;  1ST6 A;  1QLE C;  3O1I A;  4ZI7 E;  4EYY R;  4O6N A;  2DYR C;  3OYZ A;  3AVS A;  3OBV E;  4KMC A;  5HXC A;  1ZHW A;  4QI2 A;  4ZHQ E;  4U5E E;  4JEU B;  1ZHY A;  1HTJ F;  5T3W A;  3E9V A;  3N0T A;  5HXS A;  3EG9 B;  4XWJ A;  1FFT C;  2CMR A;  2QTV A;  1VYK A;  2H7B A;  3E08 A;  1HCI A;  2NP9 A;  2VKO A;  3C51 A;  4EZH A;  5J1G A;  2Q9Q C;  4IJJ A;  5LG4 A;  4XTK A;  4H63 H;  2DLR A;  2BVL A;  3FXD B;  4FJO A;  3V5S A;  3ZN1 B;  4ZI3 D;  2MBG A;  1MIW A;  2IC6 A;  2K48 A;  3FBZ A;  2O9X A;  5T3T A;  5E33 A;  4XLP F;  3F47 A;  4O4I E;  3E70 C;  2XXA A;  2CXL A;  3EDV A;  1NZE A;  4A56 A;  2P6V A;  3NYM A;  3ABM C;  2Z15 A;  1BR2 A;  4O79 A;  4ZLC A;  3FBL A;  3KIN B;  3EH1 A;  4ANJ A;  3N9L A;  3HLZ A;  4U5F E;  4IE0 A;  4X0R A;  5LBM A;  4CI1 B;  4M63 A;  3HA4 A;  2Y3H A;  3PMR A;  1FIO A;  2W61 A;  4CXW A;  5J2U E;  4AQF A;  1E1H B;  4QHO A;  3OA1 A;  3FXE B;  4XAX B;  5FMN A;  5CA0 E;  1D1B A;  3Q9D A;  3UFE A;  2IXO A;  4FES A;  2V7L A;  4WBN E;  3PDY A;  4BA9 A;  5JRC A;  4BJ1 A;  3B0P A;  3UUM A;  4ZI2 C;  3A5X A;  3RC3 A;  2X66 A;  3EGX B;  1YKH B;  4AKL A;  5LHH B;  2ZM8 A;  3I9Y A;  2KW3 C;  1M57 C;  2R7W A;  2NW8 A;  1AJ3 A;  3KH2 A;  4I1M A;  1NU7 D;  4BG0 A;  2WSS V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...