3IEEA

Crystal structure of an alpha helical protein (bf3319) from bacteroides fragilis nctc 9343 at 1.70 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
256
structure length
256
Chain Sequence
VSTADIENAAEVIKYYNTSLGVLKDMVKEKDVNAVLDYMEQKGKTPALSAIVPPAVVSKDSAIVLNPGNCFNEETRRNLKQNYTGLFQARTEFYANFDTYLSYLKKKDVTNAKKLLDVNYQLSTQMSEYKQNIFDILSPFTEQAELVLLVDNPLKAQIMSVRKMSSTMQSILNLYARKHRMDGPRIDLKVAELTKQLDAAKKLPVVNGHEGEMKSYQAFLSQVETFIKQVKKVREKGEYSDADYDMLTSAFETSII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative exported protein
publication title Crystal structure of hypothetical protein BF3319 from Bacteroides fragilis (YP_212931.1) from Bacteroides fragilis NCTC 9343 at 1.70 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Structural genomics, unknown function
total genus 104
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ieeA02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ieeA01
3IEEA 4YJWA 3RH3A
chains in the Genus database with same CATH superfamily
4A4AA 2A72A 1RKCA 1ZHCA 1D1AA 1WTYA 2QRXA 2VVNA 3F2EA 1NENA 4JEAA 1WATA 2LKGA 4HWHA 2TMVP 2DNXA 4Z91A 2XS1A 3ZC4A 1QVXA 3L8JA 1TFOB 3OWTA 4X1KE 2LSEA 5DQWA 4XPYA 4TWFA 2J0XA 2D0UA 2Q9QA 4TV8E 4FESA 3LUTB 2Z15A 3UGPA 4ASKA 1MQVA 4OYJA 1HG2A 2DI3A 1GGQA 5AC5A 1FNTc 2WZIA 3MKDA 3RQGA 2Y39A 1IJ5A 3U8VA 4LF7T 4IDOA 3DE8A 3ITFA 3AEAA 1IW7F 4AL0A 1NLXA 5JVEA 1TWAA 5KYWB 4UVBB 2IDOB 1SE7A 3Q5XA 4DR7T 4K1OA 1OR3A 1WFDA 3AAEB 3I5QA 4MW8A 3MA9A 4JI3T 1QLBA 5B3IA 3C8ZA 3RYLA 5H6QB 2A0BA 5L0HA 3B9QA 2Y8DA 1OXKA 2PF4E 4YFSA 1BZ4A 4RD9A 3ABVA 5HEJA 4CS9C 4XPWA 4N6CA 1M2VB 2NUPB 5L3QA 3V5ZA 5AQVB 2V7KA 1OCRC 3O4XE 4G2AA 1Y4CA 3JAEA 2EILC 3N0TA 1DU2A 3ASNC 2HHHT 5HXCA 1YQ4A 1RKEA 3Q5DA 1Z8UA 3N9PA 4B3ST 1IZNB 2EHOB 2IW5B 4NXMT 3PCVA 4L5GA 4EZ4A 1CUNA 3AQBA 4DIDB 2AU5A 3JSEO 5AQHB 1SYQA 2XQ7A 2K3WA 2DI4A 4YJWA 2PBEA 1VLTA 4P1NA 2HPLA 2D0TA 1HX1B 1FTSA 2BVLA 4IE7A 3FDQA 2ODVA 2IYLD 2I59A 4O6YA 2HH7A 5KYUA 1ZVZA 3S29A 3ZQYA 4DVYP 3VHLA 4QX7B 1AVOB 2DYSC 1LE2A 2EINC 5ABFA 5COFA 2L7AA 4A97A 3LEOA 3AA0B 3Q9DA 2XS8A 2J1DG 4Q7CA 4EKWA 3P4PA 4ISTA 4X20E 1R5ID 5JDFA 4BEMJ 4C3BA 4CJGA 2QLAA 5A69A 4A56A 2YHSA 1DOWA 4WW0A 2IMLA 3FXEB 4JI8T 5FXXA 1ZYRF 4NTAA 1E84A 1OR2A 2HN2A 2IM8A 2A3DA 1Q0GA 2PJQA 4DR4T 4EAHA 3GM3A 1OQCA 4XQ1A 3ZVRA 1OCZC 4JI1T 5DVWA 2LOSA 1D0ZA 3RC8A 1ZOYA 2PG8A 1K04A 2L6FA 3B0UX 4XBFB 2WVNA 3A5XA 1EI7A 2YZSA 1EQ1A 1JNZA 2CW0F 4R32A 3DM9B 3EJNA 2PFVA 3L3PA 4AK9A 2NW9A 2X67A 5LBMA 2WSSV 3ZTMA 4XEFA 4GQHA 1U89A 3LJBA 1O87A 4KC9A 4JW1A 2LKHA 3H3MA 1H7CA 2A69F 1KNRA 2WB5A 1V55C 1MMAA 4LF6T 2WS3A 2XQ8A 4CN1A 3ZT6A 1SA0E 5EGYA 4YTMA 3TKLB 2V7JA 1I4YA 3DWWA 2IXPA 3RFYA 1BBHA 4EIWA 5IHYA 5BQIA 3O1JA 5KDMC 2YKSA 1IZMA 3KPHA 5T1DB 3VKHA 3CQCB 2LK4A 4MALA 4ER9A 2QGSA 2LFDA 2H89A 2HJ3A 2UXXB 3N9NA 2LIGA 3DJUB 4K7BA 3N2KE 1FFTC 4H9PC 4JURI 2FJAA 4KMCA 3LAYA 3W2WA 3E08A 1TR2A 2VURA 3FZHB 2A9UA 2VQFT 1WWPA 1ZU5A 2CE7A 3NYLA 4IL9A 1YA9A 2WP9A 2L9JA 3UQ7A 3AE7A 2QA7A 2YU2A 2BKPA 1B7TA 2XPKA 3ZN1B 1M7KA 2JQHA 1FR0A 3CQZA 3AXJB 4DR3T 2J46A 1T01A 4D4XA 4ZI3C 3PUQA 4HN9A 2PBIA 1W9RA 1OEDA 2LSJA 3LNRA 4FAPB 1S05A 1WN0A 3S27A 5JLIA 1SMYF 3SXYA 4O4LE 3CVRA 3UT5E 5HEHA 1YA7O 3RF1A 3PDMP 4YT2A 3AA7B 4YHHT 3GMIA 2X51A 3RQUA 3HNJA 1XMQT 1HNZT 3Q2MA 3UU6A 3EGDA 5JH7E 5E0OA 3V5UA 4DV1T 2L6HA 5C2TA 2RPAA 4AE4B 2MYSA 1E85A 5E3AA 3Q7LA 3AG1C 3EG9A 3PDYA 4QHOA 2QNLA 4HWIB 3E70C 3UR3C 1E2AA 2EPKX 2CXDA 1MMDA 5FKYA 5L4HA 4YT0A 4HFKB 3VKGA 5BQHA 3JRTA 3WAJA 1Y6DA 2V6YB 2AVKA 4CSAA 3CQGB 3HNIA 5COMA 1Z0PA 4PNIA 2CXLA 4Q25A 3X1DA 3SFDA 4PFOA 2CPTA 5DABA 1OW7A 4OIRF 3TOLA 2QVAA 5FYMA 2Q9QC 4ILUA 2G3VA 1ZHYA 2GDCA 3AQCA 3E0ZA 3EQLF 2J7PD 3ZMVB 4ANJA 5JRCB 1YQ3A 1NBBA 4HFVA 4I44A 4YT5A 4MVZA 4DRHB 3LNMB 4PJJA 1Z6AA 1NEKA 3SFEA 1UGOA 3RIAA 2H8AA 2VCAA 4AKGA 4BEJA 2JX0A 3U8PA 3KMIA 4KI2A 1LKXA 2YDRA 1AUEA 4N78D 4U5BE 4EHPA 3MX3A 3RQEA 3N9OA 3EZIA 2JMHA 4IAQA 2W9YA 3F31A 2WZFA 1NAFA 4PR9A 2P0NA 3KL4A 4ZLCA 3LEVA 4O6NA 1U4QA 3KINB 4XWJA 2BE5F 4OX9T 2W62A 3NRHA 3LFMA 4IIJE 3RKOA 1ZW2A 5TAOA 3PUYF 4G78A 5HCJA 2CBJA 3GEIA 5IY5C 2D2SA 1APCA 3OJAA 2G3KA 4LF4T 5HXEA 1M57C 2VKDA 4FWVA 3ZSTA 2NR4A 2W61A 4IE5A 4O4HE 3B29A 2EPMX 3P8CD 4P09A 4G7OF 3RQWA 1LI5A 3SNHA 2MOZA 2XTLA 3RRWA 1Q0KA 1LIHA 3RIFA 4O79A 3UTKA 2C0SA 3TLVA 3AAAB 1YARO 4HE8A 4X65T 4JI6T 5C8YE 2IC6A 2X0LB 4EGWA 4CI3B 1QZXA 3TLTA 5HEUA 3SEOA 3ZC1A 5C3JA 1J8YF 2YN6A 3N24A 4GK5E 4IAOA 2I6HA 2WMNA 2VC9A 4P0AA 4XLPF 3OYXA 2UU9T 5L4EA 4QI2A 1XDPA 2E5VA 1F1MA 4NCQA 1HTJF 3UU3A 3ZJ2A 5LYJE 4BJ1A 4JEBA 3EGXB 2AWYA 2YL3A 2NTYA 3RGLA 3N9LA 5FP3A 4M63A 3SS1A 2HMQA 3QMKA 5L2LA 4OD4A 4DBRA 4LDRA 5A1LA 1V74B 5BMVE 1LS1A 5JDLA 4OD5A 3IBPA 3KKBA 2R7RA 3CEXA 4JCHA 1SR2A 4AKIA 4CI1B 2Y3HA 1UURA 1WRDA 2KLQA 4KNWA 3ZQVA 2YL0A 4OIQF 1VTMP 1HF8A 1YD8G 4YWQA 2W45A 2E9XD 5B1AC 4ZI2C 4BJ6C 2V1DB 3KYJA 2P9BA 4ZS2A 2K5BB 2LHRA 2HPJA 3HA4A 2ZM8A 1HR0T 4K0DA 4X0RA 2WM9A 4JTAB 4MVSA 4MHCA 5FZTA 3UFEA 5FY0A 3T1HT 3G06A 2WWUA 3BRJA 3I9WA 4H54A 3IHRA 4AKHA 1CHUA 3CX8B 3FB2A 5AQQB 2UXCT 1KF6A 3PUGA 3OPCA 2HSBA 2VL8A 2HFIA 1NU9C 2PP4A 4KNVA 1PD1A 5T3TA 2XAHB 2XLHA 2L3LA 2ASRA 3L0IA 3LS1A 2N2NA 5HYAA 4AXPA 4QXBB 3A7MA 4FX5A 5KYWA 4KP3C 3EAMA 5LHIB 3LESA 3EH2A 2HKVA 4QDLA 4IDQA 3MXZA 2A6HF 1MNEA 2MWQA 5DQZA 4ZI7E 2L6GA 3ZDLA 2A6EF 2OA5A 5JRAA 1V4AA 1M2VA 2WZHA 1WOLA 4WBOA 3CKDA 1BR4A 2NUPA 4QH5A 2LLYA 3ZSSA 1T5OA 2P6VA 3M3ZB 3T8OA 2LSGA 3W8HA 2OJQA 2ACXA 4MW3A 1QQ3A 3ZKRA 4U9DA 4MVOA 3WI3A 1KU2A 2R9RB 4B6IA 2EHOA 4COFA 3K1IA 3LG7A 5L3EB 3RC3A 1OEDC 2LCHA 4F8HA 4LMJA 2KJGA 5HV9A 4QXHB 2IXNA 1ZZPA 2LSIA 1QSDA 4YL1A 5L0JA 1JOGA 2KK1A 2MAWA 1CGOA 3LDQB 1OXZA 4JCZA 4J32B 4WNKA 2VQET 3AECA 3SXKA 3QZCA 4BJMA 3SZRA 1YXRA 3EHZA 3ZMUB 2V8SV 4U7YA 3GM1A 3Q6NA 4PFPA 4CS8C 5L3GB 4E18A 2FBWA 3K33A 2FJBA 4U31A 2UUCT 2KNHA 2G62A 3JYHA 2JQ9A 2WAUA 2P1AA 3U3FA 5DS4A 5L0IA 4LF8T 1OKKA 1D1BA 3HR0A 4YTPA 4U5EE 4GKKT 1XNRT 1SZIA 2OEVA 5CA0E 2XSBA 2LM2A 4XLNF 3AVSA 2O9XA 3J9X1 4I50E 2ZXPA 3QVYA 4C90A 4U74A 4U72A 4CSAC 3RKGA 3ONXA 3IF8B 3PUVF 3AJMA 3JSZA 1C03A 2L81A 4B3RT 4HFCA 1G73A 3OKQA 2HV6A 1RJ9B 4JTDB 2SPCA 1C02A 1LVFA 2KT9A 5HAXA 4TV9E 1YJGA 3G4ZA 1FMWA 3EUHA 2YK0A 3C8GD 3RW0A 2XQ5A 1D0XA 3Q5WA 4I55E 4I43B 2BC5A 2ZXOA 3GWNA 4UR9A 1B68A 2QY9A 3P50A 4YTNA 2J45A 2XM0A 4TX5A 3L1MA 3FAJA 4IT4A 4B6XA 5EK0A 5L0FA 1T6IA 2XLMA 1T6QA 4KUMB 5CGMA 1S7ZA 1O5HA 4AISA 3NKZA 5ETWA 4MS2A 1JPJA 3MK7C 1VCTA 3M4CA 2DL1A 4DMWA 1ZKEA 3K3NA 2XAJB 3JC6C 1PV3A 2Y3DA 5L47A 2WDQA 3VU7H 3DAGA 4AX2A 2OG2A 4JI2T 3QTHA 2R05A 4JBWF 3SP1A 1LPEA 4GYSA 3ZMTB 5D92A 1ORSC 2XXAB 2WWVA 1Z63A 2GWWA 2KQ9A 3IQ5A 2I8BA 2Y69C 1O3XA 3EFOB 4JIOA 4MTGA 1M62A 2OJED 4YN0B 4EUKB 1T8BA 3TLSA 2K48A 3LSVA 2Y48B 4BJTA 2XLVA 1R8IA 3AXJA 3B5MA 3NZQA 2ODUA 4EEBA 3UUBA 4CXXA 2I15A 2J0WA 4KBLA 3OVUA 4NIQA 2H7VC 2MTQA 4EB6E 5H6RB 3M4BA 5JUAA 3EABA 2PX0A 3QOFA 3KV9A 2NSFA 3PHF2 4X1IE 2EIKC 5L3BB 256BA 2YLIA 1XMOT 2VK9A 2ZMAA 1TWHA 1XWJA 4QKNA 4TWDA 1TQGA 4AE4A 4KX6A 4GKJT 3UMKA 1OCCC 2WZGA 3KV4A 3O55A 4O4IE 2VKJA 1A7EA 4U5HA 3MYFA 3NBXX 4PACA 4G0HA 5JDGA 3AEEA 4MVMA 4IGGA 2D5UA 2P7VA 2NWBA 2V26A 4MLKA 2V5CA 2RD9A 3KV5A 3ZYLA 2WU2A 3FZKB 4PK6A 1W2WA 3KV6A 4N6HA 5FL1A 4HTEA 2V6YA 1YW0A 3N2ZB 3PTRB 5AQGB 2YOEA 4ISSA 2V7LA 3ZYMA 4BA9A 1ZV4X 5JDMA 2WBLA 2CNWD 3UNGC 4BJ6A 2W0GA 4CXYA 5LA6E 4DUYT 1HCIA 2BS4A 4V1Av 1JRAA 5HXHA 2M6IA 4KBMB 3MJXA 4C7OB 3ZMSB 2OEXA 1HY5A 1E86A 2FJEA 5JRCA 1QPUA 1YVIA 4ULVA 5HWXA 2EPOA 2V7MA 3UQ4A 4WGZA 4XPXA 3AE9A 3ANWB 2WZLA 2QYWA 1HE9A 1LS4A 4DXWA 2YEVA 2C04A 2BG9E 3WODF 1VCSA 4X5TA 2ACZA 3AE2A 4I4TE 3OTOT 2A1DD 3H2UA 3U3BA 2ZM6T 2XY8B 4MQ9F 1J1JA 4AKRB 3FZFB 4X62T 1W0AA 3KVAA 1G4US 1KEYA 4JJGA 1NSGB 3AA6B 2YL7A 3GORA 3R7CA 3QB5A 4KI0F 3HJCA 1U6HA 1Y01A 2OQMA 5EK3A 1G5ZA 3P4RA 4DO0A 2XQ6A 2EPLX 3JAFA 4AI6A 5A6BA 3ZYKA 2YWAA 3LLKA 4LF9T 3DE9A 2NOXA 3B57A 5HEGA 3ZWIA 4MVUA 3TULA 5KXJA 3T1YT 4BJ5A 5LHHB 2F4VT 2EHOC 3BEHA 2NTXA 3K1IC 3RYIE 1VLSA 3RH3A 5A6KA 3QW0A 1T6UA 4YK5A 2OKUA 2CWYA 2CA5A 3K8PC 2KWHA 2VASA 5BUOA 2IIUA 4DV5T 2I0MA 2LRLA 3MZKB 3O1IA 2A68F 2WMOA 2ZM0A 3KBTA 3ONJA 5AFUL 2CLYB 4NQFA 4G7ZF 4ILBA 2YQYA 3DZAA 1S35A 3C51A 3ZEFB 1J8MF 2K9AA 4OIOF 2HSQA 4DRIB 2AP3A 4UELA 2MHRA 1ORYA 3RVYA 3EHMA 2GAQA 3VYWA 3AAIA 3K1SA 1M56C 1O3UA 2VWAA 2PNOA 4GIWA 2J8WA 2V6XA 1KNZA 3NYJA 4EZHA 1ZP0A 2FAPB 3ZC0A 4CJOA 4CS8A 2CGEA 3EGXA 4GEHA 2XAFB 5FVKA 1YYXA 2R6GF 1NWMX 3C64A 5DS6A 5BR8T 1OXBA 3US6A 4X66T 2XZEA 4EYYR 4BG0A 5TJ5E 1UX4A 2EPNA 2QE9A 3FXDB 2CXFA 1LRZA 4DUZT 5DQTA 2Q9CA 3OEOA 2AE9A 1NFOA 3BQIA 3PV0F 2CHOA 3GWHA 3AE1A 3FBZA 2B0HA 3S9OA 4HFDA 4EBJA 2XASB 3AE8A 5CI9A 4H9SE 3V5SA 3F47A 4JEUB 5K0IA 3MYIA 1ZHTA 4JVSA 4Z8XA 2YL1A 3GANA 1H6GA 1E2XA 2X9YA 4D4NA 1JPNA 5F3JA 2HMZA 5LP6E 4ZI3D 2VVSA 5FVLA 2NPUA 1H9TA 5FXWA 1N33T 5T3WA 1VYKA 4KHZF 5LJNA 4U5FE 4JJFA 1WR0A 2BG9B 2X66A 2UUBT 4PW8A 2R02A 4G7HF 3M65A 1MNDA 2IC9A 1KTMA 4GYTA 5LXTE 2R03A 3SXZA 2XQ3A 5E33A 1H9GA 3FOOA 3O6XA 1YZCA 4CN4A 2A0UA 2DGJA 4X1YE 4E7ZA 5JR9B 1IBMT 4EBBA 2CM0A 3V5YA 2KXPB 3F57A 5L3VA 3ZCJA 5E2QA 4MVRA 3QUJA 5KMGP 3RQFA 3CX6B 1ZU4A 2Q9BA 1R4TA 2YDQA 2CHNA 1JMWA 3ZPOA 1WYBA 1OWAA 5FCLA 1Z5ZA 2KGOA 4LDQA 4LACB 3OBVE 4IL4A 1JNRA 1Y64B 2WCAA 1IBLT 3H37A 1A41A 1OW6A 3AVRA 2X9WA 3EVYA 3AG2C 2AXDS 2BS3A 1E83A 3O39A 3U0CA 5AQSB 3QK6A 4JI7T 5AQPB 3PUWF 5L3CB 2DYRC 2J47A 2ICWG 1EKYA 1X9BA 1NU7D 4HFEA 1KK7A 1HFAA 3D0TA 3T4RA 2CLYC 4CDYA 5DQVA 2LT3A 2CWOA 3ABKC 3AEGA 4TZ4C 2RSEB 5LJMA 1S94A 1I4ZA 2Q9QD 3C8GB 2XJ7A 2E8IA 1YKHB 2CMRA 3IA3A 4ZHQE 3VR9A 4IRUA 1FAPB 1Q0MA 3PMRA 4I3MA 2VKHA 4XAXB 3UGOA 3NRXA 4U2ZA 3NWIA 2JPUA 5FMNA 4XEKA 3TJ5A 3N5LA 3W15B 3BQKA 4PJNA 2NW8A 4L6RA 5JP7A 1SUMB 3HNLA 3J06A 1ST6A 3UU4A 3EPVA 3PUSA 3GN5B 1GQEA 4JYAT 5KYYA 3RHWA 4LLCA 3PU8A 5AC4A 4IWBA 1H7IA 2ZM2A 1K40A 1LE4A 1IJ6A 2D4UA 1I6ZA 2FJDA 2DHRA 3UMIA 5LOVE 3CZ6A 1CPQA 2LJLA 2YINA 2R7UA 1BDJB 2EIJC 2N9DA 3HKCE 4Q5SF 2VCBA 4IJJA 4DVZA 4IB4A 1LI7A 5FXZA 3U3IA 4DRJB 4IDPA 1YDIA 3ECSA 1HE1A 3HLZA 1RJ9A 1M2OA 2D5RB 4ZEYA 2YEVC 5AQLB 1Q0FA 4ONSA 5ADXL 4W8PA 4MTOA 4L0RA 5KYNA 5GPGB 1GS9A 3B13A 5L3FB 3H2VA 2YU1A 3Q6MA 2DLRA 2Q00A 2D9DA 1I94T 2HZ8A 3P4WA 3VAYA 4AQYT 2JD3A 3DI5A 5LG3A 3VR8A 3SWHA 2E2AA 4G63A 1US7B 3VF0A 1WR6A 2W00A 5JVDE 5F5WA 4P9FA 2E5LT 5A6AA 2LE8A 3RKOF 1PCXA 4A5XA 1TKNA 1VMAA 2IHR1 4H63V 1Q0DA 4MBQA 3UUXB 4DVDA 4GOUA 5LGNB 5B1BC 4XZCA 3TQOA 3OYZA 2XM1A 2WVOA 3IPMO 3SYNA 2LOPA 2R7QA 2CCQA 3HKKA 5D91A 4EIYA 4BJ5C 4FJOA 5CA1E 5J0ZA 2XL4A 4UEMA 3EDVA 2DB4A 2Y6XA 1ZEEA 1UCUA 4DV6T 1N36T 5F5HA 1N1CA 3IEEA 2KWIB 2XXAA 5F5FA 2KW3C 3MFNA 4CS7A 2B1EA 2R7SA 1LVKA 3P7IA 2P61A 3EFOA 1FIOA 3TLWA 4TUYE 3K3QC 3RIPA 4JI0T 5AQNB 4LLEA 3U2MA 3I0OA 3S90A 4H4KC 4U7IA 1CPRA 3ESLA 3J7Yq 3C63A 4ZI2D 3HKBE 4OFZA 4YL3A 3U2LA 2J7PA 5LHGB 3AE5A 3AOUA 4YSZA 4TWHA 1PD0A 3DP7A 2XUEA 3E22E 3E9VA 4LMLA 2Z6EA 3ZCIA 5LMUT 4JE9A 5J2TE 3RPUA 3S0XA 2OU6A 1XDOA 2QUPA 3C18A 3RYFE 2Q7RA 3L8IA 2UUIA 4IHJE 4CI2B 1G4WR 3ETVA 3WAQA 4AQFA 2ZPAA 2M67A 4WYVA 5KYYB 2CEAA 1E1HB 2LHNA 2JIWA 4YLHA 4H9OC 4YSXA 3KDSE 4DV7T 3ZG1A 2V7IA 1WYCA 4J2CA 1RMVA 3JT1A 4JV5T 2X9HA 3JRMO 4HWDA 3R6NA 1ZW3A 5LGUB 3DXJF 4WBNE 2NUTB 3B71A 4H9QC 2UXBT 1IAPA 2Q4FA 3IQ6A 4JRZA 2XLWA 4Z9JA 3HL6A 3LK2B 5KYXB 3UULA 2XLOA 1FMVA 2W66A 2YLGA 2R7OA 3QVZA 3ZMZB 1MIVA 1AEPA 4IREA 4U5CE 3MACA 4IARA 3HI2A 3PJAJ 4YJ2E 1XWMA 2DCFA 4I1OB 3W2VA 4JKVA 3IHUA 3VM6A 4U5GA 2ES0A 5JREA 2JPFA 4Z9IA 4C3EA 3A11A 4C7OA 5LMNT 3NRYA 4J7TA 3O1HA 2YRFA 3AE6A 4WGYA 3CWZB 3A8YC 2W63A 3ANWA 4NUVA 3RYHE 4PAGA 4IGUA 2WB7A 4QH1A 3VRBA 3TLUA 5L0CA 2HV7A 4MFRA 2XQYA 5AGFA 3R2PA 5BQGA 4AIUA 5IWAT 4E7SA 4LDKA 3HNKA 4XEVA 2XLEA 3CAXA 3ZJ1A 4NPPA 4MVQA 5AQKB 3MLGA 2VCCA 5AQJB 2KSFA 2OV9A 2ZD9A 4UF0B 3C4ZA 3ABLC 3LK3B 1VK5A 4YT8A 1J5ET 1HMDA 3K3OA 2WVQA 5HXSA 4DV3T 3B0VC 3PUAA 1L0VA 1X79A 4LFAT 2K24A 2H7BA 1CGME 3K6BA 2ZLYA 5FL0A 3A9CA 3TJ6A 2J62A 2BL2A 2YVKA 2BBJA 4UIGA 2E87A 4YXDA 3PJAA 2A2FX 4OYKA 1TWCA 2W2UA 4DBQA 2E9XA 4MTFA 3NMKA 4DR2T 2UUHA 2R7VA 3DM5A 4DV2T 1MMNA 4H63H 4UVAB 4TN7B 3P4QA 4WABA 3CIRA 4NTBA 2UXDT 2YDSA 4JEHB 3IQTA 1A0BA 5AQMB 3LBXB 5AQOB 3V5XA 5JQGE 4EWCA 4Z9HA 2R7WA 4YJ3E 4UVCB 3NKDA 1D0YA 4PJLA 3TD7A 5CB4E 1V54C 4L9IA 2H88A 3QB5K 2CCYA 3KBUA 2WY2A 3C50A 4P6IC 1G8XA 2LSYA 4OINF 3FZMB 3UMHA 4DV4T 3I9YA 4HWCA 3IQCA 4EXTA 3AA1B 4JI5T 1UK5A 5CIVA 5FY1A 3Q5EA 3ASOC 2LQGA 3DD7A 2LRKA 1VRBA 1T72A 3AE4A 4KHPT 4HFBA 3JC6D 2IOQA 2J9WA 4QWNB 4AQGA 5LCYA 3T9OA 2KZ7B 1D1CA 4P0BA 2C03A 1JR8A 4NTFA 4LFBT 3DKAA 1Z23A 3KVBA 2BBHA 4WZXA 3B0PA 2GFHA 3CPZA 1WCRA 3S84A 1BR2A 2XL6A 4RBNA 4FI5A 2W4MA 2FGYA 3AG4C 2R25A 3FHDA 2UXNB 2CBIA 1L3PA 4CDVA 4OK0A 5HCMA 1VOMA 4K0UA 5J1GA 2OOCA 3CSKA 4QH4A 3ZSUA 3AB3B 3FOPA 4HE8D 2LSKA 2ETSA 3TOMA 4E0IA 4B3MT 3GM2A 2Q9QB 4ZZBA 4LERA 1T7SA 4O2AE 5IYZE 5JDHA 3G4XA 3NZPA 3PE0A 4ZLDA 2B0JA 2BG9A 4IE6A 3NG1A 2NSGA 4CIHA 5EHHA 1SF8A 2PTFA 2X68A 3O10A 3BK9A 3FBLA 3QNUA 1UX5A 2XSEA 3KFWX 2FUPA 5LNKA 3KH2A 5JR9A 1W09A 3DMDA 1KNYA 5LB7B 3PUXF 3RX6A 3DJNB 5CI8A 2XQ4A 1QSPA 3M79A 3ONLC 4DOZA 4HFIA 3UFGA 3JCFA 2XLDA 2C5JA 5FNVE 2RA1A 2WU5A 4B3TT 1GQAA 2KMFA 2JRKA 2WQYA 3GWLA 1M6TA 4U9EA 3ETUA 3PURA 3C4WA 2E9XB 1OCOC 3VRCA 2R7TA 1VB5A 1CGNA 3I0QA 4A98A 2VH3A 1RKEB 3FVYA 3RRCA 2BKOA 1JAFA 4YL0A 1XZPA 4Q4ZF 4IDZA 2H3RA 1QLEC 3WHNA 3R84B 2MBGA 3H65A 4UDVA 3N9MA 3RIUA 3JADA 2F22A 3F46A 3U9JA 1HW2A 2KSRA 4U3CA 3K7DA 3AGUA 2NW7A 1OEDE 3NMIA 3DJBA 1N32T 3EH1A 4F4BA 1BR0A 2QTVA 2C5IT 4N4WA 3NDBB 5GONE 1NG1A 4J30B 4N06A 3C8GA 1XZYA 4NUUA 1ZHWA 5DJQC 1UG7A 1QUUA 5KYUB 2ZXWC 3POVA 4AQFC 4HEAJ 4E17A 3UU5A 5L3DB 2R7XA 1MMGA 5ABFB 4JZAA 2YKZA 4QXCB 4JI4T 2IUBA 2LEHA 2DWKA 5HXRA 3U9MA 3C4XA 4O8SA 2ZXRA 5ABEA 1T9KA 4MNDA 3GN5A 5HEOA 2X0CA 1KFYA 5EZYE 3VRAA 5M4YA 3NMJA 3GEEA 2GK9A 1C17M 3P4SA 3QC9A 3ZT5A 2CDQA 1YZAA 2JMKA 2VB6A 1LM3B 4QX8B 3AEDA 1UFBA 4ZS3A 1AJ3A 4U5DE 4DJ9A 5F28E 4EEDA 5IUXA 2NG1A 3MBGA 3FMSA 3GODA 4HWFA 1OW8A 1XNQT 4LMKA 2EHOD 4EV6A 1U0BB 3LK42 4A2NB 1I5NA 4H9RC 4UV8B 4K0KT 3JZ0A 1WGWA 4AKLA 3FZLB 4CQIA 4W8KA 3M15A 1HMOA 3UU8A 2H7OA 1V9DA 3C98B 1GM5A 4HEAA 3RVZA 3M1CB 2Y3BA 2WDRA 2OLTA 4CX9A 3HKDE 2J9UA 1FJGT 5E3CA 4CN6A 4GYRA 2BS2A 4YSYA 5ABGA 4ILCA 2Q9AA 3CK6A 3JYYA 1OKKD 2BDEA 2HS5A 3ZTZA 1YAUO 1HNXT 5B3SC 3RLFF 1A7VA 1YKEB 3PUZF 4BAYB 3GEHA 1MIWA 3SRZA 1NZEA 2KC3A 1Z3IX 3AEFA 1HG5A 3EDUA 2N1GA 1N34T 1A7DA 2RP4A 3CMLA 5JSLA 4CS9A 1DOVA 1NFNA 2E9XC 2VL0A 5HSWA 4I1MA 4AL1A 4CDAA 3EHNA 5KX5E 3V7OA 2IXMA 4O2BE 2IAKA 4ERRA 1K05A 5F8PA 1ZHXA 2M6BA 2VKOA 5AQIB 3UUMA 2CNWA 4TNWA 4DR6T 2BZBA 3AEBA 4H9NC 1WASA 4OIPF 2XM2A 5EK2A 2XHEB 1FEWA 3AE3A 5AQUB 1RCPA 4O7GA 3DTOA 2J4GA 1OEDB 3N2OA 3U5SA 2V5DA 4TNVA 4HFHA 1J5WA 3L34A 2XAGB 3RI5A 3FAPB 4DV0T 4IE0A 3T6JA 4IE4A 3ATPA 3TK0A 3N9QA 4UXNB 5JS5A 4YT4A 3PU3A 3EGDB 4BPMA 4LF5T 3U78A 1WLXA 2M64A 4M1PA 2AWCA 3K1HA 2X9XA 4DR1T 2JQQA 3X2QC 4CBEA 3CX7B 4EYUA 1TWGA 3LS0A 3EG9B 1HW1A 5L0DA 2KYHA 1IBKT 4EOZB 3BQLA 4ILAA 1VYIA 1EZ3A 1KNPA 3GA8A 4CZZB 4X64T 1QKRA 2XSAA 4QI0A 2XM4A 1W0BA 2FFHA 3EZHA 2NUTA 2WDVA 5LBQB 1HNWT 1FFHA 1SHZC 2HJMA 2IXOA 5KYXA 2MPKA 3ZIBA 2HUJA 4OHFA 1UUSA 2X0YA 4ZOLE 4LFCT 4ULWA 3FXHA 3EI0A 1ORJA 2KINB 4GK0E 1YLMA 2B76A 3WAKA 5L0GA 3WG7C 3AG3C 3ZN0B 4YHJA 4DNDA 2J9VA 4JC7A 4C91A 2IBFA 2BG9C 2XQAA 4F6RC 4IDNA 4HKAA 4ADZA 4CXWA 2LD6A 4PK4A 5EK4A 5LGTB 4YY3T 4UV9B 2JJ9A 2M4EA 3DAFA 1L7CA 3QW1A 4J7YA 2XQ9A 3H3AA 5JTGA 3OA1A 5JR9C 4NXNT 4PJMA 3C7JA 5AQFB 4HGAA 5COGA 3W8IA 5LG4A 5FXVA 1T98A 4U33A 2CYDA 4O6MA 2XAQB 1XZQA 2G0UA 3JCUQ 1BR1A 3SOLA 3T6BA 2X0HA 2PFDA 4EBKA 4UF0A 5FY7A 3W4YA 1Z7Qc 2GA0A 3AGTA 4BJNA 2UUAT 3CQXC 2XRHA 3L09A 4JUYA 2W4XA 3ZLIA 3K66A 4Z90A 4JLEA 2W67A 1E7PA 4E0HA 3L8RA 3HTKC 5JDQA 3T6GB 1ZHZA 2YLDA 5DS5A 2LM9A 2JQKA 3O9XA 1HX8A 3RIUC 4NC3A 2KNDA 3C62A 2DWGA 2XL8A 4JTCB 2BKNA 1EA8A 4HFFB 3HKEE 3N2GE 4U2YA 3ZT7A 2Q3TA 1RXQA 5JT4A 3NKEA 2NP9A 3G50A 3Q7GA 5CFBA 2CRBA 3NYMA 3RF3A 2Y3GA 5AQTB 2LP4A 2HN1A 2L9QA 3I5PA 4NY3A 5DLJA 3FHNA 3SXMA 2OCCC 4P9TA 3RYCE 3I4UA 4CIPA 3LBXA 2BVMA 3NVOA 5CJ5A 1U5PA 2EIMC 3S4UA 3UUNA 2J9BA 3X1OA 5AQRB 5JDNA 3JTLO 4ZXLA 4DR5T 2WL8A 5HWYA 4ZZCA 1YYJA 5J2UE 1HS7A 1MIYA 2W4BA 3LLIA 5A6JA 4C3DA 2LFFA 2V3CC 3L39A 1TFKB 3LJCA 4RDAA 4PK5A 3KYIA 4WJ0A 3S28A 2L8KA 4I0UA 2C5KT 5A6BD 4O4JE 3I1AA 2PX3A 5ABHA 3ABMC 4XTKA 4DMVA
chains in the Genus database with same CATH topology
2A72A 1ZHCA 1D1AA 3F2EA 2DNXA 3ZC4A 3OWTA 4X1KE 2LSEA 5DQWA 2J0XA 2D0UA 2Q9QA 4TV8E 4FESA 2Z15A 3UGPA 4ASKA 4OYJA 1HG2A 3MKDA 2Y39A 1IJ5A 3ITFA 1IW7F 1TWAA 5KYWB 4UVBB 3Q5XA 3AAEB 3I5QA 3MA9A 3RYLA 5H6QB 3B9QA 2Y8DA 2PF4E 4YFSA 4RD9A 4CS9C 1M2VB 2NUPB 5L3QA 2V7KA 1OCRC 3O4XE 4G2AA 2EILC 3N0TA 3ASNC 5HXCA 3N9PA 1IZNB 2EHOB 2IW5B 4L5GA 4EZ4A 1CUNA 3AQBA 2DI4A 4YJWA 2D0TA 2HPLA 1FTSA 2BVLA 4IE7A 3FDQA 2ODVA 2IYLD 2I59A 4O6YA 2HH7A 5KYUA 3S29A 4DVYP 3VHLA 4QX7B 2DYSC 2EINC 3AA0B 3Q9DA 2J1DG 4Q7CA 4ISTA 4X20E 5JDFA 4C3BA 4A56A 2YHSA 4WW0A 3FXEB 1ZYRF 5FXXA 2A3DA 2PJQA 4EAHA 3ZVRA 1OCZC 5DVWA 2LOSA 1D0ZA 3RC8A 2PG8A 3B0UX 4XBFB 2WVNA 3A5XA 2YZSA 2CW0F 3DM9B 3EJNA 2PFVA 3L3PA 4AK9A 2NW9A 2X67A 5LBMA 2WSSV 3LJBA 1O87A 4KC9A 4JW1A 1H7CA 2A69F 1V55C 1MMAA 1SA0E 5EGYA 3TKLB 2V7JA 3RFYA 2IXPA 4EIWA 5IHYA 3O1JA 5KDMC 1IZMA 5T1DB 3VKHA 3CQCB 4MALA 2QGSA 2UXXB 3N9NA 3DJUB 4K7BA 3N2KE 1FFTC 4H9PC 4JURI 3LAYA 4KMCA 3W2WA 3E08A 1TR2A 1ZU5A 2CE7A 3NYLA 2L9JA 2QA7A 2YU2A 1B7TA 3ZN1B 3CQZA 2J46A 4ZI3C 3PUQA 4HN9A 2PBIA 2LSJA 3LNRA 3S27A 1SMYF 4O4LE 3CVRA 3UT5E 4YT2A 3AA7B 3GMIA 2X51A 3Q2MA 3EGDA 5JH7E 5E0OA 3V5UA 4AE4B 2MYSA 5E3AA 3Q7LA 3AG1C 3EG9A 3PDYA 4QHOA 3E70C 3UR3C 2CXDA 1MMDA 4HFKB 3VKGA 3JRTA 3WAJA 4CSAA 3CQGB 1Z0PA 4PNIA 2CXLA 4PFOA 5DABA 4OIRF 5FYMA 2Q9QC 4ILUA 2G3VA 1ZHYA 3AQCA 3E0ZA 3EQLF 2J7PD 3ZMVB 4ANJA 5JRCB 4HFVA 4I44A 4YT5A 4PJJA 1Z6AA 4AKGA 4BEJA 3KMIA 4KI2A 1LKXA 4N78D 4U5BE 3MX3A 3N9OA 3EZIA 2JMHA 2W9YA 3F31A 2WZFA 1NAFA 3KL4A 4ZLCA 3LEVA 4O6NA 1U4QA 3KINB 4XWJA 2BE5F 2W62A 3NRHA 3LFMA 4IIJE 3RKOA 5TAOA 5IY5C 2D2SA 3OJAA 2G3KA 5HXEA 1M57C 2VKDA 4FWVA 2W61A 4IE5A 4O4HE 3P8CD 4P09A 4G7OF 3SNHA 2MOZA 2XTLA 3RRWA 4O79A 3UTKA 2C0SA 3AAAB 4HE8A 5C8YE 2IC6A 2X0LB 4CI3B 1QZXA 3SEOA 3ZC1A 1J8YF 3N24A 4GK5E 4IAOA 2WMNA 4P0AA 4XLPF 3OYXA 4QI2A 1HTJF 3ZJ2A 5LYJE 4BJ1A 3EGXB 2NTYA 3N9LA 5FP3A 4M63A 3SS1A 3QMKA 5L2LA 4OD4A 4DBRA 5A1LA 1LS1A 5BMVE 5JDLA 4OD5A 3IBPA 3KKBA 2R7RA 4JCHA 4AKIA 4CI1B 2Y3HA 1WRDA 2KLQA 4KNWA 4OIQF 1HF8A 1YD8G 4YWQA 2W45A 2E9XD 5B1AC 4ZI2C 4BJ6C 2V1DB 2P9BA 4ZS2A 2K5BB 2LHRA 2HPJA 3HA4A 2ZM8A 4K0DA 4X0RA 2WM9A 4MHCA 3UFEA 5FY0A 2WWUA 3I9WA 3IHRA 4AKHA 3CX8B 3FB2A 3PUGA 2VL8A 1NU9C 2PP4A 4KNVA 1PD1A 5T3TA 2XAHB 2L3LA 3L0IA 3LS1A 2N2NA 5HYAA 4AXPA 4QXBB 4FX5A 5KYWA 4KP3C 5LHIB 3LESA 3EH2A 4QDLA 3MXZA 2A6HF 1MNEA 2MWQA 5DQZA 4ZI7E 2A6EF 2OA5A 1M2VA 4WBOA 3CKDA 1BR4A 2NUPA 2P6VA 3T8OA 2LSGA 3W8HA 2ACXA 3WI3A 1KU2A 4B6IA 2EHOA 3LG7A 5L3EB 3RC3A 2KJGA 4QXHB 2IXNA 2LSIA 1QSDA 1OXZA 4J32B 4WNKA 3QZCA 4BJMA 3SZRA 3ZMUB 3Q6NA 4PFPA 4CS8C 5L3GB 3K33A 2KNHA 2G62A 3JYHA 2WAUA 5DS4A 1OKKA 1D1BA 3HR0A 4U5EE 1SZIA 5CA0E 4XLNF 3AVSA 2O9XA 3J9X1 4I50E 2ZXPA 4C90A 4U74A 4U72A 4CSAC 3ONXA 3IF8B 3JSZA 2L81A 1G73A 3OKQA 2HV6A 1RJ9B 2SPCA 1LVFA 2KT9A 5HAXA 4TV9E 1FMWA 3EUHA 2YK0A 1D0XA 3Q5WA 4I55E 4I43B 2ZXOA 2QY9A 2J45A 4TX5A 3FAJA 4B6XA 4KUMB 1S7ZA 1O5HA 5ETWA 1JPJA 3MK7C 4DMWA 1ZKEA 3K3NA 2XAJB 3JC6C 2Y3DA 3DAGA 3VU7H 4AX2A 2OG2A 3SP1A 4GYSA 3ZMTB 5D92A 2XXAB 1Z63A 2KQ9A 2I8BA 2Y69C 1O3XA 3EFOB 4YN0B 2K48A 2Y48B 4BJTA 3NZQA 2ODUA 4CXXA 2J0WA 4KBLA 2H7VC 2MTQA 4EB6E 5H6RB 2PX0A 3KV9A 3PHF2 4X1IE 2EIKC 5L3BB 2VK9A 2ZMAA 1TWHA 4QKNA 4AE4A 3UMKA 1OCCC 2WZGA 3KV4A 4O4IE 2VKJA 4U5HA 3NBXX 4G0HA 5JDGA 2D5UA 2P7VA 2NWBA 2V26A 4MLKA 3KV5A 3ZYLA 4PK6A 1W2WA 3KV6A 4HTEA 1YW0A 3N2ZB 3PTRB 4ISSA 2V7LA 3ZYMA 4BA9A 1ZV4X 5JDMA 2WBLA 2CNWD 3UNGC 4BJ6A 2W0GA 4CXYA 5LA6E 1HCIA 4V1Av 5HXHA 4KBMB 3MJXA 4C7OB 3ZMSB 5JRCA 5HWXA 2V7MA 3ANWB 2WZLA 2YEVA 2C04A 3WODF 4I4TE 2A1DD 4MQ9F 4AKRB 3KVAA 4JJGA 3AA6B 3HJCA 5EK3A 4DO0A 4AI6A 3ZYKA 3LLKA 2NOXA 3B57A 4BJ5A 5LHHB 2EHOC 2NTXA 3K1IC 3RYIE 3RH3A 2CWYA 2CA5A 3K8PC 2KWHA 2VASA 5BUOA 3MZKB 3O1IA 2A68F 2WMOA 2ZM0A 3KBTA 5AFUL 2CLYB 4G7ZF 3DZAA 1S35A 3C51A 3ZEFB 1J8MF 2K9AA 4OIOF 4UELA 3EHMA 3VYWA 3AAIA 1M56C 2VWAA 4GIWA 1KNZA 3NYJA 4EZHA 3ZC0A 4CS8A 2CGEA 3EGXA 4GEHA 2XAFB 1NWMX 3C64A 5DS6A 4EYYR 4BG0A 1UX4A 3FXDB 2CXFA 1LRZA 5DQTA 2Q9CA 3OEOA 3BQIA 3GWHA 3FBZA 2XASB 5CI9A 4H9SE 3V5SA 3F47A 4JEUB 1ZHTA 4JVSA 4Z8XA 3GANA 2X9YA 1JPNA 5F3JA 5LP6E 4ZI3D 5FXWA 5T3WA 1VYKA 5LJNA 4U5FE 4JJFA 2X66A 4PW8A 4G7HF 3M65A 1MNDA 2IC9A 4GYTA 5LXTE 5E33A 3O6XA 2DGJA 4X1YE 4E7ZA 5JR9B 4EBBA 2CM0A 2KXPB 3F57A 5L3VA 3ZCJA 5E2QA 3QUJA 5KMGP 3CX6B 1ZU4A 2Q9BA 5FCLA 3ZPOA 1WYBA 1OWAA 1Z5ZA 2KGOA 4LACB 3OBVE 1Y64B 3H37A 3AVRA 2X9WA 3EVYA 3AG2C 3O39A 3QK6A 5L3CB 2DYRC 1NU7D 1KK7A 1HFAA 3D0TA 3T4RA 2CLYC 5DQVA 2LT3A 2CWOA 3ABKC 4TZ4C 5LJMA 1S94A 2Q9QD 2E8IA 1YKHB 2CMRA 4ZHQE 4IRUA 3PMRA 4I3MA 2VKHA 4XAXB 3UGOA 3NRXA 5FMNA 3N5LA 3W15B 3BQKA 4PJNA 2NW8A 1ST6A 3EPVA 3PUSA 3GN5B 5KYYA 4LLCA 3PU8A 4IWBA 2ZM2A 1IJ6A 2DHRA 3UMIA 5LOVE 3CZ6A 2LJLA 2YINA 2R7UA 2EIJC 2N9DA 3HKCE 4Q5SF 4IJJA 4DVZA 5FXZA 3U3IA 3ECSA 3HLZA 1RJ9A 1M2OA 2D5RB 2YEVC 5ADXL 5KYNA 4L0RA 3B13A 5L3FB 2YU1A 3Q6MA 2DLRA 3VAYA 2JD3A 3SWHA 4G63A 1US7B 1WR6A 2W00A 5JVDE 2LE8A 3RKOF 1PCXA 1TKNA 1VMAA 4H63V 4MBQA 3UUXB 4DVDA 4GOUA 5LGNB 5B1BC 4XZCA 3OYZA 2WVOA 3SYNA 2LOPA 2R7QA 2CCQA 5D91A 4BJ5C 4FJOA 5CA1E 2XL4A 4UEMA 3EDVA 2Y6XA 1ZEEA 1UCUA 5F5HA 1N1CA 3IEEA 2KWIB 2XXAA 5F5FA 2KW3C 4CS7A 2R7SA 2B1EA 1LVKA 3P7IA 3EFOA 1FIOA 4TUYE 3K3QC 3RIPA 4LLEA 3I0OA 4H4KC 3ESLA 3J7Yq 4ZI2D 3HKBE 4OFZA 2J7PA 5LHGB 1PD0A 3DP7A 2XUEA 3E22E 3E9VA 2Z6EA 3ZCIA 5J2TE 3RPUA 3S0XA 3RYFE 4IHJE 4CI2B 3ETVA 4AQFA 2ZPAA 2M67A 5KYYB 2CEAA 1E1HB 2LHNA 4YLHA 4H9OC 3KDSE 3ZG1A 2V7IA 1WYCA 4J2CA 3JT1A 2X9HA 3R6NA 5LGUB 3DXJF 4WBNE 2NUTB 4H9QC 1IAPA 3HL6A 3LK2B 5KYXB 3UULA 1FMVA 2R7OA 4U5CE 3ZMZB 1MIVA 3MACA 3HI2A 4YJ2E 2DCFA 4I1OB 3W2VA 4U5GA 2ES0A 5JREA 2JPFA 4C3EA 4C7OA 3NRYA 3O1HA 3CWZB 2W63A 3ANWA 4NUVA 3RYHE 4PAGA 4IGUA 2WB7A 2HV7A 4MFRA 2XQYA 4E7SA 3ZJ1A 3MLGA 4UF0B 3C4ZA 3ABLC 3LK3B 1VK5A 4YT8A 3K3OA 2WVQA 5HXSA 3B0VC 3PUAA 1X79A 2K24A 2H7BA 3K6BA 2ZLYA 4UIGA 2E87A 2A2FX 4OYKA 1TWCA 4DBQA 2E9XA 2R7VA 3DM5A 1MMNA 4H63H 4UVAB 4TN7B 4JEHB 3LBXB 5JQGE 4EWCA 2R7WA 4YJ3E 4UVCB 3NKDA 1D0YA 4PJLA 3TD7A 5CB4E 1V54C 4L9IA 3KBUA 3C50A 4P6IC 1G8XA 2LSYA 4OINF 3UMHA 3I9YA 4EXTA 3AA1B 5FY1A 3ASOC 3DD7A 1VRBA 3JC6D 2IOQA 2J9WA 4QWNB 4AQGA 5LCYA 2KZ7B 1D1CA 4P0BA 2C03A 1Z23A 3KVBA 3B0PA 2GFHA 3CPZA 1BR2A 4RBNA 4FI5A 2W4MA 2FGYA 3AG4C 3FHDA 2UXNB 4OK0A 1VOMA 4K0UA 5J1GA 3CSKA 3ZSUA 3AB3B 4HE8D 2LSKA 2Q9QB 4LERA 4O2AE 5IYZE 5JDHA 3NZPA 3PE0A 4ZLDA 2B0JA 4IE6A 3NG1A 4CIHA 5EHHA 1SF8A 2X68A 3BK9A 3FBLA 1UX5A 2XSEA 3KFWX 5LNKA 3KH2A 5JR9A 3DMDA 3RX6A 3DJNB 5CI8A 4DOZA 2C5JA 5FNVE 2RA1A 2KMFA 2JRKA 3ETUA 3PURA 3C4WA 2E9XB 1OCOC 2R7TA 3I0QA 2VH3A 3FVYA 3RRCA 4Q4ZF 4IDZA 2H3RA 1QLEC 3R84B 2MBGA 3H65A 3N9MA 3F46A 3K7DA 2NW7A 3DJBA 3EH1A 4F4BA 1BR0A 2QTVA 2C5IT 3NDBB 5GONE 1NG1A 4J30B 4N06A 4NUUA 1ZHWA 5DJQC 1QUUA 5KYUB 2ZXWC 3POVA 4AQFC 4HEAJ 5L3DB 2R7XA 1MMGA 4JZAA 4QXCB 2LEHA 2DWKA 5HXRA 3C4XA 4O8SA 2ZXRA 4MNDA 3GN5A 5EZYE 5M4YA 2GK9A 3QC9A 2CDQA 2JMKA 2VB6A 4QX8B 4ZS3A 1AJ3A 4U5DE 2NG1A 3GODA 2EHOD 3LK42 4A2NB 4H9RC 4UV8B 1WGWA 4AKLA 4CQIA 4W8KA 2H7OA 1V9DA 3C98B 4HEAA 3M1CB 2Y3BA 3HKDE 2J9UA 5E3CA 4GYRA 2Q9AA 1OKKD 2BDEA 5B3SC 1YKEB 4BAYB 1MIWA 3SRZA 1NZEA 1Z3IX 1HG5A 3EDUA 2N1GA 2RP4A 3CMLA 4CS9A 2E9XC 5HSWA 4I1MA 3EHNA 5KX5E 3V7OA 2IXMA 4O2BE 2IAKA 4ERRA 5F8PA 1ZHXA 3UUMA 2VKOA 2CNWA 2BZBA 4H9NC 4OIPF 5EK2A 2XHEB 1FEWA 4O7GA 3DTOA 3N2OA 3L34A 2XAGB 4IE0A 3T6JA 4IE4A 3N9QA 4UXNB 4YT4A 3PU3A 3EGDB 3U78A 1WLXA 4M1PA 3K1HA 2X9XA 2JQQA 3X2QC 4CBEA 3CX7B 4EYUA 1TWGA 3LS0A 3EG9B 4EOZB 3BQLA 1VYIA 1EZ3A 3GA8A 4CZZB 4QI0A 2NUTA 2FFHA 3EZHA 5LBQB 1FFHA 1SHZC 2IXOA 5KYXA 3ZIBA 4OHFA 4ZOLE 4ULWA 2KINB 4GK0E 3WAKA 3WG7C 3AG3C 3ZN0B 4YHJA 4DNDA 2J9VA 4C91A 4F6RC 4HKAA 4ADZA 4CXWA 4PK4A 5EK4A 5LGTB 4UV9B 2JJ9A 2M4EA 3DAFA 3H3AA 3OA1A 5JR9C 4PJMA 4HGAA 3W8IA 5LG4A 5FXVA 1T98A 4O6MA 2XAQB 2G0UA 3JCUQ 1BR1A 3SOLA 3T6BA 2PFDA 4UF0A 5FY7A 4BJNA 3CQXC 2XRHA 3L09A 4JUYA 3ZLIA 3K66A 4JLEA 3HTKC 5JDQA 1ZHZA 5DS5A 2LM9A 3O9XA 1HX8A 2KNDA 2DWGA 4HFFB 3HKEE 3N2GE 2Q3TA 3NKEA 2NP9A 3Q7GA 3NYMA 2Y3GA 3I5PA 2L9QA 4NY3A 5DLJA 3FHNA 2OCCC 3RYCE 3I4UA 3LBXA 2BVMA 1U5PA 2EIMC 3S4UA 3UUNA 3X1OA 5JDNA 2WL8A 5HWYA 5J2UE 1HS7A 1MIYA 2W4BA 3LLIA 4C3DA 2V3CC 3LJCA 4RDAA 4PK5A 4WJ0A 3S28A 2L8KA 2C5KT 4O4JE 3I1AA 2PX3A 3ABMC 4XTKA 4DMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEE A;  4YJW A;  3RH3 A; 
#chains in the Genus database with same CATH topology
 4A4A A;  2A72 A;  1RKC A;  1ZHC A;  1D1A A;  1WTY A;  2QRX A;  2VVN A;  3F2E A;  1NEN A;  4JEA A;  1WAT A;  2LKG A;  4HWH A;  2TMV P;  2DNX A;  4Z91 A;  2XS1 A;  3ZC4 A;  1QVX A;  3L8J A;  1TFO B;  3OWT A;  4X1K E;  2LSE A;  5DQW A;  4XPY A;  4TWF A;  2J0X A;  2D0U A;  2Q9Q A;  4TV8 E;  4FES A;  3LUT B;  2Z15 A;  3UGP A;  4ASK A;  1MQV A;  4OYJ A;  1HG2 A;  2DI3 A;  1GGQ A;  5AC5 A;  1FNT c;  2WZI A;  3MKD A;  3RQG A;  2Y39 A;  1IJ5 A;  3U8V A;  4LF7 T;  4IDO A;  3DE8 A;  3ITF A;  3AEA A;  1IW7 F;  4AL0 A;  1NLX A;  5JVE A;  1TWA A;  5KYW B;  4UVB B;  2IDO B;  1SE7 A;  3Q5X A;  4DR7 T;  4K1O A;  1OR3 A;  1WFD A;  3AAE B;  3I5Q A;  4MW8 A;  3MA9 A;  4JI3 T;  1QLB A;  5B3I A;  3C8Z A;  3RYL A;  5H6Q B;  2A0B A;  5L0H A;  3B9Q A;  2Y8D A;  1OXK A;  2PF4 E;  4YFS A;  1BZ4 A;  4RD9 A;  3ABV A;  5HEJ A;  4CS9 C;  4XPW A;  4N6C A;  1M2V B;  2NUP B;  5L3Q A;  3V5Z A;  5AQV B;  2V7K A;  1OCR C;  3O4X E;  4G2A A;  1Y4C A;  3JAE A;  2EIL C;  3N0T A;  1DU2 A;  3ASN C;  2HHH T;  5HXC A;  1YQ4 A;  1RKE A;  3Q5D A;  1Z8U A;  3N9P A;  4B3S T;  1IZN B;  2EHO B;  2IW5 B;  4NXM T;  3PCV A;  4L5G A;  4EZ4 A;  1CUN A;  3AQB A;  4DID B;  2AU5 A;  3JSE O;  5AQH B;  1SYQ A;  2XQ7 A;  2K3W A;  2DI4 A;  4YJW A;  2PBE A;  1VLT A;  4P1N A;  2HPL A;  2D0T A;  1HX1 B;  1FTS A;  2BVL A;  4IE7 A;  3FDQ A;  2ODV A;  2IYL D;  2I59 A;  4O6Y A;  2HH7 A;  5KYU A;  1ZVZ A;  3S29 A;  3ZQY A;  4DVY P;  3VHL A;  4QX7 B;  1AVO B;  2DYS C;  1LE2 A;  2EIN C;  5ABF A;  5COF A;  2L7A A;  4A97 A;  3LEO A;  3AA0 B;  3Q9D A;  2XS8 A;  2J1D G;  4Q7C A;  4EKW A;  3P4P A;  4IST A;  4X20 E;  1R5I D;  5JDF A;  4BEM J;  4C3B A;  4CJG A;  2QLA A;  5A69 A;  4A56 A;  2YHS A;  1DOW A;  4WW0 A;  2IML A;  3FXE B;  4JI8 T;  5FXX A;  1ZYR F;  4NTA A;  1E84 A;  1OR2 A;  2HN2 A;  2IM8 A;  2A3D A;  1Q0G A;  2PJQ A;  4DR4 T;  4EAH A;  3GM3 A;  1OQC A;  4XQ1 A;  3ZVR A;  1OCZ C;  4JI1 T;  5DVW A;  2LOS A;  1D0Z A;  3RC8 A;  1ZOY A;  2PG8 A;  1K04 A;  2L6F A;  3B0U X;  4XBF B;  2WVN A;  3A5X A;  1EI7 A;  2YZS A;  1EQ1 A;  1JNZ A;  2CW0 F;  4R32 A;  3DM9 B;  3EJN A;  2PFV A;  3L3P A;  4AK9 A;  2NW9 A;  2X67 A;  5LBM A;  2WSS V;  3ZTM A;  4XEF A;  4GQH A;  1U89 A;  3LJB A;  1O87 A;  4KC9 A;  4JW1 A;  2LKH A;  3H3M A;  1H7C A;  2A69 F;  1KNR A;  2WB5 A;  1V55 C;  1MMA A;  4LF6 T;  2WS3 A;  2XQ8 A;  4CN1 A;  3ZT6 A;  1SA0 E;  5EGY A;  4YTM A;  3TKL B;  2V7J A;  1I4Y A;  3DWW A;  2IXP A;  3RFY A;  1BBH A;  4EIW A;  5IHY A;  5BQI A;  3O1J A;  5KDM C;  2YKS A;  1IZM A;  3KPH A;  5T1D B;  3VKH A;  3CQC B;  2LK4 A;  4MAL A;  4ER9 A;  2QGS A;  2LFD A;  2H89 A;  2HJ3 A;  2UXX B;  3N9N A;  2LIG A;  3DJU B;  4K7B A;  3N2K E;  1FFT C;  4H9P C;  4JUR I;  2FJA A;  4KMC A;  3LAY A;  3W2W A;  3E08 A;  1TR2 A;  2VUR A;  3FZH B;  2A9U A;  2VQF T;  1WWP A;  1ZU5 A;  2CE7 A;  3NYL A;  4IL9 A;  1YA9 A;  2WP9 A;  2L9J A;  3UQ7 A;  3AE7 A;  2QA7 A;  2YU2 A;  2BKP A;  1B7T A;  2XPK A;  3ZN1 B;  1M7K A;  2JQH A;  1FR0 A;  3CQZ A;  3AXJ B;  4DR3 T;  2J46 A;  1T01 A;  4D4X A;  4ZI3 C;  3PUQ A;  4HN9 A;  2PBI A;  1W9R A;  1OED A;  2LSJ A;  3LNR A;  4FAP B;  1S05 A;  1WN0 A;  3S27 A;  5JLI A;  1SMY F;  3SXY A;  4O4L E;  3CVR A;  3UT5 E;  5HEH A;  1YA7 O;  3RF1 A;  3PDM P;  4YT2 A;  3AA7 B;  4YHH T;  3GMI A;  2X51 A;  3RQU A;  3HNJ A;  1XMQ T;  1HNZ T;  3Q2M A;  3UU6 A;  3EGD A;  5JH7 E;  5E0O A;  3V5U A;  4DV1 T;  2L6H A;  5C2T A;  2RPA A;  4AE4 B;  2MYS A;  1E85 A;  5E3A A;  3Q7L A;  3AG1 C;  3EG9 A;  3PDY A;  4QHO A;  2QNL A;  4HWI B;  3E70 C;  3UR3 C;  1E2A A;  2EPK X;  2CXD A;  1MMD A;  5FKY A;  5L4H A;  4YT0 A;  4HFK B;  3VKG A;  5BQH A;  3JRT A;  3WAJ A;  1Y6D A;  2V6Y B;  2AVK A;  4CSA A;  3CQG B;  3HNI A;  5COM A;  1Z0P A;  4PNI A;  2CXL A;  4Q25 A;  3X1D A;  3SFD A;  4PFO A;  2CPT A;  5DAB A;  1OW7 A;  4OIR F;  3TOL A;  2QVA A;  5FYM A;  2Q9Q C;  4ILU A;  2G3V A;  1ZHY A;  2GDC A;  3AQC A;  3E0Z A;  3EQL F;  2J7P D;  3ZMV B;  4ANJ A;  5JRC B;  1YQ3 A;  1NBB A;  4HFV A;  4I44 A;  4YT5 A;  4MVZ A;  4DRH B;  3LNM B;  4PJJ A;  1Z6A A;  1NEK A;  3SFE A;  1UGO A;  3RIA A;  2H8A A;  2VCA A;  4AKG A;  4BEJ A;  2JX0 A;  3U8P A;  3KMI A;  4KI2 A;  1LKX A;  2YDR A;  1AUE A;  4N78 D;  4U5B E;  4EHP A;  3MX3 A;  3RQE A;  3N9O A;  3EZI A;  2JMH A;  4IAQ A;  2W9Y A;  3F31 A;  2WZF A;  1NAF A;  4PR9 A;  2P0N A;  3KL4 A;  4ZLC A;  3LEV A;  4O6N A;  1U4Q A;  3KIN B;  4XWJ A;  2BE5 F;  4OX9 T;  2W62 A;  3NRH A;  3LFM A;  4IIJ E;  3RKO A;  1ZW2 A;  5TAO A;  3PUY F;  4G78 A;  5HCJ A;  2CBJ A;  3GEI A;  5IY5 C;  2D2S A;  1APC A;  3OJA A;  2G3K A;  4LF4 T;  5HXE A;  1M57 C;  2VKD A;  4FWV A;  3ZST A;  2NR4 A;  2W61 A;  4IE5 A;  4O4H E;  3B29 A;  2EPM X;  3P8C D;  4P09 A;  4G7O F;  3RQW A;  1LI5 A;  3SNH A;  2MOZ A;  2XTL A;  3RRW A;  1Q0K A;  1LIH A;  3RIF A;  4O79 A;  3UTK A;  2C0S A;  3TLV A;  3AAA B;  1YAR O;  4HE8 A;  4X65 T;  4JI6 T;  5C8Y E;  2IC6 A;  2X0L B;  4EGW A;  4CI3 B;  1QZX A;  3TLT A;  5HEU A;  3SEO A;  3ZC1 A;  5C3J A;  1J8Y F;  2YN6 A;  3N24 A;  4GK5 E;  4IAO A;  2I6H A;  2WMN A;  2VC9 A;  4P0A A;  4XLP F;  3OYX A;  2UU9 T;  5L4E A;  4QI2 A;  1XDP A;  2E5V A;  1F1M A;  4NCQ A;  1HTJ F;  3UU3 A;  3ZJ2 A;  5LYJ E;  4BJ1 A;  4JEB A;  3EGX B;  2AWY A;  2YL3 A;  2NTY A;  3RGL A;  3N9L A;  5FP3 A;  4M63 A;  3SS1 A;  2HMQ A;  3QMK A;  5L2L A;  4OD4 A;  4DBR A;  4LDR A;  5A1L A;  1V74 B;  5BMV E;  1LS1 A;  5JDL A;  4OD5 A;  3IBP A;  3KKB A;  2R7R A;  3CEX A;  4JCH A;  1SR2 A;  4AKI A;  4CI1 B;  2Y3H A;  1UUR A;  1WRD A;  2KLQ A;  4KNW A;  3ZQV A;  2YL0 A;  4OIQ F;  1VTM P;  1HF8 A;  1YD8 G;  4YWQ A;  2W45 A;  2E9X D;  5B1A C;  4ZI2 C;  4BJ6 C;  2V1D B;  3KYJ A;  2P9B A;  4ZS2 A;  2K5B B;  2LHR A;  2HPJ A;  3HA4 A;  2ZM8 A;  1HR0 T;  4K0D A;  4X0R A;  2WM9 A;  4JTA B;  4MVS A;  4MHC A;  5FZT A;  3UFE A;  5FY0 A;  3T1H T;  3G06 A;  2WWU A;  3BRJ A;  3I9W A;  4H54 A;  3IHR A;  4AKH A;  1CHU A;  3CX8 B;  3FB2 A;  5AQQ B;  2UXC T;  1KF6 A;  3PUG A;  3OPC A;  2HSB A;  2VL8 A;  2HFI A;  1NU9 C;  2PP4 A;  4KNV A;  1PD1 A;  5T3T A;  2XAH B;  2XLH A;  2L3L A;  2ASR A;  3L0I A;  3LS1 A;  2N2N A;  5HYA A;  4AXP A;  4QXB B;  3A7M A;  4FX5 A;  5KYW A;  4KP3 C;  3EAM A;  5LHI B;  3LES A;  3EH2 A;  2HKV A;  4QDL A;  4IDQ A;  3MXZ A;  2A6H F;  1MNE A;  2MWQ A;  5DQZ A;  4ZI7 E;  2L6G A;  3ZDL A;  2A6E F;  2OA5 A;  5JRA A;  1V4A A;  1M2V A;  2WZH A;  1WOL A;  4WBO A;  3CKD A;  1BR4 A;  2NUP A;  4QH5 A;  2LLY A;  3ZSS A;  1T5O A;  2P6V A;  3M3Z B;  3T8O A;  2LSG A;  3W8H A;  2OJQ A;  2ACX A;  4MW3 A;  1QQ3 A;  3ZKR A;  4U9D A;  4MVO A;  3WI3 A;  1KU2 A;  2R9R B;  4B6I A;  2EHO A;  4COF A;  3K1I A;  3LG7 A;  5L3E B;  3RC3 A;  1OED C;  2LCH A;  4F8H A;  4LMJ A;  2KJG A;  5HV9 A;  4QXH B;  2IXN A;  1ZZP A;  2LSI A;  1QSD A;  4YL1 A;  5L0J A;  1JOG A;  2KK1 A;  2MAW A;  1CGO A;  3LDQ B;  1OXZ A;  4JCZ A;  4J32 B;  4WNK A;  2VQE T;  3AEC A;  3SXK A;  3QZC A;  4BJM A;  3SZR A;  1YXR A;  3EHZ A;  3ZMU B;  2V8S V;  4U7Y A;  3GM1 A;  3Q6N A;  4PFP A;  4CS8 C;  5L3G B;  4E18 A;  2FBW A;  3K33 A;  2FJB A;  4U31 A;  2UUC T;  2KNH A;  2G62 A;  3JYH A;  2JQ9 A;  2WAU A;  2P1A A;  3U3F A;  5DS4 A;  5L0I A;  4LF8 T;  1OKK A;  1D1B A;  3HR0 A;  4YTP A;  4U5E E;  4GKK T;  1XNR T;  1SZI A;  2OEV A;  5CA0 E;  2XSB A;  2LM2 A;  4XLN F;  3AVS A;  2O9X A;  3J9X 1;  4I50 E;  2ZXP A;  3QVY A;  4C90 A;  4U74 A;  4U72 A;  4CSA C;  3RKG A;  3ONX A;  3IF8 B;  3PUV F;  3AJM A;  3JSZ A;  1C03 A;  2L81 A;  4B3R T;  4HFC A;  1G73 A;  3OKQ A;  2HV6 A;  1RJ9 B;  4JTD B;  2SPC A;  1C02 A;  1LVF A;  2KT9 A;  5HAX A;  4TV9 E;  1YJG A;  3G4Z A;  1FMW A;  3EUH A;  2YK0 A;  3C8G D;  3RW0 A;  2XQ5 A;  1D0X A;  3Q5W A;  4I55 E;  4I43 B;  2BC5 A;  2ZXO A;  3GWN A;  4UR9 A;  1B68 A;  2QY9 A;  3P50 A;  4YTN A;  2J45 A;  2XM0 A;  4TX5 A;  3L1M A;  3FAJ A;  4IT4 A;  4B6X A;  5EK0 A;  5L0F A;  1T6I A;  2XLM A;  1T6Q A;  4KUM B;  5CGM A;  1S7Z A;  1O5H A;  4AIS A;  3NKZ A;  5ETW A;  4MS2 A;  1JPJ A;  3MK7 C;  1VCT A;  3M4C A;  2DL1 A;  4DMW A;  1ZKE A;  3K3N A;  2XAJ B;  3JC6 C;  1PV3 A;  2Y3D A;  5L47 A;  2WDQ A;  3VU7 H;  3DAG A;  4AX2 A;  2OG2 A;  4JI2 T;  3QTH A;  2R05 A;  4JBW F;  3SP1 A;  1LPE A;  4GYS A;  3ZMT B;  5D92 A;  1ORS C;  2XXA B;  2WWV A;  1Z63 A;  2GWW A;  2KQ9 A;  3IQ5 A;  2I8B A;  2Y69 C;  1O3X A;  3EFO B;  4JIO A;  4MTG A;  1M62 A;  2OJE D;  4YN0 B;  4EUK B;  1T8B A;  3TLS A;  2K48 A;  3LSV A;  2Y48 B;  4BJT A;  2XLV A;  1R8I A;  3AXJ A;  3B5M A;  3NZQ A;  2ODU A;  4EEB A;  3UUB A;  4CXX A;  2I15 A;  2J0W A;  4KBL A;  3OVU A;  4NIQ A;  2H7V C;  2MTQ A;  4EB6 E;  5H6R B;  3M4B A;  5JUA A;  3EAB A;  2PX0 A;  3QOF A;  3KV9 A;  2NSF A;  3PHF 2;  4X1I E;  2EIK C;  5L3B B;  256B A;  2YLI A;  1XMO T;  2VK9 A;  2ZMA A;  1TWH A;  1XWJ A;  4QKN A;  4TWD A;  1TQG A;  4AE4 A;  4KX6 A;  4GKJ T;  3UMK A;  1OCC C;  2WZG A;  3KV4 A;  3O55 A;  4O4I E;  2VKJ A;  1A7E A;  4U5H A;  3MYF A;  3NBX X;  4PAC A;  4G0H A;  5JDG A;  3AEE A;  4MVM A;  4IGG A;  2D5U A;  2P7V A;  2NWB A;  2V26 A;  4MLK A;  2V5C A;  2RD9 A;  3KV5 A;  3ZYL A;  2WU2 A;  3FZK B;  4PK6 A;  1W2W A;  3KV6 A;  4N6H A;  5FL1 A;  4HTE A;  2V6Y A;  1YW0 A;  3N2Z B;  3PTR B;  5AQG B;  2YOE A;  4ISS A;  2V7L A;  3ZYM A;  4BA9 A;  1ZV4 X;  5JDM A;  2WBL A;  2CNW D;  3UNG C;  4BJ6 A;  2W0G A;  4CXY A;  5LA6 E;  4DUY T;  1HCI A;  2BS4 A;  4V1A v;  1JRA A;  5HXH A;  2M6I A;  4KBM B;  3MJX A;  4C7O B;  3ZMS B;  2OEX A;  1HY5 A;  1E86 A;  2FJE A;  5JRC A;  1QPU A;  1YVI A;  4ULV A;  5HWX A;  2EPO A;  2V7M A;  3UQ4 A;  4WGZ A;  4XPX A;  3AE9 A;  3ANW B;  2WZL A;  2QYW A;  1HE9 A;  1LS4 A;  4DXW A;  2YEV A;  2C04 A;  2BG9 E;  3WOD F;  1VCS A;  4X5T A;  2ACZ A;  3AE2 A;  4I4T E;  3OTO T;  2A1D D;  3H2U A;  3U3B A;  2ZM6 T;  2XY8 B;  4MQ9 F;  1J1J A;  4AKR B;  3FZF B;  4X62 T;  1W0A A;  3KVA A;  1G4U S;  1KEY A;  4JJG A;  1NSG B;  3AA6 B;  2YL7 A;  3GOR A;  3R7C A;  3QB5 A;  4KI0 F;  3HJC A;  1U6H A;  1Y01 A;  2OQM A;  5EK3 A;  1G5Z A;  3P4R A;  4DO0 A;  2XQ6 A;  2EPL X;  3JAF A;  4AI6 A;  5A6B A;  3ZYK A;  2YWA A;  3LLK A;  4LF9 T;  3DE9 A;  2NOX A;  3B57 A;  5HEG A;  3ZWI A;  4MVU A;  3TUL A;  5KXJ A;  3T1Y T;  4BJ5 A;  5LHH B;  2F4V T;  2EHO C;  3BEH A;  2NTX A;  3K1I C;  3RYI E;  1VLS A;  3RH3 A;  5A6K A;  3QW0 A;  1T6U A;  4YK5 A;  2OKU A;  2CWY A;  2CA5 A;  3K8P C;  2KWH A;  2VAS A;  5BUO A;  2IIU A;  4DV5 T;  2I0M A;  2LRL A;  3MZK B;  3O1I A;  2A68 F;  2WMO A;  2ZM0 A;  3KBT A;  3ONJ A;  5AFU L;  2CLY B;  4NQF A;  4G7Z F;  4ILB A;  2YQY A;  3DZA A;  1S35 A;  3C51 A;  3ZEF B;  1J8M F;  2K9A A;  4OIO F;  2HSQ A;  4DRI B;  2AP3 A;  4UEL A;  2MHR A;  1ORY A;  3RVY A;  3EHM A;  2GAQ A;  3VYW A;  3AAI A;  3K1S A;  1M56 C;  1O3U A;  2VWA A;  2PNO A;  4GIW A;  2J8W A;  2V6X A;  1KNZ A;  3NYJ A;  4EZH A;  1ZP0 A;  2FAP B;  3ZC0 A;  4CJO A;  4CS8 A;  2CGE A;  3EGX A;  4GEH A;  2XAF B;  5FVK A;  1YYX A;  2R6G F;  1NWM X;  3C64 A;  5DS6 A;  5BR8 T;  1OXB A;  3US6 A;  4X66 T;  2XZE A;  4EYY R;  4BG0 A;  5TJ5 E;  1UX4 A;  2EPN A;  2QE9 A;  3FXD B;  2CXF A;  1LRZ A;  4DUZ T;  5DQT A;  2Q9C A;  3OEO A;  2AE9 A;  1NFO A;  3BQI A;  3PV0 F;  2CHO A;  3GWH A;  3AE1 A;  3FBZ A;  2B0H A;  3S9O A;  4HFD A;  4EBJ A;  2XAS B;  3AE8 A;  5CI9 A;  4H9S E;  3V5S A;  3F47 A;  4JEU B;  5K0I A;  3MYI A;  1ZHT A;  4JVS A;  4Z8X A;  2YL1 A;  3GAN A;  1H6G A;  1E2X A;  2X9Y A;  4D4N A;  1JPN A;  5F3J A;  2HMZ A;  5LP6 E;  4ZI3 D;  2VVS A;  5FVL A;  2NPU A;  1H9T A;  5FXW A;  1N33 T;  5T3W A;  1VYK A;  4KHZ F;  5LJN A;  4U5F E;  4JJF A;  1WR0 A;  2BG9 B;  2X66 A;  2UUB T;  4PW8 A;  2R02 A;  4G7H F;  3M65 A;  1MND A;  2IC9 A;  1KTM A;  4GYT A;  5LXT E;  2R03 A;  3SXZ A;  2XQ3 A;  5E33 A;  1H9G A;  3FOO A;  3O6X A;  1YZC A;  4CN4 A;  2A0U A;  2DGJ A;  4X1Y E;  4E7Z A;  5JR9 B;  1IBM T;  4EBB A;  2CM0 A;  3V5Y A;  2KXP B;  3F57 A;  5L3V A;  3ZCJ A;  5E2Q A;  4MVR A;  3QUJ A;  5KMG P;  3RQF A;  3CX6 B;  1ZU4 A;  2Q9B A;  1R4T A;  2YDQ A;  2CHN A;  1JMW A;  3ZPO A;  1WYB A;  1OWA A;  5FCL A;  1Z5Z A;  2KGO A;  4LDQ A;  4LAC B;  3OBV E;  4IL4 A;  1JNR A;  1Y64 B;  2WCA A;  1IBL T;  3H37 A;  1A41 A;  1OW6 A;  3AVR A;  2X9W A;  3EVY A;  3AG2 C;  2AXD S;  2BS3 A;  1E83 A;  3O39 A;  3U0C A;  5AQS B;  3QK6 A;  4JI7 T;  5AQP B;  3PUW F;  5L3C B;  2DYR C;  2J47 A;  2ICW G;  1EKY A;  1X9B A;  1NU7 D;  4HFE A;  1KK7 A;  1HFA A;  3D0T A;  3T4R A;  2CLY C;  4CDY A;  5DQV A;  2LT3 A;  2CWO A;  3ABK C;  3AEG A;  4TZ4 C;  2RSE B;  5LJM A;  1S94 A;  1I4Z A;  2Q9Q D;  3C8G B;  2XJ7 A;  2E8I A;  1YKH B;  2CMR A;  3IA3 A;  4ZHQ E;  3VR9 A;  4IRU A;  1FAP B;  1Q0M A;  3PMR A;  4I3M A;  2VKH A;  4XAX B;  3UGO A;  3NRX A;  4U2Z A;  3NWI A;  2JPU A;  5FMN A;  4XEK A;  3TJ5 A;  3N5L A;  3W15 B;  3BQK A;  4PJN A;  2NW8 A;  4L6R A;  5JP7 A;  1SUM B;  3HNL A;  3J06 A;  1ST6 A;  3UU4 A;  3EPV A;  3PUS A;  3GN5 B;  1GQE A;  4JYA T;  5KYY A;  3RHW A;  4LLC A;  3PU8 A;  5AC4 A;  4IWB A;  1H7I A;  2ZM2 A;  1K40 A;  1LE4 A;  1IJ6 A;  2D4U A;  1I6Z A;  2FJD A;  2DHR A;  3UMI A;  5LOV E;  3CZ6 A;  1CPQ A;  2LJL A;  2YIN A;  2R7U A;  1BDJ B;  2EIJ C;  2N9D A;  3HKC E;  4Q5S F;  2VCB A;  4IJJ A;  4DVZ A;  4IB4 A;  1LI7 A;  5FXZ A;  3U3I A;  4DRJ B;  4IDP A;  1YDI A;  3ECS A;  1HE1 A;  3HLZ A;  1RJ9 A;  1M2O A;  2D5R B;  4ZEY A;  2YEV C;  5AQL B;  1Q0F A;  4ONS A;  5ADX L;  4W8P A;  4MTO A;  4L0R A;  5KYN A;  5GPG B;  1GS9 A;  3B13 A;  5L3F B;  3H2V A;  2YU1 A;  3Q6M A;  2DLR A;  2Q00 A;  2D9D A;  1I94 T;  2HZ8 A;  3P4W A;  3VAY A;  4AQY T;  2JD3 A;  3DI5 A;  5LG3 A;  3VR8 A;  3SWH A;  2E2A A;  4G63 A;  1US7 B;  3VF0 A;  1WR6 A;  2W00 A;  5JVD E;  5F5W A;  4P9F A;  2E5L T;  5A6A A;  2LE8 A;  3RKO F;  1PCX A;  4A5X A;  1TKN A;  1VMA A;  2IHR 1;  4H63 V;  1Q0D A;  4MBQ A;  3UUX B;  4DVD A;  4GOU A;  5LGN B;  5B1B C;  4XZC A;  3TQO A;  3OYZ A;  2XM1 A;  2WVO A;  3IPM O;  3SYN A;  2LOP A;  2R7Q A;  2CCQ A;  3HKK A;  5D91 A;  4EIY A;  4BJ5 C;  4FJO A;  5CA1 E;  5J0Z A;  2XL4 A;  4UEM A;  3EDV A;  2DB4 A;  2Y6X A;  1ZEE A;  1UCU A;  4DV6 T;  1N36 T;  5F5H A;  1N1C A;  3IEE A;  2KWI B;  2XXA A;  5F5F A;  2KW3 C;  3MFN A;  4CS7 A;  2B1E A;  2R7S A;  1LVK A;  3P7I A;  2P61 A;  3EFO A;  1FIO A;  3TLW A;  4TUY E;  3K3Q C;  3RIP A;  4JI0 T;  5AQN B;  4LLE A;  3U2M A;  3I0O A;  3S90 A;  4H4K C;  4U7I A;  1CPR A;  3ESL A;  3J7Y q;  3C63 A;  4ZI2 D;  3HKB E;  4OFZ A;  4YL3 A;  3U2L A;  2J7P A;  5LHG B;  3AE5 A;  3AOU A;  4YSZ A;  4TWH A;  1PD0 A;  3DP7 A;  2XUE A;  3E22 E;  3E9V A;  4LML A;  2Z6E A;  3ZCI A;  5LMU T;  4JE9 A;  5J2T E;  3RPU A;  3S0X A;  2OU6 A;  1XDO A;  2QUP A;  3C18 A;  3RYF E;  2Q7R A;  3L8I A;  2UUI A;  4IHJ E;  4CI2 B;  1G4W R;  3ETV A;  3WAQ A;  4AQF A;  2ZPA A;  2M67 A;  4WYV A;  5KYY B;  2CEA A;  1E1H B;  2LHN A;  2JIW A;  4YLH A;  4H9O C;  4YSX A;  3KDS E;  4DV7 T;  3ZG1 A;  2V7I A;  1WYC A;  4J2C A;  1RMV A;  3JT1 A;  4JV5 T;  2X9H A;  3JRM O;  4HWD A;  3R6N A;  1ZW3 A;  5LGU B;  3DXJ F;  4WBN E;  2NUT B;  3B71 A;  4H9Q C;  2UXB T;  1IAP A;  2Q4F A;  3IQ6 A;  4JRZ A;  2XLW A;  4Z9J A;  3HL6 A;  3LK2 B;  5KYX B;  3UUL A;  2XLO A;  1FMV A;  2W66 A;  2YLG A;  2R7O A;  3QVZ A;  3ZMZ B;  1MIV A;  1AEP A;  4IRE A;  4U5C E;  3MAC A;  4IAR A;  3HI2 A;  3PJA J;  4YJ2 E;  1XWM A;  2DCF A;  4I1O B;  3W2V A;  4JKV A;  3IHU A;  3VM6 A;  4U5G A;  2ES0 A;  5JRE A;  2JPF A;  4Z9I A;  4C3E A;  3A11 A;  4C7O A;  5LMN T;  3NRY A;  4J7T A;  3O1H A;  2YRF A;  3AE6 A;  4WGY A;  3CWZ B;  3A8Y C;  2W63 A;  3ANW A;  4NUV A;  3RYH E;  4PAG A;  4IGU A;  2WB7 A;  4QH1 A;  3VRB A;  3TLU A;  5L0C A;  2HV7 A;  4MFR A;  2XQY A;  5AGF A;  3R2P A;  5BQG A;  4AIU A;  5IWA T;  4E7S A;  4LDK A;  3HNK A;  4XEV A;  2XLE A;  3CAX A;  3ZJ1 A;  4NPP A;  4MVQ A;  5AQK B;  3MLG A;  2VCC A;  5AQJ B;  2KSF A;  2OV9 A;  2ZD9 A;  4UF0 B;  3C4Z A;  3ABL C;  3LK3 B;  1VK5 A;  4YT8 A;  1J5E T;  1HMD A;  3K3O A;  2WVQ A;  5HXS A;  4DV3 T;  3B0V C;  3PUA A;  1L0V A;  1X79 A;  4LFA T;  2K24 A;  2H7B A;  1CGM E;  3K6B A;  2ZLY A;  5FL0 A;  3A9C A;  3TJ6 A;  2J62 A;  2BL2 A;  2YVK A;  2BBJ A;  4UIG A;  2E87 A;  4YXD A;  3PJA A;  2A2F X;  4OYK A;  1TWC A;  2W2U A;  4DBQ A;  2E9X A;  4MTF A;  3NMK A;  4DR2 T;  2UUH A;  2R7V A;  3DM5 A;  4DV2 T;  1MMN A;  4H63 H;  4UVA B;  4TN7 B;  3P4Q A;  4WAB A;  3CIR A;  4NTB A;  2UXD T;  2YDS A;  4JEH B;  3IQT A;  1A0B A;  5AQM B;  3LBX B;  5AQO B;  3V5X A;  5JQG E;  4EWC A;  4Z9H A;  2R7W A;  4YJ3 E;  4UVC B;  3NKD A;  1D0Y A;  4PJL A;  3TD7 A;  5CB4 E;  1V54 C;  4L9I A;  2H88 A;  3QB5 K;  2CCY A;  3KBU A;  2WY2 A;  3C50 A;  4P6I C;  1G8X A;  2LSY A;  4OIN F;  3FZM B;  3UMH A;  4DV4 T;  3I9Y A;  4HWC A;  3IQC A;  4EXT A;  3AA1 B;  4JI5 T;  1UK5 A;  5CIV A;  5FY1 A;  3Q5E A;  3ASO C;  2LQG A;  3DD7 A;  2LRK A;  1VRB A;  1T72 A;  3AE4 A;  4KHP T;  4HFB A;  3JC6 D;  2IOQ A;  2J9W A;  4QWN B;  4AQG A;  5LCY A;  3T9O A;  2KZ7 B;  1D1C A;  4P0B A;  2C03 A;  1JR8 A;  4NTF A;  4LFB T;  3DKA A;  1Z23 A;  3KVB A;  2BBH A;  4WZX A;  3B0P A;  2GFH A;  3CPZ A;  1WCR A;  3S84 A;  1BR2 A;  2XL6 A;  4RBN A;  4FI5 A;  2W4M A;  2FGY A;  3AG4 C;  2R25 A;  3FHD A;  2UXN B;  2CBI A;  1L3P A;  4CDV A;  4OK0 A;  5HCM A;  1VOM A;  4K0U A;  5J1G A;  2OOC A;  3CSK A;  4QH4 A;  3ZSU A;  3AB3 B;  3FOP A;  4HE8 D;  2LSK A;  2ETS A;  3TOM A;  4E0I A;  4B3M T;  3GM2 A;  2Q9Q B;  4ZZB A;  4LER A;  1T7S A;  4O2A E;  5IYZ E;  5JDH A;  3G4X A;  3NZP A;  3PE0 A;  4ZLD A;  2B0J A;  2BG9 A;  4IE6 A;  3NG1 A;  2NSG A;  4CIH A;  5EHH A;  1SF8 A;  2PTF A;  2X68 A;  3O10 A;  3BK9 A;  3FBL A;  3QNU A;  1UX5 A;  2XSE A;  3KFW X;  2FUP A;  5LNK A;  3KH2 A;  5JR9 A;  1W09 A;  3DMD A;  1KNY A;  5LB7 B;  3PUX F;  3RX6 A;  3DJN B;  5CI8 A;  2XQ4 A;  1QSP A;  3M79 A;  3ONL C;  4DOZ A;  4HFI A;  3UFG A;  3JCF A;  2XLD A;  2C5J A;  5FNV E;  2RA1 A;  2WU5 A;  4B3T T;  1GQA A;  2KMF A;  2JRK A;  2WQY A;  3GWL A;  1M6T A;  4U9E A;  3ETU A;  3PUR A;  3C4W A;  2E9X B;  1OCO C;  3VRC A;  2R7T A;  1VB5 A;  1CGN A;  3I0Q A;  4A98 A;  2VH3 A;  1RKE B;  3FVY A;  3RRC A;  2BKO A;  1JAF A;  4YL0 A;  1XZP A;  4Q4Z F;  4IDZ A;  2H3R A;  1QLE C;  3WHN A;  3R84 B;  2MBG A;  3H65 A;  4UDV A;  3N9M A;  3RIU A;  3JAD A;  2F22 A;  3F46 A;  3U9J A;  1HW2 A;  2KSR A;  4U3C A;  3K7D A;  3AGU A;  2NW7 A;  1OED E;  3NMI A;  3DJB A;  1N32 T;  3EH1 A;  4F4B A;  1BR0 A;  2QTV A;  2C5I T;  4N4W A;  3NDB B;  5GON E;  1NG1 A;  4J30 B;  4N06 A;  3C8G A;  1XZY A;  4NUU A;  1ZHW A;  5DJQ C;  1UG7 A;  1QUU A;  5KYU B;  2ZXW C;  3POV A;  4AQF C;  4HEA J;  4E17 A;  3UU5 A;  5L3D B;  2R7X A;  1MMG A;  5ABF B;  4JZA A;  2YKZ A;  4QXC B;  4JI4 T;  2IUB A;  2LEH A;  2DWK A;  5HXR A;  3U9M A;  3C4X A;  4O8S A;  2ZXR A;  5ABE A;  1T9K A;  4MND A;  3GN5 A;  5HEO A;  2X0C A;  1KFY A;  5EZY E;  3VRA A;  5M4Y A;  3NMJ A;  3GEE A;  2GK9 A;  1C17 M;  3P4S A;  3QC9 A;  3ZT5 A;  2CDQ A;  1YZA A;  2JMK A;  2VB6 A;  1LM3 B;  4QX8 B;  3AED A;  1UFB A;  4ZS3 A;  1AJ3 A;  4U5D E;  4DJ9 A;  5F28 E;  4EED A;  5IUX A;  2NG1 A;  3MBG A;  3FMS A;  3GOD A;  4HWF A;  1OW8 A;  1XNQ T;  4LMK A;  2EHO D;  4EV6 A;  1U0B B;  3LK4 2;  4A2N B;  1I5N A;  4H9R C;  4UV8 B;  4K0K T;  3JZ0 A;  1WGW A;  4AKL A;  3FZL B;  4CQI A;  4W8K A;  3M15 A;  1HMO A;  3UU8 A;  2H7O A;  1V9D A;  3C98 B;  1GM5 A;  4HEA A;  3RVZ A;  3M1C B;  2Y3B A;  2WDR A;  2OLT A;  4CX9 A;  3HKD E;  2J9U A;  1FJG T;  5E3C A;  4CN6 A;  4GYR A;  2BS2 A;  4YSY A;  5ABG A;  4ILC A;  2Q9A A;  3CK6 A;  3JYY A;  1OKK D;  2BDE A;  2HS5 A;  3ZTZ A;  1YAU O;  1HNX T;  5B3S C;  3RLF F;  1A7V A;  1YKE B;  3PUZ F;  4BAY B;  3GEH A;  1MIW A;  3SRZ A;  1NZE A;  2KC3 A;  1Z3I X;  3AEF A;  1HG5 A;  3EDU A;  2N1G A;  1N34 T;  1A7D A;  2RP4 A;  3CML A;  5JSL A;  4CS9 A;  1DOV A;  1NFN A;  2E9X C;  2VL0 A;  5HSW A;  4I1M A;  4AL1 A;  4CDA A;  3EHN A;  5KX5 E;  3V7O A;  2IXM A;  4O2B E;  2IAK A;  4ERR A;  1K05 A;  5F8P A;  1ZHX A;  2M6B A;  2VKO A;  5AQI B;  3UUM A;  2CNW A;  4TNW A;  4DR6 T;  2BZB A;  3AEB A;  4H9N C;  1WAS A;  4OIP F;  2XM2 A;  5EK2 A;  2XHE B;  1FEW A;  3AE3 A;  5AQU B;  1RCP A;  4O7G A;  3DTO A;  2J4G A;  1OED B;  3N2O A;  3U5S A;  2V5D A;  4TNV A;  4HFH A;  1J5W A;  3L34 A;  2XAG B;  3RI5 A;  3FAP B;  4DV0 T;  4IE0 A;  3T6J A;  4IE4 A;  3ATP A;  3TK0 A;  3N9Q A;  4UXN B;  5JS5 A;  4YT4 A;  3PU3 A;  3EGD B;  4BPM A;  4LF5 T;  3U78 A;  1WLX A;  2M64 A;  4M1P A;  2AWC A;  3K1H A;  2X9X A;  4DR1 T;  2JQQ A;  3X2Q C;  4CBE A;  3CX7 B;  4EYU A;  1TWG A;  3LS0 A;  3EG9 B;  1HW1 A;  5L0D A;  2KYH A;  1IBK T;  4EOZ B;  3BQL A;  4ILA A;  1VYI A;  1EZ3 A;  1KNP A;  3GA8 A;  4CZZ B;  4X64 T;  1QKR A;  2XSA A;  4QI0 A;  2XM4 A;  1W0B A;  2FFH A;  3EZH A;  2NUT A;  2WDV A;  5LBQ B;  1HNW T;  1FFH A;  1SHZ C;  2HJM A;  2IXO A;  5KYX A;  2MPK A;  3ZIB A;  2HUJ A;  4OHF A;  1UUS A;  2X0Y A;  4ZOL E;  4LFC T;  4ULW A;  3FXH A;  3EI0 A;  1ORJ A;  2KIN B;  4GK0 E;  1YLM A;  2B76 A;  3WAK A;  5L0G A;  3WG7 C;  3AG3 C;  3ZN0 B;  4YHJ A;  4DND A;  2J9V A;  4JC7 A;  4C91 A;  2IBF A;  2BG9 C;  2XQA A;  4F6R C;  4IDN A;  4HKA A;  4ADZ A;  4CXW A;  2LD6 A;  4PK4 A;  5EK4 A;  5LGT B;  4YY3 T;  4UV9 B;  2JJ9 A;  2M4E A;  3DAF A;  1L7C A;  3QW1 A;  4J7Y A;  2XQ9 A;  3H3A A;  5JTG A;  3OA1 A;  5JR9 C;  4NXN T;  4PJM A;  3C7J A;  5AQF B;  4HGA A;  5COG A;  3W8I A;  5LG4 A;  5FXV A;  1T98 A;  4U33 A;  2CYD A;  4O6M A;  2XAQ B;  1XZQ A;  2G0U A;  3JCU Q;  1BR1 A;  3SOL A;  3T6B A;  2X0H A;  2PFD A;  4EBK A;  4UF0 A;  5FY7 A;  3W4Y A;  1Z7Q c;  2GA0 A;  3AGT A;  4BJN A;  2UUA T;  3CQX C;  2XRH A;  3L09 A;  4JUY A;  2W4X A;  3ZLI A;  3K66 A;  4Z90 A;  4JLE A;  2W67 A;  1E7P A;  4E0H A;  3L8R A;  3HTK C;  5JDQ A;  3T6G B;  1ZHZ A;  2YLD A;  5DS5 A;  2LM9 A;  2JQK A;  3O9X A;  1HX8 A;  3RIU C;  4NC3 A;  2KND A;  3C62 A;  2DWG A;  2XL8 A;  4JTC B;  2BKN A;  1EA8 A;  4HFF B;  3HKE E;  3N2G E;  4U2Y A;  3ZT7 A;  2Q3T A;  1RXQ A;  5JT4 A;  3NKE A;  2NP9 A;  3G50 A;  3Q7G A;  5CFB A;  2CRB A;  3NYM A;  3RF3 A;  2Y3G A;  5AQT B;  2LP4 A;  2HN1 A;  2L9Q A;  3I5P A;  4NY3 A;  5DLJ A;  3FHN A;  3SXM A;  2OCC C;  4P9T A;  3RYC E;  3I4U A;  4CIP A;  3LBX A;  2BVM A;  3NVO A;  5CJ5 A;  1U5P A;  2EIM C;  3S4U A;  3UUN A;  2J9B A;  3X1O A;  5AQR B;  5JDN A;  3JTL O;  4ZXL A;  4DR5 T;  2WL8 A;  5HWY A;  4ZZC A;  1YYJ A;  5J2U E;  1HS7 A;  1MIY A;  2W4B A;  3LLI A;  5A6J A;  4C3D A;  2LFF A;  2V3C C;  3L39 A;  1TFK B;  3LJC A;  4RDA A;  4PK5 A;  3KYI A;  4WJ0 A;  3S28 A;  2L8K A;  4I0U A;  2C5K T;  5A6B D;  4O4J E;  3I1A A;  2PX3 A;  5ABH A;  3ABM C;  4XTK A;  4DMV A; 
#chains in the Genus database with same CATH homology
 2A72 A;  1ZHC A;  1D1A A;  3F2E A;  2DNX A;  3ZC4 A;  3OWT A;  4X1K E;  2LSE A;  5DQW A;  2J0X A;  2D0U A;  2Q9Q A;  4TV8 E;  4FES A;  2Z15 A;  3UGP A;  4ASK A;  4OYJ A;  1HG2 A;  3MKD A;  2Y39 A;  1IJ5 A;  3ITF A;  1IW7 F;  1TWA A;  5KYW B;  4UVB B;  3Q5X A;  3AAE B;  3I5Q A;  3MA9 A;  3RYL A;  5H6Q B;  3B9Q A;  2Y8D A;  2PF4 E;  4YFS A;  4RD9 A;  4CS9 C;  1M2V B;  2NUP B;  5L3Q A;  2V7K A;  1OCR C;  3O4X E;  4G2A A;  2EIL C;  3N0T A;  3ASN C;  5HXC A;  3N9P A;  1IZN B;  2EHO B;  2IW5 B;  4L5G A;  4EZ4 A;  1CUN A;  3AQB A;  2DI4 A;  4YJW A;  2D0T A;  2HPL A;  1FTS A;  2BVL A;  4IE7 A;  3FDQ A;  2ODV A;  2IYL D;  2I59 A;  4O6Y A;  2HH7 A;  5KYU A;  3S29 A;  4DVY P;  3VHL A;  4QX7 B;  2DYS C;  2EIN C;  3AA0 B;  3Q9D A;  2J1D G;  4Q7C A;  4IST A;  4X20 E;  5JDF A;  4C3B A;  4A56 A;  2YHS A;  4WW0 A;  3FXE B;  1ZYR F;  5FXX A;  2A3D A;  2PJQ A;  4EAH A;  3ZVR A;  1OCZ C;  5DVW A;  2LOS A;  1D0Z A;  3RC8 A;  2PG8 A;  3B0U X;  4XBF B;  2WVN A;  3A5X A;  2YZS A;  2CW0 F;  3DM9 B;  3EJN A;  2PFV A;  3L3P A;  4AK9 A;  2NW9 A;  2X67 A;  5LBM A;  2WSS V;  3LJB A;  1O87 A;  4KC9 A;  4JW1 A;  1H7C A;  2A69 F;  1V55 C;  1MMA A;  1SA0 E;  5EGY A;  3TKL B;  2V7J A;  3RFY A;  2IXP A;  4EIW A;  5IHY A;  3O1J A;  5KDM C;  1IZM A;  5T1D B;  3VKH A;  3CQC B;  4MAL A;  2QGS A;  2UXX B;  3N9N A;  3DJU B;  4K7B A;  3N2K E;  1FFT C;  4H9P C;  4JUR I;  3LAY A;  4KMC A;  3W2W A;  3E08 A;  1TR2 A;  1ZU5 A;  2CE7 A;  3NYL A;  2L9J A;  2QA7 A;  2YU2 A;  1B7T A;  3ZN1 B;  3CQZ A;  2J46 A;  4ZI3 C;  3PUQ A;  4HN9 A;  2PBI A;  2LSJ A;  3LNR A;  3S27 A;  1SMY F;  4O4L E;  3CVR A;  3UT5 E;  4YT2 A;  3AA7 B;  3GMI A;  2X51 A;  3Q2M A;  3EGD A;  5JH7 E;  5E0O A;  3V5U A;  4AE4 B;  2MYS A;  5E3A A;  3Q7L A;  3AG1 C;  3EG9 A;  3PDY A;  4QHO A;  3E70 C;  3UR3 C;  2CXD A;  1MMD A;  4HFK B;  3VKG A;  3JRT A;  3WAJ A;  4CSA A;  3CQG B;  1Z0P A;  4PNI A;  2CXL A;  4PFO A;  5DAB A;  4OIR F;  5FYM A;  2Q9Q C;  4ILU A;  2G3V A;  1ZHY A;  3AQC A;  3E0Z A;  3EQL F;  2J7P D;  3ZMV B;  4ANJ A;  5JRC B;  4HFV A;  4I44 A;  4YT5 A;  4PJJ A;  1Z6A A;  4AKG A;  4BEJ A;  3KMI A;  4KI2 A;  1LKX A;  4N78 D;  4U5B E;  3MX3 A;  3N9O A;  3EZI A;  2JMH A;  2W9Y A;  3F31 A;  2WZF A;  1NAF A;  3KL4 A;  4ZLC A;  3LEV A;  4O6N A;  1U4Q A;  3KIN B;  4XWJ A;  2BE5 F;  2W62 A;  3NRH A;  3LFM A;  4IIJ E;  3RKO A;  5TAO A;  5IY5 C;  2D2S A;  3OJA A;  2G3K A;  5HXE A;  1M57 C;  2VKD A;  4FWV A;  2W61 A;  4IE5 A;  4O4H E;  3P8C D;  4P09 A;  4G7O F;  3SNH A;  2MOZ A;  2XTL A;  3RRW A;  4O79 A;  3UTK A;  2C0S A;  3AAA B;  4HE8 A;  5C8Y E;  2IC6 A;  2X0L B;  4CI3 B;  1QZX A;  3SEO A;  3ZC1 A;  1J8Y F;  3N24 A;  4GK5 E;  4IAO A;  2WMN A;  4P0A A;  4XLP F;  3OYX A;  4QI2 A;  1HTJ F;  3ZJ2 A;  5LYJ E;  4BJ1 A;  3EGX B;  2NTY A;  3N9L A;  5FP3 A;  4M63 A;  3SS1 A;  3QMK A;  5L2L A;  4OD4 A;  4DBR A;  5A1L A;  1LS1 A;  5BMV E;  5JDL A;  4OD5 A;  3IBP A;  3KKB A;  2R7R A;  4JCH A;  4AKI A;  4CI1 B;  2Y3H A;  1WRD A;  2KLQ A;  4KNW A;  4OIQ F;  1HF8 A;  1YD8 G;  4YWQ A;  2W45 A;  2E9X D;  5B1A C;  4ZI2 C;  4BJ6 C;  2V1D B;  2P9B A;  4ZS2 A;  2K5B B;  2LHR A;  2HPJ A;  3HA4 A;  2ZM8 A;  4K0D A;  4X0R A;  2WM9 A;  4MHC A;  3UFE A;  5FY0 A;  2WWU A;  3I9W A;  3IHR A;  4AKH A;  3CX8 B;  3FB2 A;  3PUG A;  2VL8 A;  1NU9 C;  2PP4 A;  4KNV A;  1PD1 A;  5T3T A;  2XAH B;  2L3L A;  3L0I A;  3LS1 A;  2N2N A;  5HYA A;  4AXP A;  4QXB B;  4FX5 A;  5KYW A;  4KP3 C;  5LHI B;  3LES A;  3EH2 A;  4QDL A;  3MXZ A;  2A6H F;  1MNE A;  2MWQ A;  5DQZ A;  4ZI7 E;  2A6E F;  2OA5 A;  1M2V A;  4WBO A;  3CKD A;  1BR4 A;  2NUP A;  2P6V A;  3T8O A;  2LSG A;  3W8H A;  2ACX A;  3WI3 A;  1KU2 A;  4B6I A;  2EHO A;  3LG7 A;  5L3E B;  3RC3 A;  2KJG A;  4QXH B;  2IXN A;  2LSI A;  1QSD A;  1OXZ A;  4J32 B;  4WNK A;  3QZC A;  4BJM A;  3SZR A;  3ZMU B;  3Q6N A;  4PFP A;  4CS8 C;  5L3G B;  3K33 A;  2KNH A;  2G62 A;  3JYH A;  2WAU A;  5DS4 A;  1OKK A;  1D1B A;  3HR0 A;  4U5E E;  1SZI A;  5CA0 E;  4XLN F;  3AVS A;  2O9X A;  3J9X 1;  4I50 E;  2ZXP A;  4C90 A;  4U74 A;  4U72 A;  4CSA C;  3ONX A;  3IF8 B;  3JSZ A;  2L81 A;  1G73 A;  3OKQ A;  2HV6 A;  1RJ9 B;  2SPC A;  1LVF A;  2KT9 A;  5HAX A;  4TV9 E;  1FMW A;  3EUH A;  2YK0 A;  1D0X A;  3Q5W A;  4I55 E;  4I43 B;  2ZXO A;  2QY9 A;  2J45 A;  4TX5 A;  3FAJ A;  4B6X A;  4KUM B;  1S7Z A;  1O5H A;  5ETW A;  1JPJ A;  3MK7 C;  4DMW A;  1ZKE A;  3K3N A;  2XAJ B;  3JC6 C;  2Y3D A;  3DAG A;  3VU7 H;  4AX2 A;  2OG2 A;  3SP1 A;  4GYS A;  3ZMT B;  5D92 A;  2XXA B;  1Z63 A;  2KQ9 A;  2I8B A;  2Y69 C;  1O3X A;  3EFO B;  4YN0 B;  2K48 A;  2Y48 B;  4BJT A;  3NZQ A;  2ODU A;  4CXX A;  2J0W A;  4KBL A;  2H7V C;  2MTQ A;  4EB6 E;  5H6R B;  2PX0 A;  3KV9 A;  3PHF 2;  4X1I E;  2EIK C;  5L3B B;  2VK9 A;  2ZMA A;  1TWH A;  4QKN A;  4AE4 A;  3UMK A;  1OCC C;  2WZG A;  3KV4 A;  4O4I E;  2VKJ A;  4U5H A;  3NBX X;  4G0H A;  5JDG A;  2D5U A;  2P7V A;  2NWB A;  2V26 A;  4MLK A;  3KV5 A;  3ZYL A;  4PK6 A;  1W2W A;  3KV6 A;  4HTE A;  1YW0 A;  3N2Z B;  3PTR B;  4ISS A;  2V7L A;  3ZYM A;  4BA9 A;  1ZV4 X;  5JDM A;  2WBL A;  2CNW D;  3UNG C;  4BJ6 A;  2W0G A;  4CXY A;  5LA6 E;  1HCI A;  4V1A v;  5HXH A;  4KBM B;  3MJX A;  4C7O B;  3ZMS B;  5JRC A;  5HWX A;  2V7M A;  3ANW B;  2WZL A;  2YEV A;  2C04 A;  3WOD F;  4I4T E;  2A1D D;  4MQ9 F;  4AKR B;  3KVA A;  4JJG A;  3AA6 B;  3HJC A;  5EK3 A;  4DO0 A;  4AI6 A;  3ZYK A;  3LLK A;  2NOX A;  3B57 A;  4BJ5 A;  5LHH B;  2EHO C;  2NTX A;  3K1I C;  3RYI E;  3RH3 A;  2CWY A;  2CA5 A;  3K8P C;  2KWH A;  2VAS A;  5BUO A;  3MZK B;  3O1I A;  2A68 F;  2WMO A;  2ZM0 A;  3KBT A;  5AFU L;  2CLY B;  4G7Z F;  3DZA A;  1S35 A;  3C51 A;  3ZEF B;  1J8M F;  2K9A A;  4OIO F;  4UEL A;  3EHM A;  3VYW A;  3AAI A;  1M56 C;  2VWA A;  4GIW A;  1KNZ A;  3NYJ A;  4EZH A;  3ZC0 A;  4CS8 A;  2CGE A;  3EGX A;  4GEH A;  2XAF B;  1NWM X;  3C64 A;  5DS6 A;  4EYY R;  4BG0 A;  1UX4 A;  3FXD B;  2CXF A;  1LRZ A;  5DQT A;  2Q9C A;  3OEO A;  3BQI A;  3GWH A;  3FBZ A;  2XAS B;  5CI9 A;  4H9S E;  3V5S A;  3F47 A;  4JEU B;  1ZHT A;  4JVS A;  4Z8X A;  3GAN A;  2X9Y A;  1JPN A;  5F3J A;  5LP6 E;  4ZI3 D;  5FXW A;  5T3W A;  1VYK A;  5LJN A;  4U5F E;  4JJF A;  2X66 A;  4PW8 A;  4G7H F;  3M65 A;  1MND A;  2IC9 A;  4GYT A;  5LXT E;  5E33 A;  3O6X A;  2DGJ A;  4X1Y E;  4E7Z A;  5JR9 B;  4EBB A;  2CM0 A;  2KXP B;  3F57 A;  5L3V A;  3ZCJ A;  5E2Q A;  3QUJ A;  5KMG P;  3CX6 B;  1ZU4 A;  2Q9B A;  5FCL A;  3ZPO A;  1WYB A;  1OWA A;  1Z5Z A;  2KGO A;  4LAC B;  3OBV E;  1Y64 B;  3H37 A;  3AVR A;  2X9W A;  3EVY A;  3AG2 C;  3O39 A;  3QK6 A;  5L3C B;  2DYR C;  1NU7 D;  1KK7 A;  1HFA A;  3D0T A;  3T4R A;  2CLY C;  5DQV A;  2LT3 A;  2CWO A;  3ABK C;  4TZ4 C;  5LJM A;  1S94 A;  2Q9Q D;  2E8I A;  1YKH B;  2CMR A;  4ZHQ E;  4IRU A;  3PMR A;  4I3M A;  2VKH A;  4XAX B;  3UGO A;  3NRX A;  5FMN A;  3N5L A;  3W15 B;  3BQK A;  4PJN A;  2NW8 A;  1ST6 A;  3EPV A;  3PUS A;  3GN5 B;  5KYY A;  4LLC A;  3PU8 A;  4IWB A;  2ZM2 A;  1IJ6 A;  2DHR A;  3UMI A;  5LOV E;  3CZ6 A;  2LJL A;  2YIN A;  2R7U A;  2EIJ C;  2N9D A;  3HKC E;  4Q5S F;  4IJJ A;  4DVZ A;  5FXZ A;  3U3I A;  3ECS A;  3HLZ A;  1RJ9 A;  1M2O A;  2D5R B;  2YEV C;  5ADX L;  5KYN A;  4L0R A;  3B13 A;  5L3F B;  2YU1 A;  3Q6M A;  2DLR A;  3VAY A;  2JD3 A;  3SWH A;  4G63 A;  1US7 B;  1WR6 A;  2W00 A;  5JVD E;  2LE8 A;  3RKO F;  1PCX A;  1TKN A;  1VMA A;  4H63 V;  4MBQ A;  3UUX B;  4DVD A;  4GOU A;  5LGN B;  5B1B C;  4XZC A;  3OYZ A;  2WVO A;  3SYN A;  2LOP A;  2R7Q A;  2CCQ A;  5D91 A;  4BJ5 C;  4FJO A;  5CA1 E;  2XL4 A;  4UEM A;  3EDV A;  2Y6X A;  1ZEE A;  1UCU A;  5F5H A;  1N1C A;  3IEE A;  2KWI B;  2XXA A;  5F5F A;  2KW3 C;  4CS7 A;  2R7S A;  2B1E A;  1LVK A;  3P7I A;  3EFO A;  1FIO A;  4TUY E;  3K3Q C;  3RIP A;  4LLE A;  3I0O A;  4H4K C;  3ESL A;  3J7Y q;  4ZI2 D;  3HKB E;  4OFZ A;  2J7P A;  5LHG B;  1PD0 A;  3DP7 A;  2XUE A;  3E22 E;  3E9V A;  2Z6E A;  3ZCI A;  5J2T E;  3RPU A;  3S0X A;  3RYF E;  4IHJ E;  4CI2 B;  3ETV A;  4AQF A;  2ZPA A;  2M67 A;  5KYY B;  2CEA A;  1E1H B;  2LHN A;  4YLH A;  4H9O C;  3KDS E;  3ZG1 A;  2V7I A;  1WYC A;  4J2C A;  3JT1 A;  2X9H A;  3R6N A;  5LGU B;  3DXJ F;  4WBN E;  2NUT B;  4H9Q C;  1IAP A;  3HL6 A;  3LK2 B;  5KYX B;  3UUL A;  1FMV A;  2R7O A;  4U5C E;  3ZMZ B;  1MIV A;  3MAC A;  3HI2 A;  4YJ2 E;  2DCF A;  4I1O B;  3W2V A;  4U5G A;  2ES0 A;  5JRE A;  2JPF A;  4C3E A;  4C7O A;  3NRY A;  3O1H A;  3CWZ B;  2W63 A;  3ANW A;  4NUV A;  3RYH E;  4PAG A;  4IGU A;  2WB7 A;  2HV7 A;  4MFR A;  2XQY A;  4E7S A;  3ZJ1 A;  3MLG A;  4UF0 B;  3C4Z A;  3ABL C;  3LK3 B;  1VK5 A;  4YT8 A;  3K3O A;  2WVQ A;  5HXS A;  3B0V C;  3PUA A;  1X79 A;  2K24 A;  2H7B A;  3K6B A;  2ZLY A;  4UIG A;  2E87 A;  2A2F X;  4OYK A;  1TWC A;  4DBQ A;  2E9X A;  2R7V A;  3DM5 A;  1MMN A;  4H63 H;  4UVA B;  4TN7 B;  4JEH B;  3LBX B;  5JQG E;  4EWC A;  2R7W A;  4YJ3 E;  4UVC B;  3NKD A;  1D0Y A;  4PJL A;  3TD7 A;  5CB4 E;  1V54 C;  4L9I A;  3KBU A;  3C50 A;  4P6I C;  1G8X A;  2LSY A;  4OIN F;  3UMH A;  3I9Y A;  4EXT A;  3AA1 B;  5FY1 A;  3ASO C;  3DD7 A;  1VRB A;  3JC6 D;  2IOQ A;  2J9W A;  4QWN B;  4AQG A;  5LCY A;  2KZ7 B;  1D1C A;  4P0B A;  2C03 A;  1Z23 A;  3KVB A;  3B0P A;  2GFH A;  3CPZ A;  1BR2 A;  4RBN A;  4FI5 A;  2W4M A;  2FGY A;  3AG4 C;  3FHD A;  2UXN B;  4OK0 A;  1VOM A;  4K0U A;  5J1G A;  3CSK A;  3ZSU A;  3AB3 B;  4HE8 D;  2LSK A;  2Q9Q B;  4LER A;  4O2A E;  5IYZ E;  5JDH A;  3NZP A;  3PE0 A;  4ZLD A;  2B0J A;  4IE6 A;  3NG1 A;  4CIH A;  5EHH A;  1SF8 A;  2X68 A;  3BK9 A;  3FBL A;  1UX5 A;  2XSE A;  3KFW X;  5LNK A;  3KH2 A;  5JR9 A;  3DMD A;  3RX6 A;  3DJN B;  5CI8 A;  4DOZ A;  2C5J A;  5FNV E;  2RA1 A;  2KMF A;  2JRK A;  3ETU A;  3PUR A;  3C4W A;  2E9X B;  1OCO C;  2R7T A;  3I0Q A;  2VH3 A;  3FVY A;  3RRC A;  4Q4Z F;  4IDZ A;  2H3R A;  1QLE C;  3R84 B;  2MBG A;  3H65 A;  3N9M A;  3F46 A;  3K7D A;  2NW7 A;  3DJB A;  3EH1 A;  4F4B A;  1BR0 A;  2QTV A;  2C5I T;  3NDB B;  5GON E;  1NG1 A;  4J30 B;  4N06 A;  4NUU A;  1ZHW A;  5DJQ C;  1QUU A;  5KYU B;  2ZXW C;  3POV A;  4AQF C;  4HEA J;  5L3D B;  2R7X A;  1MMG A;  4JZA A;  4QXC B;  2LEH A;  2DWK A;  5HXR A;  3C4X A;  4O8S A;  2ZXR A;  4MND A;  3GN5 A;  5EZY E;  5M4Y A;  2GK9 A;  3QC9 A;  2CDQ A;  2JMK A;  2VB6 A;  4QX8 B;  4ZS3 A;  1AJ3 A;  4U5D E;  2NG1 A;  3GOD A;  2EHO D;  3LK4 2;  4A2N B;  4H9R C;  4UV8 B;  1WGW A;  4AKL A;  4CQI A;  4W8K A;  2H7O A;  1V9D A;  3C98 B;  4HEA A;  3M1C B;  2Y3B A;  3HKD E;  2J9U A;  5E3C A;  4GYR A;  2Q9A A;  1OKK D;  2BDE A;  5B3S C;  1YKE B;  4BAY B;  1MIW A;  3SRZ A;  1NZE A;  1Z3I X;  1HG5 A;  3EDU A;  2N1G A;  2RP4 A;  3CML A;  4CS9 A;  2E9X C;  5HSW A;  4I1M A;  3EHN A;  5KX5 E;  3V7O A;  2IXM A;  4O2B E;  2IAK A;  4ERR A;  5F8P A;  1ZHX A;  3UUM A;  2VKO A;  2CNW A;  2BZB A;  4H9N C;  4OIP F;  5EK2 A;  2XHE B;  1FEW A;  4O7G A;  3DTO A;  3N2O A;  3L34 A;  2XAG B;  4IE0 A;  3T6J A;  4IE4 A;  3N9Q A;  4UXN B;  4YT4 A;  3PU3 A;  3EGD B;  3U78 A;  1WLX A;  4M1P A;  3K1H A;  2X9X A;  2JQQ A;  3X2Q C;  4CBE A;  3CX7 B;  4EYU A;  1TWG A;  3LS0 A;  3EG9 B;  4EOZ B;  3BQL A;  1VYI A;  1EZ3 A;  3GA8 A;  4CZZ B;  4QI0 A;  2NUT A;  2FFH A;  3EZH A;  5LBQ B;  1FFH A;  1SHZ C;  2IXO A;  5KYX A;  3ZIB A;  4OHF A;  4ZOL E;  4ULW A;  2KIN B;  4GK0 E;  3WAK A;  3WG7 C;  3AG3 C;  3ZN0 B;  4YHJ A;  4DND A;  2J9V A;  4C91 A;  4F6R C;  4HKA A;  4ADZ A;  4CXW A;  4PK4 A;  5EK4 A;  5LGT B;  4UV9 B;  2JJ9 A;  2M4E A;  3DAF A;  3H3A A;  3OA1 A;  5JR9 C;  4PJM A;  4HGA A;  3W8I A;  5LG4 A;  5FXV A;  1T98 A;  4O6M A;  2XAQ B;  2G0U A;  3JCU Q;  1BR1 A;  3SOL A;  3T6B A;  2PFD A;  4UF0 A;  5FY7 A;  4BJN A;  3CQX C;  2XRH A;  3L09 A;  4JUY A;  3ZLI A;  3K66 A;  4JLE A;  3HTK C;  5JDQ A;  1ZHZ A;  5DS5 A;  2LM9 A;  3O9X A;  1HX8 A;  2KND A;  2DWG A;  4HFF B;  3HKE E;  3N2G E;  2Q3T A;  3NKE A;  2NP9 A;  3Q7G A;  3NYM A;  2Y3G A;  3I5P A;  2L9Q A;  4NY3 A;  5DLJ A;  3FHN A;  2OCC C;  3RYC E;  3I4U A;  3LBX A;  2BVM A;  1U5P A;  2EIM C;  3S4U A;  3UUN A;  3X1O A;  5JDN A;  2WL8 A;  5HWY A;  5J2U E;  1HS7 A;  1MIY A;  2W4B A;  3LLI A;  4C3D A;  2V3C C;  3LJC A;  4RDA A;  4PK5 A;  4WJ0 A;  3S28 A;  2L8K A;  2C5K T;  4O4J E;  3I1A A;  2PX3 A;  3ABM C;  4XTK A;  4DMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...