3IEEA

Crystal structure of an alpha helical protein (bf3319) from bacteroides fragilis nctc 9343 at 1.70 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
256
structure length
256
Chain Sequence
VSTADIENAAEVIKYYNTSLGVLKDMVKEKDVNAVLDYMEQKGKTPALSAIVPPAVVSKDSAIVLNPGNCFNEETRRNLKQNYTGLFQARTEFYANFDTYLSYLKKKDVTNAKKLLDVNYQLSTQMSEYKQNIFDILSPFTEQAELVLLVDNPLKAQIMSVRKMSSTMQSILNLYARKHRMDGPRIDLKVAELTKQLDAAKKLPVVNGHEGEMKSYQAFLSQVETFIKQVKKVREKGEYSDADYDMLTSAFETSII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative exported protein
publication title Crystal structure of hypothetical protein BF3319 from Bacteroides fragilis (YP_212931.1) from Bacteroides fragilis NCTC 9343 at 1.70 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Structural genomics, unknown function
total genus 104
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ieeA02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ieeA01
4YJWA 3RH3A 3IEEA
chains in the Genus database with same CATH superfamily
3C51A 4CI2B 1WFDA 4CJGA 4DV0T 3SXZA 4QX8B 4CS7A 3MX3A 2L7AA 3TD7A 4CQIA 4MFRA 2PF4E 1OXKA 2VCBA 3UUBA 4JEBA 5HWYA 4CN6A 1QLBA 3CQXC 4DVDA 3ZTMA 1OW8A 4ULVA 4CIPA 2UUBT 3SEOA 3GEIA 4QHOA 5JRCB 2H7VC 3J7Yq 3LBXA 3TLTA 4IE4A 2YL3A 1SE7A 4LDRA 3K7DA 1ZHTA 3AB3B 3PUGA 2Y39A 3ZMTB 4DV3T 1PV3A 1HG5A 1JOGA 2XS1A 2Y69C 4TWHA 2IC6A 4MVRA 1S7ZA 3DKAA 2YWAA 2WY2A 3ZDLA 3LNRA 1X9BA 1HNZT 3ZYMA 4C7OA 4JI2T 3Q5EA 4DMVA 1FFTC 3PDMP 4OIPF 3K3QC 2VKHA 2XQ6A 3GM2A 2LT3A 4XLNF 1WGWA 4AI6A 4ULWA 5C2TA 5FVLA 1T6QA 2BG9A 2EPKX 2W4BA 4LF9T 4XEVA 2J1DG 3SZRA 3B0VC 3EDUA 5F5HA 3CPZA 1H9TA 4GKJT 3AECA 5AQOB 5L0IA 2JD3A 4YTNA 2Y3HA 5CJ5A 2E9XB 5HXCA 2HSQA 2QY9A 1WR0A 3DAFA 2K5BB 4U5EE 2V3CC 2XQ9A 5DQVA 2HJMA 4IREA 3QTHA 1ZHXA 2Q9AA 2Q4FA 4L6RA 2XL8A 1G4US 1XZQA 4J2CA 3Q7LA 3AE5A 2OLTA 2GA0A 5K0IA 2KINB 4XAXB 1A7DA 3NMKA 2P9BA 4YWQA 3JC6C 2V7LA 4RBNA 3UMIA 4XEKA 5A6KA 1MMAA 2AWCA 2HV7A 1Z7Qc 2V7MA 3VRBA 2NUTA 2JQQA 5HCJA 4ZZBA 4XPXA 3AA7B 5J0ZA 1SUMB 4AK9A 5C8YE 1APCA 4AKHA 4O4IE 5L3FB 1GS9A 3P4SA 1HS7A 1D0XA 4X65T 4ZS2A 1U6HA 3I9YA 256BA 2VCCA 4W8PA 1IW7F 3P4WA 2J9BA 3MZKB 2MWQA 3ANWA 3CQCB 1E1HB 4U5CE 4HKAA 1YZCA 5HEUA 1XMQT 3E9VA 5B3IA 4C91A 4I50E 1NU9C 4AISA 2DNXA 2K48A 4YT2A 3B13A 1MMGA 3AE6A 4BEMJ 2BVMA 1SR2A 3ZYLA 3LESA 5EHHA 2XQYA 3AJMA 1YA9A 4G7OF 3ZIBA 3ETVA 4MLKA 5HXEA 1J8YF 1TKNA 4CS9C 2W66A 3A5XA 4N6CA 4ILAA 3UUMA 2YL7A 3K6BA 1E85A 1YKEB 4QXBB 5L3VA 2W2UA 3I5QA 1W9RA 3SXYA 4C3BA 2MBGA 3ATPA 2X68A 4HFCA 2J46A 4EZHA 3DMDA 2GFHA 3OA1A 2WZLA 2LSIA 2X51A 4CN1A 5JDMA 4IL9A 5LBQB 4LF4T 3AAAB 2OA5A 4NTFA 4DRIB 2LM9A 2C5KT 4PJLA 5JREA 4MTFA 2NSFA 5ETWA 4RDAA 4NQFA 3ZVRA 4QWNB 2XLEA 1L7CA 2J9WA 4L0RA 4P09A 4DNDA 1MMNA 2IUBA 2L6FA 3NYMA 5CA0E 2OV9A 1LKXA 3K1IC 3B71A 2BVLA 3N2GE 1N36T 4JV5T 5HV9A 2X9XA 3AEAA 1PCXA 1QUUA 3ZC0A 4GYRA 3RH3A 2XSAA 2CW0F 2IM8A 1QVXA 3GORA 2LCHA 2KT9A 1IJ6A 1D0ZA 3KBTA 3Q5WA 5AC5A 2LD6A 2WZIA 4ANJA 2VKDA 2UU9T 1RJ9A 4BA9A 4JC7A 1MIYA 2HS5A 1FIOA 3T6BA 3CSKA 3KV5A 1CUNA 3DM9B 2DB4A 4G7HF 1IBMT 3DP7A 1N32T 5H6QB 3AEGA 3KINB 5KYUB 1SHZC 2I0MA 2MTQA 3H2UA 2DWKA 4UIGA 5L3DB 3V7OA 1G8XA 3UULA 4XQ1A 1FTSA 4CDAA 3S0XA 2EIJC 1JPNA 2WL8A 1A7VA 5FNVE 4EEBA 1KFYA 4LACB 3TLUA 5L3BB 2YL1A 2NTYA 2VC9A 4CDVA 3RW0A 2AU5A 4I0UA 2R7UA 5JT4A 3M15A 1W0BA 3W8HA 3BQLA 5COMA 4MQ9F 5D91A 4DR6T 1RMVA 1PD1A 1M2OA 2LOSA 2L9QA 2XLHA 1MIWA 1A0BA 3HNLA 2LRKA 5EK4A 2LRLA 5JR9A 4OINF 3TK0A 3KV4A 3A11A 3EFOB 2NW8A 4ZOLE 2LHNA 3SFEA 2L9JA 2WP9A 2PX3A 3CEXA 4AQYT 3N2KE 1WR6A 5JDQA 3HI2A 5F5WA 3FXHA 4PK5A 2DCFA 1EQ1A 3JCUQ 2XM0A 1HTJF 3M65A 5AQTB 2UXBT 1ZKEA 3TOLA 3T6GB 4U2ZA 4PFPA 3QW1A 3TJ5A 2P7VA 3SXKA 2FJAA 3HL6A 4OYKA 2EHOB 2EIMC 1QSDA 3C8ZA 1DOWA 1JR8A 1T6IA 4MVQA 2I15A 2BZBA 2VQFT 1OEDA 2CRBA 2KJGA 2LK4A 1ST6A 3B29A 1ZHZA 4Z9IA 4JUYA 3EHZA 4LF8T 3AQCA 4PJJA 1F1MA 3M4BA 1OCRC 3MYFA 3UMKA 5D92A 4JIOA 4DJ9A 4O4JE 3EG9A 4PJMA 3AEDA 2XAGB 1YQ4A 1EKYA 5F3JA 4X1KE 4D4XA 2WM9A 4O8SA 5CI9A 4KBLA 3R84B 2ZM6T 4E0IA 2H8AA 4MALA 3AGUA 3LLKA 3C64A 1KNYA 4ZI3D 1N1CA 2JQ9A 3ABMC 2V6YA 2Q00A 3AEBA 1HE9A 1FFHA 2HN2A 2OCCC 1LVKA 4EYUA 5IUXA 5LMNT 2R7OA 3SFDA 1VYKA 3GM1A 3PDYA 3EHNA 2H88A 3HKEE 4UF0B 4IE7A 3VM6A 3UU6A 5LHGB 2XM2A 4X1YE 4JBWF 4GK5E 1BR2A 4I43B 4JI7T 2A6HF 4AE4A 3UFEA 2Z15A 3AG4C 4J32B 4AKIA 2XAFB 1UCUA 3ABLC 4IDZA 4IWBA 4DRHB 5CIVA 1OWAA 2D5UA 4QI0A 3ZMUB 1YW0A 1CGNA 2X9WA 2P6VA 3QVYA 3ZJ2A 1BDJB 3EGDA 4CSAA 2YDQA 3F46A 2X0HA 3ITFA 1RCPA 3NKEA 3ZMSB 2WVOA 3ONJA 4ADZA 2YHSA 3FXEB 2YLGA 2DI4A 4K0UA 3CKDA 3NRHA 3S84A 4MHCA 1YAUO 3PU3A 1M7KA 3BK9A 3RC8A 1V4AA 2UUHA 3P4RA 2D2SA 1XWJA 2CGEA 2QRXA 2WZFA 3PUXF 5FP3A 1CPRA 4KP3C 3FHNA 1HW2A 1KEYA 3C18A 2WB5A 1K05A 3C7JA 5L0GA 3G4XA 4UEMA 1A7EA 5JSLA 4C3DA 2XASB 2X0YA 1OKKD 5GONE 3JCFA 5COFA 2R03A 2E9XC 4B3TT 3MXZA 5IY5C 5LHHB 4LMLA 4U74A 4UVBB 5F8PA 3A9CA 4O7GA 4B6XA 5BQGA 2ACZA 4ILBA 1TQGA 3AOUA 2WDRA 2JRKA 4TN7B 5EK0A 1TWCA 3NRXA 2EIKC 5AFUL 1TFKB 1AVOB 2CXFA 3QK6A 3RVYA 3POVA 1NLXA 3TULA 1HR0T 4OX9T 3NDBB 2EINC 2M67A 2LQGA 3CK6A 4O2AE 2L8KA 4KI0F 1NWMX 3FOOA 2XTLA 2MYSA 5FY7A 4YSZA 1N33T 2MHRA 2Q9BA 5IYZE 2Z6EA 3ZT6A 2XQ8A 5EGYA 3DJBA 3J9X1 2WWVA 3N24A 3LDQB 1IBLT 4P9TA 4F4BA 1BR0A 1OR2A 1KNRA 2V5DA 2W61A 5FY1A 3N9QA 1YYJA 1D1AA 5HEJA 2XRHA 4JCZA 1S94A 1YZAA 5LBMA 5HAXA 3U9JA 1LI7A 3ZMZB 1O3XA 3LJCA 4WW0A 2SPCA 3AE7A 4O2BE 3CVRA 4FAPB 3L8IA 1FEWA 2NUPA 3NZQA 5LJMA 4FESA 3U2MA 2E5VA 2J62A 4HE8A 3H2VA 2J9UA 3N2ZB 2QGSA 4DR5T 4CJOA 4WYVA 1LE4A 2LLYA 1CGME 3GEEA 4YLHA 3Q9DA 2GK9A 4IL4A 1ZP0A 5AQMB 3X1OA 5JRAA 3HNIA 5LOVE 5KYXB 4FWVA 1H9GA 5ABGA 4I1OB 3UQ4A 2DYRC 3I4UA 4YK5A 3IF8B 1M57C 3PV0F 2ZXRA 3PURA 2LFDA 2ZD9A 4WJ0A 1O5HA 3JYYA 3IBPA 1YDIA 3VU7H 4AXPA 3NWIA 4OIOF 1ORJA 3QVZA 3W15B 2BE5F 4P9FA 3RYLA 5A6AA 4YXDA 1KU2A 3IQCA 4HGAA 1C03A 4KBMB 4ONSA 2O9XA 2AP3A 5ABFA 5H6RB 4JRZA 4HE8D 2LSYA 2OJED 3F2EA 3AXJA 2WVNA 3RQFA 4KMCA 2KSRA 5JP7A 4BJ5C 4C7OB 1VLSA 1T8BA 2DL1A 3WODF 1MNEA 1VB5A 4B3ST 4BG0A 2YEVC 2KGOA 2VK9A 4X64T 5JQGE 4A97A 1S05A 1EI7A 1G73A 2ETSA 2BG9B 4JTCB 4UVAB 3HLZA 5BUOA 4BEJA 3FAJA 3JYHA 4O4HE 4EIYA 2PNOA 3L0IA 3NKDA 4Q5SF 4AKGA 4AIUA 2DHRA 2K3WA 5HXRA 4LERA 5AQUB 1NFOA 4Z8XA 4OHFA 2NWBA 2ZXWC 1IBKT 4ZI7E 1XDOA 1OCCC 4PK4A 4XPWA 4KI2A 3UU4A 2ZM2A 2CCQA 5T3TA 2V7IA 4GEHA 5DS5A 4U7YA 4BJNA 5HYAA 4LDKA 4WGZA 3JTLO 1FAPB 1O3UA 4XEFA 3UGOA 2FJEA 2A9UA 3MA9A 1H6GA 1ZHWA 2IOQA 1YVIA 2LFFA 1Z23A 4XLPF 2NUTB 4G2AA 1D1CA 2C04A 4IDPA 3EVYA 2XAHB 3H65A 2W45A 2CHNA 3OBVE 2DGJA 3MKDA 2KWIB 2XZEA 2W67A 4WNKA 3UUXB 4BAYB 3L1MA 2WWUA 4CS8C 3KV6A 1J8MF 4AKRB 2WU2A 2R05A 1IZNB 1Q0FA 3KYIA 1WCRA 1YQ3A 4JZAA 4LF5T 2XLVA 3ZKRA 2XSBA 3EZHA 4BJMA 4OK0A 4G7ZF 4J30B 3ONLC 5LG3A 5LP6E 3KPHA 4X20E 4IGGA 5AQRB 3RIFA 4LDQA 3S28A 4H9PC 2Q9QC 2NW9A 3FBZA 3C8GD 4GOUA 1L0VA 1M6TA 5T3WA 1UX5A 3HKBE 4DBQA 3LUTB 4MVSA 3VKGA 3JT1A 4AQGA 4K1OA 3I1AA 3U3BA 4ZI2D 5FL1A 3RGLA 2UUIA 2VVNA 3M79A 2C0SA 1UGOA 3QNUA 4CI1B 2YINA 4EWCA 2OG2A 3T8OA 4MVUA 2J0XA 4WZXA 4E7ZA 1BR1A 1RKEA 2FJDA 4ILUA 1V9DA 3RI5A 1E2AA 2LM2A 3Q6NA 3EQLF 3IEEA 3U3FA 4NXNT 1E2XA 2LSKA 4OIRF 1Q0GA 3AA0B 3AG3C 2OKUA 3PHF2 4MW8A 2PG8A 1L3PA 3LSVA 4KHZF 4YTPA 4HFKB 4JYAT 5C3JA 3C50A 4BJ1A 3GN5B 4DBRA 3L34A 5JTGA 4IHJE 4FI5A 4IJJA 1NBBA 1RJ9B 3ZC4A 2W4XA 3UMHA 3WAJA 3HNJA 2WB7A 3SRZA 3PMRA 3RKOA 2E8IA 4KX6A 3ZJ1A 2WDQA 3N0TA 1J5WA 5LB7B 3JAEA 4TNWA 1WOLA 3QB5K 4H54A 4EZ4A 3IHUA 4OYJA 3VRCA 5AC4A 3NVOA 4PACA 2HPJA 4QKNA 3LLIA 5FXXA 4M63A 2XS8A 5AQVB 4JI8T 2QNLA 4CXYA 4N06A 2M4EA 4LF6T 1UFBA 4I3MA 5L0DA 5EZYE 2BDEA 1M56C 1ZHYA 4HEAA 4U5FE 3E08A 4N78D 4DV6T 3S9OA 1JNZA 5M4YA 3ECSA 3UQ7A 3ZEFB 2BKPA 4HWFA 3AEEA 4K7BA 4H9RC 2NOXA 2B0HA 5JR9B 4O6MA 4HTEA 2J0WA 2CPTA 3UU3A 3PU8A 2AE9A 2AXDS 3RYIE 3DJNB 5DQZA 4YL0A 2IIUA 3I0QA 3EZIA 3PJAJ 2FBWA 3K33A 2CE7A 4WABA 3MFNA 4Z91A 4E17A 3N9MA 3C4XA 3VRAA 1OXZA 4JTAB 5JUAA 3JRTA 3KL4A 4QX7B 2PTFA 3GANA 4X62T 4I55E 2A1DD 2ZXOA 2IHR1 5L0JA 3OYXA 3SYNA 2Y3BA 3U78A 1OEDB 1C17M 1YARO 2GAQA 4PR9A 2E9XA 1T5OA 2L81A 3RLFF 3AE2A 1QQ3A 3KKBA 3EAMA 3K3NA 3H3AA 5DJQC 2A2FX 3LK3B 1HCIA 1LIHA 5BR8T 3LS1A 4Z9JA 4QDLA 4IGUA 5IWAT 2V6YB 4CI3B 2XM4A 4NIQA 1LI5A 2CXDA 3WAQA 1SZIA 1IZMA 3LEOA 5KYYA 4PK6A 3UNGC 3L8RA 3ZQVA 3FZMB 5L0CA 4J7YA 4F8HA 1WYCA 2XQ7A 3US6A 2A72A 2AWYA 2EILC 4A98A 4LMKA 3B9QA 4MBQA 5KDMC 4DV5T 3SS1A 4HFFB 3L8JA 2B1EA 1Y64B 3C98B 1DU2A 2JJ9A 4AE4B 4JJFA 1TFOB 2R9RB 2NPUA 1YJGA 4OIQF 1WN0A 5T1DB 3RFYA 5L0FA 4JVSA 1YYXA 3HTKC 5JDHA 1FR0A 2JX0A 2F4VT 2P0NA 1CHUA 2R02A 3V5ZA 2DWGA 2VQET 4EXTA 4MVMA 1MNDA 3ZSSA 2CYDA 2V7KA 4W8KA 2WZHA 4BJ6A 4DXWA 2BC5A 5EK2A 3ASOC 4JE9A 2LEHA 4U7IA 3LFMA 3O4XE 1SF8A 2D0UA 2HKVA 1VLTA 5BMVE 2CDQA 2BG9C 3TLSA 3QC9A 1C02A 3AEFA 1I94T 2PP4A 3Q5XA 1VRBA 2ICWG 3T1HT 1W09A 3X1DA 4CDYA 1IAPA 4GQHA 3NZPA 4JKVA 1ZEEA 4U5HA 2LJLA 2CWYA 3L3PA 3PUSA 2MAWA 3IQ6A 1RKCA 4JLEA 4WBNE 5HXHA 2C03A 4V1Av 5HSWA 4TUYE 2RA1A 4X0RA 4DVZA 2A3DA 4QH1A 2PBEA 1NG1A 3K8PC 1NU7D 4YTMA 4GYSA 1VTMP 4Z90A 3JZ0A 3AE1A 3U3IA 4G0HA 2QLAA 4BJ5A 3FBLA 1Q0MA 4CBEA 2YEVA 4YY3T 4DVYP 4IE0A 3QZCA 2L6HA 3OYZA 2V7JA 3K1SA 1T98A 2YLDA 4ZXLA 4CX9A 1XZYA 3ZT7A 2BS2A 2LKHA 3SNHA 2NTXA 4O79A 2XQ3A 4LF7T 1US7B 1D0YA 1PD0A 3PUVF 4EUKB 4B6IA 5KYUA 1HG2A 3H3MA 2KWHA 4C3EA 5A6JA 5FY0A 1HW1A 4Q7CA 4DV2T 1TWAA 3RRCA 4IIJE 2NUPB 4BPMA 4IE5A 2FGYA 5E33A 1O87A 1SA0E 4I1MA 4U33A 2RD9A 1LE2A 5FXVA 1I6ZA 2YDSA 3ZCJA 2XUEA 3DI5A 5BQIA 2YRFA 4H9NC 4B3MT 4U9DA 1OQCA 4L9IA 2VH3A 2XAJB 3UUNA 3OTOT 4JI0T 1TWGA 3QW0A 3LNMB 4X1IE 3RQEA 4GKKT 4AL1A 3EH2A 1QSPA 3EFOA 1NFNA 4AX2A 1T6UA 4XZCA 4CS8A 4CIHA 2CBJA 3J06A 2CXLA 3NG1A 4A5XA 5ABFB 4Z9HA 4U72A 2P1AA 1V74B 5JVEA 3UT5E 4A56A 2HMZA 3AE9A 3AXJB 3JSZA 4JURI 1AJ3A 5AQKB 1ORYA 4LFCT 1I4YA 2Q9QA 4EGWA 3Q5DA 1A41A 3PTRB 2QYWA 1VYIA 3M1CB 3WAKA 3GMIA 4CN4A 3GODA 3DWWA 3QOFA 3PCVA 5HCMA 3GWLA 3D0TA 4PFOA 3RIPA 3C4ZA 4YJ2E 2LSGA 1RXQA 4EHPA 1G4WR 2ES0A 5KYWA 1LS4A 2IW5B 2UXNB 4HWIB 2HFIA 4UXNB 4LMJA 5AQGB 5CI8A 4LFBT 4EB6E 4ERRA 5A69A 4DV1T 3CZ6A 2OQMA 2Q3TA 2BKNA 3ESLA 3G06A 4DV7T 2ZXPA 3U8PA 3R7CA 5FL0A 4L5GA 3QUJA 5TAOA 1NAFA 2ODVA 1LRZA 3O6XA 4IE6A 3C8GB 5JDGA 3W4YA 5CFBA 1GM5A 2ZPAA 2WQYA 3ZPOA 2Q9QD 2KXPB 5EK3A 3AE4A 5B3SC 3K3OA 1B68A 2D5RB 5GPGB 1VCTA 1VK5A 4DUYT 2VL8A 3IA3A 3TLWA 3FXDB 3I0OA 2LIGA 2WS3A 3T6JA 2VKJA 5JR9C 3NBXX 2W9YA 3UU5A 5A6BA 4YFSA 5FYMA 3EABA 1B7TA 4ZHQE 3BRJA 3NRYA 4NY3A 3L39A 2W0GA 2BS4A 1ZYRF 5AQIB 4BJTA 5L4HA 2KK1A 4YT8A 3EUHA 1R5ID 4DO0A 4ZI3C 2UUAT 5B1AC 1WRDA 5TJ5E 3KDSE 3LBXB 4AQFC 4UDVA 4Q4ZF 1K40A 2YZSA 2KZ7B 4TWFA 2J8WA 5AQPB 2QVAA 3KVAA 3RQUA 4YHJA 2N2NA 3UFGA 4WBOA 5CGMA 1VOMA 4O4LE 2J7PA 1OCOC 2M64A 2C5IT 5LMUT 5E2QA 3B57A 5B1BC 4H9QC 5L47A 5DQWA 5AQQB 5IHYA 1GQAA 3CWZB 3RPUA 4N4WA 1HF8A 1OEDC 1HNXT 3AQBA 3JC6D 3NMIA 1HFAA 3DJUB 4CS9A 1ZZPA 1Q0DA 3FOPA 1HY5A 2OEVA 1BBHA 3JAFA 2FFHA 3B5MA 3AVSA 5A6BD 2XXAA 3V5SA 1Z3IX 4JEHB 2DYSC 2H7OA 1U89A 4NTAA 1E86A 1UUSA 1RKEB 2N9DA 4PJNA 3GWNA 4YSXA 5LCYA 4EOZB 3OKQA 3QB5A 1ZV4X 3NYJA 3PUZF 5FMNA 3T4RA 2JQKA 3ZQYA 1WASA 3RIAA 3C63A 1CPQA 2ZM8A 2K9AA 4ZZCA 1V55C 2KQ9A 3CX7B 4MTGA 1HE1A 5CA1E 3U5SA 2R7TA 1NENA 2CWOA 4TV8E 1OR3A 5JDFA 3JRMO 5FZTA 4COFA 2J7PD 5FVKA 3DM5A 2M6IA 3K1IA 2BKOA 2BL2A 3KV9A 2YKZA 4O6YA 5L3QA 1WYBA 4NUUA 1N34T 3EH1A 3E70C 2LP4A 3O39A 2AVKA 4HFHA 2XLOA 3DZAA 2FJBA 2IAKA 4TV9E 2XLDA 1XZPA 2YVKA 3K1HA 4M1PA 5DQTA 3N2OA 3IPMO 2IXPA 4E7SA 3KBUA 3W2WA 3KVBA 4I44A 3EHMA 3P7IA 2WMOA 3ANWB 3ZWIA 2YQYA 2XQ4A 1H7CA 4ILCA 1S35A 3HR0A 5KYXA 4K0KT 1ZW3A 2L3LA 5JDNA 2XY8B 3AA6B 2M6BA 1EZ3A 2MOZA 3RYCE 3I5PA 4XBFB 4YL3A 3ZG1A 2Y3DA 1Z6AA 3FAPB 2EHOC 3T1YT 2PFVA 5LNKA 3RYHE 2A0UA 3NYLA 5JVDE 5E3CA 2YU2A 4DR3T 4FX5A 5HEOA 1WTYA 4PW8A 2A6EF 5KYNA 4HFEA 1LS1A 3EGXA 1Y4CA 3TKLB 2D4UA 1UK5A 2X9YA 4JI6T 1WATA 2LKGA 4IDNA 3N5LA 2X9HA 1M2VA 5LGTB 1KNPA 5AQSB 4NXMT 3WI3A 3F31A 3RX6A 2HH7A 3ZYKA 2P61A 1UX4A 2JMHA 4JEUB 2R7SA 3AVRA 3CMLA 3KH2A 3L09A 2XHEB 2W00A 1HNWT 2JPUA 3LJBA 3UR3C 3RIUC 2R7RA 2KC3A 4DR1T 3B0PA 3PUYF 4ISSA 1JAFA 2IXNA 5A1LA 2Y3GA 2W62A 2WBLA 4HWDA 1HX1B 4QXCB 5L3CB 3CX6B 2VB6A 4P0AA 1LVFA 4ZLDA 3Q7GA 1KK7A 3JSEO 2YLIA 2E87A 3P4PA 2V8SV 2VURA 4OD4A 3N9NA 3N9OA 5F5FA 4MVZA 4ZS3A 4NCQA 1M62A 3UU8A 1YXRA 4MNDA 2ZMAA 3DTOA 2G62A 3ZMVB 4JCHA 3S29A 3W8IA 3FHDA 3HKDE 5KYYB 2XL4A 2NSGA 1QKRA 1MQVA 3EPVA 2W4MA 3AE3A 4TNVA 4KHPT 5LHIB 2JIWA 2CLYB 4HWHA 3DAGA 3AAIA 2PJQA 4DUZT 2G3VA 1W0AA 4K0DA 2EPNA 4IRUA 2KLQA 2BG9E 4P0BA 5FCLA 2G3KA 3ZLIA 2CNWA 2V1DB 3VYWA 3RQWA 3S4UA 2N1GA 1ZU5A 3CX8B 5DVWA 3LG7A 2ODUA 4P1NA 4HFDA 2ACXA 2I59A 3H37A 3R2PA 5JRCA 4JEAA 2LHRA 3E22E 5JDLA 2YOEA 1UG7A 4F6RC 4OFZA 4QI2A 3LK2B 2R25A 4QH5A 3DD7A 3VHLA 3IHRA 5E0OA 1T72A 3AA1B 2J9VA 2J4GA 2OEXA 3HJCA 2XM1A 2YDRA 3TOMA 1ZVZA 5AQHB 5LA6E 4XTKA 3P4QA 4D4NA 1V54C 4IAOA 2X0LB 2HZ8A 4UVCB 3N9LA 1FJGT 1E7PA 2IMLA 2BBJA 5FXWA 4DRJB 2HMQA 4J7TA 2YK0A 3DE9A 1NSGB 2CNWD 4U31A 2PBIA 4IDOA 5LGUB 4H9OC 3V5YA 5LXTE 2QA7A 3DXJF 2XPKA 3S90A 3MK7C 2C5JA 4YJ3E 2R7XA 2LE8A 1X79A 1GGQA 5L2LA 3FZKB 2KNDA 4G63A 3EG9B 2HJ3A 1Z63A 3O1JA 1AEPA 5DLJA 2VL0A 4C90A 2LSEA 3C62A 4H4KC 4MTOA 3W2VA 3T9OA 2J47A 3VR9A 1Z8UA 3GN5A 1EA8A 5J1GA 1JMWA 4ZI2C 5AGFA 2R6GF 2EPMX 2VVSA 2UXDT 4JJGA 3ZSTA 3E0ZA 4DR7T 2OU6A 1QLEC 2JPFA 1FNTc 1CGOA 3ETUA 3FB2A 5ABHA 2Y8DA 3F57A 1HMDA 4NC3A 1XDPA 4H63V 3RC3A 2K24A 2KSFA 4U5BE 2NG1A 2E9XD 4LFAT 5L0HA 3UTKA 2PX0A 2RPAA 4YT4A 1DOVA 1I4ZA 4YSYA 3PUWF 2TMVP 4DR4T 3ABKC 2R7WA 2YKSA 3EGDB 4HFVA 3LAYA 3FZLB 5JLIA 4EBJA 2L6GA 4ZEYA 3CIRA 1NZEA 3Q6MA 5L3EB 3U9MA 4GYTA 2KYHA 2H7BA 4RD9A 2HPLA 4EYYR 1BR4A 2QTVA 2CMRA 1U4QA 3LEVA 3SOLA 1ZHCA 4JI1T 3AGTA 1YKHB 5AQFB 3DE8A 2HN1A 2UUCT 2EPLX 3HKKA 4KNVA 1Z5ZA 2VCAA 2NW7A 2VKOA 3ZN1B 2OJQA 2B76A 3BEHA 2BBHA 1LM3B 2XAQB 1NEKA 4AQFA 1YA7O 4N6HA 1U5PA 2WMNA 2X67A 1ZOYA 4JTDB 4R32A 2HUJA 5KX5E 2G0UA 1JNRA 1Y6DA 5J2UE 2GDCA 1MIVA 1Q0KA 5FKYA 1YLMA 4FJOA 5AQNB 3F47A 4UV8B 5LYJE 2Q9QB 4EBKA 1SMYF 4X5TA 3PE0A 1T7SA 4HWCA 4IAQA 3SWHA 4U9EA 4IT4A 1OCZC 4ZLCA 4QH4A 2Q7RA 2RP4A 2WVQA 2Q9CA 4CXWA 1VMAA 3AE8A 3TJ6A 2XQ5A 1VCSA 3RKOF 5DS4A 1QPUA 5KYWB 3RHWA 1FMWA 1E84A 4PNIA 4CXXA 3U0CA 3EDVA 3O1HA 5KXJA 1XWMA 4B3RT 1UURA 4YT0A 2WCAA 3RVZA 2F22A 1HMOA 3RRWA 2CM0A 4EIWA 2Y6XA 3FDQA 4IARA 3QMKA 4YN0B 1H7IA 3SXMA 2ZLYA 5AQJB 1HX8A 4HN9A 1KNZA 3G4ZA 5HXSA 2CBIA 2CHOA 4NPPA 4O6NA 4XWJA 3BQIA 1OKKA 3ZSUA 3IQTA 3GA8A 3EI0A 3M3ZB 3VF0A 4IDQA 2WSSV 2KMFA 4JI3T 3V5UA 3MACA 1LPEA 1OEDE 4YL1A 2I8BA 1OXBA 3KYJA 4LLCA 4X66T 3NKZA 3Q2MA 2NR4A 4U2YA 3RKGA 2XLWA 3MLGA 3OJAA 4H9SE 4ASKA 1E83A 4TX5A 1KF6A 2WAUA 3VR8A 2OOCA 2IBFA 2J45A 2W63A 2FUPA 1J5ET 4DOZA 2MPKA 3HNKA 2RSEB 3GEHA 4P6IC 3RYFE 2H3RA 2V5CA 3KFWX 3V5XA 3CAXA 2Y48B 4U3CA 5KMGP 1TR2A 2EHOA 5HEGA 2XL6A 2LOPA 2WDVA 2BS3A 2XJ7A 4G78A 4E18A 5HWXA 2QUPA 4JI4T 2QE9A 4JW1A 4H63H 3ZC1A 2R7QA 3FZHB 2R7VA 2XXAB 2D0TA 4WGYA 3HA4A 3IQ5A 3C4WA 2XLMA 4KC9A 3OWTA 3OEOA 1T01A 2IXOA 2WU5A 1OW6A 2IXMA 5E3AA 3RF1A 3JADA 2IYLD 2HV6A 4HEAJ 3MJXA 2VASA 1MMDA 3CQGB 4U5DE 2A68F 2V26A 2B0JA 2I6HA 4YJWA 4MS2A 4DIDB 2A0BA 2YU1A 3AAEB 2JMKA 2IDOB 2CLYC 4IB4A 1JPJA 1QZXA 5L4EA 4YHHT 3AG1C 1I5NA 3RIUA 2X66A 3ABVA 4HFIA 4OD5A 3VAYA 3ZCIA 3U8VA 2EHOD 3BQKA 3ZTZA 3A7MA 4UF0A 4QXHB 5COGA 4UV9B 3PJAA 4CZZB 2HHHT 1TWHA 4EAHA 3WHNA 2CEAA 4TZ4C 3P50A 3SP1A 1ZW2A 1R8IA 4I4TE 5BQHA 1ZU4A 3PUAA 3N9PA 3P8CD 4EEDA 2VWAA 4BJ6C 3TQOA 4DR2T 4GIWA 3ASNC 5AQLB 4PAGA 4KUMB 1XNQT 3VKHA 1G5ZA 1OW7A 3MYIA 4EBBA 1XMOT 2ASRA 2IC9A 1ORSC 3K66A 3GM3A 2DLRA 2JQHA 1T9KA 5J2TE 3B0UX 3FVYA 3M4CA 3UGPA 5ABEA 5JS5A 3OPCA 1JRAA 3WG7C 4JI5T 3CQZA 4AKLA 3GWHA 1K04A 4TWDA 4ISTA 5L3GB 5JH7E 1Y01A 2UXCT 1YD8G 2YL0A 3EGXB 3PUQA 1D1BA 3X2QC 4NUVA 4DMWA 4GK0E 4U5GA 1KTMA 1AUEA 2WZGA 5DS6A 4HFBA 2EPOA 1IJ5A 5LGNB 5LG4A 3ZT5A 4UELA 1M2VB 2A69F 2E2AA 3EJNA 3RF3A 3O9XA 4NTBA 3G50A 2D9DA 5ADXL 2V6XA 1Z0PA 3LS0A 3FZFB 4UR9A 4EV6A 1W2WA 5F28E 3O10A 4LLEA 1GQEA 2X0CA 3NMJA 3R6NA 3RQGA 4EKWA 2NP9A 4ER9A 1R4TA 3O1IA 3A8YC 3KMIA 4XPYA 4MW3A 4YT5A 2FAPB 5CB4E 4E0HA 5LJNA 2E5LT 2YN6A 1U0BB 4A4AA 1XNRT 3LK42 4MVOA 3ONXA 1SYQA 3S27A 3AG2C 3TLVA 3OVUA 2UXXB 1WWPA 4Q25A 5DABA 4KNWA 2GWWA 4CSAC 3FMSA 2HSBA 2ZM0A 5FXZA 2LSJA 5HEHA 2CA5A 4DV4T 3C8GA 1FMVA 2XSEA 4A2NB 2KW3C 2H89A 2PFDA 2XQAA 3O55A 3U2LA 2KNHA 2CCYA 3MBGA 1BZ4A 3ZN0B 3HKCE 1J1JA 4AL0A 2DI3A 3I9WA 1WLXA
chains in the Genus database with same CATH topology
3C51A 4CI2B 4QX8B 4CS7A 3MX3A 3TD7A 4CQIA 4MFRA 2PF4E 5HWYA 3CQXC 4DVDA 3SEOA 4QHOA 5JRCB 2H7VC 3J7Yq 3LBXA 4IE4A 3K7DA 1ZHTA 3AB3B 3PUGA 2Y39A 3ZMTB 1HG5A 2Y69C 2IC6A 1S7ZA 3LNRA 3ZYMA 4C7OA 4DMVA 1FFTC 4OIPF 3K3QC 2VKHA 2LT3A 4XLNF 1WGWA 4AI6A 4ULWA 2W4BA 2J1DG 3SZRA 3B0VC 3EDUA 5F5HA 3CPZA 2JD3A 2Y3HA 2E9XB 5HXCA 2QY9A 3DAFA 4U5EE 2K5BB 2V3CC 5DQVA 1ZHXA 2Q9AA 4J2CA 3Q7LA 2KINB 4XAXB 2P9BA 4YWQA 3JC6C 2V7LA 4RBNA 3UMIA 1MMAA 2HV7A 2V7MA 2NUTA 2JQQA 3AA7B 4AK9A 5C8YE 4AKHA 4O4IE 5L3FB 1HS7A 1D0XA 4ZS2A 3I9YA 1IW7F 3MZKB 2MWQA 3ANWA 3CQCB 1E1HB 4U5CE 4HKAA 3E9VA 4C91A 4I50E 1NU9C 2DNXA 2K48A 4YT2A 3B13A 1MMGA 2BVMA 3ZYLA 3LESA 5EHHA 2XQYA 4G7OF 3ZIBA 3ETVA 4MLKA 5HXEA 1J8YF 1TKNA 4CS9C 3A5XA 3UUMA 3K6BA 1YKEB 4QXBB 5L3VA 3I5QA 4C3BA 2MBGA 2X68A 2J46A 4EZHA 3DMDA 2GFHA 3OA1A 2WZLA 2LSIA 2X51A 5JDMA 5LBQB 3AAAB 2OA5A 2LM9A 2C5KT 4PJLA 5JREA 5ETWA 4RDAA 3ZVRA 4QWNB 2J9WA 4L0RA 4P09A 4DNDA 1MMNA 3NYMA 5CA0E 1LKXA 3K1IC 2BVLA 3N2GE 2X9XA 1PCXA 1QUUA 3ZC0A 4GYRA 3RH3A 2CW0F 2KT9A 1IJ6A 1D0ZA 3KBTA 3Q5WA 4ANJA 2VKDA 1RJ9A 4BA9A 1MIYA 1FIOA 3T6BA 3CSKA 3KV5A 1CUNA 3DM9B 4G7HF 3DP7A 5H6QB 3KINB 5KYUB 1SHZC 2MTQA 2DWKA 4UIGA 5L3DB 3V7OA 1G8XA 3UULA 1FTSA 3S0XA 2EIJC 1JPNA 2WL8A 5FNVE 4LACB 5L3BB 2NTYA 2R7UA 3W8HA 3BQLA 4MQ9F 5D91A 1PD1A 1M2OA 2LOSA 2L9QA 1MIWA 5EK4A 5JR9A 4OINF 3KV4A 3EFOB 2NW8A 4ZOLE 2LHNA 2L9JA 2PX3A 3N2KE 1WR6A 5JDQA 3HI2A 4PK5A 2DCFA 3JCUQ 1HTJF 3M65A 1ZKEA 4PFPA 2P7VA 3HL6A 2EIMC 4OYKA 2EHOB 1QSDA 2BZBA 2KJGA 1ST6A 1ZHZA 4JUYA 3AQCA 4PJJA 1OCRC 3UMKA 5D92A 4O4JE 3EG9A 4PJMA 2XAGB 5F3JA 4X1KE 5CI9A 2WM9A 4O8SA 4KBLA 3R84B 4MALA 3LLKA 3C64A 4ZI3D 1N1CA 3ABMC 1FFHA 2OCCC 1LVKA 4EYUA 2R7OA 1VYKA 3PDYA 3EHNA 3HKEE 4UF0B 4IE7A 4X1YE 5LHGB 2A6HF 4GK5E 1BR2A 4I43B 4AE4A 3UFEA 2Z15A 3AG4C 4J32B 4AKIA 2XAFB 1UCUA 3ABLC 4IDZA 4IWBA 1OWAA 2D5UA 4QI0A 3ZMUB 1YW0A 2X9WA 2P6VA 3ZJ2A 3EGDA 4CSAA 3F46A 3ITFA 3NKEA 3ZMSB 2WVOA 4ADZA 2YHSA 3FXEB 2DI4A 4K0UA 3CKDA 3NRHA 4MHCA 3PU3A 3BK9A 3RC8A 2D2SA 2CGEA 2WZFA 5FP3A 4KP3C 3FHNA 4UEMA 4C3DA 2XASB 1OKKD 5GONE 2E9XC 3MXZA 5IY5C 5LHHB 4U74A 4UVBB 5F8PA 4O7GA 4B6XA 2JRKA 4TN7B 1TWCA 3NRXA 2EIKC 5AFUL 2CXFA 3QK6A 3POVA 3NDBB 2EINC 2M67A 4O2AE 2L8KA 1NWMX 2XTLA 2MYSA 5FY7A 2Q9BA 5IYZE 2Z6EA 5EGYA 3DJBA 3J9X1 3N24A 4F4BA 1BR0A 2W61A 5FY1A 3N9QA 1D1AA 2XRHA 1S94A 5LBMA 5HAXA 3ZMZB 1O3XA 3LJCA 4WW0A 2SPCA 4O2BE 3CVRA 1FEWA 2NUPA 3NZQA 5LJMA 4FESA 4HE8A 3N2ZB 2J9UA 2QGSA 4YLHA 3Q9DA 2GK9A 3X1OA 5LOVE 5KYXB 4FWVA 4I1OB 2DYRC 3I4UA 3IF8B 1M57C 2ZXRA 3PURA 4WJ0A 1O5HA 3IBPA 3VU7H 4AXPA 4OIOF 3W15B 2BE5F 3RYLA 1KU2A 4HGAA 4KBMB 2O9XA 5H6RB 4HE8D 2LSYA 3F2EA 2WVNA 4KMCA 4BJ5C 4C7OB 3WODF 1MNEA 4BG0A 2YEVC 2KGOA 2VK9A 5JQGE 1G73A 4UVAB 3HLZA 5BUOA 4BEJA 3FAJA 3JYHA 4O4HE 3L0IA 3NKDA 4Q5SF 4AKGA 2DHRA 5HXRA 4LERA 4Z8XA 4OHFA 2NWBA 2ZXWC 4ZI7E 1OCCC 4PK4A 4KI2A 5T3TA 2ZM2A 2CCQA 2V7IA 4GEHA 5DS5A 4BJNA 5HYAA 3UGOA 3MA9A 1ZHWA 2IOQA 1Z23A 4XLPF 2NUTB 4G2AA 1D1CA 2C04A 3EVYA 2XAHB 3H65A 2W45A 3OBVE 2DGJA 3MKDA 2KWIB 4WNKA 3UUXB 4BAYB 2WWUA 4CS8C 3KV6A 1J8MF 4AKRB 1IZNB 4JZAA 3EZHA 4BJMA 4OK0A 4G7ZF 4J30B 5LP6E 4X20E 3S28A 4H9PC 2Q9QC 2NW9A 3FBZA 4GOUA 5T3WA 1UX5A 3HKBE 4DBQA 3VKGA 3JT1A 4AQGA 3I1AA 4ZI2D 2C0SA 4CI1B 2YINA 4EWCA 2OG2A 3T8OA 2J0XA 4E7ZA 1BR1A 4ILUA 1V9DA 3Q6NA 3EQLF 3IEEA 2LSKA 4OIRF 3AG3C 3AA0B 3PHF2 2PG8A 4HFKB 3C50A 4BJ1A 3GN5B 4DBRA 3L34A 4IHJE 4FI5A 4IJJA 1RJ9B 3ZC4A 3UMHA 3WAJA 2WB7A 3SRZA 3PMRA 3RKOA 2E8IA 3ZJ1A 3N0TA 4EZ4A 4OYJA 2HPJA 4QKNA 3LLIA 5FXXA 4M63A 4CXYA 4N06A 2M4EA 4I3MA 5EZYE 2BDEA 1M56C 1ZHYA 4HEAA 4U5FE 3E08A 4N78D 5M4YA 3ECSA 3ZEFB 4K7BA 4H9RC 2NOXA 5JR9B 4O6MA 4HTEA 2J0WA 3PU8A 3RYIE 3DJNB 5DQZA 3I0QA 3EZIA 3K33A 2CE7A 3N9MA 3C4XA 1OXZA 3JRTA 3KL4A 4QX7B 3GANA 4I55E 2A1DD 2ZXOA 3OYXA 3SYNA 2Y3BA 3U78A 2E9XA 2L81A 3KKBA 3K3NA 3H3AA 5DJQC 2A2FX 3LK3B 1HCIA 3LS1A 4QDLA 4IGUA 4CI3B 2CXDA 1SZIA 1IZMA 5KYYA 4PK6A 3UNGC 1WYCA 2A72A 2EILC 3B9QA 4MBQA 5KDMC 3SS1A 4HFFB 2B1EA 1Y64B 3C98B 2JJ9A 4AE4B 4JJFA 4OIQF 5T1DB 3RFYA 4JVSA 3HTKC 5JDHA 2DWGA 4EXTA 1MNDA 2V7KA 4W8KA 4BJ6A 5EK2A 3ASOC 2LEHA 3LFMA 3O4XE 1SF8A 2D0UA 5BMVE 2CDQA 3QC9A 2PP4A 3Q5XA 1VRBA 1IAPA 3NZPA 1ZEEA 4U5HA 2LJLA 2CWYA 3L3PA 3PUSA 4JLEA 4WBNE 5HXHA 2C03A 4V1Av 5HSWA 4TUYE 2RA1A 4X0RA 4DVZA 2A3DA 1NG1A 3K8PC 1NU7D 4GYSA 3U3IA 4G0HA 4BJ5A 3FBLA 4CBEA 2YEVA 4DVYP 4IE0A 3QZCA 3OYZA 2V7JA 1T98A 3SNHA 2NTXA 4O79A 1US7B 1D0YA 1PD0A 4B6IA 5KYUA 1HG2A 2KWHA 4C3EA 5FY0A 4Q7CA 1TWAA 3RRCA 4IIJE 2NUPB 4IE5A 2FGYA 5E33A 1O87A 1SA0E 4I1MA 5FXVA 3ZCJA 2XUEA 4H9NC 4L9IA 2VH3A 2XAJB 3UUNA 1TWGA 4X1IE 3EH2A 3EFOA 4AX2A 4XZCA 4CS8A 4CIHA 2CXLA 3NG1A 4U72A 3UT5E 4A56A 3JSZA 4JURI 1AJ3A 2Q9QA 3PTRB 1VYIA 3M1CB 3WAKA 3GMIA 3GODA 3D0TA 4PFOA 3RIPA 3C4ZA 4YJ2E 2LSGA 2ES0A 5KYWA 2IW5B 2UXNB 4UXNB 5CI8A 4EB6E 4ERRA 3CZ6A 2Q3TA 3ESLA 2ZXPA 4L5GA 3QUJA 5TAOA 1NAFA 2ODVA 1LRZA 3O6XA 4IE6A 5JDGA 2ZPAA 3ZPOA 2Q9QD 2KXPB 5EK3A 5B3SC 3K3OA 2D5RB 1VK5A 2VL8A 3FXDB 3I0OA 3T6JA 2VKJA 5JR9C 3NBXX 2W9YA 4YFSA 5FYMA 1B7TA 4ZHQE 3NRYA 4NY3A 2W0GA 1ZYRF 4BJTA 4YT8A 3EUHA 4DO0A 4ZI3C 5B1AC 1WRDA 3KDSE 3LBXB 4AQFC 4Q4ZF 2YZSA 2KZ7B 3KVAA 4YHJA 2N2NA 4WBOA 1VOMA 4O4LE 2J7PA 1OCOC 2C5IT 5E2QA 3B57A 5B1BC 4H9QC 5DQWA 5IHYA 3CWZB 3RPUA 1HF8A 3AQBA 3JC6D 1HFAA 3DJUB 4CS9A 2FFHA 3AVSA 2XXAA 3V5SA 1Z3IX 4JEHB 2DYSC 2H7OA 2N9DA 4PJNA 5LCYA 4EOZB 3OKQA 1ZV4X 3NYJA 5FMNA 3T4RA 2KQ9A 2ZM8A 2K9AA 1V55C 3CX7B 5CA1E 2R7TA 2CWOA 4TV8E 5JDFA 2J7PD 3DM5A 3KV9A 4O6YA 5L3QA 1WYBA 4NUUA 3EH1A 3E70C 3O39A 3DZAA 2IAKA 4TV9E 3K1HA 4M1PA 5DQTA 3N2OA 2IXPA 4E7SA 3KBUA 3W2WA 3KVBA 4I44A 3EHMA 3P7IA 2WMOA 3ANWB 1H7CA 1S35A 3HR0A 5KYXA 2L3LA 5JDNA 3AA6B 1EZ3A 2MOZA 3RYCE 3I5PA 4XBFB 3ZG1A 2Y3DA 1Z6AA 2EHOC 2PFVA 5LNKA 3RYHE 3NYLA 5JVDE 5E3CA 2YU2A 4FX5A 4PW8A 2A6EF 5KYNA 1LS1A 3EGXA 3TKLB 2X9YA 3N5LA 2X9HA 1M2VA 5LGTB 3WI3A 3F31A 3RX6A 2HH7A 3ZYKA 1UX4A 2JMHA 4JEUB 2R7SA 3AVRA 3CMLA 3KH2A 3L09A 2XHEB 2W00A 3LJBA 3UR3C 2R7RA 3B0PA 4ISSA 2IXNA 2Y3GA 5A1LA 2W62A 2WBLA 4QXCB 5L3CB 3CX6B 2VB6A 4P0AA 1LVFA 4ZLDA 3Q7GA 1KK7A 2E87A 4OD4A 3N9NA 3N9OA 5F5FA 4ZS3A 4MNDA 2ZMAA 3DTOA 2G62A 3ZMVB 4JCHA 3S29A 3W8IA 3FHDA 3HKDE 5KYYB 2XL4A 3EPVA 2W4MA 5LHIB 2CLYB 3DAGA 3AAIA 2PJQA 2G3VA 4K0DA 4IRUA 2KLQA 4P0BA 5FCLA 2G3KA 3ZLIA 2CNWA 2V1DB 3VYWA 3S4UA 2N1GA 1ZU5A 3CX8B 5DVWA 3LG7A 2ODUA 2ACXA 2I59A 3H37A 5JRCA 2LHRA 3E22E 5JDLA 4F6RC 4OFZA 4QI2A 3LK2B 3DD7A 3VHLA 3IHRA 5E0OA 3AA1B 2J9VA 3HJCA 5LA6E 4XTKA 1V54C 4IAOA 2X0LB 4UVCB 3N9LA 5FXWA 2YK0A 2CNWD 2PBIA 5LGUB 4H9OC 5LXTE 2QA7A 3DXJF 3MK7C 2C5JA 4YJ3E 2R7XA 2LE8A 1X79A 5L2LA 2KNDA 4G63A 3EG9B 1Z63A 3O1JA 5DLJA 4C90A 2LSEA 4H4KC 3W2VA 3GN5A 5J1GA 4ZI2C 4JJGA 3E0ZA 1QLEC 2JPFA 3ETUA 3FB2A 2Y8DA 3F57A 4H63V 3RC3A 4U5BE 2K24A 2NG1A 2E9XD 3UTKA 2PX0A 4YT4A 3ABKC 2R7WA 3EGDB 4HFVA 3LAYA 1NZEA 3Q6MA 5L3EB 4GYTA 2H7BA 4RD9A 2HPLA 4EYYR 1BR4A 2QTVA 2CMRA 1U4QA 3LEVA 3SOLA 1ZHCA 1YKHB 4KNVA 1Z5ZA 2NW7A 2VKOA 3ZN1B 2XAQB 4AQFA 1U5PA 2WMNA 2X67A 5KX5E 2G0UA 5J2UE 1MIVA 4FJOA 3F47A 4UV8B 5LYJE 2Q9QB 1SMYF 3PE0A 3SWHA 1OCZC 4ZLCA 2RP4A 2WVQA 2Q9CA 4CXWA 1VMAA 3RKOF 5DS4A 5KYWB 1FMWA 4PNIA 4CXXA 3EDVA 3O1HA 3RRWA 2CM0A 4EIWA 2Y6XA 3FDQA 3QMKA 4YN0B 2ZLYA 1KNZA 1HX8A 4HN9A 4O6NA 5HXSA 4XWJA 3BQIA 1OKKA 3ZSUA 3GA8A 2WSSV 2KMFA 3V5UA 3MACA 2I8BA 4LLCA 3Q2MA 3MLGA 3OJAA 4H9SE 4ASKA 4TX5A 2WAUA 2J45A 2W63A 4DOZA 4P6IC 3RYFE 2H3RA 3KFWX 2Y48B 5KMGP 1TR2A 2EHOA 2LOPA 5HWXA 4JW1A 4H63H 3ZC1A 2R7QA 2R7VA 2XXAB 2D0TA 3HA4A 3C4WA 4KC9A 3OWTA 3OEOA 2IXOA 2IXMA 5E3AA 2IYLD 2HV6A 4HEAJ 3MJXA 2VASA 1MMDA 3CQGB 4U5DE 2A68F 2V26A 2B0JA 4YJWA 3AAEB 2YU1A 2JMKA 2CLYC 1JPJA 1QZXA 3AG1C 2X66A 4OD5A 3VAYA 3ZCIA 2EHOD 3BQKA 4UF0A 4QXHB 4UV9B 4CZZB 1TWHA 4EAHA 2CEAA 4TZ4C 3SP1A 4I4TE 1ZU4A 3PUAA 3N9PA 3P8CD 2VWAA 4BJ6C 4GIWA 3ASNC 4PAGA 4KUMB 3VKHA 4EBBA 2IC9A 3K66A 2DLRA 5J2TE 3B0UX 3FVYA 3UGPA 3WG7C 3CQZA 4AKLA 3GWHA 4ISTA 5L3GB 5JH7E 1YD8G 3EGXB 3PUQA 1D1BA 3X2QC 4NUVA 4DMWA 4GK0E 4U5GA 2WZGA 5DS6A 1IJ5A 5LGNB 5LG4A 4UELA 1M2VB 2A69F 3EJNA 3O9XA 5ADXL 1Z0PA 3LS0A 1W2WA 4LLEA 3R6NA 2NP9A 3O1IA 3KMIA 4YT5A 5CB4E 5LJNA 3LK42 3ONXA 3S27A 3AG2C 2UXXB 5DABA 4KNWA 4CSAC 2ZM0A 5FXZA 2LSJA 2CA5A 1FMVA 2XSEA 4A2NB 2KW3C 2PFDA 2KNHA 3ZN0B 3HKCE 3I9WA 1WLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YJW A;  3RH3 A;  3IEE A; 
#chains in the Genus database with same CATH topology
 3C51 A;  4CI2 B;  1WFD A;  4CJG A;  4DV0 T;  3SXZ A;  4QX8 B;  4CS7 A;  3MX3 A;  2L7A A;  3TD7 A;  4CQI A;  4MFR A;  2PF4 E;  1OXK A;  2VCB A;  3UUB A;  4JEB A;  5HWY A;  4CN6 A;  1QLB A;  3CQX C;  4DVD A;  3ZTM A;  1OW8 A;  4ULV A;  4CIP A;  2UUB T;  3SEO A;  3GEI A;  4QHO A;  5JRC B;  2H7V C;  3J7Y q;  3LBX A;  3TLT A;  4IE4 A;  2YL3 A;  1SE7 A;  4LDR A;  3K7D A;  1ZHT A;  3AB3 B;  3PUG A;  2Y39 A;  3ZMT B;  4DV3 T;  1PV3 A;  1HG5 A;  1JOG A;  2XS1 A;  2Y69 C;  4TWH A;  2IC6 A;  4MVR A;  1S7Z A;  3DKA A;  2YWA A;  2WY2 A;  3ZDL A;  3LNR A;  1X9B A;  1HNZ T;  3ZYM A;  4C7O A;  4JI2 T;  3Q5E A;  4DMV A;  1FFT C;  3PDM P;  4OIP F;  3K3Q C;  2VKH A;  2XQ6 A;  3GM2 A;  2LT3 A;  4XLN F;  1WGW A;  4AI6 A;  4ULW A;  5C2T A;  5FVL A;  1T6Q A;  2BG9 A;  2EPK X;  2W4B A;  4LF9 T;  4XEV A;  2J1D G;  3SZR A;  3B0V C;  3EDU A;  5F5H A;  3CPZ A;  1H9T A;  4GKJ T;  3AEC A;  5AQO B;  5L0I A;  2JD3 A;  4YTN A;  2Y3H A;  5CJ5 A;  2E9X B;  5HXC A;  2HSQ A;  2QY9 A;  1WR0 A;  3DAF A;  2K5B B;  4U5E E;  2V3C C;  2XQ9 A;  5DQV A;  2HJM A;  4IRE A;  3QTH A;  1ZHX A;  2Q9A A;  2Q4F A;  4L6R A;  2XL8 A;  1G4U S;  1XZQ A;  4J2C A;  3Q7L A;  3AE5 A;  2OLT A;  2GA0 A;  5K0I A;  2KIN B;  4XAX B;  1A7D A;  3NMK A;  2P9B A;  4YWQ A;  3JC6 C;  2V7L A;  4RBN A;  3UMI A;  4XEK A;  5A6K A;  1MMA A;  2AWC A;  2HV7 A;  1Z7Q c;  2V7M A;  3VRB A;  2NUT A;  2JQQ A;  5HCJ A;  4ZZB A;  4XPX A;  3AA7 B;  5J0Z A;  1SUM B;  4AK9 A;  5C8Y E;  1APC A;  4AKH A;  4O4I E;  5L3F B;  1GS9 A;  3P4S A;  1HS7 A;  1D0X A;  4X65 T;  4ZS2 A;  1U6H A;  3I9Y A;  256B A;  2VCC A;  4W8P A;  1IW7 F;  3P4W A;  2J9B A;  3MZK B;  2MWQ A;  3ANW A;  3CQC B;  1E1H B;  4U5C E;  4HKA A;  1YZC A;  5HEU A;  1XMQ T;  3E9V A;  5B3I A;  4C91 A;  4I50 E;  1NU9 C;  4AIS A;  2DNX A;  2K48 A;  4YT2 A;  3B13 A;  1MMG A;  3AE6 A;  4BEM J;  2BVM A;  1SR2 A;  3ZYL A;  3LES A;  5EHH A;  2XQY A;  3AJM A;  1YA9 A;  4G7O F;  3ZIB A;  3ETV A;  4MLK A;  5HXE A;  1J8Y F;  1TKN A;  4CS9 C;  2W66 A;  3A5X A;  4N6C A;  4ILA A;  3UUM A;  2YL7 A;  3K6B A;  1E85 A;  1YKE B;  4QXB B;  5L3V A;  2W2U A;  3I5Q A;  1W9R A;  3SXY A;  4C3B A;  2MBG A;  3ATP A;  2X68 A;  4HFC A;  2J46 A;  4EZH A;  3DMD A;  2GFH A;  3OA1 A;  2WZL A;  2LSI A;  2X51 A;  4CN1 A;  5JDM A;  4IL9 A;  5LBQ B;  4LF4 T;  3AAA B;  2OA5 A;  4NTF A;  4DRI B;  2LM9 A;  2C5K T;  4PJL A;  5JRE A;  4MTF A;  2NSF A;  5ETW A;  4RDA A;  4NQF A;  3ZVR A;  4QWN B;  2XLE A;  1L7C A;  2J9W A;  4L0R A;  4P09 A;  4DND A;  1MMN A;  2IUB A;  2L6F A;  3NYM A;  5CA0 E;  2OV9 A;  1LKX A;  3K1I C;  3B71 A;  2BVL A;  3N2G E;  1N36 T;  4JV5 T;  5HV9 A;  2X9X A;  3AEA A;  1PCX A;  1QUU A;  3ZC0 A;  4GYR A;  3RH3 A;  2XSA A;  2CW0 F;  2IM8 A;  1QVX A;  3GOR A;  2LCH A;  2KT9 A;  1IJ6 A;  1D0Z A;  3KBT A;  3Q5W A;  5AC5 A;  2LD6 A;  2WZI A;  4ANJ A;  2VKD A;  2UU9 T;  1RJ9 A;  4BA9 A;  4JC7 A;  1MIY A;  2HS5 A;  1FIO A;  3T6B A;  3CSK A;  3KV5 A;  1CUN A;  3DM9 B;  2DB4 A;  4G7H F;  1IBM T;  3DP7 A;  1N32 T;  5H6Q B;  3AEG A;  3KIN B;  5KYU B;  1SHZ C;  2I0M A;  2MTQ A;  3H2U A;  2DWK A;  4UIG A;  5L3D B;  3V7O A;  1G8X A;  3UUL A;  4XQ1 A;  1FTS A;  4CDA A;  3S0X A;  2EIJ C;  1JPN A;  2WL8 A;  1A7V A;  5FNV E;  4EEB A;  1KFY A;  4LAC B;  3TLU A;  5L3B B;  2YL1 A;  2NTY A;  2VC9 A;  4CDV A;  3RW0 A;  2AU5 A;  4I0U A;  2R7U A;  5JT4 A;  3M15 A;  1W0B A;  3W8H A;  3BQL A;  5COM A;  4MQ9 F;  5D91 A;  4DR6 T;  1RMV A;  1PD1 A;  1M2O A;  2LOS A;  2L9Q A;  2XLH A;  1MIW A;  1A0B A;  3HNL A;  2LRK A;  5EK4 A;  2LRL A;  5JR9 A;  4OIN F;  3TK0 A;  3KV4 A;  3A11 A;  3EFO B;  2NW8 A;  4ZOL E;  2LHN A;  3SFE A;  2L9J A;  2WP9 A;  2PX3 A;  3CEX A;  4AQY T;  3N2K E;  1WR6 A;  5JDQ A;  3HI2 A;  5F5W A;  3FXH A;  4PK5 A;  2DCF A;  1EQ1 A;  3JCU Q;  2XM0 A;  1HTJ F;  3M65 A;  5AQT B;  2UXB T;  1ZKE A;  3TOL A;  3T6G B;  4U2Z A;  4PFP A;  3QW1 A;  3TJ5 A;  2P7V A;  3SXK A;  2FJA A;  3HL6 A;  4OYK A;  2EHO B;  2EIM C;  1QSD A;  3C8Z A;  1DOW A;  1JR8 A;  1T6I A;  4MVQ A;  2I15 A;  2BZB A;  2VQF T;  1OED A;  2CRB A;  2KJG A;  2LK4 A;  1ST6 A;  3B29 A;  1ZHZ A;  4Z9I A;  4JUY A;  3EHZ A;  4LF8 T;  3AQC A;  4PJJ A;  1F1M A;  3M4B A;  1OCR C;  3MYF A;  3UMK A;  5D92 A;  4JIO A;  4DJ9 A;  4O4J E;  3EG9 A;  4PJM A;  3AED A;  2XAG B;  1YQ4 A;  1EKY A;  5F3J A;  4X1K E;  4D4X A;  2WM9 A;  4O8S A;  5CI9 A;  4KBL A;  3R84 B;  2ZM6 T;  4E0I A;  2H8A A;  4MAL A;  3AGU A;  3LLK A;  3C64 A;  1KNY A;  4ZI3 D;  1N1C A;  2JQ9 A;  3ABM C;  2V6Y A;  2Q00 A;  3AEB A;  1HE9 A;  1FFH A;  2HN2 A;  2OCC C;  1LVK A;  4EYU A;  5IUX A;  5LMN T;  2R7O A;  3SFD A;  1VYK A;  3GM1 A;  3PDY A;  3EHN A;  2H88 A;  3HKE E;  4UF0 B;  4IE7 A;  3VM6 A;  3UU6 A;  5LHG B;  2XM2 A;  4X1Y E;  4JBW F;  4GK5 E;  1BR2 A;  4I43 B;  4JI7 T;  2A6H F;  4AE4 A;  3UFE A;  2Z15 A;  3AG4 C;  4J32 B;  4AKI A;  2XAF B;  1UCU A;  3ABL C;  4IDZ A;  4IWB A;  4DRH B;  5CIV A;  1OWA A;  2D5U A;  4QI0 A;  3ZMU B;  1YW0 A;  1CGN A;  2X9W A;  2P6V A;  3QVY A;  3ZJ2 A;  1BDJ B;  3EGD A;  4CSA A;  2YDQ A;  3F46 A;  2X0H A;  3ITF A;  1RCP A;  3NKE A;  3ZMS B;  2WVO A;  3ONJ A;  4ADZ A;  2YHS A;  3FXE B;  2YLG A;  2DI4 A;  4K0U A;  3CKD A;  3NRH A;  3S84 A;  4MHC A;  1YAU O;  3PU3 A;  1M7K A;  3BK9 A;  3RC8 A;  1V4A A;  2UUH A;  3P4R A;  2D2S A;  1XWJ A;  2CGE A;  2QRX A;  2WZF A;  3PUX F;  5FP3 A;  1CPR A;  4KP3 C;  3FHN A;  1HW2 A;  1KEY A;  3C18 A;  2WB5 A;  1K05 A;  3C7J A;  5L0G A;  3G4X A;  4UEM A;  1A7E A;  5JSL A;  4C3D A;  2XAS B;  2X0Y A;  1OKK D;  5GON E;  3JCF A;  5COF A;  2R03 A;  2E9X C;  4B3T T;  3MXZ A;  5IY5 C;  5LHH B;  4LML A;  4U74 A;  4UVB B;  5F8P A;  3A9C A;  4O7G A;  4B6X A;  5BQG A;  2ACZ A;  4ILB A;  1TQG A;  3AOU A;  2WDR A;  2JRK A;  4TN7 B;  5EK0 A;  1TWC A;  3NRX A;  2EIK C;  5AFU L;  1TFK B;  1AVO B;  2CXF A;  3QK6 A;  3RVY A;  3POV A;  1NLX A;  3TUL A;  1HR0 T;  4OX9 T;  3NDB B;  2EIN C;  2M67 A;  2LQG A;  3CK6 A;  4O2A E;  2L8K A;  4KI0 F;  1NWM X;  3FOO A;  2XTL A;  2MYS A;  5FY7 A;  4YSZ A;  1N33 T;  2MHR A;  2Q9B A;  5IYZ E;  2Z6E A;  3ZT6 A;  2XQ8 A;  5EGY A;  3DJB A;  3J9X 1;  2WWV A;  3N24 A;  3LDQ B;  1IBL T;  4P9T A;  4F4B A;  1BR0 A;  1OR2 A;  1KNR A;  2V5D A;  2W61 A;  5FY1 A;  3N9Q A;  1YYJ A;  1D1A A;  5HEJ A;  2XRH A;  4JCZ A;  1S94 A;  1YZA A;  5LBM A;  5HAX A;  3U9J A;  1LI7 A;  3ZMZ B;  1O3X A;  3LJC A;  4WW0 A;  2SPC A;  3AE7 A;  4O2B E;  3CVR A;  4FAP B;  3L8I A;  1FEW A;  2NUP A;  3NZQ A;  5LJM A;  4FES A;  3U2M A;  2E5V A;  2J62 A;  4HE8 A;  3H2V A;  2J9U A;  3N2Z B;  2QGS A;  4DR5 T;  4CJO A;  4WYV A;  1LE4 A;  2LLY A;  1CGM E;  3GEE A;  4YLH A;  3Q9D A;  2GK9 A;  4IL4 A;  1ZP0 A;  5AQM B;  3X1O A;  5JRA A;  3HNI A;  5LOV E;  5KYX B;  4FWV A;  1H9G A;  5ABG A;  4I1O B;  3UQ4 A;  2DYR C;  3I4U A;  4YK5 A;  3IF8 B;  1M57 C;  3PV0 F;  2ZXR A;  3PUR A;  2LFD A;  2ZD9 A;  4WJ0 A;  1O5H A;  3JYY A;  3IBP A;  1YDI A;  3VU7 H;  4AXP A;  3NWI A;  4OIO F;  1ORJ A;  3QVZ A;  3W15 B;  2BE5 F;  4P9F A;  3RYL A;  5A6A A;  4YXD A;  1KU2 A;  3IQC A;  4HGA A;  1C03 A;  4KBM B;  4ONS A;  2O9X A;  2AP3 A;  5ABF A;  5H6R B;  4JRZ A;  4HE8 D;  2LSY A;  2OJE D;  3F2E A;  3AXJ A;  2WVN A;  3RQF A;  4KMC A;  2KSR A;  5JP7 A;  4BJ5 C;  4C7O B;  1VLS A;  1T8B A;  2DL1 A;  3WOD F;  1MNE A;  1VB5 A;  4B3S T;  4BG0 A;  2YEV C;  2KGO A;  2VK9 A;  4X64 T;  5JQG E;  4A97 A;  1S05 A;  1EI7 A;  1G73 A;  2ETS A;  2BG9 B;  4JTC B;  4UVA B;  3HLZ A;  5BUO A;  4BEJ A;  3FAJ A;  3JYH A;  4O4H E;  4EIY A;  2PNO A;  3L0I A;  3NKD A;  4Q5S F;  4AKG A;  4AIU A;  2DHR A;  2K3W A;  5HXR A;  4LER A;  5AQU B;  1NFO A;  4Z8X A;  4OHF A;  2NWB A;  2ZXW C;  1IBK T;  4ZI7 E;  1XDO A;  1OCC C;  4PK4 A;  4XPW A;  4KI2 A;  3UU4 A;  2ZM2 A;  2CCQ A;  5T3T A;  2V7I A;  4GEH A;  5DS5 A;  4U7Y A;  4BJN A;  5HYA A;  4LDK A;  4WGZ A;  3JTL O;  1FAP B;  1O3U A;  4XEF A;  3UGO A;  2FJE A;  2A9U A;  3MA9 A;  1H6G A;  1ZHW A;  2IOQ A;  1YVI A;  2LFF A;  1Z23 A;  4XLP F;  2NUT B;  4G2A A;  1D1C A;  2C04 A;  4IDP A;  3EVY A;  2XAH B;  3H65 A;  2W45 A;  2CHN A;  3OBV E;  2DGJ A;  3MKD A;  2KWI B;  2XZE A;  2W67 A;  4WNK A;  3UUX B;  4BAY B;  3L1M A;  2WWU A;  4CS8 C;  3KV6 A;  1J8M F;  4AKR B;  2WU2 A;  2R05 A;  1IZN B;  1Q0F A;  3KYI A;  1WCR A;  1YQ3 A;  4JZA A;  4LF5 T;  2XLV A;  3ZKR A;  2XSB A;  3EZH A;  4BJM A;  4OK0 A;  4G7Z F;  4J30 B;  3ONL C;  5LG3 A;  5LP6 E;  3KPH A;  4X20 E;  4IGG A;  5AQR B;  3RIF A;  4LDQ A;  3S28 A;  4H9P C;  2Q9Q C;  2NW9 A;  3FBZ A;  3C8G D;  4GOU A;  1L0V A;  1M6T A;  5T3W A;  1UX5 A;  3HKB E;  4DBQ A;  3LUT B;  4MVS A;  3VKG A;  3JT1 A;  4AQG A;  4K1O A;  3I1A A;  3U3B A;  4ZI2 D;  5FL1 A;  3RGL A;  2UUI A;  2VVN A;  3M79 A;  2C0S A;  1UGO A;  3QNU A;  4CI1 B;  2YIN A;  4EWC A;  2OG2 A;  3T8O A;  4MVU A;  2J0X A;  4WZX A;  4E7Z A;  1BR1 A;  1RKE A;  2FJD A;  4ILU A;  1V9D A;  3RI5 A;  1E2A A;  2LM2 A;  3Q6N A;  3EQL F;  3IEE A;  3U3F A;  4NXN T;  1E2X A;  2LSK A;  4OIR F;  1Q0G A;  3AA0 B;  3AG3 C;  2OKU A;  3PHF 2;  4MW8 A;  2PG8 A;  1L3P A;  3LSV A;  4KHZ F;  4YTP A;  4HFK B;  4JYA T;  5C3J A;  3C50 A;  4BJ1 A;  3GN5 B;  4DBR A;  3L34 A;  5JTG A;  4IHJ E;  4FI5 A;  4IJJ A;  1NBB A;  1RJ9 B;  3ZC4 A;  2W4X A;  3UMH A;  3WAJ A;  3HNJ A;  2WB7 A;  3SRZ A;  3PMR A;  3RKO A;  2E8I A;  4KX6 A;  3ZJ1 A;  2WDQ A;  3N0T A;  1J5W A;  5LB7 B;  3JAE A;  4TNW A;  1WOL A;  3QB5 K;  4H54 A;  4EZ4 A;  3IHU A;  4OYJ A;  3VRC A;  5AC4 A;  3NVO A;  4PAC A;  2HPJ A;  4QKN A;  3LLI A;  5FXX A;  4M63 A;  2XS8 A;  5AQV B;  4JI8 T;  2QNL A;  4CXY A;  4N06 A;  2M4E A;  4LF6 T;  1UFB A;  4I3M A;  5L0D A;  5EZY E;  2BDE A;  1M56 C;  1ZHY A;  4HEA A;  4U5F E;  3E08 A;  4N78 D;  4DV6 T;  3S9O A;  1JNZ A;  5M4Y A;  3ECS A;  3UQ7 A;  3ZEF B;  2BKP A;  4HWF A;  3AEE A;  4K7B A;  4H9R C;  2NOX A;  2B0H A;  5JR9 B;  4O6M A;  4HTE A;  2J0W A;  2CPT A;  3UU3 A;  3PU8 A;  2AE9 A;  2AXD S;  3RYI E;  3DJN B;  5DQZ A;  4YL0 A;  2IIU A;  3I0Q A;  3EZI A;  3PJA J;  2FBW A;  3K33 A;  2CE7 A;  4WAB A;  3MFN A;  4Z91 A;  4E17 A;  3N9M A;  3C4X A;  3VRA A;  1OXZ A;  4JTA B;  5JUA A;  3JRT A;  3KL4 A;  4QX7 B;  2PTF A;  3GAN A;  4X62 T;  4I55 E;  2A1D D;  2ZXO A;  2IHR 1;  5L0J A;  3OYX A;  3SYN A;  2Y3B A;  3U78 A;  1OED B;  1C17 M;  1YAR O;  2GAQ A;  4PR9 A;  2E9X A;  1T5O A;  2L81 A;  3RLF F;  3AE2 A;  1QQ3 A;  3KKB A;  3EAM A;  3K3N A;  3H3A A;  5DJQ C;  2A2F X;  3LK3 B;  1HCI A;  1LIH A;  5BR8 T;  3LS1 A;  4Z9J A;  4QDL A;  4IGU A;  5IWA T;  2V6Y B;  4CI3 B;  2XM4 A;  4NIQ A;  1LI5 A;  2CXD A;  3WAQ A;  1SZI A;  1IZM A;  3LEO A;  5KYY A;  4PK6 A;  3UNG C;  3L8R A;  3ZQV A;  3FZM B;  5L0C A;  4J7Y A;  4F8H A;  1WYC A;  2XQ7 A;  3US6 A;  2A72 A;  2AWY A;  2EIL C;  4A98 A;  4LMK A;  3B9Q A;  4MBQ A;  5KDM C;  4DV5 T;  3SS1 A;  4HFF B;  3L8J A;  2B1E A;  1Y64 B;  3C98 B;  1DU2 A;  2JJ9 A;  4AE4 B;  4JJF A;  1TFO B;  2R9R B;  2NPU A;  1YJG A;  4OIQ F;  1WN0 A;  5T1D B;  3RFY A;  5L0F A;  4JVS A;  1YYX A;  3HTK C;  5JDH A;  1FR0 A;  2JX0 A;  2F4V T;  2P0N A;  1CHU A;  2R02 A;  3V5Z A;  2DWG A;  2VQE T;  4EXT A;  4MVM A;  1MND A;  3ZSS A;  2CYD A;  2V7K A;  4W8K A;  2WZH A;  4BJ6 A;  4DXW A;  2BC5 A;  5EK2 A;  3ASO C;  4JE9 A;  2LEH A;  4U7I A;  3LFM A;  3O4X E;  1SF8 A;  2D0U A;  2HKV A;  1VLT A;  5BMV E;  2CDQ A;  2BG9 C;  3TLS A;  3QC9 A;  1C02 A;  3AEF A;  1I94 T;  2PP4 A;  3Q5X A;  1VRB A;  2ICW G;  3T1H T;  1W09 A;  3X1D A;  4CDY A;  1IAP A;  4GQH A;  3NZP A;  4JKV A;  1ZEE A;  4U5H A;  2LJL A;  2CWY A;  3L3P A;  3PUS A;  2MAW A;  3IQ6 A;  1RKC A;  4JLE A;  4WBN E;  5HXH A;  2C03 A;  4V1A v;  5HSW A;  4TUY E;  2RA1 A;  4X0R A;  4DVZ A;  2A3D A;  4QH1 A;  2PBE A;  1NG1 A;  3K8P C;  1NU7 D;  4YTM A;  4GYS A;  1VTM P;  4Z90 A;  3JZ0 A;  3AE1 A;  3U3I A;  4G0H A;  2QLA A;  4BJ5 A;  3FBL A;  1Q0M A;  4CBE A;  2YEV A;  4YY3 T;  4DVY P;  4IE0 A;  3QZC A;  2L6H A;  3OYZ A;  2V7J A;  3K1S A;  1T98 A;  2YLD A;  4ZXL A;  4CX9 A;  1XZY A;  3ZT7 A;  2BS2 A;  2LKH A;  3SNH A;  2NTX A;  4O79 A;  2XQ3 A;  4LF7 T;  1US7 B;  1D0Y A;  1PD0 A;  3PUV F;  4EUK B;  4B6I A;  5KYU A;  1HG2 A;  3H3M A;  2KWH A;  4C3E A;  5A6J A;  5FY0 A;  1HW1 A;  4Q7C A;  4DV2 T;  1TWA A;  3RRC A;  4IIJ E;  2NUP B;  4BPM A;  4IE5 A;  2FGY A;  5E33 A;  1O87 A;  1SA0 E;  4I1M A;  4U33 A;  2RD9 A;  1LE2 A;  5FXV A;  1I6Z A;  2YDS A;  3ZCJ A;  2XUE A;  3DI5 A;  5BQI A;  2YRF A;  4H9N C;  4B3M T;  4U9D A;  1OQC A;  4L9I A;  2VH3 A;  2XAJ B;  3UUN A;  3OTO T;  4JI0 T;  1TWG A;  3QW0 A;  3LNM B;  4X1I E;  3RQE A;  4GKK T;  4AL1 A;  3EH2 A;  1QSP A;  3EFO A;  1NFN A;  4AX2 A;  1T6U A;  4XZC A;  4CS8 A;  4CIH A;  2CBJ A;  3J06 A;  2CXL A;  3NG1 A;  4A5X A;  5ABF B;  4Z9H A;  4U72 A;  2P1A A;  1V74 B;  5JVE A;  3UT5 E;  4A56 A;  2HMZ A;  3AE9 A;  3AXJ B;  3JSZ A;  4JUR I;  1AJ3 A;  5AQK B;  1ORY A;  4LFC T;  1I4Y A;  2Q9Q A;  4EGW A;  3Q5D A;  1A41 A;  3PTR B;  2QYW A;  1VYI A;  3M1C B;  3WAK A;  3GMI A;  4CN4 A;  3GOD A;  3DWW A;  3QOF A;  3PCV A;  5HCM A;  3GWL A;  3D0T A;  4PFO A;  3RIP A;  3C4Z A;  4YJ2 E;  2LSG A;  1RXQ A;  4EHP A;  1G4W R;  2ES0 A;  5KYW A;  1LS4 A;  2IW5 B;  2UXN B;  4HWI B;  2HFI A;  4UXN B;  4LMJ A;  5AQG B;  5CI8 A;  4LFB T;  4EB6 E;  4ERR A;  5A69 A;  4DV1 T;  3CZ6 A;  2OQM A;  2Q3T A;  2BKN A;  3ESL A;  3G06 A;  4DV7 T;  2ZXP A;  3U8P A;  3R7C A;  5FL0 A;  4L5G A;  3QUJ A;  5TAO A;  1NAF A;  2ODV A;  1LRZ A;  3O6X A;  4IE6 A;  3C8G B;  5JDG A;  3W4Y A;  5CFB A;  1GM5 A;  2ZPA A;  2WQY A;  3ZPO A;  2Q9Q D;  2KXP B;  5EK3 A;  3AE4 A;  5B3S C;  3K3O A;  1B68 A;  2D5R B;  5GPG B;  1VCT A;  1VK5 A;  4DUY T;  2VL8 A;  3IA3 A;  3TLW A;  3FXD B;  3I0O A;  2LIG A;  2WS3 A;  3T6J A;  2VKJ A;  5JR9 C;  3NBX X;  2W9Y A;  3UU5 A;  5A6B A;  4YFS A;  5FYM A;  3EAB A;  1B7T A;  4ZHQ E;  3BRJ A;  3NRY A;  4NY3 A;  3L39 A;  2W0G A;  2BS4 A;  1ZYR F;  5AQI B;  4BJT A;  5L4H A;  2KK1 A;  4YT8 A;  3EUH A;  1R5I D;  4DO0 A;  4ZI3 C;  2UUA T;  5B1A C;  1WRD A;  5TJ5 E;  3KDS E;  3LBX B;  4AQF C;  4UDV A;  4Q4Z F;  1K40 A;  2YZS A;  2KZ7 B;  4TWF A;  2J8W A;  5AQP B;  2QVA A;  3KVA A;  3RQU A;  4YHJ A;  2N2N A;  3UFG A;  4WBO A;  5CGM A;  1VOM A;  4O4L E;  2J7P A;  1OCO C;  2M64 A;  2C5I T;  5LMU T;  5E2Q A;  3B57 A;  5B1B C;  4H9Q C;  5L47 A;  5DQW A;  5AQQ B;  5IHY A;  1GQA A;  3CWZ B;  3RPU A;  4N4W A;  1HF8 A;  1OED C;  1HNX T;  3AQB A;  3JC6 D;  3NMI A;  1HFA A;  3DJU B;  4CS9 A;  1ZZP A;  1Q0D A;  3FOP A;  1HY5 A;  2OEV A;  1BBH A;  3JAF A;  2FFH A;  3B5M A;  3AVS A;  5A6B D;  2XXA A;  3V5S A;  1Z3I X;  4JEH B;  2DYS C;  2H7O A;  1U89 A;  4NTA A;  1E86 A;  1UUS A;  1RKE B;  2N9D A;  4PJN A;  3GWN A;  4YSX A;  5LCY A;  4EOZ B;  3OKQ A;  3QB5 A;  1ZV4 X;  3NYJ A;  3PUZ F;  5FMN A;  3T4R A;  2JQK A;  3ZQY A;  1WAS A;  3RIA A;  3C63 A;  1CPQ A;  2ZM8 A;  2K9A A;  4ZZC A;  1V55 C;  2KQ9 A;  3CX7 B;  4MTG A;  1HE1 A;  5CA1 E;  3U5S A;  2R7T A;  1NEN A;  2CWO A;  4TV8 E;  1OR3 A;  5JDF A;  3JRM O;  5FZT A;  4COF A;  2J7P D;  5FVK A;  3DM5 A;  2M6I A;  3K1I A;  2BKO A;  2BL2 A;  3KV9 A;  2YKZ A;  4O6Y A;  5L3Q A;  1WYB A;  4NUU A;  1N34 T;  3EH1 A;  3E70 C;  2LP4 A;  3O39 A;  2AVK A;  4HFH A;  2XLO A;  3DZA A;  2FJB A;  2IAK A;  4TV9 E;  2XLD A;  1XZP A;  2YVK A;  3K1H A;  4M1P A;  5DQT A;  3N2O A;  3IPM O;  2IXP A;  4E7S A;  3KBU A;  3W2W A;  3KVB A;  4I44 A;  3EHM A;  3P7I A;  2WMO A;  3ANW B;  3ZWI A;  2YQY A;  2XQ4 A;  1H7C A;  4ILC A;  1S35 A;  3HR0 A;  5KYX A;  4K0K T;  1ZW3 A;  2L3L A;  5JDN A;  2XY8 B;  3AA6 B;  2M6B A;  1EZ3 A;  2MOZ A;  3RYC E;  3I5P A;  4XBF B;  4YL3 A;  3ZG1 A;  2Y3D A;  1Z6A A;  3FAP B;  2EHO C;  3T1Y T;  2PFV A;  5LNK A;  3RYH E;  2A0U A;  3NYL A;  5JVD E;  5E3C A;  2YU2 A;  4DR3 T;  4FX5 A;  5HEO A;  1WTY A;  4PW8 A;  2A6E F;  5KYN A;  4HFE A;  1LS1 A;  3EGX A;  1Y4C A;  3TKL B;  2D4U A;  1UK5 A;  2X9Y A;  4JI6 T;  1WAT A;  2LKG A;  4IDN A;  3N5L A;  2X9H A;  1M2V A;  5LGT B;  1KNP A;  5AQS B;  4NXM T;  3WI3 A;  3F31 A;  3RX6 A;  2HH7 A;  3ZYK A;  2P61 A;  1UX4 A;  2JMH A;  4JEU B;  2R7S A;  3AVR A;  3CML A;  3KH2 A;  3L09 A;  2XHE B;  2W00 A;  1HNW T;  2JPU A;  3LJB A;  3UR3 C;  3RIU C;  2R7R A;  2KC3 A;  4DR1 T;  3B0P A;  3PUY F;  4ISS A;  1JAF A;  2IXN A;  5A1L A;  2Y3G A;  2W62 A;  2WBL A;  4HWD A;  1HX1 B;  4QXC B;  5L3C B;  3CX6 B;  2VB6 A;  4P0A A;  1LVF A;  4ZLD A;  3Q7G A;  1KK7 A;  3JSE O;  2YLI A;  2E87 A;  3P4P A;  2V8S V;  2VUR A;  4OD4 A;  3N9N A;  3N9O A;  5F5F A;  4MVZ A;  4ZS3 A;  4NCQ A;  1M62 A;  3UU8 A;  1YXR A;  4MND A;  2ZMA A;  3DTO A;  2G62 A;  3ZMV B;  4JCH A;  3S29 A;  3W8I A;  3FHD A;  3HKD E;  5KYY B;  2XL4 A;  2NSG A;  1QKR A;  1MQV A;  3EPV A;  2W4M A;  3AE3 A;  4TNV A;  4KHP T;  5LHI B;  2JIW A;  2CLY B;  4HWH A;  3DAG A;  3AAI A;  2PJQ A;  4DUZ T;  2G3V A;  1W0A A;  4K0D A;  2EPN A;  4IRU A;  2KLQ A;  2BG9 E;  4P0B A;  5FCL A;  2G3K A;  3ZLI A;  2CNW A;  2V1D B;  3VYW A;  3RQW A;  3S4U A;  2N1G A;  1ZU5 A;  3CX8 B;  5DVW A;  3LG7 A;  2ODU A;  4P1N A;  4HFD A;  2ACX A;  2I59 A;  3H37 A;  3R2P A;  5JRC A;  4JEA A;  2LHR A;  3E22 E;  5JDL A;  2YOE A;  1UG7 A;  4F6R C;  4OFZ A;  4QI2 A;  3LK2 B;  2R25 A;  4QH5 A;  3DD7 A;  3VHL A;  3IHR A;  5E0O A;  1T72 A;  3AA1 B;  2J9V A;  2J4G A;  2OEX A;  3HJC A;  2XM1 A;  2YDR A;  3TOM A;  1ZVZ A;  5AQH B;  5LA6 E;  4XTK A;  3P4Q A;  4D4N A;  1V54 C;  4IAO A;  2X0L B;  2HZ8 A;  4UVC B;  3N9L A;  1FJG T;  1E7P A;  2IML A;  2BBJ A;  5FXW A;  4DRJ B;  2HMQ A;  4J7T A;  2YK0 A;  3DE9 A;  1NSG B;  2CNW D;  4U31 A;  2PBI A;  4IDO A;  5LGU B;  4H9O C;  3V5Y A;  5LXT E;  2QA7 A;  3DXJ F;  2XPK A;  3S90 A;  3MK7 C;  2C5J A;  4YJ3 E;  2R7X A;  2LE8 A;  1X79 A;  1GGQ A;  5L2L A;  3FZK B;  2KND A;  4G63 A;  3EG9 B;  2HJ3 A;  1Z63 A;  3O1J A;  1AEP A;  5DLJ A;  2VL0 A;  4C90 A;  2LSE A;  3C62 A;  4H4K C;  4MTO A;  3W2V A;  3T9O A;  2J47 A;  3VR9 A;  1Z8U A;  3GN5 A;  1EA8 A;  5J1G A;  1JMW A;  4ZI2 C;  5AGF A;  2R6G F;  2EPM X;  2VVS A;  2UXD T;  4JJG A;  3ZST A;  3E0Z A;  4DR7 T;  2OU6 A;  1QLE C;  2JPF A;  1FNT c;  1CGO A;  3ETU A;  3FB2 A;  5ABH A;  2Y8D A;  3F57 A;  1HMD A;  4NC3 A;  1XDP A;  4H63 V;  3RC3 A;  2K24 A;  2KSF A;  4U5B E;  2NG1 A;  2E9X D;  4LFA T;  5L0H A;  3UTK A;  2PX0 A;  2RPA A;  4YT4 A;  1DOV A;  1I4Z A;  4YSY A;  3PUW F;  2TMV P;  4DR4 T;  3ABK C;  2R7W A;  2YKS A;  3EGD B;  4HFV A;  3LAY A;  3FZL B;  5JLI A;  4EBJ A;  2L6G A;  4ZEY A;  3CIR A;  1NZE A;  3Q6M A;  5L3E B;  3U9M A;  4GYT A;  2KYH A;  2H7B A;  4RD9 A;  2HPL A;  4EYY R;  1BR4 A;  2QTV A;  2CMR A;  1U4Q A;  3LEV A;  3SOL A;  1ZHC A;  4JI1 T;  3AGT A;  1YKH B;  5AQF B;  3DE8 A;  2HN1 A;  2UUC T;  2EPL X;  3HKK A;  4KNV A;  1Z5Z A;  2VCA A;  2NW7 A;  2VKO A;  3ZN1 B;  2OJQ A;  2B76 A;  3BEH A;  2BBH A;  1LM3 B;  2XAQ B;  1NEK A;  4AQF A;  1YA7 O;  4N6H A;  1U5P A;  2WMN A;  2X67 A;  1ZOY A;  4JTD B;  4R32 A;  2HUJ A;  5KX5 E;  2G0U A;  1JNR A;  1Y6D A;  5J2U E;  2GDC A;  1MIV A;  1Q0K A;  5FKY A;  1YLM A;  4FJO A;  5AQN B;  3F47 A;  4UV8 B;  5LYJ E;  2Q9Q B;  4EBK A;  1SMY F;  4X5T A;  3PE0 A;  1T7S A;  4HWC A;  4IAQ A;  3SWH A;  4U9E A;  4IT4 A;  1OCZ C;  4ZLC A;  4QH4 A;  2Q7R A;  2RP4 A;  2WVQ A;  2Q9C A;  4CXW A;  1VMA A;  3AE8 A;  3TJ6 A;  2XQ5 A;  1VCS A;  3RKO F;  5DS4 A;  1QPU A;  5KYW B;  3RHW A;  1FMW A;  1E84 A;  4PNI A;  4CXX A;  3U0C A;  3EDV A;  3O1H A;  5KXJ A;  1XWM A;  4B3R T;  1UUR A;  4YT0 A;  2WCA A;  3RVZ A;  2F22 A;  1HMO A;  3RRW A;  2CM0 A;  4EIW A;  2Y6X A;  3FDQ A;  4IAR A;  3QMK A;  4YN0 B;  1H7I A;  3SXM A;  2ZLY A;  5AQJ B;  1HX8 A;  4HN9 A;  1KNZ A;  3G4Z A;  5HXS A;  2CBI A;  2CHO A;  4NPP A;  4O6N A;  4XWJ A;  3BQI A;  1OKK A;  3ZSU A;  3IQT A;  3GA8 A;  3EI0 A;  3M3Z B;  3VF0 A;  4IDQ A;  2WSS V;  2KMF A;  4JI3 T;  3V5U A;  3MAC A;  1LPE A;  1OED E;  4YL1 A;  2I8B A;  1OXB A;  3KYJ A;  4LLC A;  4X66 T;  3NKZ A;  3Q2M A;  2NR4 A;  4U2Y A;  3RKG A;  2XLW A;  3MLG A;  3OJA A;  4H9S E;  4ASK A;  1E83 A;  4TX5 A;  1KF6 A;  2WAU A;  3VR8 A;  2OOC A;  2IBF A;  2J45 A;  2W63 A;  2FUP A;  1J5E T;  4DOZ A;  2MPK A;  3HNK A;  2RSE B;  3GEH A;  4P6I C;  3RYF E;  2H3R A;  2V5C A;  3KFW X;  3V5X A;  3CAX A;  2Y48 B;  4U3C A;  5KMG P;  1TR2 A;  2EHO A;  5HEG A;  2XL6 A;  2LOP A;  2WDV A;  2BS3 A;  2XJ7 A;  4G78 A;  4E18 A;  5HWX A;  2QUP A;  4JI4 T;  2QE9 A;  4JW1 A;  4H63 H;  3ZC1 A;  2R7Q A;  3FZH B;  2R7V A;  2XXA B;  2D0T A;  4WGY A;  3HA4 A;  3IQ5 A;  3C4W A;  2XLM A;  4KC9 A;  3OWT A;  3OEO A;  1T01 A;  2IXO A;  2WU5 A;  1OW6 A;  2IXM A;  5E3A A;  3RF1 A;  3JAD A;  2IYL D;  2HV6 A;  4HEA J;  3MJX A;  2VAS A;  1MMD A;  3CQG B;  4U5D E;  2A68 F;  2V26 A;  2B0J A;  2I6H A;  4YJW A;  4MS2 A;  4DID B;  2A0B A;  2YU1 A;  3AAE B;  2JMK A;  2IDO B;  2CLY C;  4IB4 A;  1JPJ A;  1QZX A;  5L4E A;  4YHH T;  3AG1 C;  1I5N A;  3RIU A;  2X66 A;  3ABV A;  4HFI A;  4OD5 A;  3VAY A;  3ZCI A;  3U8V A;  2EHO D;  3BQK A;  3ZTZ A;  3A7M A;  4UF0 A;  4QXH B;  5COG A;  4UV9 B;  3PJA A;  4CZZ B;  2HHH T;  1TWH A;  4EAH A;  3WHN A;  2CEA A;  4TZ4 C;  3P50 A;  3SP1 A;  1ZW2 A;  1R8I A;  4I4T E;  5BQH A;  1ZU4 A;  3PUA A;  3N9P A;  3P8C D;  4EED A;  2VWA A;  4BJ6 C;  3TQO A;  4DR2 T;  4GIW A;  3ASN C;  5AQL B;  4PAG A;  4KUM B;  1XNQ T;  3VKH A;  1G5Z A;  1OW7 A;  3MYI A;  4EBB A;  1XMO T;  2ASR A;  2IC9 A;  1ORS C;  3K66 A;  3GM3 A;  2DLR A;  2JQH A;  1T9K A;  5J2T E;  3B0U X;  3FVY A;  3M4C A;  3UGP A;  5ABE A;  5JS5 A;  3OPC A;  1JRA A;  3WG7 C;  4JI5 T;  3CQZ A;  4AKL A;  3GWH A;  1K04 A;  4TWD A;  4IST A;  5L3G B;  5JH7 E;  1Y01 A;  2UXC T;  1YD8 G;  2YL0 A;  3EGX B;  3PUQ A;  1D1B A;  3X2Q C;  4NUV A;  4DMW A;  4GK0 E;  4U5G A;  1KTM A;  1AUE A;  2WZG A;  5DS6 A;  4HFB A;  2EPO A;  1IJ5 A;  5LGN B;  5LG4 A;  3ZT5 A;  4UEL A;  1M2V B;  2A69 F;  2E2A A;  3EJN A;  3RF3 A;  3O9X A;  4NTB A;  3G50 A;  2D9D A;  5ADX L;  2V6X A;  1Z0P A;  3LS0 A;  3FZF B;  4UR9 A;  4EV6 A;  1W2W A;  5F28 E;  3O10 A;  4LLE A;  1GQE A;  2X0C A;  3NMJ A;  3R6N A;  3RQG A;  4EKW A;  2NP9 A;  4ER9 A;  1R4T A;  3O1I A;  3A8Y C;  3KMI A;  4XPY A;  4MW3 A;  4YT5 A;  2FAP B;  5CB4 E;  4E0H A;  5LJN A;  2E5L T;  2YN6 A;  1U0B B;  4A4A A;  1XNR T;  3LK4 2;  4MVO A;  3ONX A;  1SYQ A;  3S27 A;  3AG2 C;  3TLV A;  3OVU A;  2UXX B;  1WWP A;  4Q25 A;  5DAB A;  4KNW A;  2GWW A;  4CSA C;  3FMS A;  2HSB A;  2ZM0 A;  5FXZ A;  2LSJ A;  5HEH A;  2CA5 A;  4DV4 T;  3C8G A;  1FMV A;  2XSE A;  4A2N B;  2KW3 C;  2H89 A;  2PFD A;  2XQA A;  3O55 A;  3U2L A;  2KNH A;  2CCY A;  3MBG A;  1BZ4 A;  3ZN0 B;  3HKC E;  1J1J A;  4AL0 A;  2DI3 A;  3I9W A;  1WLX A; 
#chains in the Genus database with same CATH homology
 3C51 A;  4CI2 B;  4QX8 B;  4CS7 A;  3MX3 A;  3TD7 A;  4CQI A;  4MFR A;  2PF4 E;  5HWY A;  3CQX C;  4DVD A;  3SEO A;  4QHO A;  5JRC B;  2H7V C;  3J7Y q;  3LBX A;  4IE4 A;  3K7D A;  1ZHT A;  3AB3 B;  3PUG A;  2Y39 A;  3ZMT B;  1HG5 A;  2Y69 C;  2IC6 A;  1S7Z A;  3LNR A;  3ZYM A;  4C7O A;  4DMV A;  1FFT C;  4OIP F;  3K3Q C;  2VKH A;  2LT3 A;  4XLN F;  1WGW A;  4AI6 A;  4ULW A;  2W4B A;  2J1D G;  3SZR A;  3B0V C;  3EDU A;  5F5H A;  3CPZ A;  2JD3 A;  2Y3H A;  2E9X B;  5HXC A;  2QY9 A;  3DAF A;  4U5E E;  2K5B B;  2V3C C;  5DQV A;  1ZHX A;  2Q9A A;  4J2C A;  3Q7L A;  2KIN B;  4XAX B;  2P9B A;  4YWQ A;  3JC6 C;  2V7L A;  4RBN A;  3UMI A;  1MMA A;  2HV7 A;  2V7M A;  2NUT A;  2JQQ A;  3AA7 B;  4AK9 A;  5C8Y E;  4AKH A;  4O4I E;  5L3F B;  1HS7 A;  1D0X A;  4ZS2 A;  3I9Y A;  1IW7 F;  3MZK B;  2MWQ A;  3ANW A;  3CQC B;  1E1H B;  4U5C E;  4HKA A;  3E9V A;  4C91 A;  4I50 E;  1NU9 C;  2DNX A;  2K48 A;  4YT2 A;  3B13 A;  1MMG A;  2BVM A;  3ZYL A;  3LES A;  5EHH A;  2XQY A;  4G7O F;  3ZIB A;  3ETV A;  4MLK A;  5HXE A;  1J8Y F;  1TKN A;  4CS9 C;  3A5X A;  3UUM A;  3K6B A;  1YKE B;  4QXB B;  5L3V A;  3I5Q A;  4C3B A;  2MBG A;  2X68 A;  2J46 A;  4EZH A;  3DMD A;  2GFH A;  3OA1 A;  2WZL A;  2LSI A;  2X51 A;  5JDM A;  5LBQ B;  3AAA B;  2OA5 A;  2LM9 A;  2C5K T;  4PJL A;  5JRE A;  5ETW A;  4RDA A;  3ZVR A;  4QWN B;  2J9W A;  4L0R A;  4P09 A;  4DND A;  1MMN A;  3NYM A;  5CA0 E;  1LKX A;  3K1I C;  2BVL A;  3N2G E;  2X9X A;  1PCX A;  1QUU A;  3ZC0 A;  4GYR A;  3RH3 A;  2CW0 F;  2KT9 A;  1IJ6 A;  1D0Z A;  3KBT A;  3Q5W A;  4ANJ A;  2VKD A;  1RJ9 A;  4BA9 A;  1MIY A;  1FIO A;  3T6B A;  3CSK A;  3KV5 A;  1CUN A;  3DM9 B;  4G7H F;  3DP7 A;  5H6Q B;  3KIN B;  5KYU B;  1SHZ C;  2MTQ A;  2DWK A;  4UIG A;  5L3D B;  3V7O A;  1G8X A;  3UUL A;  1FTS A;  3S0X A;  2EIJ C;  1JPN A;  2WL8 A;  5FNV E;  4LAC B;  5L3B B;  2NTY A;  2R7U A;  3W8H A;  3BQL A;  4MQ9 F;  5D91 A;  1PD1 A;  1M2O A;  2LOS A;  2L9Q A;  1MIW A;  5EK4 A;  5JR9 A;  4OIN F;  3KV4 A;  3EFO B;  2NW8 A;  4ZOL E;  2LHN A;  2L9J A;  2PX3 A;  3N2K E;  1WR6 A;  5JDQ A;  3HI2 A;  4PK5 A;  2DCF A;  3JCU Q;  1HTJ F;  3M65 A;  1ZKE A;  4PFP A;  2P7V A;  3HL6 A;  2EIM C;  4OYK A;  2EHO B;  1QSD A;  2BZB A;  2KJG A;  1ST6 A;  1ZHZ A;  4JUY A;  3AQC A;  4PJJ A;  1OCR C;  3UMK A;  5D92 A;  4O4J E;  3EG9 A;  4PJM A;  2XAG B;  5F3J A;  4X1K E;  5CI9 A;  2WM9 A;  4O8S A;  4KBL A;  3R84 B;  4MAL A;  3LLK A;  3C64 A;  4ZI3 D;  1N1C A;  3ABM C;  1FFH A;  2OCC C;  1LVK A;  4EYU A;  2R7O A;  1VYK A;  3PDY A;  3EHN A;  3HKE E;  4UF0 B;  4IE7 A;  4X1Y E;  5LHG B;  2A6H F;  4GK5 E;  1BR2 A;  4I43 B;  4AE4 A;  3UFE A;  2Z15 A;  3AG4 C;  4J32 B;  4AKI A;  2XAF B;  1UCU A;  3ABL C;  4IDZ A;  4IWB A;  1OWA A;  2D5U A;  4QI0 A;  3ZMU B;  1YW0 A;  2X9W A;  2P6V A;  3ZJ2 A;  3EGD A;  4CSA A;  3F46 A;  3ITF A;  3NKE A;  3ZMS B;  2WVO A;  4ADZ A;  2YHS A;  3FXE B;  2DI4 A;  4K0U A;  3CKD A;  3NRH A;  4MHC A;  3PU3 A;  3BK9 A;  3RC8 A;  2D2S A;  2CGE A;  2WZF A;  5FP3 A;  4KP3 C;  3FHN A;  4UEM A;  4C3D A;  2XAS B;  1OKK D;  5GON E;  2E9X C;  3MXZ A;  5IY5 C;  5LHH B;  4U74 A;  4UVB B;  5F8P A;  4O7G A;  4B6X A;  2JRK A;  4TN7 B;  1TWC A;  3NRX A;  2EIK C;  5AFU L;  2CXF A;  3QK6 A;  3POV A;  3NDB B;  2EIN C;  2M67 A;  4O2A E;  2L8K A;  1NWM X;  2XTL A;  2MYS A;  5FY7 A;  2Q9B A;  5IYZ E;  2Z6E A;  5EGY A;  3DJB A;  3J9X 1;  3N24 A;  4F4B A;  1BR0 A;  2W61 A;  5FY1 A;  3N9Q A;  1D1A A;  2XRH A;  1S94 A;  5LBM A;  5HAX A;  3ZMZ B;  1O3X A;  3LJC A;  4WW0 A;  2SPC A;  4O2B E;  3CVR A;  1FEW A;  2NUP A;  3NZQ A;  5LJM A;  4FES A;  4HE8 A;  3N2Z B;  2J9U A;  2QGS A;  4YLH A;  3Q9D A;  2GK9 A;  3X1O A;  5LOV E;  5KYX B;  4FWV A;  4I1O B;  2DYR C;  3I4U A;  3IF8 B;  1M57 C;  2ZXR A;  3PUR A;  4WJ0 A;  1O5H A;  3IBP A;  3VU7 H;  4AXP A;  4OIO F;  3W15 B;  2BE5 F;  3RYL A;  1KU2 A;  4HGA A;  4KBM B;  2O9X A;  5H6R B;  4HE8 D;  2LSY A;  3F2E A;  2WVN A;  4KMC A;  4BJ5 C;  4C7O B;  3WOD F;  1MNE A;  4BG0 A;  2YEV C;  2KGO A;  2VK9 A;  5JQG E;  1G73 A;  4UVA B;  3HLZ A;  5BUO A;  4BEJ A;  3FAJ A;  3JYH A;  4O4H E;  3L0I A;  3NKD A;  4Q5S F;  4AKG A;  2DHR A;  5HXR A;  4LER A;  4Z8X A;  4OHF A;  2NWB A;  2ZXW C;  4ZI7 E;  1OCC C;  4PK4 A;  4KI2 A;  5T3T A;  2ZM2 A;  2CCQ A;  2V7I A;  4GEH A;  5DS5 A;  4BJN A;  5HYA A;  3UGO A;  3MA9 A;  1ZHW A;  2IOQ A;  1Z23 A;  4XLP F;  2NUT B;  4G2A A;  1D1C A;  2C04 A;  3EVY A;  2XAH B;  3H65 A;  2W45 A;  3OBV E;  2DGJ A;  3MKD A;  2KWI B;  4WNK A;  3UUX B;  4BAY B;  2WWU A;  4CS8 C;  3KV6 A;  1J8M F;  4AKR B;  1IZN B;  4JZA A;  3EZH A;  4BJM A;  4OK0 A;  4G7Z F;  4J30 B;  5LP6 E;  4X20 E;  3S28 A;  4H9P C;  2Q9Q C;  2NW9 A;  3FBZ A;  4GOU A;  5T3W A;  1UX5 A;  3HKB E;  4DBQ A;  3VKG A;  3JT1 A;  4AQG A;  3I1A A;  4ZI2 D;  2C0S A;  4CI1 B;  2YIN A;  4EWC A;  2OG2 A;  3T8O A;  2J0X A;  4E7Z A;  1BR1 A;  4ILU A;  1V9D A;  3Q6N A;  3EQL F;  3IEE A;  2LSK A;  4OIR F;  3AG3 C;  3AA0 B;  3PHF 2;  2PG8 A;  4HFK B;  3C50 A;  4BJ1 A;  3GN5 B;  4DBR A;  3L34 A;  4IHJ E;  4FI5 A;  4IJJ A;  1RJ9 B;  3ZC4 A;  3UMH A;  3WAJ A;  2WB7 A;  3SRZ A;  3PMR A;  3RKO A;  2E8I A;  3ZJ1 A;  3N0T A;  4EZ4 A;  4OYJ A;  2HPJ A;  4QKN A;  3LLI A;  5FXX A;  4M63 A;  4CXY A;  4N06 A;  2M4E A;  4I3M A;  5EZY E;  2BDE A;  1M56 C;  1ZHY A;  4HEA A;  4U5F E;  3E08 A;  4N78 D;  5M4Y A;  3ECS A;  3ZEF B;  4K7B A;  4H9R C;  2NOX A;  5JR9 B;  4O6M A;  4HTE A;  2J0W A;  3PU8 A;  3RYI E;  3DJN B;  5DQZ A;  3I0Q A;  3EZI A;  3K33 A;  2CE7 A;  3N9M A;  3C4X A;  1OXZ A;  3JRT A;  3KL4 A;  4QX7 B;  3GAN A;  4I55 E;  2A1D D;  2ZXO A;  3OYX A;  3SYN A;  2Y3B A;  3U78 A;  2E9X A;  2L81 A;  3KKB A;  3K3N A;  3H3A A;  5DJQ C;  2A2F X;  3LK3 B;  1HCI A;  3LS1 A;  4QDL A;  4IGU A;  4CI3 B;  2CXD A;  1SZI A;  1IZM A;  5KYY A;  4PK6 A;  3UNG C;  1WYC A;  2A72 A;  2EIL C;  3B9Q A;  4MBQ A;  5KDM C;  3SS1 A;  4HFF B;  2B1E A;  1Y64 B;  3C98 B;  2JJ9 A;  4AE4 B;  4JJF A;  4OIQ F;  5T1D B;  3RFY A;  4JVS A;  3HTK C;  5JDH A;  2DWG A;  4EXT A;  1MND A;  2V7K A;  4W8K A;  4BJ6 A;  5EK2 A;  3ASO C;  2LEH A;  3LFM A;  3O4X E;  1SF8 A;  2D0U A;  5BMV E;  2CDQ A;  3QC9 A;  2PP4 A;  3Q5X A;  1VRB A;  1IAP A;  3NZP A;  1ZEE A;  4U5H A;  2LJL A;  2CWY A;  3L3P A;  3PUS A;  4JLE A;  4WBN E;  5HXH A;  2C03 A;  4V1A v;  5HSW A;  4TUY E;  2RA1 A;  4X0R A;  4DVZ A;  2A3D A;  1NG1 A;  3K8P C;  1NU7 D;  4GYS A;  3U3I A;  4G0H A;  4BJ5 A;  3FBL A;  4CBE A;  2YEV A;  4DVY P;  4IE0 A;  3QZC A;  3OYZ A;  2V7J A;  1T98 A;  3SNH A;  2NTX A;  4O79 A;  1US7 B;  1D0Y A;  1PD0 A;  4B6I A;  5KYU A;  1HG2 A;  2KWH A;  4C3E A;  5FY0 A;  4Q7C A;  1TWA A;  3RRC A;  4IIJ E;  2NUP B;  4IE5 A;  2FGY A;  5E33 A;  1O87 A;  1SA0 E;  4I1M A;  5FXV A;  3ZCJ A;  2XUE A;  4H9N C;  4L9I A;  2VH3 A;  2XAJ B;  3UUN A;  1TWG A;  4X1I E;  3EH2 A;  3EFO A;  4AX2 A;  4XZC A;  4CS8 A;  4CIH A;  2CXL A;  3NG1 A;  4U72 A;  3UT5 E;  4A56 A;  3JSZ A;  4JUR I;  1AJ3 A;  2Q9Q A;  3PTR B;  1VYI A;  3M1C B;  3WAK A;  3GMI A;  3GOD A;  3D0T A;  4PFO A;  3RIP A;  3C4Z A;  4YJ2 E;  2LSG A;  2ES0 A;  5KYW A;  2IW5 B;  2UXN B;  4UXN B;  5CI8 A;  4EB6 E;  4ERR A;  3CZ6 A;  2Q3T A;  3ESL A;  2ZXP A;  4L5G A;  3QUJ A;  5TAO A;  1NAF A;  2ODV A;  1LRZ A;  3O6X A;  4IE6 A;  5JDG A;  2ZPA A;  3ZPO A;  2Q9Q D;  2KXP B;  5EK3 A;  5B3S C;  3K3O A;  2D5R B;  1VK5 A;  2VL8 A;  3FXD B;  3I0O A;  3T6J A;  2VKJ A;  5JR9 C;  3NBX X;  2W9Y A;  4YFS A;  5FYM A;  1B7T A;  4ZHQ E;  3NRY A;  4NY3 A;  2W0G A;  1ZYR F;  4BJT A;  4YT8 A;  3EUH A;  4DO0 A;  4ZI3 C;  5B1A C;  1WRD A;  3KDS E;  3LBX B;  4AQF C;  4Q4Z F;  2YZS A;  2KZ7 B;  3KVA A;  4YHJ A;  2N2N A;  4WBO A;  1VOM A;  4O4L E;  2J7P A;  1OCO C;  2C5I T;  5E2Q A;  3B57 A;  5B1B C;  4H9Q C;  5DQW A;  5IHY A;  3CWZ B;  3RPU A;  1HF8 A;  3AQB A;  3JC6 D;  1HFA A;  3DJU B;  4CS9 A;  2FFH A;  3AVS A;  2XXA A;  3V5S A;  1Z3I X;  4JEH B;  2DYS C;  2H7O A;  2N9D A;  4PJN A;  5LCY A;  4EOZ B;  3OKQ A;  1ZV4 X;  3NYJ A;  5FMN A;  3T4R A;  2KQ9 A;  2ZM8 A;  2K9A A;  1V55 C;  3CX7 B;  5CA1 E;  2R7T A;  2CWO A;  4TV8 E;  5JDF A;  2J7P D;  3DM5 A;  3KV9 A;  4O6Y A;  5L3Q A;  1WYB A;  4NUU A;  3EH1 A;  3E70 C;  3O39 A;  3DZA A;  2IAK A;  4TV9 E;  3K1H A;  4M1P A;  5DQT A;  3N2O A;  2IXP A;  4E7S A;  3KBU A;  3W2W A;  3KVB A;  4I44 A;  3EHM A;  3P7I A;  2WMO A;  3ANW B;  1H7C A;  1S35 A;  3HR0 A;  5KYX A;  2L3L A;  5JDN A;  3AA6 B;  1EZ3 A;  2MOZ A;  3RYC E;  3I5P A;  4XBF B;  3ZG1 A;  2Y3D A;  1Z6A A;  2EHO C;  2PFV A;  5LNK A;  3RYH E;  3NYL A;  5JVD E;  5E3C A;  2YU2 A;  4FX5 A;  4PW8 A;  2A6E F;  5KYN A;  1LS1 A;  3EGX A;  3TKL B;  2X9Y A;  3N5L A;  2X9H A;  1M2V A;  5LGT B;  3WI3 A;  3F31 A;  3RX6 A;  2HH7 A;  3ZYK A;  1UX4 A;  2JMH A;  4JEU B;  2R7S A;  3AVR A;  3CML A;  3KH2 A;  3L09 A;  2XHE B;  2W00 A;  3LJB A;  3UR3 C;  2R7R A;  3B0P A;  4ISS A;  2IXN A;  2Y3G A;  5A1L A;  2W62 A;  2WBL A;  4QXC B;  5L3C B;  3CX6 B;  2VB6 A;  4P0A A;  1LVF A;  4ZLD A;  3Q7G A;  1KK7 A;  2E87 A;  4OD4 A;  3N9N A;  3N9O A;  5F5F A;  4ZS3 A;  4MND A;  2ZMA A;  3DTO A;  2G62 A;  3ZMV B;  4JCH A;  3S29 A;  3W8I A;  3FHD A;  3HKD E;  5KYY B;  2XL4 A;  3EPV A;  2W4M A;  5LHI B;  2CLY B;  3DAG A;  3AAI A;  2PJQ A;  2G3V A;  4K0D A;  4IRU A;  2KLQ A;  4P0B A;  5FCL A;  2G3K A;  3ZLI A;  2CNW A;  2V1D B;  3VYW A;  3S4U A;  2N1G A;  1ZU5 A;  3CX8 B;  5DVW A;  3LG7 A;  2ODU A;  2ACX A;  2I59 A;  3H37 A;  5JRC A;  2LHR A;  3E22 E;  5JDL A;  4F6R C;  4OFZ A;  4QI2 A;  3LK2 B;  3DD7 A;  3VHL A;  3IHR A;  5E0O A;  3AA1 B;  2J9V A;  3HJC A;  5LA6 E;  4XTK A;  1V54 C;  4IAO A;  2X0L B;  4UVC B;  3N9L A;  5FXW A;  2YK0 A;  2CNW D;  2PBI A;  5LGU B;  4H9O C;  5LXT E;  2QA7 A;  3DXJ F;  3MK7 C;  2C5J A;  4YJ3 E;  2R7X A;  2LE8 A;  1X79 A;  5L2L A;  2KND A;  4G63 A;  3EG9 B;  1Z63 A;  3O1J A;  5DLJ A;  4C90 A;  2LSE A;  4H4K C;  3W2V A;  3GN5 A;  5J1G A;  4ZI2 C;  4JJG A;  3E0Z A;  1QLE C;  2JPF A;  3ETU A;  3FB2 A;  2Y8D A;  3F57 A;  4H63 V;  3RC3 A;  4U5B E;  2K24 A;  2NG1 A;  2E9X D;  3UTK A;  2PX0 A;  4YT4 A;  3ABK C;  2R7W A;  3EGD B;  4HFV A;  3LAY A;  1NZE A;  3Q6M A;  5L3E B;  4GYT A;  2H7B A;  4RD9 A;  2HPL A;  4EYY R;  1BR4 A;  2QTV A;  2CMR A;  1U4Q A;  3LEV A;  3SOL A;  1ZHC A;  1YKH B;  4KNV A;  1Z5Z A;  2NW7 A;  2VKO A;  3ZN1 B;  2XAQ B;  4AQF A;  1U5P A;  2WMN A;  2X67 A;  5KX5 E;  2G0U A;  5J2U E;  1MIV A;  4FJO A;  3F47 A;  4UV8 B;  5LYJ E;  2Q9Q B;  1SMY F;  3PE0 A;  3SWH A;  1OCZ C;  4ZLC A;  2RP4 A;  2WVQ A;  2Q9C A;  4CXW A;  1VMA A;  3RKO F;  5DS4 A;  5KYW B;  1FMW A;  4PNI A;  4CXX A;  3EDV A;  3O1H A;  3RRW A;  2CM0 A;  4EIW A;  2Y6X A;  3FDQ A;  3QMK A;  4YN0 B;  2ZLY A;  1KNZ A;  1HX8 A;  4HN9 A;  4O6N A;  5HXS A;  4XWJ A;  3BQI A;  1OKK A;  3ZSU A;  3GA8 A;  2WSS V;  2KMF A;  3V5U A;  3MAC A;  2I8B A;  4LLC A;  3Q2M A;  3MLG A;  3OJA A;  4H9S E;  4ASK A;  4TX5 A;  2WAU A;  2J45 A;  2W63 A;  4DOZ A;  4P6I C;  3RYF E;  2H3R A;  3KFW X;  2Y48 B;  5KMG P;  1TR2 A;  2EHO A;  2LOP A;  5HWX A;  4JW1 A;  4H63 H;  3ZC1 A;  2R7Q A;  2R7V A;  2XXA B;  2D0T A;  3HA4 A;  3C4W A;  4KC9 A;  3OWT A;  3OEO A;  2IXO A;  2IXM A;  5E3A A;  2IYL D;  2HV6 A;  4HEA J;  3MJX A;  2VAS A;  1MMD A;  3CQG B;  4U5D E;  2A68 F;  2V26 A;  2B0J A;  4YJW A;  3AAE B;  2YU1 A;  2JMK A;  2CLY C;  1JPJ A;  1QZX A;  3AG1 C;  2X66 A;  4OD5 A;  3VAY A;  3ZCI A;  2EHO D;  3BQK A;  4UF0 A;  4QXH B;  4UV9 B;  4CZZ B;  1TWH A;  4EAH A;  2CEA A;  4TZ4 C;  3SP1 A;  4I4T E;  1ZU4 A;  3PUA A;  3N9P A;  3P8C D;  2VWA A;  4BJ6 C;  4GIW A;  3ASN C;  4PAG A;  4KUM B;  3VKH A;  4EBB A;  2IC9 A;  3K66 A;  2DLR A;  5J2T E;  3B0U X;  3FVY A;  3UGP A;  3WG7 C;  3CQZ A;  4AKL A;  3GWH A;  4IST A;  5L3G B;  5JH7 E;  1YD8 G;  3EGX B;  3PUQ A;  1D1B A;  3X2Q C;  4NUV A;  4DMW A;  4GK0 E;  4U5G A;  2WZG A;  5DS6 A;  1IJ5 A;  5LGN B;  5LG4 A;  4UEL A;  1M2V B;  2A69 F;  3EJN A;  3O9X A;  5ADX L;  1Z0P A;  3LS0 A;  1W2W A;  4LLE A;  3R6N A;  2NP9 A;  3O1I A;  3KMI A;  4YT5 A;  5CB4 E;  5LJN A;  3LK4 2;  3ONX A;  3S27 A;  3AG2 C;  2UXX B;  5DAB A;  4KNW A;  4CSA C;  2ZM0 A;  5FXZ A;  2LSJ A;  2CA5 A;  1FMV A;  2XSE A;  4A2N B;  2KW3 C;  2PFD A;  2KNH A;  3ZN0 B;  3HKC E;  3I9W A;  1WLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...