3IEEA

Crystal structure of an alpha helical protein (bf3319) from bacteroides fragilis nctc 9343 at 1.70 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
256
structure length
256
Chain Sequence
VSTADIENAAEVIKYYNTSLGVLKDMVKEKDVNAVLDYMEQKGKTPALSAIVPPAVVSKDSAIVLNPGNCFNEETRRNLKQNYTGLFQARTEFYANFDTYLSYLKKKDVTNAKKLLDVNYQLSTQMSEYKQNIFDILSPFTEQAELVLLVDNPLKAQIMSVRKMSSTMQSILNLYARKHRMDGPRIDLKVAELTKQLDAAKKLPVVNGHEGEMKSYQAFLSQVETFIKQVKKVREKGEYSDADYDMLTSAFETSII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein BF3319 from Bacteroides fragilis (YP_212931.1) from Bacteroides fragilis NCTC 9343 at 1.70 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Structural genomics, unknown function
molecule keywords Putative exported protein
total genus 104
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ieeA02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ieeA01
4YJWA 3IEEA 3RH3A
chains in the Genus database with same CATH superfamily
4TNVA 1U5PA 3SP1A 5D92A 3GA8A 3P4PA 1Y4CA 5HXSA 4J7TA 4DUYT 4PJJA 5JR9A 4XWJA 4YL1A 3S84A 1OEDB 5LGUB 4O8SA 3ZMVB 1IW7F 2PBIA 4HWDA 1Z23A 1H6GA 3NDBB 4OK0A 4X1KE 5J1GA 3O1JA 5ABEA 3ONLC 5BQIA 1YA9A 3MX3A 4XEVA 3LK42 2LCHA 5IY5C 4YY3T 2E5VA 3CKDA 2BG9A 5JVDE 2WCAA 3W2VA 3RRCA 2CYDA 4NTFA 5FXZA 3P7IA 3EDVA 3K3NA 3EHMA 3JAFA 3S0XA 3I1AA 2CBIA 4K7BA 4KC9A 3EI0A 2EHOC 5A6BA 3RYHE 5BUOA 3N9PA 2W63A 3ASNC 2OOCA 3W4YA 3AVSA 2PFVA 4MW3A 4OYKA 2HSQA 4KI2A 2VC9A 4AX2A 3I0QA 2L6GA 3AE9A 3WG7C 2W2UA 2MYSA 2H89A 2NR4A 4BJTA 5DS4A 4IT4A 2FJDA 1U4QA 1C02A 2KNHA 4EBKA 3SWHA 4A4AA 3PUQA 3FXDB 3HJCA 3E22E 4UVBB 5FL0A 1GQAA 1NSGB 4LF4T 2WY2A 3AOUA 3EZIA 1ZV4X 1JAFA 4JV5T 5J2TE 3AECA 1FMVA 4BAYB 4CN6A 1S94A 4OIPF 3Q9DA 3C51A 2V6YA 4QKNA 1QQ3A 3AEEA 5AQKB 5H6QB 2PX3A 3DE9A 4IL4A 5FKYA 1T9KA 1FMWA 2J62A 3VRBA 3ESLA 1V9DA 3CQXC 2HN2A 2ZM2A 3DWWA 4X64T 2H8AA 4ISTA 4H9OC 2ZM6T 3Q7GA 3WAQA 3R7CA 5C3JA 3RQWA 4Z9JA 3ZG1A 4LDKA 2Q9BA 3UQ4A 4BJ1A 3V5ZA 1YKHB 4PR9A 1TFOB 3S9OA 1ORYA 3RQFA 3VF0A 1HR0T 1AVOB 4P1NA 4C7OA 3M15A 4B6XA 4YHJA 5ADXL 5HAXA 3ABLC 3ZT7A 3ABKC 3RF1A 1TR2A 1Q0GA 3B29A 3K1IC 4UF0B 1LPEA 3UGPA 3IPMO 1OCZC 5L0CA 1V74B 3LJBA 1KNPA 4WABA 2KSFA 4WBOA 4YN0B 3J9X1 5L47A 4ANJA 4O4JE 2G0UA 3HTKC 3ZYLA 3G4ZA 2E2AA 2XL4A 4CSAA 4G0HA 4DBQA 2XHEB 2KJGA 5LJNA 5COMA 5JR9B 1NLXA 1QLBA 2ZM8A 1XMOT 4CS8C 3J7Yq 3SZRA 3FZLB 1CHUA 4O6YA 3ZDLA 3OPCA 3IQCA 3FZKB 1NBBA 2YVKA 1HG2A 1JNZA 3RYFE 5M4YA 2J47A 2YDRA 5JRCA 5FNVE 4L6RA 3MA9A 3NZQA 3IQ6A 4R32A 5LMNT 2ODVA 2XRHA 4U72A 5HSWA 4HFEA 4MLKA 3O1HA 1O5HA 3AJMA 2KW3C 5F5FA 2FJBA 3NMJA 3PUZF 4BJ6C 1IBKT 5KYXB 1KFYA 5DVWA 3DE8A 5L0HA 3AA1B 2ZLYA 3EUHA 4TNWA 3F46A 1WYBA 4X65T 4HFHA 2YL0A 2BS3A 2K9AA 2BZBA 2V3CC 4CS9A 1PD0A 4W8KA 2Y48B 4JURI 1N1CA 1T6UA 1N34T 1EKYA 2WB7A 2KMFA 2PF4E 5F5WA 2HUJA 1Z8UA 1ZHZA 2J45A 3D0TA 3NYJA 1UX5A 4C90A 4MALA 3RRWA 3AEDA 3FZHB 1LM3B 2BG9C 4K0KT 1CUNA 3PE0A 2KK1A 2I0MA 2D0UA 2NPUA 5EK2A 3WAJA 3TD7A 1T6IA 2ASRA 3BQIA 4B3MT 1FIOA 4JI8T 1MMAA 5E3AA 3IQTA 4N4WA 4IL9A 1W2WA 4MTGA 2E8IA 5FY1A 2D5UA 4LMJA 3ZSTA 4MQ9F 4L9IA 2X66A 1NAFA 3FBLA 3U3FA 1B68A 4KHPT 1OCOC 3KV6A 1WR6A 4WGYA 1EQ1A 2NW8A 4H63H 2K5BB 4U5HA 2HJ3A 4ZXLA 4ZS3A 1XWMA 3HL6A 1WLXA 3Q5DA 3S27A 5AQLB 5HEOA 3AA0B 3QB5K 4QHOA 2H7VC 3RIUC 4BJNA 1QPUA 3CX6B 2LSYA 2EILC 2JJ9A 3M65A 2CNWA 4I4TE 1GM5A 3UU8A 3CPZA 3RQEA 3QW0A 1MMNA 2DCFA 1D0YA 4OFZA 1OW7A 4IGUA 3SXMA 3H2UA 3H65A 2P0NA 4YL0A 5TAOA 1ORJA 3FOOA 4YJ2E 3F57A 4HFBA 2QVAA 3PUAA 2P61A 3JC6C 3KBUA 5E2QA 4YSZA 4OX9T 1YYJA 2YEVC 4ULVA 3MZKB 3J06A 4DRHB 2IBFA 4UELA 2L3LA 5KMGP 2NG1A 256BA 2R7OA 4AQFA 2CHNA 5JDNA 4Z90A 1O3UA 4O4HE 1IBLT 2FBWA 4HFCA 5LHHB 2JQ9A 4LF6T 3MLGA 3BK9A 2KYHA 4GQHA 3M1CB 2LFFA 5HYAA 3TLWA 5LBQB 1UG7A 1RCPA 3PUXF 4DR7T 3A8YC 5B1BC 3WODF 2C03A 5AQTB 4JI0T 4DVYP 3ZN1B 4ZI3D 4CJOA 4AE4A 4UDVA 4JW1A 2BC5A 2WVNA 3HKCE 1YLMA 1OKKD 3KMIA 1W0BA 5FVKA 1NWMX 3RKGA 2WVQA 4DMWA 3NG1A 1MIYA 1DOVA 3W8HA 4CS9C 3P4QA 4CBEA 3FZFB 2A3DA 4CS8A 3GN5A 3AG3C 2YRFA 3T1YT 3ZCIA 3VAYA 3AA7B 4EEBA 4PK6A 1ZVZA 2CLYB 4H9PC 3GWNA 1M6TA 1AEPA 1ZHYA 4U9EA 3FHDA 2XM2A 2OA5A 3K7DA 3G50A 4HEAA 3L8IA 2RA1A 3ZMTB 1HE9A 1VCSA 2WZFA 4JC7A 4IE6A 1TQGA 4P9TA 4N6HA 5KYWA 4Q4ZF 4QI2A 3ZSUA 1LI5A 2E9XC 4PNIA 3RGLA 2IYLD 3K1IA 1IJ6A 3N9OA 1LIHA 3O6XA 3C8ZA 2OCCC 1LRZA 2Y6XA 2H7BA 1M7KA 1K40A 4CZZB 4LLCA 3UNGC 3M3ZB 4PFOA 5E3CA 5H6RB 5LHGB 3F2EA 4AKGA 1OW8A 2XL6A 3QW1A 3A7MA 2YINA 2IC6A 3UQ7A 2FJAA 4NQFA 2X0CA 4G7HF 3FMSA 2EHOD 2LEHA 1WYCA 2Y69C 3ZC4A 1MNEA 4U9DA 3W2WA 2X9WA 3VRCA 4MVUA 2CMRA 1T6QA 2XAHB 2R05A 5A6JA 3UMKA 3DM5A 1PD1A 3IHRA 2CBJA 2AVKA 2XASB 3BQKA 4KMCA 1G8XA 2XAJB 5ETWA 4UXNB 2IIUA 4ILUA 1BZ4A 1OR3A 1SF8A 2V7LA 1NEKA 2WAUA 4Q25A 2QE9A 1QSPA 1OXBA 4J32B 2JX0A 3NRHA 5L2LA 2NWBA 2V7MA 4PW8A 3W8IA 4A56A 3ZMUB 4YK5A 4NXNT 2X9XA 3GM3A 4K0UA 2CWYA 3MKDA 5JDGA 4EYUA 4BJ6A 2MBGA 3DXJF 3AA6B 4ADZA 4CI3B 3NBXX 3CWZB 4IARA 2IXOA 2X51A 3EAMA 4L0RA 3PUSA 2EPLX 4WW0A 5L4EA 1FR0A 2XLMA 3GN5B 4X0RA 3SXKA 4ZHQE 2AU5A 4TWFA 2D4UA 1Z0PA 5EGYA 2KWIB 1VTMP 1KK7A 1YW0A 3HKKA 1WGWA 1VK5A 1T72A 2V1DB 2FJEA 2BDEA 3BEHA 4U5GA 2PG8A 2N9DA 2K3WA 4CIPA 1OEDC 3AEBA 2V5DA 2XQ9A 1RKCA 2AWCA 3UUBA 3UUXB 1VB5A 1FFHA 3ZT5A 3BRJA 4DV4T 5KXJA 2HH7A 2XQ6A 3AE1A 3N9QA 5L0DA 2JIWA 4KHZF 2A68F 5L0FA 3N24A 3EZHA 4CQIA 3KYIA 3EPVA 5HEUA 5DQWA 1ZHTA 1LE2A 1J5ET 2YL7A 4IAQA 4ONSA 2WDQA 1GGQA 1O87A 3IQ5A 2R7SA 1WTYA 3AGUA 5KDMC 3AXJB 4TUYE 1HW1A 4LF8T 3GM1A 5JRCB 2J9BA 2WBLA 2DI3A 1LKXA 3ZQYA 1CPQA 5HEHA 4H54A 5BQGA 3NVOA 2GA0A 3A5XA 5DQVA 2IXNA 2WZHA 4AE4B 3P4RA 4TV8E 3RFYA 1D0ZA 3VKHA 4P0AA 4H4KC 2XSBA 5C2TA 1SR2A 2ODUA 5F3JA 3S90A 1LS4A 5IHYA 4O6NA 4B3RT 2BBHA 2KWHA 3FBZA 4EIWA 3ZC0A 1YAUO 3DJBA 3C4ZA 1FTSA 2W45A 3N9LA 5AQVB 5AQQB 3DTOA 2IUBA 4MNDA 3NMIA 2AP3A 3T1HT 5HWYA 4DVDA 1H9GA 3H3MA 3QUJA 2NUTA 4QXHB 4XEFA 3NKZA 2J0XA 3AG4C 3TJ5A 4PACA 3GMIA 5AQMB 5JH7E 3OWTA 4DJ9A 2XAGB 2J8WA 2VKJA 3GEEA 4OIRF 1HE1A 2UXBT 2LLYA 5AFUL 2PP4A 5AQJB 3FHNA 3CVRA 2Q4FA 5HV9A 5HCMA 4DV2T 3AEAA 1E2XA 2A1DD 3O39A 4JTCB 2WMOA 2VB6A 3X1DA 1US7B 3AAEB 4FJOA 1TWGA 5LB7B 1QSDA 4HTEA 3AXJA 1I6ZA 3ETUA 2XXAB 2X67A 3AAIA 3U78A 3ZPOA 4UVCB 2OG2A 1UUSA 3UU5A 5LP6E 2LRKA 3O9XA 1YVIA 3B0PA 2R03A 2IOQA 3OKQA 2WZIA 1ZHWA 2D0TA 2YL1A 4HFFB 4C3EA 3A11A 3L3PA 3US6A 2FGYA 4OYJA 1NZEA 4ZI3C 2V7JA 5JDQA 2EIMC 1YJGA 3K1HA 2XQ7A 5KYUA 1RKEB 2VKDA 3V5XA 2ETSA 2HKVA 5F28E 3ZMZB 3AE4A 3L09A 3U9JA 3RLFF 1ZHXA 2XQ3A 1T8BA 1J8MF 2XAQB 2OEXA 3KDSE 3QZCA 2HFIA 1SHZC 5T3TA 3RH3A 3U8VA 2AWYA 4HWIB 5KYXA 1ST6A 1R8IA 3EDUA 4LDRA 2XQYA 2BKNA 4U33A 5JS5A 3LS1A 2LE8A 4GK5E 3UUMA 2JQKA 3ETVA 1AUEA 3L34A 2WQYA 2JMHA 3M4CA 5ABGA 3RX6A 2XS1A 4LDQA 2D2SA 5DQTA 2J7PA 3NMKA 4J30B 4PJLA 5FXWA 1HNWT 3HI2A 4N6CA 2L6FA 3ANWB 4MTOA 3UFGA 5L3FB 4B3ST 4JI4T 5LBMA 4TWHA 1N36T 3LS0A 1E84A 2X9YA 5AQNB 2XM0A 5KYUB 2KLQA 2KINB 1M62A 2V5CA 3VKGA 3QK6A 2Q00A 2XM4A 5DABA 1OCRC 4JI3T 4GYRA 4DV7T 3SFEA 5LHIB 3U3BA 4IWBA 4GOUA 3JYHA 3TK0A 2IDOB 4EAHA 3JADA 5FXVA 1HG5A 2GAQA 2HV7A 4WZXA 1VLTA 2YL3A 2Q3TA 2W4MA 2A2FX 2A0UA 4MFRA 1SMYF 2UXCT 2Y8DA 2MOZA 1JPJA 2R7XA 3DM9B 5JVEA 4XPXA 1E85A 3JSEO 3GWHA 3RVZA 2W00A 5JSLA 2W4BA 4HE8D 3LK2B 4JJFA 3ECSA 5A6KA 2BVMA 4LERA 2OLTA 4DV3T 3AQCA 3KL4A 3LEOA 3UTKA 2BKPA 2Q9QD 2UUCT 2ZXWC 2DWGA 2B0JA 4LFAT 3RVYA 2QA7A 4L5GA 1HF8A 4HFVA 2V6YB 2FAPB 4UF0A 2P1AA 1V4AA 1ZU4A 2EIJC 4PAGA 2WVOA 5L3GB 4XLNF 3NZPA 4JUYA 1WCRA 2K24A 2CXDA 2CNWD 4XEKA 4XPYA 2R7UA 2Z15A 2NSGA 2LM2A 3M4BA 5LJMA 3H2VA 3UMIA 1X9BA 5AQRB 2EHOA 4ISSA 4IDZA 2H3RA 3EHZA 4DRJB 2R6GF 3N5LA 1WOLA 3FAJA 4IE0A 4PFPA 1RJ9A 2PJQA 4JTDB 2H7OA 2FUPA 5AQIB 3JCUQ 4KBLA 3N9NA 3K33A 2EPOA 2YLIA 3LBXB 4YSYA 2XPKA 2YDQA 4BEMJ 3PDMP 4I43B 3SNHA 2WU5A 4O6MA 1QLEC 1GQEA 3HNLA 5EK4A 4ZI2C 4BPMA 3V5UA 2KC3A 1S05A 5T1DB 1ZEEA 1XMQT 5L0GA 2EPMX 2P9BA 5IWAT 4JTAB 2HZ8A 4HEAJ 5L0JA 2LSKA 4OIQF 5CA0E 3KV5A 5JTGA 4YT5A 4D4NA 2E9XD 3RC8A 3KBTA 3FXEB 3K66A 3T6JA 3PJAJ 4ZZBA 1H7IA 4LF7T 2LKHA 5JT4A 4JE9A 2UUIA 3QTHA 1SA0E 1SZIA 3ZTMA 4ZLDA 4DUZT 2VCBA 2JD3A 4IRUA 2L9QA 3C63A 4FAPB 4AQGA 4BG0A 3R6NA 4A2NB 1ZP0A 1WRDA 3MJXA 4W8PA 4FWVA 3RQUA 4ULWA 1TWAA 2G3VA 4YSXA 3C50A 3WI3A 4P6IC 3GM2A 3RC3A 3LNRA 1FNTc 3U3IA 4YHHT 1L3PA 5A6BD 4DR5T 2M4EA 4DO0A 1CGME 5FL1A 3E08A 2VVNA 3VU7H 3SRZA 4ILBA 2DNXA 4C3BA 4G63A 2D5RB 3DKAA 4AISA 2XUEA 4G7OF 3UGOA 3ATPA 3LEVA 4V1Av 2XLWA 3RYLA 4NCQA 5B1AC 4QXBB 5JUAA 3ONJA 1T01A 2XQAA 2XJ7A 1NENA 2C5KT 1LS1A 2BE5F 2R7QA 4F8HA 4J7YA 3E0ZA 4O7GA 1T7SA 4A97A 4YT2A 5JDMA 2LT3A 5L3BB 4U31A 3U9MA 2VVSA 2BKOA 3QVYA 3ITFA 4FI5A 3HLZA 5ABFA 4DV0T 4KX6A 3L8RA 5L3DB 3SFDA 3X1OA 2Q9AA 3HNKA 3L1MA 3LBXA 4EUKB 3U8PA 2K48A 3IHUA 1TKNA 3RYCE 1B7TA 1GS9A 4U5BE 3RKOF 5DS5A 4ZEYA 4KNWA 1S7ZA 3DI5A 5HEGA 2UUHA 5FXXA 3AVRA 4EZHA 4DR2T 4AL0A 1LI7A 5A6AA 1FEWA 3FXHA 3JCFA 1A7VA 1VYKA 5JRAA 3JRMO 4MBQA 2LHNA 1Q0DA 2AXDS 3RIFA 2WSSV 5CFBA 3ZIBA 2XS8A 2I15A 3N0TA 5FY7A 5HEJA 2BBJA 4JYAT 5F8PA 2VASA 3EGDA 4EXTA 2VL0A 4YJ3E 3EHNA 4U2YA 1CGNA 2J0WA 1BR4A 2V26A 4E0HA 3OA1A 4JI6T 4E0IA 5LOVE 3C8GD 4ZOLE 1MIVA 4QXCB 3B0UX 1N32T 5JDLA 2LP4A 1MQVA 1VLSA 1OXKA 5AQFB 3B13A 2TMVP 1DOWA 3JSZA 3KPHA 3FZMB 3IA3A 3LG7A 4DR3T 3ZYKA 3V5SA 5FVLA 2EPKX 4J2CA 4JRZA 3SS1A 2NSFA 4BJMA 2J9VA 1D1BA 4C7OB 4OIOF 3ZN0B 2P7VA 4I55E 5AQPB 3R2PA 1H9TA 3C98B 5KYNA 1JOGA 3CEXA 4DV5T 5IUXA 2EPNA 2LK4A 3F31A 2YHSA 3H3AA 3UUNA 5TJ5E 4IGGA 2WMNA 3AE7A 4TN7B 3CX8B 3PUYF 2NUPA 3AG2C 2W67A 5LGNB 3QC9A 1U6HA 2JQQA 2EINC 5DLJA 5L0IA 2RSEB 4CIHA 4MVQA 2VCCA 3S28A 1QZXA 3TULA 4YT0A 3VR8A 1Y6DA 4FX5A 3W15B 1SE7A 4YJWA 2J7PD 4O4IE 3OVUA 1YZAA 4CXXA 4JJGA 3PU8A 1HCIA 4OINF 3MYFA 3N2OA 5JREA 4HFIA 3K1SA 2NW7A 3LK3B 3G06A 4CN4A 2LFDA 3HNJA 3T6GB 4JCZA 2CXFA 4JI2T 2XLEA 2OKUA 1YQ3A 2X0HA 3JT1A 5JLIA 1I94T 1V54C 3AE6A 2CGEA 3Q2MA 1W0AA 2ACZA 2L7AA 4IE5A 2FFHA 1KTMA 2X0YA 4Z8XA 1HMDA 2ZMAA 4YLHA 2EHOB 4X1IE 3VR9A 1HW2A 2YLGA 2LSEA 3EFOA 3HKDE 5L3QA 4X1YE 1AJ3A 3DAFA 1N33T 4DRIB 2XAFB 3C4XA 2NTXA 5ABFB 3B9QA 4CDYA 2BS4A 3OTOT 1XDPA 3Q5XA 3RHWA 2QNLA 3T9OA 5AQOB 3GANA 4CXYA 4U7IA 3F47A 2XQ8A 4KUMB 1VYIA 2CA5A 3I9YA 5LXTE 2VL8A 2WWUA 2V7IA 3NRXA 4YTPA 3JZ0A 2I8BA 2CRBA 4I3MA 3C4WA 2J9WA 3O4XE 3U2MA 1Q0MA 2HPLA 2L9JA 2LD6A 4N06A 4JEHB 2ACXA 3E9VA 5AGFA 2R02A 5EK0A 1YKEB 4U5EE 3ZT6A 1I4ZA 3PHF2 2G62A 2YQYA 5K0IA 5L4HA 5CA1E 2XXAA 1JMWA 4KI0F 2UUBT 2F4VT 2B1EA 2KGOA 2YN6A 4EHPA 4ILAA 3EGXA 1UX4A 1LVKA 4X20E 3MFNA 3U2LA 4UR9A 4CDAA 5LG4A 4GIWA 3EGXB 2XLDA 4ERRA 3PURA 4ZI2D 2PNOA 4NTAA 3TQOA 2OU6A 1E1HB 1IJ5A 2GFHA 4YWQA 2R7WA 1WN0A 1YDIA 3DMDA 3ZMSB 4I44A 4WGZA 1HNXT 4DOZA 4H9SE 1T5OA 2SPCA 4RD9A 1KF6A 2XZEA 5FMNA 5JR9C 4OHFA 3LFMA 2CDQA 1HFAA 4CS7A 1NFNA 3C18A 3C8GA 5DS6A 2ICWG 4YT8A 4EB6E 3DJNB 3AB3B 3T4RA 1UFBA 5FZTA 2PX0A 1A7EA 3HA4A 5BMVE 3AEFA 4MVZA 4AXPA 1VCTA 3X2QC 3LNMB 5L3VA 2UXNB 2IM8A 3B71A 5FCLA 1JRAA 2LKGA 5COFA 3OYXA 1MMDA 5HCJA 3UU3A 5AQHB 2MAWA 4U5FE 2YDSA 2E9XA 2YKZA 1UCUA 2CWOA 4Z91A 2VKOA 5HXHA 3HNIA 2MPKA 5KYYA 5LG3A 4WYVA 2OJED 2XSEA 2IHR1 3PJAA 4O4LE 2NW9A 2UU9T 3NKDA 5AC5A 5KYYB 2HPJA 4GYSA 2I6HA 2OQMA 2WWVA 3P4WA 1K04A 4KBMB 2LQGA 4BJ5C 2LM9A 3Q6MA 1G73A 5D91A 1C17M 3MYIA 5T3WA 4XAXB 2EIKC 3SYNA 2KXPB 2J4GA 3SOLA 3C7JA 4JBWF 2Q9QC 1RKEA 2YU1A 2BG9B 4AL1A 2V7KA 4YFSA 3EH2A 3Q6NA 3TLSA 3I4UA 3EVYA 3CSKA 4G2AA 5GONE 1M2VB 2OJQA 1J1JA 4DBRA 2WL8A 5HXRA 2A6HF 3DP7A 5COGA 1HY5A 2XY8B 3V5YA 2A0BA 2JRKA 3TLVA 1KNYA 3WHNA 5JDHA 5B3SC 1R4TA 1FFTC 2HV6A 4E17A 5JDFA 3K3OA 2QLAA 2GDCA 2PTFA 1TWHA 1I4YA 4QX7B 4U3CA 1WFDA 2M6IA 3P8CD 3T8OA 1YYXA 1U0BB 3KYJA 4TV9E 2M64A 1G4WR 2V8SV 3V7OA 1XZPA 3RYIE 4G78A 1V55C 4K0DA 4NIQA 3R84B 3PTRB 4F6RC 2LRLA 4EBJA 5AQUB 4O2BE 4LFCT 2CCYA 4XPWA 1MIWA 3LDQB 1OW6A 3MK7C 2QUPA 3HKBE 2YLDA 2N2NA 1BR2A 4IJJA 2A72A 3PUVF 2MTQA 4A98A 4JZAA 1VMAA 3AE2A 1WATA 3P50A 1UURA 2E5LT 3KINB 3LSVA 3EQLF 4RDAA 1XZQA 2B76A 1G5ZA 1M2VA 5A69A 3KKBA 1WR0A 2ZXPA 2XLOA 3HR0A 3QVZA 4XLPF 1M2OA 3QMKA 3S29A 3NYLA 1WASA 1JPNA 3LJCA 3N2GE 4YXDA 2BL2A 4QI0A 1TWCA 3MBGA 3HKEE 3ANWA 3N2ZB 3PMRA 2W0GA 2HMQA 3C62A 3PU3A 2VCAA 4I1MA 1EZ3A 3UU4A 2W66A 4O79A 1G4US 1UGOA 3LLIA 4HFKB 4EEDA 1ZW2A 4Z9HA 1FAPB 1UK5A 1HNZT 3AAAB 2XLHA 3ZKRA 4COFA 1M56C 4ZZCA 3Q7LA 2QY9A 4YT4A 3IBPA 2Q9QB 3AQBA 3ZWIA 1XWJA 2PFDA 1BR1A 3QB5A 3EH1A 4JI5T 3JAEA 2KZ7B 2DL1A 1SYQA 1EI7A 1L7CA 1U89A 4ILCA 1T98A 1QUUA 4IHJE 4A5XA 5EZYE 1QVXA 4NXMT 4CDVA 1OKKA 1BR0A 4UEMA 4X66T 3EG9B 4JEAA 4LF5T 4DV1T 1ZOYA 3K8PC 2GK9A 4IB4A 4I50E 1TFKB 3ZVRA 3S4UA 3CAXA 2ZPAA 2IAKA 5BQHA 2KT9A 5F5HA 3ASOC 4HWFA 2BVLA 2DB4A 1ZHCA 2KSRA 4B3TT 2W9YA 1YD8G 3TKLB 2NUTB 4EYYR 1MNDA 4HE8A 4H9RC 4I0UA 2CLYC 3ZYMA 2J46A 5FP3A 1CGOA 3TJ6A 4GEHA 1E86A 3RPUA 2ZXRA 4NY3A 4QH4A 3M79A 3PCVA 3B57A 2NUPB 3KFWX 4MW8A 3MACA 3GODA 4BEJA 4U7YA 4JI1T 5C8YE 2C5JA 3DD7A 2E87A 2M67A 1WWPA 5CIVA 2QGSA 1YARO 1Z63A 2LSGA 4DR1T 1KNZA 4N78D 2H88A 2ES0A 3KVAA 3VYWA 1HTJF 5E0OA 2B0HA 2F22A 2NOXA 3G4XA 3EABA 2CCQA 2I59A 1R5ID 3A9CA 2IXPA 5LMUT 4X62T 4GK0E 4EGWA 4WNKA 4M1PA 1NU7D 4UV8B 4B6IA 1IZNB 5E33A 5IYZE 2YK0A 2DHRA 4G7ZF 2WM9A 4PJMA 3CQCB 4PK5A 3JRTA 4I1OB 3CIRA 4PK4A 4IREA 2DYSC 2WB5A 4JCHA 4QX8B 2PBEA 2DWKA 2HHHT 1OEDE 3IEEA 4QH5A 2Y39A 2AE9A 2XL8A 2W4XA 4H63V 4IDNA 4AQYT 2C04A 2YWAA 4XTKA 4UV9B 4LACB 4KP3C 1F1MA 2Y3HA 5BR8T 1OQCA 3GORA 4HGAA 3K6BA 4TZ4C 1OR2A 4HN9A 1D1AA 4EZ4A 3GEHA 5GPGB 4YL3A 4JIOA 4LF9T 3JYYA 2YEVA 3H37A 1ZU5A 3DJUB 2DI4A 4EV6A 2JPUA 3FVYA 4MVOA 1KU2A 4D4XA 1VOMA 4GYTA 1J8YF 3O10A 3I0OA 2O9XA 4NPPA 3EJNA 3JTLO 3E70C 1NU9C 1L0VA 3ZJ2A 2VH3A 3VM6A 1CPRA 3I5PA 2WU2A 4Q5SF 5ABHA 2CPTA 4UIGA 4IDQA 1RMVA 3FOPA 4HKAA 1HMOA 2V6XA 4AK9A 4CX9A 5DJQC 2J1DG 4JEBA 3K3QC 1D1CA 3NWIA 4DV6T 1XNQT 1BBHA 5A1LA 4AKLA 4C91A 2WDVA 1ZZPA 5B3IA 2GWWA 3CQGB 2LOSA 3SEOA 2MHRA 2R7RA 3ZSSA 2UXDT 5LYJE 2LIGA 1C03A 1H7CA 1YQ4A 2ZM0A 4BJ5A 2XQ5A 3QOFA 3U5SA 4ZI7E 5LCYA 1HS7A 4EIYA 2NP9A 4ZS2A 5AC4A 3WAKA 4LMKA 5CJ5A 1OEDA 5L3CB 3ZTZA 3N2KE 4HWHA 2A9UA 1X79A 2R7VA 2YKSA 2XTLA 3OEOA 1YXRA 2VWAA 3Q5WA 3B0VC 4IAOA 4DR6T 4AQFC 3UMHA 2WZGA 4NTBA 1W09A 3PUWF 3GEIA 3RKOA 3LLKA 4U5DE 2CW0F 1VRBA 1K05A 2HSBA 5KYWB 3P4SA 1XDOA 4CXWA 3AG1C 3B5MA 4EWCA 3O55A 4XQ1A 2WP9A 4PJNA 4IDPA 2LSIA 3CK6A 1RXQA 2CE7A 2C5IT 2UXXB 4DVZA 3RIAA 4MVRA 3DZAA 2RD9A 2OV9A 2ZXOA 4TX5A 4OD4A 3FAPB 2VK9A 3KV9A 5J0ZA 2DGJA 4E18A 5FY0A 5CGMA 4U2ZA 3T6BA 5KX5E 3RIUA 2IMLA 5CI9A 2XLVA 4JI7T 3GWLA 4UVAB 1FJGT 3ZQVA 4ZLCA 4HFDA 3L0IA 2RP4A 1LVFA 2RPAA 1QKRA 3O1IA 4P0BA 2Y3BA 2ZD9A 1DU2A 3FDQA 4EBBA 4TWDA 1IBMT 4FESA 4QDLA 3EFOB 3RIPA 4AKHA 2R25A 3ZLIA 2WDRA 2DLRA 3Q5EA 4K1OA 1EA8A 2HMZA 3UR3C 5FYMA 1E2AA 5EK3A 4LFBT 3IF8B 4IDOA 3UT5E 3I5QA 1A7DA 2Y3DA 4MS2A 3ABVA 1JR8A 3AE8A 3NRYA 2VQFT 1E83A 3CQZA 4AI6A 1BDJB 1XZYA 4EOZB 2LJLA 5AQGB 4C3DA 1A0BA 5CI8A 4ER9A 2HS5A 1ORSC 3LUTB 3FB2A 2C0SA 2UUAT 2CXLA 2CM0A 1PCXA 3KH2A 5LNKA 1ZW3A 4DNDA 3VRAA 1HX1B 4CN1A 4M63A 3LESA 2YU2A 3BQLA 3TOLA 3ZJ1A 3NYMA 2D9DA 5AQSB 1PV3A 3PUGA 3NKEA 2LHRA 3C64A 4AKRB 2IC9A 3DAGA 4WBNE 1OXZA 1XNRT 1W9RA 4H9QC 1APCA 2X0LB 2X9HA 4YTMA 3TLUA 4DXWA 2KQ9A 1E7PA 3PV0F 4CI1B 1JNRA 2DYRC 3CX7B 2IXMA 3ZCJA 2YOEA 3POVA 4IE7A 3VHLA 3QNUA 1I5NA 3ABMC 4CJGA 2JQHA 1Y01A 4P9FA 2NTYA 2CHOA 1ZKEA 3AEGA 4LMLA 2R7TA 4IE4A 4U74A 3OYZA 4AIUA 1Z5ZA 2J9UA 3AGTA 2M6BA 3OBVE 4XBFB 4H9NC 5HXEA 2N1GA 4Q7CA 1YZCA 3KVBA 1Z3IX 4OD5A 3KV4A 2L81A 4BA9A 2YZSA 2Z6EA 3CZ6A 4X5TA 1YA7O 3SXZA 4NC3A 4Z9IA 2XSAA 4O2AE 1A41A 2P6VA 4NUVA 4AKIA 4JKVA 2HJMA 2LSJA 4EKWA 2A6EF 1KEYA 2CEAA 2QRXA 1LE4A 3UU6A 2Q9CA 5JQGE 3EG9A 1S35A 1RJ9B 2XQ4A 3SXYA 3RI5A 2W62A 1OWAA 4CSAC 1IZMA 3UFEA 5HXCA 4KNVA 4ASKA 2X68A 2BG9E 4MTFA 4LLEA 3CMLA 3L8JA 4JLEA 3N9MA 5L3EB 1SUMB 2Q7RA 4QH1A 4F4BA 3L39A 2VKHA 1Z7Qc 5CB4E 3LAYA 4YTNA 2KNDA 2E9XB 2LOPA 2Q9QA 2WS3A 1O3XA 1NG1A 1Q0FA 4MVSA 1Z6AA 3EGDB 1NFOA 4JVSA 2L8KA 2Y3GA 2L6HA 1KNRA 2JMKA 4DMVA 4IIJE 4MHCA 2JPFA 1Q0KA 4QWNB 3TLTA 2VURA 1OCCC 1HX8A 1Y64B 3MXZA 3JC6D 3RQGA 3RF3A 5LGTB 5EHHA 5J2UE 4CI2B 2QYWA 3AE3A 4GKJT 4XZCA 3RW0A 2R9RB 4P09A 3AE5A 1J5WA 2VQET 3C8GB 4NUUA 2G3KA 4DR4T 2IW5B 2OEVA 4JEUB 2A69F 1IAPA 4HWCA 3ZC1A 4U5CE 4RBNA 2XM1A 1D0XA 5DQZA 1M57C 2HN1A 4WJ0A 2W61A 3UULA 3U0CA 3TOMA 4E7SA 1ZYRF 3ONXA 2MWQA 2QTVA 4E7ZA 3OJAA 5HWXA 5JP7A 4MVMA 1MMGA 2BS2A 4GKKT 2WZLA 3I9WA 5LA6E 3PDYA 4DIDB 3ZEFB
chains in the Genus database with same CATH topology
4J32B 3NRHA 3X1OA 1U5PA 5L2LA 2Q9AA 2BVLA 5D92A 3SP1A 2NWBA 2V7MA 3GA8A 1ZHCA 4PW8A 4A56A 3LBXA 3ZMUB 3W8IA 2X9XA 2K48A 2W9YA 1YD8G 4K0UA 3RYCE 5HXSA 2CWYA 3TKLB 1B7TA 1TKNA 3MKDA 5JDGA 2NUTB 4PJJA 5JR9A 4EYYR 4EYUA 4U5BE 4XWJA 3RKOF 5LGUB 4BJ6A 4O8SA 1MNDA 4HE8A 5DS5A 3ZMVB 2MBGA 1IW7F 3DXJF 3AA6B 2PBIA 4ADZA 4CI3B 4H9RC 3NBXX 3CWZB 1S7ZA 4KNWA 2IXOA 2CLYC 2X51A 3ZYMA 4L0RA 5FP3A 3AVRA 3PUSA 5FXXA 4EZHA 2J46A 4WW0A 1Z23A 4GEHA 3NDBB 4OK0A 4X1KE 3RPUA 3GN5B 4X0RA 1FEWA 5J1GA 3O1JA 2ZXRA 4NY3A 4ZHQE 3B57A 1Z0PA 3KFWX 2KWIB 2NUPB 1VYKA 5EGYA 1KK7A 3MACA 3GODA 4BEJA 1YW0A 4MBQA 1WGWA 1VK5A 3MX3A 5C8YE 3LK42 2V1DB 5IY5C 2LHNA 2C5JA 2BDEA 2E87A 3DD7A 4U5GA 2M67A 2PG8A 2N9DA 2WSSV 3ZIBA 3CKDA 5JVDE 2QGSA 3W2VA 3N0TA 1Z63A 2LSGA 5FY7A 3RRCA 1KNZA 4N78D 5FXZA 3P7IA 2ES0A 3UUXB 3KVAA 1FFHA 3VYWA 3EDVA 3K3NA 2VASA 1HTJF 5E0OA 5F8PA 4EXTA 2NOXA 3EHMA 3EGDA 3S0XA 2HH7A 3I1AA 3N9QA 4YJ3E 3EHNA 4K7BA 2J0WA 2CCQA 1BR4A 2A68F 3N24A 2I59A 2EHOC 2V26A 3OA1A 3EZHA 2IXPA 4KC9A 4CQIA 3RYHE 4GK0E 5LOVE 4WNKA 3EPVA 5BUOA 4M1PA 3N9PA 1NU7D 5DQWA 1ZHTA 4UV8B 4B6IA 1IZNB 5E33A 5IYZE 3ZC4A 2YK0A 2W63A 4ZOLE 1MIVA 2DHRA 4QXCB 3ASNC 4XLPF 4G7ZF 2WM9A 4PJMA 3CQCB 3AVSA 4PK5A 5JDLA 2PFVA 1O87A 3JRTA 3B0UX 2R7SA 4OYKA 4I1OB 5KDMC 4PK4A 4TUYE 4KI2A 2DYSC 3B13A 4JCHA 4QX8B 4AX2A 2DWKA 3I0QA 5JRCB 2WBLA 3WG7C 3JSZA 2MYSA 3IEEA 1LKXA 4BJTA 5DS4A 2Y39A 1U4QA 3LG7A 4H63V 3ZYKA 3A5XA 3SWHA 2C04A 3V5SA 2KNHA 5DQVA 4XTKA 3PUQA 3FXDB 4UV9B 4J2CA 3E22E 4UVBB 3SS1A 2IXNA 4BJMA 3HJCA 4KP3C 3RYLA 4AE4B 2J9VA 1D1BA 4TV8E 3EZIA 1ZV4X 4OIOF 4C7OB 2Y3HA 5J2TE 3RFYA 3ZN0B 1D0ZA 2P7VA 4I55E 4HGAA 3VKHA 4P0AA 3K6BA 1FMVA 3C98B 4TZ4C 4BAYB 4H4KC 5D91A 1S94A 5KYNA 3Q9DA 4OIPF 3C51A 4HN9A 1D1AA 4QKNA 4EZ4A 2YHSA 3F31A 2ODUA 5F3JA 3H3AA 3UUNA 5H6QB 2YEVA 5IHYA 4O6NA 3H37A 2WMNA 4TN7B 2DI4A 1ZU5A 3CX8B 2NUPA 2PX3A 3DJUB 3FVYA 1FMWA 1KU2A 3AG2C 2KWHA 3FBZA 4EIWA 3ZC0A 1VOMA 3ESLA 5LGNB 3QC9A 2EINC 1V9DA 2JQQA 1J8YF 4GYTA 5DLJA 3DJBA 3I0OA 3CQXC 3C4ZA 2O9XA 1FTSA 2W45A 2ZM2A 3N9LA 3EJNA 3DTOA 4CIHA 4ISTA 3E70C 4MNDA 3S28A 1NU9C 1QZXA 4H9OC 3ZJ2A 2VH3A 3Q7GA 3I5PA 4FX5A 4Q5SF 3ZG1A 3W15B 2Q9BA 5HWYA 4DVDA 4UIGA 4O4IE 2J7PD 3QUJA 4YJWA 2NUTA 4BJ1A 4QXHB 4HKAA 4CXXA 2J0XA 3AG4C 1YKHB 4JJGA 3PU8A 3GMIA 3OWTA 1HCIA 5JH7E 4OINF 4AK9A 2XAGB 5DJQC 2J1DG 2VKJA 3N2OA 3K3QC 5JREA 4C7OA 3LK3B 2NW7A 4OIRF 1D1CA 4B6XA 5AFUL 2PP4A 4YHJA 3FHNA 3CVRA 2CXFA 5HAXA 5ADXL 3ABLC 5A1LA 3ABKC 4AKLA 4C91A 1TR2A 3K1IC 2A1DD 3O39A 3JT1A 2WMOA 4UF0B 3UGPA 2VB6A 3CQGB 2LOSA 1OCZC 1US7B 1V54C 3SEOA 3AAEB 2R7RA 4FJOA 1TWGA 5LYJE 3LJBA 1H7CA 2ZM0A 4WBOA 2CGEA 1QSDA 4HTEA 3Q2MA 4YN0B 3ETUA 4BJ5A 4CS9A 2X67A 2XXAB 3AAIA 3J9X1 3U78A 3ZPOA 4UVCB 2OG2A 4ANJA 4O4JE 4IE5A 2G0UA 4ZI7E 2FFHA 3HTKC 5LCYA 3ZYLA 4Z8XA 5LP6E 1HS7A 2XL4A 2ZMAA 4CSAA 4YLHA 2EHOB 3O9XA 4G0HA 2NP9A 4ZS2A 2XHEB 3WAKA 4DBQA 3B0PA 2KJGA 4X1IE 5LJNA 2IOQA 5L3CB 3N2KE 3OKQA 5JR9B 1ZHWA 2D0TA 4HFFB 4C3EA 1X79A 3L3PA 2ZM8A 2R7VA 2FGYA 4OYJA 1NZEA 4ZI3C 2V7JA 2XTLA 3HKDE 5JDQA 2LSEA 3EFOA 3OEOA 2EIMC 5L3QA 4CS8C 3K1HA 2VWAA 4X1YE 3J7Yq 3Q5WA 1AJ3A 3DAFA 5KYUA 3SZRA 3B0VC 2XAFB 2VKDA 3C4XA 2NTXA 4IAOA 4O6YA 3B9QA 4AQFC 3UMHA 5DQZA 2WZGA 3ZMZB 1HG2A 3Q5XA 3RYFE 3L09A 5M4YA 1ZHXA 3GANA 3RKOA 1J8MF 5JRCA 2XAQB 4CXYA 5FNVE 3LLKA 4U5DE 3MA9A 3NZQA 3F47A 3KDSE 1VRBA 2CW0F 3QZCA 5KYWB 4KUMB 1VYIA 2CA5A 3I9YA 2ODVA 4CXWA 1SHZC 2XRHA 4U72A 3AG1C 5HSWA 4EWCA 5LXTE 2VL8A 5T3TA 3RH3A 2WWUA 4MLKA 2V7IA 3NRXA 5KYXA 2I8BA 1ST6A 3O1HA 3C4WA 4PJNA 1O5HA 2J9WA 4I3MA 3O4XE 2LSIA 3EDUA 2KW3C 2HPLA 2L9JA 2XQYA 2CE7A 2C5IT 2UXXB 2ACXA 4JEHB 3E9VA 4N06A 4BJ6C 3LS1A 3DZAA 4DVZA 2LE8A 1YKEB 4U5EE 5KYXB 4GK5E 3UUMA 2ZXOA 3PHF2 5DVWA 4TX5A 2G62A 4OD4A 2VK9A 3KV9A 3ETVA 3AA1B 3L34A 2ZLYA 2JMHA 3EUHA 2DGJA 3F46A 1WYBA 3RX6A 5CA1E 5FY0A 2D2SA 2XXAA 3T6BA 5KX5E 2K9AA 2KGOA 2B1EA 5CI9A 5DQTA 2J7PA 2BZBA 2V3CC 4J30B 3EGXA 4UVAB 1UX4A 1LVKA 4PJLA 4X20E 5FXWA 3HI2A 4ZLCA 5LG4A 3L0IA 1PD0A 4GIWA 2Y48B 3EGXB 4JURI 4P6IC 3ANWB 4ERRA 4W8KA 3PURA 2RP4A 1LVFA 4ZI2D 5L3FB 1N1CA 3O1IA 4P0BA 5LBMA 3LS0A 2Y3BA 2WB7A 2KMFA 1E1HB 1IJ5A 2GFHA 2X9YA 2PF4E 4YWQA 2R7WA 5KYUB 4EBBA 3FDQA 2KLQA 4FESA 3DMDA 3ZMSB 4QDLA 2KINB 4I44A 3EFOB 3RIPA 4DOZA 4AKHA 1ZHZA 2J45A 4H9SE 3D0TA 3ZLIA 3VKGA 3QK6A 3NYJA 1UX5A 4C90A 4MALA 4LACB 2SPCA 4RD9A 3RRWA 2DLRA 5DABA 4OD5A 5FMNA 5JR9C 4OHFA 3LFMA 3UR3C 2CDQA 1HFAA 4CS7A 1OCRC 1CUNA 5FYMA 5DS6A 3PE0A 4GYRA 3IF8B 5EK3A 4YT8A 4EB6E 3UT5E 2D0UA 5LHIB 3DJNB 5EK2A 2Y3DA 3I5QA 3AB3B 3T4RA 4IWBA 3WAJA 4GOUA 3TD7A 2PX0A 3JYHA 3BQIA 3HA4A 5BMVE 4AXPA 1FIOA 3NRYA 3X2QC 1MMAA 4EAHA 5E3AA 3CQZA 5L3VA 4AI6A 5FXVA 1HG5A 2UXNB 4EOZB 1W2WA 2HV7A 2E8IA 2LJLA 5FY1A 5FCLA 4C3DA 2D5UA 2Q3TA 2W4MA 4MQ9F 5CI8A 2A2FX 4L9IA 3OYXA 4MFRA 1SMYF 1MMDA 2Y8DA 2X66A 1NAFA 3FBLA 2MOZA 2C0SA 3FB2A 1JPJA 1OCOC 3KV6A 1WR6A 2R7XA 4U5FE 2CXLA 2NW8A 4H63H 2CM0A 2K5BB 1PCXA 3DM9B 5LNKA 2E9XA 3KH2A 4DNDA 4U5HA 4ZS3A 3GWHA 1UCUA 2W00A 2CWOA 2W4BA 3HL6A 3LK2B 2VKOA 5HXHA 3ECSA 4HE8D 4JJFA 4M63A 2BVMA 4LERA 3LESA 5KYYA 1WLXA 3S27A 2YU2A 3BQLA 3AQCA 3KL4A 2XSEA 3AA0B 3UTKA 2Q9QD 3ZJ1A 4QHOA 2H7VC 4BJNA 2ZXWC 3NYMA 4O4LE 3CX6B 2NW9A 3PUGA 3NKDA 3NKEA 2LHRA 3C64A 4AKRB 2DWGA 2B0JA 2LSYA 5KYYB 2EILC 2IC9A 2HPJA 2QA7A 2JJ9A 4GYSA 3M65A 4L5GA 4I4TE 1OXZA 4WBNE 2CNWA 3DAGA 3CPZA 1HF8A 4H9QC 1MMNA 4HFVA 2X0LB 2DCFA 1D0YA 4UF0A 2X9HA 4KBMB 1ZU4A 2EIJC 4BJ5C 2LM9A 3Q6MA 1G73A 4OFZA 4PAGA 2KQ9A 4IGUA 5L3GB 2WVOA 4CI1B 3H65A 4XLNF 3NZPA 4JUYA 4XAXB 5T3WA 5TAOA 2EIKC 2K24A 2DYRC 3SYNA 2KXPB 3SOLA 2CXDA 3CX7B 2CNWD 2Q9QC 2IXMA 3ZCJA 3F57A 4YJ2E 2YU1A 2V7KA 4YFSA 3POVA 3PUAA 3EH2A 3JC6C 3KBUA 3Q6NA 3I4UA 5E2QA 3EVYA 4IE7A 3CSKA 3VHLA 2Z15A 2R7UA 5F5FA 2YEVC 4G2AA 5GONE 3MZKB 1M2VB 5LJMA 4DBRA 3ABMC 2WL8A 3UMIA 4UELA 2EHOA 4ISSA 2L3LA 2NTYA 4IDZA 1ZKEA 5HXRA 5KMGP 2A6HF 2H3RA 2NG1A 3DP7A 2R7TA 2R7OA 4IE4A 4U74A 3OYZA 3N5LA 1Z5ZA 4AQFA 2J9UA 5JDNA 3FAJA 3OBVE 2JRKA 4IE0A 4PFPA 4XBFB 5JDHA 4H9NC 1RJ9A 5B3SC 2PJQA 5HXEA 2H7OA 2N1GA 4O4HE 1FFTC 2HV6A 4Q7CA 5JDFA 3K3OA 5LHHB 3KVBA 1Z3IX 3N9NA 3JCUQ 4KBLA 3MLGA 3KV4A 3BK9A 2L81A 3K33A 3M1CB 4BA9A 1TWHA 5HYAA 2YZSA 2Z6EA 5LBQB 4QX7B 3CZ6A 3LBXB 5B1BC 3WODF 4I43B 2C03A 3P8CD 3T8OA 3SNHA 4DVYP 4O2AE 4TV9E 3ZN1B 4ZI3D 4O6MA 2P6VA 3V7OA 4AE4A 3RYIE 1QLEC 1V55C 4K0DA 4NUVA 5EK4A 3R84B 4ZI2C 4AKIA 4JW1A 3V5UA 2LSJA 2WVNA 3PTRB 4F6RC 3HKCE 2A6EF 4O2BE 2CEAA 1OKKD 3KMIA 5T1DB 1ZEEA 2Q9CA 1MIWA 4OIQF 1NWMX 2P9BA 2WVQA 4DMWA 3NG1A 1MIYA 3W8HA 4CS9C 3MK7C 5JQGE 4HEAJ 3EG9A 4CBEA 1S35A 2A3DA 1RJ9B 2LSKA 3HKBE 4CS8A 2N2NA 1BR2A 3GN5A 4IJJA 2W62A 1OWAA 2A72A 2MTQA 3AG3C 5CA0E 3KV5A 1IZMA 3UFEA 4JZAA 1VMAA 4YT5A 4CSAC 5HXCA 4KNVA 4ASKA 2E9XD 2X68A 3KBTA 3FXEB 3RC8A 3K66A 3CMLA 4LLEA 3ZCIA 3T6JA 3VAYA 3KINB 4RDAA 4JLEA 3N9MA 3AA7B 5L3EB 3EQLF 4PK6A 4F4BA 2CLYB 4H9PC 2VKHA 5CB4E 1ZHYA 3FHDA 3K7DA 1SA0E 2OA5A 1M2VA 1SZIA 3LAYA 2KNDA 4HEAA 4ZLDA 2RA1A 2E9XB 3ZMTB 2JD3A 2ZXPA 3KKBA 2L9QA 2LOPA 2Q9QA 1O3XA 3HR0A 1NG1A 4IRUA 1Z6AA 2WZFA 4AQGA 1M2OA 3R6NA 3EGDB 3QMKA 3S29A 4IE6A 4A2NB 4JVSA 4BG0A 2L8KA 1WRDA 3MJXA 3NYLA 4FWVA 2Y3GA 5KYWA 1JPNA 4ULWA 4Q4ZF 4QI2A 3ZSUA 2JMKA 3LJCA 2E9XC 1TWAA 4PNIA 3N2GE 4IIJE 4MHCA 4DMVA 2JPFA 2G3VA 1TWCA 4QWNB 2IYLD 4QI0A 1IJ6A 3HKEE 3ANWA 3C50A 3N9OA 3N2ZB 3O6XA 2W0GA 3WI3A 1HX8A 3PU3A 1OCCC 3PMRA 1EZ3A 1Y64B 3RC3A 4I1MA 3MXZA 3LNRA 2OCCC 4O79A 1LRZA 2Y6XA 3JC6D 2H7BA 3U3IA 4CZZB 5LGTB 3LLIA 4HFKB 5EHHA 2M4EA 5J2UE 4DO0A 4LLCA 3UNGC 4CI2B 4PFOA 3E08A 4XZCA 3AAAB 5H6RB 5E3CA 5LHGB 1M56C 3VU7H 4P09A 3SRZA 3Q7LA 3F2EA 2QY9A 4YT4A 4AKGA 3IBPA 2Q9QB 3AQBA 2DNXA 4NUUA 2YINA 4G63A 2PFDA 1BR1A 2D5RB 4C3BA 2XUEA 3EH1A 4G7OF 2IC6A 3UGOA 2G3KA 4G7HF 2KZ7B 2IW5B 2EHOD 3LEVA 2LEHA 1WYCA 4JEUB 4V1Av 2A69F 1MNEA 1T98A 1QUUA 4IHJE 2Y69C 1IAPA 5EZYE 3ZC1A 4U5CE 2X9WA 4RBNA 1D0XA 5B1AC 3W2WA 2CMRA 4QXBB 2XAHB 1OKKA 1M57C 4WJ0A 3UMKA 3DM5A 1BR0A 1PD1A 2W61A 3IHRA 4UEMA 3EG9B 3UULA 3K8PC 2XASB 3BQKA 2GK9A 2C5KT 4KMCA 4I50E 4E7SA 1LS1A 3ONXA 1ZYRF 1G8XA 2XAJB 2BE5F 2MWQA 2QTVA 5ETWA 3E0ZA 3OJAA 4E7ZA 2R7QA 4UXNB 5HWXA 3ZVRA 3S4UA 4ILUA 4O7GA 4YT2A 1MMGA 2LT3A 5JDMA 5L3BB 2IAKA 2V7LA 1SF8A 2ZPAA 2WZLA 3ITFA 3I9WA 5LA6E 2KT9A 3PDYA 2WAUA 4FI5A 5F5HA 3HLZA 3ASOC 3ZEFB 5L3DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YJW A;  3IEE A;  3RH3 A; 
#chains in the Genus database with same CATH topology
 4TNV A;  1U5P A;  3SP1 A;  5D92 A;  3GA8 A;  3P4P A;  1Y4C A;  5HXS A;  4J7T A;  4DUY T;  4PJJ A;  5JR9 A;  4XWJ A;  4YL1 A;  3S84 A;  1OED B;  5LGU B;  4O8S A;  3ZMV B;  1IW7 F;  2PBI A;  4HWD A;  1Z23 A;  1H6G A;  3NDB B;  4OK0 A;  4X1K E;  5J1G A;  3O1J A;  5ABE A;  3ONL C;  5BQI A;  1YA9 A;  3MX3 A;  4XEV A;  3LK4 2;  2LCH A;  5IY5 C;  4YY3 T;  2E5V A;  3CKD A;  2BG9 A;  5JVD E;  2WCA A;  3W2V A;  3RRC A;  2CYD A;  4NTF A;  5FXZ A;  3P7I A;  3EDV A;  3K3N A;  3EHM A;  3JAF A;  3S0X A;  3I1A A;  2CBI A;  4K7B A;  4KC9 A;  3EI0 A;  2EHO C;  5A6B A;  3RYH E;  5BUO A;  3N9P A;  2W63 A;  3ASN C;  2OOC A;  3W4Y A;  3AVS A;  2PFV A;  4MW3 A;  4OYK A;  2HSQ A;  4KI2 A;  2VC9 A;  4AX2 A;  3I0Q A;  2L6G A;  3AE9 A;  3WG7 C;  2W2U A;  2MYS A;  2H89 A;  2NR4 A;  4BJT A;  5DS4 A;  4IT4 A;  2FJD A;  1U4Q A;  1C02 A;  2KNH A;  4EBK A;  3SWH A;  4A4A A;  3PUQ A;  3FXD B;  3HJC A;  3E22 E;  4UVB B;  5FL0 A;  1GQA A;  1NSG B;  4LF4 T;  2WY2 A;  3AOU A;  3EZI A;  1ZV4 X;  1JAF A;  4JV5 T;  5J2T E;  3AEC A;  1FMV A;  4BAY B;  4CN6 A;  1S94 A;  4OIP F;  3Q9D A;  3C51 A;  2V6Y A;  4QKN A;  1QQ3 A;  3AEE A;  5AQK B;  5H6Q B;  2PX3 A;  3DE9 A;  4IL4 A;  5FKY A;  1T9K A;  1FMW A;  2J62 A;  3VRB A;  3ESL A;  1V9D A;  3CQX C;  2HN2 A;  2ZM2 A;  3DWW A;  4X64 T;  2H8A A;  4IST A;  4H9O C;  2ZM6 T;  3Q7G A;  3WAQ A;  3R7C A;  5C3J A;  3RQW A;  4Z9J A;  3ZG1 A;  4LDK A;  2Q9B A;  3UQ4 A;  4BJ1 A;  3V5Z A;  1YKH B;  4PR9 A;  1TFO B;  3S9O A;  1ORY A;  3RQF A;  3VF0 A;  1HR0 T;  1AVO B;  4P1N A;  4C7O A;  3M15 A;  4B6X A;  4YHJ A;  5ADX L;  5HAX A;  3ABL C;  3ZT7 A;  3ABK C;  3RF1 A;  1TR2 A;  1Q0G A;  3B29 A;  3K1I C;  4UF0 B;  1LPE A;  3UGP A;  3IPM O;  1OCZ C;  5L0C A;  1V74 B;  3LJB A;  1KNP A;  4WAB A;  2KSF A;  4WBO A;  4YN0 B;  3J9X 1;  5L47 A;  4ANJ A;  4O4J E;  2G0U A;  3HTK C;  3ZYL A;  3G4Z A;  2E2A A;  2XL4 A;  4CSA A;  4G0H A;  4DBQ A;  2XHE B;  2KJG A;  5LJN A;  5COM A;  5JR9 B;  1NLX A;  1QLB A;  2ZM8 A;  1XMO T;  4CS8 C;  3J7Y q;  3SZR A;  3FZL B;  1CHU A;  4O6Y A;  3ZDL A;  3OPC A;  3IQC A;  3FZK B;  1NBB A;  2YVK A;  1HG2 A;  1JNZ A;  3RYF E;  5M4Y A;  2J47 A;  2YDR A;  5JRC A;  5FNV E;  4L6R A;  3MA9 A;  3NZQ A;  3IQ6 A;  4R32 A;  5LMN T;  2ODV A;  2XRH A;  4U72 A;  5HSW A;  4HFE A;  4MLK A;  3O1H A;  1O5H A;  3AJM A;  2KW3 C;  5F5F A;  2FJB A;  3NMJ A;  3PUZ F;  4BJ6 C;  1IBK T;  5KYX B;  1KFY A;  5DVW A;  3DE8 A;  5L0H A;  3AA1 B;  2ZLY A;  3EUH A;  4TNW A;  3F46 A;  1WYB A;  4X65 T;  4HFH A;  2YL0 A;  2BS3 A;  2K9A A;  2BZB A;  2V3C C;  4CS9 A;  1PD0 A;  4W8K A;  2Y48 B;  4JUR I;  1N1C A;  1T6U A;  1N34 T;  1EKY A;  2WB7 A;  2KMF A;  2PF4 E;  5F5W A;  2HUJ A;  1Z8U A;  1ZHZ A;  2J45 A;  3D0T A;  3NYJ A;  1UX5 A;  4C90 A;  4MAL A;  3RRW A;  3AED A;  3FZH B;  1LM3 B;  2BG9 C;  4K0K T;  1CUN A;  3PE0 A;  2KK1 A;  2I0M A;  2D0U A;  2NPU A;  5EK2 A;  3WAJ A;  3TD7 A;  1T6I A;  2ASR A;  3BQI A;  4B3M T;  1FIO A;  4JI8 T;  1MMA A;  5E3A A;  3IQT A;  4N4W A;  4IL9 A;  1W2W A;  4MTG A;  2E8I A;  5FY1 A;  2D5U A;  4LMJ A;  3ZST A;  4MQ9 F;  4L9I A;  2X66 A;  1NAF A;  3FBL A;  3U3F A;  1B68 A;  4KHP T;  1OCO C;  3KV6 A;  1WR6 A;  4WGY A;  1EQ1 A;  2NW8 A;  4H63 H;  2K5B B;  4U5H A;  2HJ3 A;  4ZXL A;  4ZS3 A;  1XWM A;  3HL6 A;  1WLX A;  3Q5D A;  3S27 A;  5AQL B;  5HEO A;  3AA0 B;  3QB5 K;  4QHO A;  2H7V C;  3RIU C;  4BJN A;  1QPU A;  3CX6 B;  2LSY A;  2EIL C;  2JJ9 A;  3M65 A;  2CNW A;  4I4T E;  1GM5 A;  3UU8 A;  3CPZ A;  3RQE A;  3QW0 A;  1MMN A;  2DCF A;  1D0Y A;  4OFZ A;  1OW7 A;  4IGU A;  3SXM A;  3H2U A;  3H65 A;  2P0N A;  4YL0 A;  5TAO A;  1ORJ A;  3FOO A;  4YJ2 E;  3F57 A;  4HFB A;  2QVA A;  3PUA A;  2P61 A;  3JC6 C;  3KBU A;  5E2Q A;  4YSZ A;  4OX9 T;  1YYJ A;  2YEV C;  4ULV A;  3MZK B;  3J06 A;  4DRH B;  2IBF A;  4UEL A;  2L3L A;  5KMG P;  2NG1 A;  256B A;  2R7O A;  4AQF A;  2CHN A;  5JDN A;  4Z90 A;  1O3U A;  4O4H E;  1IBL T;  2FBW A;  4HFC A;  5LHH B;  2JQ9 A;  4LF6 T;  3MLG A;  3BK9 A;  2KYH A;  4GQH A;  3M1C B;  2LFF A;  5HYA A;  3TLW A;  5LBQ B;  1UG7 A;  1RCP A;  3PUX F;  4DR7 T;  3A8Y C;  5B1B C;  3WOD F;  2C03 A;  5AQT B;  4JI0 T;  4DVY P;  3ZN1 B;  4ZI3 D;  4CJO A;  4AE4 A;  4UDV A;  4JW1 A;  2BC5 A;  2WVN A;  3HKC E;  1YLM A;  1OKK D;  3KMI A;  1W0B A;  5FVK A;  1NWM X;  3RKG A;  2WVQ A;  4DMW A;  3NG1 A;  1MIY A;  1DOV A;  3W8H A;  4CS9 C;  3P4Q A;  4CBE A;  3FZF B;  2A3D A;  4CS8 A;  3GN5 A;  3AG3 C;  2YRF A;  3T1Y T;  3ZCI A;  3VAY A;  3AA7 B;  4EEB A;  4PK6 A;  1ZVZ A;  2CLY B;  4H9P C;  3GWN A;  1M6T A;  1AEP A;  1ZHY A;  4U9E A;  3FHD A;  2XM2 A;  2OA5 A;  3K7D A;  3G50 A;  4HEA A;  3L8I A;  2RA1 A;  3ZMT B;  1HE9 A;  1VCS A;  2WZF A;  4JC7 A;  4IE6 A;  1TQG A;  4P9T A;  4N6H A;  5KYW A;  4Q4Z F;  4QI2 A;  3ZSU A;  1LI5 A;  2E9X C;  4PNI A;  3RGL A;  2IYL D;  3K1I A;  1IJ6 A;  3N9O A;  1LIH A;  3O6X A;  3C8Z A;  2OCC C;  1LRZ A;  2Y6X A;  2H7B A;  1M7K A;  1K40 A;  4CZZ B;  4LLC A;  3UNG C;  3M3Z B;  4PFO A;  5E3C A;  5H6R B;  5LHG B;  3F2E A;  4AKG A;  1OW8 A;  2XL6 A;  3QW1 A;  3A7M A;  2YIN A;  2IC6 A;  3UQ7 A;  2FJA A;  4NQF A;  2X0C A;  4G7H F;  3FMS A;  2EHO D;  2LEH A;  1WYC A;  2Y69 C;  3ZC4 A;  1MNE A;  4U9D A;  3W2W A;  2X9W A;  3VRC A;  4MVU A;  2CMR A;  1T6Q A;  2XAH B;  2R05 A;  5A6J A;  3UMK A;  3DM5 A;  1PD1 A;  3IHR A;  2CBJ A;  2AVK A;  2XAS B;  3BQK A;  4KMC A;  1G8X A;  2XAJ B;  5ETW A;  4UXN B;  2IIU A;  4ILU A;  1BZ4 A;  1OR3 A;  1SF8 A;  2V7L A;  1NEK A;  2WAU A;  4Q25 A;  2QE9 A;  1QSP A;  1OXB A;  4J32 B;  2JX0 A;  3NRH A;  5L2L A;  2NWB A;  2V7M A;  4PW8 A;  3W8I A;  4A56 A;  3ZMU B;  4YK5 A;  4NXN T;  2X9X A;  3GM3 A;  4K0U A;  2CWY A;  3MKD A;  5JDG A;  4EYU A;  4BJ6 A;  2MBG A;  3DXJ F;  3AA6 B;  4ADZ A;  4CI3 B;  3NBX X;  3CWZ B;  4IAR A;  2IXO A;  2X51 A;  3EAM A;  4L0R A;  3PUS A;  2EPL X;  4WW0 A;  5L4E A;  1FR0 A;  2XLM A;  3GN5 B;  4X0R A;  3SXK A;  4ZHQ E;  2AU5 A;  4TWF A;  2D4U A;  1Z0P A;  5EGY A;  2KWI B;  1VTM P;  1KK7 A;  1YW0 A;  3HKK A;  1WGW A;  1VK5 A;  1T72 A;  2V1D B;  2FJE A;  2BDE A;  3BEH A;  4U5G A;  2PG8 A;  2N9D A;  2K3W A;  4CIP A;  1OED C;  3AEB A;  2V5D A;  2XQ9 A;  1RKC A;  2AWC A;  3UUB A;  3UUX B;  1VB5 A;  1FFH A;  3ZT5 A;  3BRJ A;  4DV4 T;  5KXJ A;  2HH7 A;  2XQ6 A;  3AE1 A;  3N9Q A;  5L0D A;  2JIW A;  4KHZ F;  2A68 F;  5L0F A;  3N24 A;  3EZH A;  4CQI A;  3KYI A;  3EPV A;  5HEU A;  5DQW A;  1ZHT A;  1LE2 A;  1J5E T;  2YL7 A;  4IAQ A;  4ONS A;  2WDQ A;  1GGQ A;  1O87 A;  3IQ5 A;  2R7S A;  1WTY A;  3AGU A;  5KDM C;  3AXJ B;  4TUY E;  1HW1 A;  4LF8 T;  3GM1 A;  5JRC B;  2J9B A;  2WBL A;  2DI3 A;  1LKX A;  3ZQY A;  1CPQ A;  5HEH A;  4H54 A;  5BQG A;  3NVO A;  2GA0 A;  3A5X A;  5DQV A;  2IXN A;  2WZH A;  4AE4 B;  3P4R A;  4TV8 E;  3RFY A;  1D0Z A;  3VKH A;  4P0A A;  4H4K C;  2XSB A;  5C2T A;  1SR2 A;  2ODU A;  5F3J A;  3S90 A;  1LS4 A;  5IHY A;  4O6N A;  4B3R T;  2BBH A;  2KWH A;  3FBZ A;  4EIW A;  3ZC0 A;  1YAU O;  3DJB A;  3C4Z A;  1FTS A;  2W45 A;  3N9L A;  5AQV B;  5AQQ B;  3DTO A;  2IUB A;  4MND A;  3NMI A;  2AP3 A;  3T1H T;  5HWY A;  4DVD A;  1H9G A;  3H3M A;  3QUJ A;  2NUT A;  4QXH B;  4XEF A;  3NKZ A;  2J0X A;  3AG4 C;  3TJ5 A;  4PAC A;  3GMI A;  5AQM B;  5JH7 E;  3OWT A;  4DJ9 A;  2XAG B;  2J8W A;  2VKJ A;  3GEE A;  4OIR F;  1HE1 A;  2UXB T;  2LLY A;  5AFU L;  2PP4 A;  5AQJ B;  3FHN A;  3CVR A;  2Q4F A;  5HV9 A;  5HCM A;  4DV2 T;  3AEA A;  1E2X A;  2A1D D;  3O39 A;  4JTC B;  2WMO A;  2VB6 A;  3X1D A;  1US7 B;  3AAE B;  4FJO A;  1TWG A;  5LB7 B;  1QSD A;  4HTE A;  3AXJ A;  1I6Z A;  3ETU A;  2XXA B;  2X67 A;  3AAI A;  3U78 A;  3ZPO A;  4UVC B;  2OG2 A;  1UUS A;  3UU5 A;  5LP6 E;  2LRK A;  3O9X A;  1YVI A;  3B0P A;  2R03 A;  2IOQ A;  3OKQ A;  2WZI A;  1ZHW A;  2D0T A;  2YL1 A;  4HFF B;  4C3E A;  3A11 A;  3L3P A;  3US6 A;  2FGY A;  4OYJ A;  1NZE A;  4ZI3 C;  2V7J A;  5JDQ A;  2EIM C;  1YJG A;  3K1H A;  2XQ7 A;  5KYU A;  1RKE B;  2VKD A;  3V5X A;  2ETS A;  2HKV A;  5F28 E;  3ZMZ B;  3AE4 A;  3L09 A;  3U9J A;  3RLF F;  1ZHX A;  2XQ3 A;  1T8B A;  1J8M F;  2XAQ B;  2OEX A;  3KDS E;  3QZC A;  2HFI A;  1SHZ C;  5T3T A;  3RH3 A;  3U8V A;  2AWY A;  4HWI B;  5KYX A;  1ST6 A;  1R8I A;  3EDU A;  4LDR A;  2XQY A;  2BKN A;  4U33 A;  5JS5 A;  3LS1 A;  2LE8 A;  4GK5 E;  3UUM A;  2JQK A;  3ETV A;  1AUE A;  3L34 A;  2WQY A;  2JMH A;  3M4C A;  5ABG A;  3RX6 A;  2XS1 A;  4LDQ A;  2D2S A;  5DQT A;  2J7P A;  3NMK A;  4J30 B;  4PJL A;  5FXW A;  1HNW T;  3HI2 A;  4N6C A;  2L6F A;  3ANW B;  4MTO A;  3UFG A;  5L3F B;  4B3S T;  4JI4 T;  5LBM A;  4TWH A;  1N36 T;  3LS0 A;  1E84 A;  2X9Y A;  5AQN B;  2XM0 A;  5KYU B;  2KLQ A;  2KIN B;  1M62 A;  2V5C A;  3VKG A;  3QK6 A;  2Q00 A;  2XM4 A;  5DAB A;  1OCR C;  4JI3 T;  4GYR A;  4DV7 T;  3SFE A;  5LHI B;  3U3B A;  4IWB A;  4GOU A;  3JYH A;  3TK0 A;  2IDO B;  4EAH A;  3JAD A;  5FXV A;  1HG5 A;  2GAQ A;  2HV7 A;  4WZX A;  1VLT A;  2YL3 A;  2Q3T A;  2W4M A;  2A2F X;  2A0U A;  4MFR A;  1SMY F;  2UXC T;  2Y8D A;  2MOZ A;  1JPJ A;  2R7X A;  3DM9 B;  5JVE A;  4XPX A;  1E85 A;  3JSE O;  3GWH A;  3RVZ A;  2W00 A;  5JSL A;  2W4B A;  4HE8 D;  3LK2 B;  4JJF A;  3ECS A;  5A6K A;  2BVM A;  4LER A;  2OLT A;  4DV3 T;  3AQC A;  3KL4 A;  3LEO A;  3UTK A;  2BKP A;  2Q9Q D;  2UUC T;  2ZXW C;  2DWG A;  2B0J A;  4LFA T;  3RVY A;  2QA7 A;  4L5G A;  1HF8 A;  4HFV A;  2V6Y B;  2FAP B;  4UF0 A;  2P1A A;  1V4A A;  1ZU4 A;  2EIJ C;  4PAG A;  2WVO A;  5L3G B;  4XLN F;  3NZP A;  4JUY A;  1WCR A;  2K24 A;  2CXD A;  2CNW D;  4XEK A;  4XPY A;  2R7U A;  2Z15 A;  2NSG A;  2LM2 A;  3M4B A;  5LJM A;  3H2V A;  3UMI A;  1X9B A;  5AQR B;  2EHO A;  4ISS A;  4IDZ A;  2H3R A;  3EHZ A;  4DRJ B;  2R6G F;  3N5L A;  1WOL A;  3FAJ A;  4IE0 A;  4PFP A;  1RJ9 A;  2PJQ A;  4JTD B;  2H7O A;  2FUP A;  5AQI B;  3JCU Q;  4KBL A;  3N9N A;  3K33 A;  2EPO A;  2YLI A;  3LBX B;  4YSY A;  2XPK A;  2YDQ A;  4BEM J;  3PDM P;  4I43 B;  3SNH A;  2WU5 A;  4O6M A;  1QLE C;  1GQE A;  3HNL A;  5EK4 A;  4ZI2 C;  4BPM A;  3V5U A;  2KC3 A;  1S05 A;  5T1D B;  1ZEE A;  1XMQ T;  5L0G A;  2EPM X;  2P9B A;  5IWA T;  4JTA B;  2HZ8 A;  4HEA J;  5L0J A;  2LSK A;  4OIQ F;  5CA0 E;  3KV5 A;  5JTG A;  4YT5 A;  4D4N A;  2E9X D;  3RC8 A;  3KBT A;  3FXE B;  3K66 A;  3T6J A;  3PJA J;  4ZZB A;  1H7I A;  4LF7 T;  2LKH A;  5JT4 A;  4JE9 A;  2UUI A;  3QTH A;  1SA0 E;  1SZI A;  3ZTM A;  4ZLD A;  4DUZ T;  2VCB A;  2JD3 A;  4IRU A;  2L9Q A;  3C63 A;  4FAP B;  4AQG A;  4BG0 A;  3R6N A;  4A2N B;  1ZP0 A;  1WRD A;  3MJX A;  4W8P A;  4FWV A;  3RQU A;  4ULW A;  1TWA A;  2G3V A;  4YSX A;  3C50 A;  3WI3 A;  4P6I C;  3GM2 A;  3RC3 A;  3LNR A;  1FNT c;  3U3I A;  4YHH T;  1L3P A;  5A6B D;  4DR5 T;  2M4E A;  4DO0 A;  1CGM E;  5FL1 A;  3E08 A;  2VVN A;  3VU7 H;  3SRZ A;  4ILB A;  2DNX A;  4C3B A;  4G63 A;  2D5R B;  3DKA A;  4AIS A;  2XUE A;  4G7O F;  3UGO A;  3ATP A;  3LEV A;  4V1A v;  2XLW A;  3RYL A;  4NCQ A;  5B1A C;  4QXB B;  5JUA A;  3ONJ A;  1T01 A;  2XQA A;  2XJ7 A;  1NEN A;  2C5K T;  1LS1 A;  2BE5 F;  2R7Q A;  4F8H A;  4J7Y A;  3E0Z A;  4O7G A;  1T7S A;  4A97 A;  4YT2 A;  5JDM A;  2LT3 A;  5L3B B;  4U31 A;  3U9M A;  2VVS A;  2BKO A;  3QVY A;  3ITF A;  4FI5 A;  3HLZ A;  5ABF A;  4DV0 T;  4KX6 A;  3L8R A;  5L3D B;  3SFD A;  3X1O A;  2Q9A A;  3HNK A;  3L1M A;  3LBX A;  4EUK B;  3U8P A;  2K48 A;  3IHU A;  1TKN A;  3RYC E;  1B7T A;  1GS9 A;  4U5B E;  3RKO F;  5DS5 A;  4ZEY A;  4KNW A;  1S7Z A;  3DI5 A;  5HEG A;  2UUH A;  5FXX A;  3AVR A;  4EZH A;  4DR2 T;  4AL0 A;  1LI7 A;  5A6A A;  1FEW A;  3FXH A;  3JCF A;  1A7V A;  1VYK A;  5JRA A;  3JRM O;  4MBQ A;  2LHN A;  1Q0D A;  2AXD S;  3RIF A;  2WSS V;  5CFB A;  3ZIB A;  2XS8 A;  2I15 A;  3N0T A;  5FY7 A;  5HEJ A;  2BBJ A;  4JYA T;  5F8P A;  2VAS A;  3EGD A;  4EXT A;  2VL0 A;  4YJ3 E;  3EHN A;  4U2Y A;  1CGN A;  2J0W A;  1BR4 A;  2V26 A;  4E0H A;  3OA1 A;  4JI6 T;  4E0I A;  5LOV E;  3C8G D;  4ZOL E;  1MIV A;  4QXC B;  3B0U X;  1N32 T;  5JDL A;  2LP4 A;  1MQV A;  1VLS A;  1OXK A;  5AQF B;  3B13 A;  2TMV P;  1DOW A;  3JSZ A;  3KPH A;  3FZM B;  3IA3 A;  3LG7 A;  4DR3 T;  3ZYK A;  3V5S A;  5FVL A;  2EPK X;  4J2C A;  4JRZ A;  3SS1 A;  2NSF A;  4BJM A;  2J9V A;  1D1B A;  4C7O B;  4OIO F;  3ZN0 B;  2P7V A;  4I55 E;  5AQP B;  3R2P A;  1H9T A;  3C98 B;  5KYN A;  1JOG A;  3CEX A;  4DV5 T;  5IUX A;  2EPN A;  2LK4 A;  3F31 A;  2YHS A;  3H3A A;  3UUN A;  5TJ5 E;  4IGG A;  2WMN A;  3AE7 A;  4TN7 B;  3CX8 B;  3PUY F;  2NUP A;  3AG2 C;  2W67 A;  5LGN B;  3QC9 A;  1U6H A;  2JQQ A;  2EIN C;  5DLJ A;  5L0I A;  2RSE B;  4CIH A;  4MVQ A;  2VCC A;  3S28 A;  1QZX A;  3TUL A;  4YT0 A;  3VR8 A;  1Y6D A;  4FX5 A;  3W15 B;  1SE7 A;  4YJW A;  2J7P D;  4O4I E;  3OVU A;  1YZA A;  4CXX A;  4JJG A;  3PU8 A;  1HCI A;  4OIN F;  3MYF A;  3N2O A;  5JRE A;  4HFI A;  3K1S A;  2NW7 A;  3LK3 B;  3G06 A;  4CN4 A;  2LFD A;  3HNJ A;  3T6G B;  4JCZ A;  2CXF A;  4JI2 T;  2XLE A;  2OKU A;  1YQ3 A;  2X0H A;  3JT1 A;  5JLI A;  1I94 T;  1V54 C;  3AE6 A;  2CGE A;  3Q2M A;  1W0A A;  2ACZ A;  2L7A A;  4IE5 A;  2FFH A;  1KTM A;  2X0Y A;  4Z8X A;  1HMD A;  2ZMA A;  4YLH A;  2EHO B;  4X1I E;  3VR9 A;  1HW2 A;  2YLG A;  2LSE A;  3EFO A;  3HKD E;  5L3Q A;  4X1Y E;  1AJ3 A;  3DAF A;  1N33 T;  4DRI B;  2XAF B;  3C4X A;  2NTX A;  5ABF B;  3B9Q A;  4CDY A;  2BS4 A;  3OTO T;  1XDP A;  3Q5X A;  3RHW A;  2QNL A;  3T9O A;  5AQO B;  3GAN A;  4CXY A;  4U7I A;  3F47 A;  2XQ8 A;  4KUM B;  1VYI A;  2CA5 A;  3I9Y A;  5LXT E;  2VL8 A;  2WWU A;  2V7I A;  3NRX A;  4YTP A;  3JZ0 A;  2I8B A;  2CRB A;  4I3M A;  3C4W A;  2J9W A;  3O4X E;  3U2M A;  1Q0M A;  2HPL A;  2L9J A;  2LD6 A;  4N06 A;  4JEH B;  2ACX A;  3E9V A;  5AGF A;  2R02 A;  5EK0 A;  1YKE B;  4U5E E;  3ZT6 A;  1I4Z A;  3PHF 2;  2G62 A;  2YQY A;  5K0I A;  5L4H A;  5CA1 E;  2XXA A;  1JMW A;  4KI0 F;  2UUB T;  2F4V T;  2B1E A;  2KGO A;  2YN6 A;  4EHP A;  4ILA A;  3EGX A;  1UX4 A;  1LVK A;  4X20 E;  3MFN A;  3U2L A;  4UR9 A;  4CDA A;  5LG4 A;  4GIW A;  3EGX B;  2XLD A;  4ERR A;  3PUR A;  4ZI2 D;  2PNO A;  4NTA A;  3TQO A;  2OU6 A;  1E1H B;  1IJ5 A;  2GFH A;  4YWQ A;  2R7W A;  1WN0 A;  1YDI A;  3DMD A;  3ZMS B;  4I44 A;  4WGZ A;  1HNX T;  4DOZ A;  4H9S E;  1T5O A;  2SPC A;  4RD9 A;  1KF6 A;  2XZE A;  5FMN A;  5JR9 C;  4OHF A;  3LFM A;  2CDQ A;  1HFA A;  4CS7 A;  1NFN A;  3C18 A;  3C8G A;  5DS6 A;  2ICW G;  4YT8 A;  4EB6 E;  3DJN B;  3AB3 B;  3T4R A;  1UFB A;  5FZT A;  2PX0 A;  1A7E A;  3HA4 A;  5BMV E;  3AEF A;  4MVZ A;  4AXP A;  1VCT A;  3X2Q C;  3LNM B;  5L3V A;  2UXN B;  2IM8 A;  3B71 A;  5FCL A;  1JRA A;  2LKG A;  5COF A;  3OYX A;  1MMD A;  5HCJ A;  3UU3 A;  5AQH B;  2MAW A;  4U5F E;  2YDS A;  2E9X A;  2YKZ A;  1UCU A;  2CWO A;  4Z91 A;  2VKO A;  5HXH A;  3HNI A;  2MPK A;  5KYY A;  5LG3 A;  4WYV A;  2OJE D;  2XSE A;  2IHR 1;  3PJA A;  4O4L E;  2NW9 A;  2UU9 T;  3NKD A;  5AC5 A;  5KYY B;  2HPJ A;  4GYS A;  2I6H A;  2OQM A;  2WWV A;  3P4W A;  1K04 A;  4KBM B;  2LQG A;  4BJ5 C;  2LM9 A;  3Q6M A;  1G73 A;  5D91 A;  1C17 M;  3MYI A;  5T3W A;  4XAX B;  2EIK C;  3SYN A;  2KXP B;  2J4G A;  3SOL A;  3C7J A;  4JBW F;  2Q9Q C;  1RKE A;  2YU1 A;  2BG9 B;  4AL1 A;  2V7K A;  4YFS A;  3EH2 A;  3Q6N A;  3TLS A;  3I4U A;  3EVY A;  3CSK A;  4G2A A;  5GON E;  1M2V B;  2OJQ A;  1J1J A;  4DBR A;  2WL8 A;  5HXR A;  2A6H F;  3DP7 A;  5COG A;  1HY5 A;  2XY8 B;  3V5Y A;  2A0B A;  2JRK A;  3TLV A;  1KNY A;  3WHN A;  5JDH A;  5B3S C;  1R4T A;  1FFT C;  2HV6 A;  4E17 A;  5JDF A;  3K3O A;  2QLA A;  2GDC A;  2PTF A;  1TWH A;  1I4Y A;  4QX7 B;  4U3C A;  1WFD A;  2M6I A;  3P8C D;  3T8O A;  1YYX A;  1U0B B;  3KYJ A;  4TV9 E;  2M64 A;  1G4W R;  2V8S V;  3V7O A;  1XZP A;  3RYI E;  4G78 A;  1V55 C;  4K0D A;  4NIQ A;  3R84 B;  3PTR B;  4F6R C;  2LRL A;  4EBJ A;  5AQU B;  4O2B E;  4LFC T;  2CCY A;  4XPW A;  1MIW A;  3LDQ B;  1OW6 A;  3MK7 C;  2QUP A;  3HKB E;  2YLD A;  2N2N A;  1BR2 A;  4IJJ A;  2A72 A;  3PUV F;  2MTQ A;  4A98 A;  4JZA A;  1VMA A;  3AE2 A;  1WAT A;  3P50 A;  1UUR A;  2E5L T;  3KIN B;  3LSV A;  3EQL F;  4RDA A;  1XZQ A;  2B76 A;  1G5Z A;  1M2V A;  5A69 A;  3KKB A;  1WR0 A;  2ZXP A;  2XLO A;  3HR0 A;  3QVZ A;  4XLP F;  1M2O A;  3QMK A;  3S29 A;  3NYL A;  1WAS A;  1JPN A;  3LJC A;  3N2G E;  4YXD A;  2BL2 A;  4QI0 A;  1TWC A;  3MBG A;  3HKE E;  3ANW A;  3N2Z B;  3PMR A;  2W0G A;  2HMQ A;  3C62 A;  3PU3 A;  2VCA A;  4I1M A;  1EZ3 A;  3UU4 A;  2W66 A;  4O79 A;  1G4U S;  1UGO A;  3LLI A;  4HFK B;  4EED A;  1ZW2 A;  4Z9H A;  1FAP B;  1UK5 A;  1HNZ T;  3AAA B;  2XLH A;  3ZKR A;  4COF A;  1M56 C;  4ZZC A;  3Q7L A;  2QY9 A;  4YT4 A;  3IBP A;  2Q9Q B;  3AQB A;  3ZWI A;  1XWJ A;  2PFD A;  1BR1 A;  3QB5 A;  3EH1 A;  4JI5 T;  3JAE A;  2KZ7 B;  2DL1 A;  1SYQ A;  1EI7 A;  1L7C A;  1U89 A;  4ILC A;  1T98 A;  1QUU A;  4IHJ E;  4A5X A;  5EZY E;  1QVX A;  4NXM T;  4CDV A;  1OKK A;  1BR0 A;  4UEM A;  4X66 T;  3EG9 B;  4JEA A;  4LF5 T;  4DV1 T;  1ZOY A;  3K8P C;  2GK9 A;  4IB4 A;  4I50 E;  1TFK B;  3ZVR A;  3S4U A;  3CAX A;  2ZPA A;  2IAK A;  5BQH A;  2KT9 A;  5F5H A;  3ASO C;  4HWF A;  2BVL A;  2DB4 A;  1ZHC A;  2KSR A;  4B3T T;  2W9Y A;  1YD8 G;  3TKL B;  2NUT B;  4EYY R;  1MND A;  4HE8 A;  4H9R C;  4I0U A;  2CLY C;  3ZYM A;  2J46 A;  5FP3 A;  1CGO A;  3TJ6 A;  4GEH A;  1E86 A;  3RPU A;  2ZXR A;  4NY3 A;  4QH4 A;  3M79 A;  3PCV A;  3B57 A;  2NUP B;  3KFW X;  4MW8 A;  3MAC A;  3GOD A;  4BEJ A;  4U7Y A;  4JI1 T;  5C8Y E;  2C5J A;  3DD7 A;  2E87 A;  2M67 A;  1WWP A;  5CIV A;  2QGS A;  1YAR O;  1Z63 A;  2LSG A;  4DR1 T;  1KNZ A;  4N78 D;  2H88 A;  2ES0 A;  3KVA A;  3VYW A;  1HTJ F;  5E0O A;  2B0H A;  2F22 A;  2NOX A;  3G4X A;  3EAB A;  2CCQ A;  2I59 A;  1R5I D;  3A9C A;  2IXP A;  5LMU T;  4X62 T;  4GK0 E;  4EGW A;  4WNK A;  4M1P A;  1NU7 D;  4UV8 B;  4B6I A;  1IZN B;  5E33 A;  5IYZ E;  2YK0 A;  2DHR A;  4G7Z F;  2WM9 A;  4PJM A;  3CQC B;  4PK5 A;  3JRT A;  4I1O B;  3CIR A;  4PK4 A;  4IRE A;  2DYS C;  2WB5 A;  4JCH A;  4QX8 B;  2PBE A;  2DWK A;  2HHH T;  1OED E;  3IEE A;  4QH5 A;  2Y39 A;  2AE9 A;  2XL8 A;  2W4X A;  4H63 V;  4IDN A;  4AQY T;  2C04 A;  2YWA A;  4XTK A;  4UV9 B;  4LAC B;  4KP3 C;  1F1M A;  2Y3H A;  5BR8 T;  1OQC A;  3GOR A;  4HGA A;  3K6B A;  4TZ4 C;  1OR2 A;  4HN9 A;  1D1A A;  4EZ4 A;  3GEH A;  5GPG B;  4YL3 A;  4JIO A;  4LF9 T;  3JYY A;  2YEV A;  3H37 A;  1ZU5 A;  3DJU B;  2DI4 A;  4EV6 A;  2JPU A;  3FVY A;  4MVO A;  1KU2 A;  4D4X A;  1VOM A;  4GYT A;  1J8Y F;  3O10 A;  3I0O A;  2O9X A;  4NPP A;  3EJN A;  3JTL O;  3E70 C;  1NU9 C;  1L0V A;  3ZJ2 A;  2VH3 A;  3VM6 A;  1CPR A;  3I5P A;  2WU2 A;  4Q5S F;  5ABH A;  2CPT A;  4UIG A;  4IDQ A;  1RMV A;  3FOP A;  4HKA A;  1HMO A;  2V6X A;  4AK9 A;  4CX9 A;  5DJQ C;  2J1D G;  4JEB A;  3K3Q C;  1D1C A;  3NWI A;  4DV6 T;  1XNQ T;  1BBH A;  5A1L A;  4AKL A;  4C91 A;  2WDV A;  1ZZP A;  5B3I A;  2GWW A;  3CQG B;  2LOS A;  3SEO A;  2MHR A;  2R7R A;  3ZSS A;  2UXD T;  5LYJ E;  2LIG A;  1C03 A;  1H7C A;  1YQ4 A;  2ZM0 A;  4BJ5 A;  2XQ5 A;  3QOF A;  3U5S A;  4ZI7 E;  5LCY A;  1HS7 A;  4EIY A;  2NP9 A;  4ZS2 A;  5AC4 A;  3WAK A;  4LMK A;  5CJ5 A;  1OED A;  5L3C B;  3ZTZ A;  3N2K E;  4HWH A;  2A9U A;  1X79 A;  2R7V A;  2YKS A;  2XTL A;  3OEO A;  1YXR A;  2VWA A;  3Q5W A;  3B0V C;  4IAO A;  4DR6 T;  4AQF C;  3UMH A;  2WZG A;  4NTB A;  1W09 A;  3PUW F;  3GEI A;  3RKO A;  3LLK A;  4U5D E;  2CW0 F;  1VRB A;  1K05 A;  2HSB A;  5KYW B;  3P4S A;  1XDO A;  4CXW A;  3AG1 C;  3B5M A;  4EWC A;  3O55 A;  4XQ1 A;  2WP9 A;  4PJN A;  4IDP A;  2LSI A;  3CK6 A;  1RXQ A;  2CE7 A;  2C5I T;  2UXX B;  4DVZ A;  3RIA A;  4MVR A;  3DZA A;  2RD9 A;  2OV9 A;  2ZXO A;  4TX5 A;  4OD4 A;  3FAP B;  2VK9 A;  3KV9 A;  5J0Z A;  2DGJ A;  4E18 A;  5FY0 A;  5CGM A;  4U2Z A;  3T6B A;  5KX5 E;  3RIU A;  2IML A;  5CI9 A;  2XLV A;  4JI7 T;  3GWL A;  4UVA B;  1FJG T;  3ZQV A;  4ZLC A;  4HFD A;  3L0I A;  2RP4 A;  1LVF A;  2RPA A;  1QKR A;  3O1I A;  4P0B A;  2Y3B A;  2ZD9 A;  1DU2 A;  3FDQ A;  4EBB A;  4TWD A;  1IBM T;  4FES A;  4QDL A;  3EFO B;  3RIP A;  4AKH A;  2R25 A;  3ZLI A;  2WDR A;  2DLR A;  3Q5E A;  4K1O A;  1EA8 A;  2HMZ A;  3UR3 C;  5FYM A;  1E2A A;  5EK3 A;  4LFB T;  3IF8 B;  4IDO A;  3UT5 E;  3I5Q A;  1A7D A;  2Y3D A;  4MS2 A;  3ABV A;  1JR8 A;  3AE8 A;  3NRY A;  2VQF T;  1E83 A;  3CQZ A;  4AI6 A;  1BDJ B;  1XZY A;  4EOZ B;  2LJL A;  5AQG B;  4C3D A;  1A0B A;  5CI8 A;  4ER9 A;  2HS5 A;  1ORS C;  3LUT B;  3FB2 A;  2C0S A;  2UUA T;  2CXL A;  2CM0 A;  1PCX A;  3KH2 A;  5LNK A;  1ZW3 A;  4DND A;  3VRA A;  1HX1 B;  4CN1 A;  4M63 A;  3LES A;  2YU2 A;  3BQL A;  3TOL A;  3ZJ1 A;  3NYM A;  2D9D A;  5AQS B;  1PV3 A;  3PUG A;  3NKE A;  2LHR A;  3C64 A;  4AKR B;  2IC9 A;  3DAG A;  4WBN E;  1OXZ A;  1XNR T;  1W9R A;  4H9Q C;  1APC A;  2X0L B;  2X9H A;  4YTM A;  3TLU A;  4DXW A;  2KQ9 A;  1E7P A;  3PV0 F;  4CI1 B;  1JNR A;  2DYR C;  3CX7 B;  2IXM A;  3ZCJ A;  2YOE A;  3POV A;  4IE7 A;  3VHL A;  3QNU A;  1I5N A;  3ABM C;  4CJG A;  2JQH A;  1Y01 A;  4P9F A;  2NTY A;  2CHO A;  1ZKE A;  3AEG A;  4LML A;  2R7T A;  4IE4 A;  4U74 A;  3OYZ A;  4AIU A;  1Z5Z A;  2J9U A;  3AGT A;  2M6B A;  3OBV E;  4XBF B;  4H9N C;  5HXE A;  2N1G A;  4Q7C A;  1YZC A;  3KVB A;  1Z3I X;  4OD5 A;  3KV4 A;  2L81 A;  4BA9 A;  2YZS A;  2Z6E A;  3CZ6 A;  4X5T A;  1YA7 O;  3SXZ A;  4NC3 A;  4Z9I A;  2XSA A;  4O2A E;  1A41 A;  2P6V A;  4NUV A;  4AKI A;  4JKV A;  2HJM A;  2LSJ A;  4EKW A;  2A6E F;  1KEY A;  2CEA A;  2QRX A;  1LE4 A;  3UU6 A;  2Q9C A;  5JQG E;  3EG9 A;  1S35 A;  1RJ9 B;  2XQ4 A;  3SXY A;  3RI5 A;  2W62 A;  1OWA A;  4CSA C;  1IZM A;  3UFE A;  5HXC A;  4KNV A;  4ASK A;  2X68 A;  2BG9 E;  4MTF A;  4LLE A;  3CML A;  3L8J A;  4JLE A;  3N9M A;  5L3E B;  1SUM B;  2Q7R A;  4QH1 A;  4F4B A;  3L39 A;  2VKH A;  1Z7Q c;  5CB4 E;  3LAY A;  4YTN A;  2KND A;  2E9X B;  2LOP A;  2Q9Q A;  2WS3 A;  1O3X A;  1NG1 A;  1Q0F A;  4MVS A;  1Z6A A;  3EGD B;  1NFO A;  4JVS A;  2L8K A;  2Y3G A;  2L6H A;  1KNR A;  2JMK A;  4DMV A;  4IIJ E;  4MHC A;  2JPF A;  1Q0K A;  4QWN B;  3TLT A;  2VUR A;  1OCC C;  1HX8 A;  1Y64 B;  3MXZ A;  3JC6 D;  3RQG A;  3RF3 A;  5LGT B;  5EHH A;  5J2U E;  4CI2 B;  2QYW A;  3AE3 A;  4GKJ T;  4XZC A;  3RW0 A;  2R9R B;  4P09 A;  3AE5 A;  1J5W A;  2VQE T;  3C8G B;  4NUU A;  2G3K A;  4DR4 T;  2IW5 B;  2OEV A;  4JEU B;  2A69 F;  1IAP A;  4HWC A;  3ZC1 A;  4U5C E;  4RBN A;  2XM1 A;  1D0X A;  5DQZ A;  1M57 C;  2HN1 A;  4WJ0 A;  2W61 A;  3UUL A;  3U0C A;  3TOM A;  4E7S A;  1ZYR F;  3ONX A;  2MWQ A;  2QTV A;  4E7Z A;  3OJA A;  5HWX A;  5JP7 A;  4MVM A;  1MMG A;  2BS2 A;  4GKK T;  2WZL A;  3I9W A;  5LA6 E;  3PDY A;  4DID B;  3ZEF B; 
#chains in the Genus database with same CATH homology
 4J32 B;  3NRH A;  3X1O A;  1U5P A;  5L2L A;  2Q9A A;  2BVL A;  5D92 A;  3SP1 A;  2NWB A;  2V7M A;  3GA8 A;  1ZHC A;  4PW8 A;  4A56 A;  3LBX A;  3ZMU B;  3W8I A;  2X9X A;  2K48 A;  2W9Y A;  1YD8 G;  4K0U A;  3RYC E;  5HXS A;  2CWY A;  3TKL B;  1B7T A;  1TKN A;  3MKD A;  5JDG A;  2NUT B;  4PJJ A;  5JR9 A;  4EYY R;  4EYU A;  4U5B E;  4XWJ A;  3RKO F;  5LGU B;  4BJ6 A;  4O8S A;  1MND A;  4HE8 A;  5DS5 A;  3ZMV B;  2MBG A;  1IW7 F;  3DXJ F;  3AA6 B;  2PBI A;  4ADZ A;  4CI3 B;  4H9R C;  3NBX X;  3CWZ B;  1S7Z A;  4KNW A;  2IXO A;  2CLY C;  2X51 A;  3ZYM A;  4L0R A;  5FP3 A;  3AVR A;  3PUS A;  5FXX A;  4EZH A;  2J46 A;  4WW0 A;  1Z23 A;  4GEH A;  3NDB B;  4OK0 A;  4X1K E;  3RPU A;  3GN5 B;  4X0R A;  1FEW A;  5J1G A;  3O1J A;  2ZXR A;  4NY3 A;  4ZHQ E;  3B57 A;  1Z0P A;  3KFW X;  2KWI B;  2NUP B;  1VYK A;  5EGY A;  1KK7 A;  3MAC A;  3GOD A;  4BEJ A;  1YW0 A;  4MBQ A;  1WGW A;  1VK5 A;  3MX3 A;  5C8Y E;  3LK4 2;  2V1D B;  5IY5 C;  2LHN A;  2C5J A;  2BDE A;  2E87 A;  3DD7 A;  4U5G A;  2M67 A;  2PG8 A;  2N9D A;  2WSS V;  3ZIB A;  3CKD A;  5JVD E;  2QGS A;  3W2V A;  3N0T A;  1Z63 A;  2LSG A;  5FY7 A;  3RRC A;  1KNZ A;  4N78 D;  5FXZ A;  3P7I A;  2ES0 A;  3UUX B;  3KVA A;  1FFH A;  3VYW A;  3EDV A;  3K3N A;  2VAS A;  1HTJ F;  5E0O A;  5F8P A;  4EXT A;  2NOX A;  3EHM A;  3EGD A;  3S0X A;  2HH7 A;  3I1A A;  3N9Q A;  4YJ3 E;  3EHN A;  4K7B A;  2J0W A;  2CCQ A;  1BR4 A;  2A68 F;  3N24 A;  2I59 A;  2EHO C;  2V26 A;  3OA1 A;  3EZH A;  2IXP A;  4KC9 A;  4CQI A;  3RYH E;  4GK0 E;  5LOV E;  4WNK A;  3EPV A;  5BUO A;  4M1P A;  3N9P A;  1NU7 D;  5DQW A;  1ZHT A;  4UV8 B;  4B6I A;  1IZN B;  5E33 A;  5IYZ E;  3ZC4 A;  2YK0 A;  2W63 A;  4ZOL E;  1MIV A;  2DHR A;  4QXC B;  3ASN C;  4XLP F;  4G7Z F;  2WM9 A;  4PJM A;  3CQC B;  3AVS A;  4PK5 A;  5JDL A;  2PFV A;  1O87 A;  3JRT A;  3B0U X;  2R7S A;  4OYK A;  4I1O B;  5KDM C;  4PK4 A;  4TUY E;  4KI2 A;  2DYS C;  3B13 A;  4JCH A;  4QX8 B;  4AX2 A;  2DWK A;  3I0Q A;  5JRC B;  2WBL A;  3WG7 C;  3JSZ A;  2MYS A;  3IEE A;  1LKX A;  4BJT A;  5DS4 A;  2Y39 A;  1U4Q A;  3LG7 A;  4H63 V;  3ZYK A;  3A5X A;  3SWH A;  2C04 A;  3V5S A;  2KNH A;  5DQV A;  4XTK A;  3PUQ A;  3FXD B;  4UV9 B;  4J2C A;  3E22 E;  4UVB B;  3SS1 A;  2IXN A;  4BJM A;  3HJC A;  4KP3 C;  3RYL A;  4AE4 B;  2J9V A;  1D1B A;  4TV8 E;  3EZI A;  1ZV4 X;  4OIO F;  4C7O B;  2Y3H A;  5J2T E;  3RFY A;  3ZN0 B;  1D0Z A;  2P7V A;  4I55 E;  4HGA A;  3VKH A;  4P0A A;  3K6B A;  1FMV A;  3C98 B;  4TZ4 C;  4BAY B;  4H4K C;  5D91 A;  1S94 A;  5KYN A;  3Q9D A;  4OIP F;  3C51 A;  4HN9 A;  1D1A A;  4QKN A;  4EZ4 A;  2YHS A;  3F31 A;  2ODU A;  5F3J A;  3H3A A;  3UUN A;  5H6Q B;  2YEV A;  5IHY A;  4O6N A;  3H37 A;  2WMN A;  4TN7 B;  2DI4 A;  1ZU5 A;  3CX8 B;  2NUP A;  2PX3 A;  3DJU B;  3FVY A;  1FMW A;  1KU2 A;  3AG2 C;  2KWH A;  3FBZ A;  4EIW A;  3ZC0 A;  1VOM A;  3ESL A;  5LGN B;  3QC9 A;  2EIN C;  1V9D A;  2JQQ A;  1J8Y F;  4GYT A;  5DLJ A;  3DJB A;  3I0O A;  3CQX C;  3C4Z A;  2O9X A;  1FTS A;  2W45 A;  2ZM2 A;  3N9L A;  3EJN A;  3DTO A;  4CIH A;  4IST A;  3E70 C;  4MND A;  3S28 A;  1NU9 C;  1QZX A;  4H9O C;  3ZJ2 A;  2VH3 A;  3Q7G A;  3I5P A;  4FX5 A;  4Q5S F;  3ZG1 A;  3W15 B;  2Q9B A;  5HWY A;  4DVD A;  4UIG A;  4O4I E;  2J7P D;  3QUJ A;  4YJW A;  2NUT A;  4BJ1 A;  4QXH B;  4HKA A;  4CXX A;  2J0X A;  3AG4 C;  1YKH B;  4JJG A;  3PU8 A;  3GMI A;  3OWT A;  1HCI A;  5JH7 E;  4OIN F;  4AK9 A;  2XAG B;  5DJQ C;  2J1D G;  2VKJ A;  3N2O A;  3K3Q C;  5JRE A;  4C7O A;  3LK3 B;  2NW7 A;  4OIR F;  1D1C A;  4B6X A;  5AFU L;  2PP4 A;  4YHJ A;  3FHN A;  3CVR A;  2CXF A;  5HAX A;  5ADX L;  3ABL C;  5A1L A;  3ABK C;  4AKL A;  4C91 A;  1TR2 A;  3K1I C;  2A1D D;  3O39 A;  3JT1 A;  2WMO A;  4UF0 B;  3UGP A;  2VB6 A;  3CQG B;  2LOS A;  1OCZ C;  1US7 B;  1V54 C;  3SEO A;  3AAE B;  2R7R A;  4FJO A;  1TWG A;  5LYJ E;  3LJB A;  1H7C A;  2ZM0 A;  4WBO A;  2CGE A;  1QSD A;  4HTE A;  3Q2M A;  4YN0 B;  3ETU A;  4BJ5 A;  4CS9 A;  2X67 A;  2XXA B;  3AAI A;  3J9X 1;  3U78 A;  3ZPO A;  4UVC B;  2OG2 A;  4ANJ A;  4O4J E;  4IE5 A;  2G0U A;  4ZI7 E;  2FFH A;  3HTK C;  5LCY A;  3ZYL A;  4Z8X A;  5LP6 E;  1HS7 A;  2XL4 A;  2ZMA A;  4CSA A;  4YLH A;  2EHO B;  3O9X A;  4G0H A;  2NP9 A;  4ZS2 A;  2XHE B;  3WAK A;  4DBQ A;  3B0P A;  2KJG A;  4X1I E;  5LJN A;  2IOQ A;  5L3C B;  3N2K E;  3OKQ A;  5JR9 B;  1ZHW A;  2D0T A;  4HFF B;  4C3E A;  1X79 A;  3L3P A;  2ZM8 A;  2R7V A;  2FGY A;  4OYJ A;  1NZE A;  4ZI3 C;  2V7J A;  2XTL A;  3HKD E;  5JDQ A;  2LSE A;  3EFO A;  3OEO A;  2EIM C;  5L3Q A;  4CS8 C;  3K1H A;  2VWA A;  4X1Y E;  3J7Y q;  3Q5W A;  1AJ3 A;  3DAF A;  5KYU A;  3SZR A;  3B0V C;  2XAF B;  2VKD A;  3C4X A;  2NTX A;  4IAO A;  4O6Y A;  3B9Q A;  4AQF C;  3UMH A;  5DQZ A;  2WZG A;  3ZMZ B;  1HG2 A;  3Q5X A;  3RYF E;  3L09 A;  5M4Y A;  1ZHX A;  3GAN A;  3RKO A;  1J8M F;  5JRC A;  2XAQ B;  4CXY A;  5FNV E;  3LLK A;  4U5D E;  3MA9 A;  3NZQ A;  3F47 A;  3KDS E;  1VRB A;  2CW0 F;  3QZC A;  5KYW B;  4KUM B;  1VYI A;  2CA5 A;  3I9Y A;  2ODV A;  4CXW A;  1SHZ C;  2XRH A;  4U72 A;  3AG1 C;  5HSW A;  4EWC A;  5LXT E;  2VL8 A;  5T3T A;  3RH3 A;  2WWU A;  4MLK A;  2V7I A;  3NRX A;  5KYX A;  2I8B A;  1ST6 A;  3O1H A;  3C4W A;  4PJN A;  1O5H A;  2J9W A;  4I3M A;  3O4X E;  2LSI A;  3EDU A;  2KW3 C;  2HPL A;  2L9J A;  2XQY A;  2CE7 A;  2C5I T;  2UXX B;  2ACX A;  4JEH B;  3E9V A;  4N06 A;  4BJ6 C;  3LS1 A;  3DZA A;  4DVZ A;  2LE8 A;  1YKE B;  4U5E E;  5KYX B;  4GK5 E;  3UUM A;  2ZXO A;  3PHF 2;  5DVW A;  4TX5 A;  2G62 A;  4OD4 A;  2VK9 A;  3KV9 A;  3ETV A;  3AA1 B;  3L34 A;  2ZLY A;  2JMH A;  3EUH A;  2DGJ A;  3F46 A;  1WYB A;  3RX6 A;  5CA1 E;  5FY0 A;  2D2S A;  2XXA A;  3T6B A;  5KX5 E;  2K9A A;  2KGO A;  2B1E A;  5CI9 A;  5DQT A;  2J7P A;  2BZB A;  2V3C C;  4J30 B;  3EGX A;  4UVA B;  1UX4 A;  1LVK A;  4PJL A;  4X20 E;  5FXW A;  3HI2 A;  4ZLC A;  5LG4 A;  3L0I A;  1PD0 A;  4GIW A;  2Y48 B;  3EGX B;  4JUR I;  4P6I C;  3ANW B;  4ERR A;  4W8K A;  3PUR A;  2RP4 A;  1LVF A;  4ZI2 D;  5L3F B;  1N1C A;  3O1I A;  4P0B A;  5LBM A;  3LS0 A;  2Y3B A;  2WB7 A;  2KMF A;  1E1H B;  1IJ5 A;  2GFH A;  2X9Y A;  2PF4 E;  4YWQ A;  2R7W A;  5KYU B;  4EBB A;  3FDQ A;  2KLQ A;  4FES A;  3DMD A;  3ZMS B;  4QDL A;  2KIN B;  4I44 A;  3EFO B;  3RIP A;  4DOZ A;  4AKH A;  1ZHZ A;  2J45 A;  4H9S E;  3D0T A;  3ZLI A;  3VKG A;  3QK6 A;  3NYJ A;  1UX5 A;  4C90 A;  4MAL A;  4LAC B;  2SPC A;  4RD9 A;  3RRW A;  2DLR A;  5DAB A;  4OD5 A;  5FMN A;  5JR9 C;  4OHF A;  3LFM A;  3UR3 C;  2CDQ A;  1HFA A;  4CS7 A;  1OCR C;  1CUN A;  5FYM A;  5DS6 A;  3PE0 A;  4GYR A;  3IF8 B;  5EK3 A;  4YT8 A;  4EB6 E;  3UT5 E;  2D0U A;  5LHI B;  3DJN B;  5EK2 A;  2Y3D A;  3I5Q A;  3AB3 B;  3T4R A;  4IWB A;  3WAJ A;  4GOU A;  3TD7 A;  2PX0 A;  3JYH A;  3BQI A;  3HA4 A;  5BMV E;  4AXP A;  1FIO A;  3NRY A;  3X2Q C;  1MMA A;  4EAH A;  5E3A A;  3CQZ A;  5L3V A;  4AI6 A;  5FXV A;  1HG5 A;  2UXN B;  4EOZ B;  1W2W A;  2HV7 A;  2E8I A;  2LJL A;  5FY1 A;  5FCL A;  4C3D A;  2D5U A;  2Q3T A;  2W4M A;  4MQ9 F;  5CI8 A;  2A2F X;  4L9I A;  3OYX A;  4MFR A;  1SMY F;  1MMD A;  2Y8D A;  2X66 A;  1NAF A;  3FBL A;  2MOZ A;  2C0S A;  3FB2 A;  1JPJ A;  1OCO C;  3KV6 A;  1WR6 A;  2R7X A;  4U5F E;  2CXL A;  2NW8 A;  4H63 H;  2CM0 A;  2K5B B;  1PCX A;  3DM9 B;  5LNK A;  2E9X A;  3KH2 A;  4DND A;  4U5H A;  4ZS3 A;  3GWH A;  1UCU A;  2W00 A;  2CWO A;  2W4B A;  3HL6 A;  3LK2 B;  2VKO A;  5HXH A;  3ECS A;  4HE8 D;  4JJF A;  4M63 A;  2BVM A;  4LER A;  3LES A;  5KYY A;  1WLX A;  3S27 A;  2YU2 A;  3BQL A;  3AQC A;  3KL4 A;  2XSE A;  3AA0 B;  3UTK A;  2Q9Q D;  3ZJ1 A;  4QHO A;  2H7V C;  4BJN A;  2ZXW C;  3NYM A;  4O4L E;  3CX6 B;  2NW9 A;  3PUG A;  3NKD A;  3NKE A;  2LHR A;  3C64 A;  4AKR B;  2DWG A;  2B0J A;  2LSY A;  5KYY B;  2EIL C;  2IC9 A;  2HPJ A;  2QA7 A;  2JJ9 A;  4GYS A;  3M65 A;  4L5G A;  4I4T E;  1OXZ A;  4WBN E;  2CNW A;  3DAG A;  3CPZ A;  1HF8 A;  4H9Q C;  1MMN A;  4HFV A;  2X0L B;  2DCF A;  1D0Y A;  4UF0 A;  2X9H A;  4KBM B;  1ZU4 A;  2EIJ C;  4BJ5 C;  2LM9 A;  3Q6M A;  1G73 A;  4OFZ A;  4PAG A;  2KQ9 A;  4IGU A;  5L3G B;  2WVO A;  4CI1 B;  3H65 A;  4XLN F;  3NZP A;  4JUY A;  4XAX B;  5T3W A;  5TAO A;  2EIK C;  2K24 A;  2DYR C;  3SYN A;  2KXP B;  3SOL A;  2CXD A;  3CX7 B;  2CNW D;  2Q9Q C;  2IXM A;  3ZCJ A;  3F57 A;  4YJ2 E;  2YU1 A;  2V7K A;  4YFS A;  3POV A;  3PUA A;  3EH2 A;  3JC6 C;  3KBU A;  3Q6N A;  3I4U A;  5E2Q A;  3EVY A;  4IE7 A;  3CSK A;  3VHL A;  2Z15 A;  2R7U A;  5F5F A;  2YEV C;  4G2A A;  5GON E;  3MZK B;  1M2V B;  5LJM A;  4DBR A;  3ABM C;  2WL8 A;  3UMI A;  4UEL A;  2EHO A;  4ISS A;  2L3L A;  2NTY A;  4IDZ A;  1ZKE A;  5HXR A;  5KMG P;  2A6H F;  2H3R A;  2NG1 A;  3DP7 A;  2R7T A;  2R7O A;  4IE4 A;  4U74 A;  3OYZ A;  3N5L A;  1Z5Z A;  4AQF A;  2J9U A;  5JDN A;  3FAJ A;  3OBV E;  2JRK A;  4IE0 A;  4PFP A;  4XBF B;  5JDH A;  4H9N C;  1RJ9 A;  5B3S C;  2PJQ A;  5HXE A;  2H7O A;  2N1G A;  4O4H E;  1FFT C;  2HV6 A;  4Q7C A;  5JDF A;  3K3O A;  5LHH B;  3KVB A;  1Z3I X;  3N9N A;  3JCU Q;  4KBL A;  3MLG A;  3KV4 A;  3BK9 A;  2L81 A;  3K33 A;  3M1C B;  4BA9 A;  1TWH A;  5HYA A;  2YZS A;  2Z6E A;  5LBQ B;  4QX7 B;  3CZ6 A;  3LBX B;  5B1B C;  3WOD F;  4I43 B;  2C03 A;  3P8C D;  3T8O A;  3SNH A;  4DVY P;  4O2A E;  4TV9 E;  3ZN1 B;  4ZI3 D;  4O6M A;  2P6V A;  3V7O A;  4AE4 A;  3RYI E;  1QLE C;  1V55 C;  4K0D A;  4NUV A;  5EK4 A;  3R84 B;  4ZI2 C;  4AKI A;  4JW1 A;  3V5U A;  2LSJ A;  2WVN A;  3PTR B;  4F6R C;  3HKC E;  2A6E F;  4O2B E;  2CEA A;  1OKK D;  3KMI A;  5T1D B;  1ZEE A;  2Q9C A;  1MIW A;  4OIQ F;  1NWM X;  2P9B A;  2WVQ A;  4DMW A;  3NG1 A;  1MIY A;  3W8H A;  4CS9 C;  3MK7 C;  5JQG E;  4HEA J;  3EG9 A;  4CBE A;  1S35 A;  2A3D A;  1RJ9 B;  2LSK A;  3HKB E;  4CS8 A;  2N2N A;  1BR2 A;  3GN5 A;  4IJJ A;  2W62 A;  1OWA A;  2A72 A;  2MTQ A;  3AG3 C;  5CA0 E;  3KV5 A;  1IZM A;  3UFE A;  4JZA A;  1VMA A;  4YT5 A;  4CSA C;  5HXC A;  4KNV A;  4ASK A;  2E9X D;  2X68 A;  3KBT A;  3FXE B;  3RC8 A;  3K66 A;  3CML A;  4LLE A;  3ZCI A;  3T6J A;  3VAY A;  3KIN B;  4RDA A;  4JLE A;  3N9M A;  3AA7 B;  5L3E B;  3EQL F;  4PK6 A;  4F4B A;  2CLY B;  4H9P C;  2VKH A;  5CB4 E;  1ZHY A;  3FHD A;  3K7D A;  1SA0 E;  2OA5 A;  1M2V A;  1SZI A;  3LAY A;  2KND A;  4HEA A;  4ZLD A;  2RA1 A;  2E9X B;  3ZMT B;  2JD3 A;  2ZXP A;  3KKB A;  2L9Q A;  2LOP A;  2Q9Q A;  1O3X A;  3HR0 A;  1NG1 A;  4IRU A;  1Z6A A;  2WZF A;  4AQG A;  1M2O A;  3R6N A;  3EGD B;  3QMK A;  3S29 A;  4IE6 A;  4A2N B;  4JVS A;  4BG0 A;  2L8K A;  1WRD A;  3MJX A;  3NYL A;  4FWV A;  2Y3G A;  5KYW A;  1JPN A;  4ULW A;  4Q4Z F;  4QI2 A;  3ZSU A;  2JMK A;  3LJC A;  2E9X C;  1TWA A;  4PNI A;  3N2G E;  4IIJ E;  4MHC A;  4DMV A;  2JPF A;  2G3V A;  1TWC A;  4QWN B;  2IYL D;  4QI0 A;  1IJ6 A;  3HKE E;  3ANW A;  3C50 A;  3N9O A;  3N2Z B;  3O6X A;  2W0G A;  3WI3 A;  1HX8 A;  3PU3 A;  1OCC C;  3PMR A;  1EZ3 A;  1Y64 B;  3RC3 A;  4I1M A;  3MXZ A;  3LNR A;  2OCC C;  4O79 A;  1LRZ A;  2Y6X A;  3JC6 D;  2H7B A;  3U3I A;  4CZZ B;  5LGT B;  3LLI A;  4HFK B;  5EHH A;  2M4E A;  5J2U E;  4DO0 A;  4LLC A;  3UNG C;  4CI2 B;  4PFO A;  3E08 A;  4XZC A;  3AAA B;  5H6R B;  5E3C A;  5LHG B;  1M56 C;  3VU7 H;  4P09 A;  3SRZ A;  3Q7L A;  3F2E A;  2QY9 A;  4YT4 A;  4AKG A;  3IBP A;  2Q9Q B;  3AQB A;  2DNX A;  4NUU A;  2YIN A;  4G63 A;  2PFD A;  1BR1 A;  2D5R B;  4C3B A;  2XUE A;  3EH1 A;  4G7O F;  2IC6 A;  3UGO A;  2G3K A;  4G7H F;  2KZ7 B;  2IW5 B;  2EHO D;  3LEV A;  2LEH A;  1WYC A;  4JEU B;  4V1A v;  2A69 F;  1MNE A;  1T98 A;  1QUU A;  4IHJ E;  2Y69 C;  1IAP A;  5EZY E;  3ZC1 A;  4U5C E;  2X9W A;  4RBN A;  1D0X A;  5B1A C;  3W2W A;  2CMR A;  4QXB B;  2XAH B;  1OKK A;  1M57 C;  4WJ0 A;  3UMK A;  3DM5 A;  1BR0 A;  1PD1 A;  2W61 A;  3IHR A;  4UEM A;  3EG9 B;  3UUL A;  3K8P C;  2XAS B;  3BQK A;  2GK9 A;  2C5K T;  4KMC A;  4I50 E;  4E7S A;  1LS1 A;  3ONX A;  1ZYR F;  1G8X A;  2XAJ B;  2BE5 F;  2MWQ A;  2QTV A;  5ETW A;  3E0Z A;  3OJA A;  4E7Z A;  2R7Q A;  4UXN B;  5HWX A;  3ZVR A;  3S4U A;  4ILU A;  4O7G A;  4YT2 A;  1MMG A;  2LT3 A;  5JDM A;  5L3B B;  2IAK A;  2V7L A;  1SF8 A;  2ZPA A;  2WZL A;  3ITF A;  3I9W A;  5LA6 E;  2KT9 A;  3PDY A;  2WAU A;  4FI5 A;  5F5H A;  3HLZ A;  3ASO C;  3ZEF B;  5L3D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...