3IEEA

Crystal structure of an alpha helical protein (bf3319) from bacteroides fragilis nctc 9343 at 1.70 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
256
structure length
256
Chain Sequence
VSTADIENAAEVIKYYNTSLGVLKDMVKEKDVNAVLDYMEQKGKTPALSAIVPPAVVSKDSAIVLNPGNCFNEETRRNLKQNYTGLFQARTEFYANFDTYLSYLKKKDVTNAKKLLDVNYQLSTQMSEYKQNIFDILSPFTEQAELVLLVDNPLKAQIMSVRKMSSTMQSILNLYARKHRMDGPRIDLKVAELTKQLDAAKKLPVVNGHEGEMKSYQAFLSQVETFIKQVKKVREKGEYSDADYDMLTSAFETSII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative exported protein
publication title Crystal structure of hypothetical protein BF3319 from Bacteroides fragilis (YP_212931.1) from Bacteroides fragilis NCTC 9343 at 1.70 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
total genus 104
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ieeA02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ieeA01
3RH3A 4YJWA 3IEEA
chains in the Genus database with same CATH superfamily
3NZPA 3AXJB 2JQHA 2D4UA 5HXSA 2CA5A 2UXXB 2L6GA 4V1Av 2EPLX 2XS8A 2V7IA 5AQVB 3AEBA 4JTCB 3RIUC 3QB5A 3DAGA 2OA5A 4NTAA 3BK9A 2LCHA 2E9XB 4U7YA 3AQBA 1G5ZA 2KC3A 1FEWA 2OG2A 3EI0A 3ZTZA 4JV5T 2HPJA 1Q0DA 3N0TA 3AEEA 2CMRA 3EFOB 5HEGA 5KYYB 2LT3A 3N2KE 3NYJA 4O2AE 5T3WA 2IDOB 2XAHB 4HWDA 1I94T 2IHR1 1S05A 4Q7CA 1A0BA 3L8JA 2LHRA 4EEBA 3IQ5A 3K3NA 4A56A 1TWCA 3JT1A 3HKDE 5L3EB 2FBWA 2VKOA 2RSEB 3UU4A 5GPGB 3UMIA 2YU2A 2CBIA 5FP3A 3L3PA 3PUAA 2X0LB 2AP3A 4L9IA 1YZAA 2YKSA 3AGTA 5BQGA 1XNRT 1W0BA 4IAQA 1IBKT 1LKXA 5DVWA 5M4YA 4UIGA 2X51A 5JVDE 3V5ZA 3ANWA 3JZ0A 3CQZA 3CIRA 4ILBA 2P61A 3NKDA 2JQ9A 3LJCA 4X64T 3ASNC 4TWHA 4CXXA 3EDVA 3EGXA 3EAMA 2UXNB 2BG9B 3MFNA 5AQRB 2YLGA 3L8IA 4LMLA 2J0WA 2R7SA 3RVYA 3NYLA 2QGSA 4YL0A 4PJJA 2R7TA 4DR5T 2WZHA 2QNLA 2N2NA 2Y3DA 1G4WR 1LIHA 1Z0PA 3C8GB 1OKKD 2A0UA 2XLHA 4MW8A 3TJ5A 4NIQA 3GM3A 3NVOA 5IUXA 3RRCA 4JEHB 4G0HA 1JPJA 4L0RA 3RYLA 2XQAA 3CPZA 2Q9QB 3FBLA 2C5IT 1KFYA 1D1BA 2VURA 3ZSUA 3POVA 2GAQA 4BJ5A 4X66T 3AOUA 3IEEA 1YLMA 5ABFA 2PFDA 2GFHA 4LLCA 5AQKB 5AQPB 3WG7C 3HKKA 4MLKA 2NUPA 3LBXB 5F8PA 3W2VA 4K0DA 1KNPA 4MNDA 4XLPF 5FXZA 5AQHB 3CQCB 2QYWA 2YEVA 3VRCA 3TLWA 2KSRA 2J0XA 3ABLC 5A6AA 3EGDB 4GYRA 4HFKB 2AWYA 1E84A 3SXZA 1Y01A 2KZ7B 3RQEA 3AE7A 4JKVA 3CKDA 2WAUA 5F28E 2NP9A 4YSZA 5E33A 2XZEA 1ZHXA 5COGA 4DO0A 3X1DA 4PW8A 3FBZA 2YVKA 3FZFB 3SNHA 1M62A 2XAJB 1J1JA 4L6RA 3L09A 5HEOA 2NW7A 4ZEYA 2V6YA 2LE8A 2K3WA 5JR9B 2W63A 4PAGA 3QVZA 4YWQA 4TX5A 2Y6XA 1R5ID 3ZJ1A 2FAPB 5TAOA 2XL8A 2P0NA 1U4QA 2WWVA 3VYWA 4XWJA 4B6XA 1XDPA 4IWBA 3AAAB 3AE1A 5LBMA 3ZT7A 4JE9A 1U5PA 3OYZA 1B7TA 5LJMA 4CS8A 1Y6DA 3ZYKA 2XL4A 4EBKA 2XL6A 3FXHA 4DBRA 5KX5E 3DE8A 4GK5E 2UU9T 4O2BE 3O6XA 3N9PA 4CIHA 4JC7A 4B3MT 5AQOB 4FESA 3FB2A 3MKDA 5LB7B 1LI7A 4MBQA 1YAUO 4DIDB 1X79A 4CDYA 5D92A 4QH5A 2HPLA 3ZQYA 3TLVA 3NWIA 2WU2A 4UVBB 4KUMB 3N2OA 3LEVA 5GONE 3BRJA 2XAQB 2A2FX 4AIUA 1OCZC 3GEIA 4TNVA 3V5YA 2E9XD 2Y3BA 1XMQT 4WBNE 3U5SA 4O8SA 4KHPT 5JQGE 1FAPB 3C51A 4MTOA 4WJ0A 2WSSV 2ASRA 4FWVA 3AE6A 3B9QA 3KFWX 2VKJA 2ACXA 2QRXA 4JZAA 4F4BA 4QWNB 4B6IA 4K0KT 3RRWA 3UU8A 5JLIA 1J5ET 2YL0A 3JAEA 3N2ZB 3L0IA 1HS7A 2F22A 1EI7A 2DI3A 4JJGA 2MAWA 3Q7GA 3SXYA 3PJAA 4OINF 5HEHA 3IHRA 1TWAA 1I4YA 5A6BD 3WAJA 2R7UA 1VLTA 2ICWG 1TWGA 4A98A 4DBQA 2PP4A 1KNYA 3PE0A 3RQFA 2KINB 4YN0B 2GWWA 4ULVA 2EPKX 4DV0T 4JCZA 2MWQA 3A9CA 2DI4A 3M3ZB 4FJOA 4OIPF 3AE3A 4BJTA 2ZM2A 5ABEA 1IZMA 3KINB 2L6HA 3O39A 3UUMA 4MS2A 2QA7A 4NC3A 3B13A 5JVEA 2G3VA 4DR1T 4HFFB 3UU6A 3MZKB 2ZM0A 3QNUA 3FOOA 1X9BA 3C8GD 1W09A 4BJMA 4CS9A 2XY8B 2HKVA 4PACA 5FZTA 2MTQA 1CGOA 1IBMT 3K33A 3IHUA 3U2LA 5L4HA 3GWLA 2HV6A 3NG1A 2DYRC 4CI2B 1E2AA 3T1HT 1OXZA 2Q9QD 3LK2B 2KQ9A 3VRBA 1IBLT 4AL1A 2VVNA 4AQFC 2W45A 1W9RA 2LRKA 4UXNB 3R7CA 1H7IA 2WZIA 5FXVA 4X1YE 1MQVA 4KI0F 1D0YA 2LFDA 2D0TA 2KW3C 3N24A 2DLRA 1VYIA 4EWCA 3K1IA 1CPRA 2IXNA 2OJQA 1HCIA 1VCTA 3OYXA 2LIGA 4X0RA 4D4XA 1Z6AA 4YK5A 1OW6A 4OD5A 4IDZA 4NPPA 3CMLA 3KL4A 1SE7A 4IL4A 4QX7B 2IAKA 1VLSA 2XLEA 1VTMP 3JRMO 1M57C 4GYTA 2KWHA 1HG5A 3VRAA 1ORJA 3U8PA 1CPQA 3BQLA 4JYAT 4JJFA 1LVKA 4QH4A 4ASKA 2NW9A 4CDAA 2VK9A 2J62A 2BBJA 3T8OA 4ZI2C 4GIWA 3FAJA 3QW1A 3L1MA 4LLEA 3S84A 3ZYMA 2IUBA 4UV9B 2XASB 3N9LA 3DM5A 1J8YF 5ABGA 3H37A 5KXJA 5FL0A 3OBVE 3DP7A 4LMKA 2CWOA 2P7VA 2OU6A 4ILUA 4P9FA 4CZZB 4XPYA 4QXHB 5HAXA 3SFEA 3ZMZB 3T9OA 4A2NB 2K48A 3ZMUB 2K5BB 1YDIA 1HNWT 4BA9A 3V7OA 4X1KE 1GS9A 2VL0A 4COFA 1T6IA 4W8KA 3BQIA 1YYJA 2H7VC 5CGMA 4LFCT 1NU9C 3GANA 2R05A 2WB5A 3AGUA 3E9VA 4K7BA 3U9JA 2A72A 5E0OA 2EINC 1ZHYA 3CX7B 2B76A 1ZVZA 2C0SA 3JYYA 1JR8A 4U5FE 4AL0A 2J45A 5F5FA 2W4BA 1QQ3A 4J30B 4U2ZA 4JEUB 1U89A 3W2WA 4K1OA 3RIFA 3LFMA 3OTOT 4IGUA 3KBTA 3EH1A 2CWYA 1BR4A 4HEAJ 4U2YA 2JMHA 3CVRA 5AQNB 2BL2A 5AC4A 2BE5F 4DV5T 2ZM8A 3AECA 3VAYA 4KBLA 1SHZC 3SOLA 4IJJA 2FJEA 3ONJA 5LHHB 1V55C 3V5SA 2W67A 4MTGA 4R32A 3AA6B 4AQGA 5AFUL 1HMOA 1K04A 1ORYA 2PNOA 3FZKB 2HFIA 3EQLF 1Q0FA 3ONXA 4QH1A 2DWKA 2XM1A 5HXEA 3TOLA 5KYNA 4ANJA 1Q0MA 2J7PD 2IIUA 3P8CD 3EUHA 1OXBA 3UU3A 2LM2A 2UUAT 1KF6A 5E3CA 5LOVE 5JDGA 3N9NA 2NSFA 3UR3C 2IYLD 1LS4A 3TQOA 2I6HA 2E5LT 2VCAA 3NMIA 3EABA 3HJCA 2WP9A 3U78A 1WR0A 4JI6T 4AK9A 3DTOA 5JDQA 1JRAA 3DD7A 4AISA 2B0JA 2DCFA 3AEGA 2LSJA 4QHOA 2PX3A 4G7OF 3ETUA 4MQ9F 4O6NA 4JI4T 1T72A 4HN9A 4TWFA 3NYMA 1YXRA 4LF8T 3H65A 1V74B 3OEOA 3RQUA 5IHYA 4UVCB 2FJAA 4IAOA 3ITFA 3DXJF 1CGME 3TLUA 5J0ZA 3CK6A 4A97A 4JUYA 2CNWD 4EIYA 5JRCA 1FMWA 2E9XA 4ERRA 5HWXA 1OW8A 4O79A 3LS1A 2KSFA 5KYYA 4HWIB 4AQYT 3I5QA 4U5DE 3OA1A 3EG9B 1NG1A 3Q5DA 1E2XA 1RJ9B 2KT9A 3RGLA 1YJGA 5JRAA 2A6EF 4UF0B 3D0TA 4BJ5C 2VKHA 1NBBA 3C4XA 4EHPA 3ABMC 4WNKA 1J5WA 1Z23A 3H2VA 4ZS3A 1HX8A 3UQ7A 1Q0GA 1RXQA 2QE9A 3WAQA 4X5TA 3FMSA 3E0ZA 3EVYA 4ILAA 5A6BA 4HWFA 3LNRA 5DQWA 2XQ7A 3RYCE 2YEVC 2D5RB 1WFDA 4LF4T 3AE8A 1I6ZA 2L6FA 4JCHA 4KNVA 4WZXA 4PFOA 1ZU5A 2I8BA 5LXTE 3V5UA 1V9DA 2WDQA 3R2PA 2V5CA 2QLAA 4QI2A 5L3GB 5L0HA 2ZD9A 3LJBA 1T98A 2WDVA 3U3BA 3UT5E 1SR2A 4ZOLE 5AQLB 5CJ5A 3UFGA 5A6JA 3X2QC 3RC8A 2YU1A 4B3TT 4J7TA 3RLFF 3L8RA 4JBWF 3L34A 2W62A 4YT5A 2E8IA 2L9QA 2D9DA 5IWAT 1PD1A 2PG8A 2UUBT 3I0OA 3ZN0B 1BDJB 4M63A 3LK3B 1ZYRF 4CS8C 3RF1A 5LGTB 1NU7D 2EIJC 4P9TA 3ZDLA 4IT4A 4J7YA 4U3CA 4DV1T 2MPKA 2QVAA 4GK0E 2LFFA 2FJBA 3ZT6A 3OVUA 5LMUT 2XS1A 5LCYA 4N06A 3LBXA 1GQAA 1MNDA 2GK9A 3UFEA 3P4RA 2OV9A 3DM9B 2G0UA 5CB4E 5KYUA 3B29A 4AE4A 5DQZA 2YINA 4XQ1A 3KV4A 2NR4A 1KEYA 2OLTA 3S90A 3ZC4A 1N33T 1ZU4A 2R7QA 5L3DB 2VASA 4ZXLA 5JDFA 4LDKA 2W00A 2CCYA 4YJ3E 3ZKRA 4MALA 1KNRA 2BG9E 3RQWA 2LOSA 4BJ6A 2JQKA 2PFVA 5AQJB 4X62T 3S29A 1RKEB 3KMIA 2XQ9A 4HFDA 4HWHA 2VKDA 2UUCT 4NUUA 3AE9A 2XHEB 1T01A 4H9OC 4MVMA 2PBEA 1HX1B 2ZLYA 3G06A 4N78D 2J8WA 3TULA 2XQ8A 1OQCA 1EA8A 4LF6T 1QLEC 2KNDA 3J9X1 1XWJA 3PDYA 3AE4A 3R6NA 3JADA 2IXOA 3EHZA 1Y4CA 1IZNB 1XNQT 2DB4A 1T7SA 4EKWA 3AG2C 4YL1A 5LBQB 3ZJ2A 3H3MA 3EJNA 4ZLCA 4I4TE 2M6BA 1HE9A 2WM9A 2LRLA 3P7IA 5FVLA 2VQET 2CRBA 1C02A 4DVDA 3H2UA 4EOZB 3KVBA 1UK5A 3P4SA 5B3SC 2A9UA 4MTFA 3O1IA 3TOMA 1UGOA 2X9XA 3AEAA 4CI3B 3FXDB 3T1YT 1SF8A 3DJUB 4EEDA 5J2TE 4IRUA 3RHWA 5DS6A 3SXKA 3S28A 3OJAA 4YHJA 2Y69C 2LSGA 4N6HA 1T6UA 2HJMA 2V7KA 5KYWA 4J2CA 5H6QB 1JMWA 5F5WA 2LLYA 1E83A 4J32B 4XTKA 2V7MA 4CS9C 4CI1B 5LJNA 3RC3A 1QLBA 1QSDA 1DOWA 2Y48B 1A41A 4HFVA 2PBIA 1NFNA 3LEOA 4I44A 1LPEA 3RIAA 1ZW2A 4NQFA 5L3QA 2CCQA 2Q9AA 2VCCA 2BKOA 2PF4E 3ANWB 2ZXWC 4OIOF 5F5HA 1E7PA 3ZLIA 4JTAB 5DS5A 2YHSA 3PJAJ 1ZHCA 4HWCA 4FX5A 3ZG1A 3EGXB 2LQGA 3IBPA 4UEMA 4WW0A 4Z8XA 2ZXPA 4A5XA 2OKUA 2EILC 1DU2A 3PMRA 1YKEB 4HE8D 2Y3HA 3I9YA 2XAFB 3N9OA 3K1IC 5CI8A 2MBGA 3GORA 3KYIA 1K40A 4YFSA 3F47A 4YY3T 4MVRA 5FXXA 2M64A 3AE5A 1T5OA 3UULA 2X0YA 2J9WA 4MFRA 1WWPA 4NXMT 1DOVA 1YQ3A 1NFOA 1TFOB 2YOEA 5FVKA 4MVQA 4DUZT 1WYCA 3ESLA 3LUTB 4CSAC 4E7SA 4G7HF 4GKKT 4FAPB 3O1JA 2YLDA 5ABFB 1US7B 3FOPA 2XPKA 3AAIA 3PUQA 5COMA 3O10A 3KYJA 2Y39A 2LM9A 2NUPB 2QY9A 5JDHA 2V7LA 1A7EA 2D5UA 3KKBA 5KYXA 2UXBT 3FZLB 1NLXA 2LOPA 3E22E 2XM2A 4LFBT 3AAEB 5L0FA 1L0VA 2ODVA 4TWDA 4GQHA 3SWHA 3UTKA 3JSZA 2HN1A 4G78A 1QSPA 3NMJA 3IF8B 4OD4A 3PHF2 3M4CA 3NBXX 4ZI2D 1JOGA 3PUXF 3LDQB 2HSQA 1CUNA 3PUWF 4ZI3C 2YN6A 1XMOT 2V6YB 5EGYA 4AKRB 1OCOC 3K8PC 3PCVA 5HEUA 2UUHA 3LSVA 3RFYA 2NPUA 4HFHA 4H9PC 4JI5T 2C04A 3UMHA 4EZ4A 4LF5T 3SP1A 2EHOC 1UURA 2LSKA 4WBOA 4AKIA 5JDLA 3DJBA 4YT0A 4PR9A 4LF9T 3Q5EA 4UVAB 1W0AA 5KDMC 1CGNA 3EHMA 4LMJA 2BS3A 2EPMX 2WQYA 2FFHA 3UGPA 3E08A 5COFA 3SYNA 2LJLA 1LM3B 4NY3A 3T6GB 1PD0A 1OEDA 4IHJE 4U7IA 4XZCA 4HFCA 4P0AA 3IPMO 1OXKA 3A7MA 2W2UA 3K1SA 3GA8A 4QDLA 4C3BA 4F6RC 3MLGA 5H6RB 3UUNA 2X9WA 4C7OA 2OEXA 2TMVP 5LGUB 1EKYA 3SRZA 3HL6A 5L47A 4XPXA 4DR2T 2J9UA 4P1NA 4I1MA 4TUYE 4EB6E 3PV0F 3RYIE 3K3QC 1Z5ZA 3CQGB 2A6HF 2KWIB 3UQ4A 4CS7A 4H9QC 5DQTA 3K6BA 4XEFA 2YWAA 2YQYA 5BUOA 4U72A 1M2OA 1JPNA 3WAKA 2Q9CA 1ZHTA 3QB5K 5LMNT 3VM6A 1ZV4X 3AJMA 3ASOC 1JNZA 2NOXA 4HFBA 1U6HA 2P6VA 3RPUA 4JI1T 1UUSA 2BZBA 2J46A 4TN7B 1SZIA 4OIRF 5LHIB 3U3FA 4JI8T 4IDPA 2M4EA 3ZMTB 1GM5A 1E85A 5AQSB 2HUJA 3VR8A 3RVZA 2XAGB 4DV4T 2C03A 3F2EA 2DNXA 4I50E 4IE5A 4O4IE 3DWWA 4IDQA 4I1OB 2R7OA 2VH3A 5CI9A 5HXRA 3C7JA 3N5LA 3MYIA 4WYVA 3NRYA 2C5JA 5FCLA 2XXAB 3EZIA 4RBNA 1OEDE 1Y64B 3PUSA 3MA9A 2X0CA 4ZHQE 1OKKA 3S9OA 1HY5A 4G63A 5K0IA 4DJ9A 1IAPA 1UX5A 4YLHA 3CWZB 3CSKA 3FAPB 4HGAA 1NZEA 2XLWA 1ZOYA 3SFDA 5AGFA 3IQCA 5LNKA 2BS2A 2K9AA 4G2AA 4ER9A 2HSBA 5DQVA 4DRIB 2UXCT 2JRKA 2L7AA 3HNJA 2BKPA 4ULWA 2WMNA 4H63H 1WR6A 3QOFA 3VR9A 1BR1A 4U74A 4Z9HA 1ZZPA 4KX6A 4GOUA 4YT8A 2I0MA 1O3XA 2CYDA 5HV9A 4DRJB 1E86A 3ABVA 3PDMP 5AQMB 2CHNA 3DE9A 3JC6C 2F4VT 1MMGA 1NWMX 1F1MA 4EYUA 3RIPA 1O5HA 3VF0A 1J8MF 1BR2A 2P9BA 1O3UA 1S94A 1HMDA 5DJQC 3HKBE 3KPHA 2A0BA 3ATPA 2WZFA 3ZC0A 4CJGA 1SA0E 4NCQA 3N2GE 1Z63A 5DS4A 3ECSA 3C4ZA 4U5BE 5JP7A 4NTBA 4JI0T 2NUTA 5A6KA 1GGQA 1QZXA 2CGEA 2BVMA 3EG9A 4PFPA 3G4ZA 5BQHA 2X68A 3PUGA 1YD8G 2G62A 3Q5WA 4O4HE 3HKEE 3GN5A 1MIYA 4O4LE 3RKGA 3GODA 1IJ6A 4JEAA 4IB4A 3G4XA 4WABA 3K66A 4H54A 2X66A 2KK1A 4ZZCA 3AB3B 3N9QA 4H9NC 1M2VA 3FHDA 4Q25A 3B5MA 3NMKA 4X65T 3TLSA 2AXDS 5HEJA 4CN4A 2VVSA 4X20E 1L3PA 2HS5A 4KC9A 2UXDT 4PK6A 1HF8A 1NSGB 1CHUA 1YVIA 4LDQA 4IIJE 2W66A 4NTFA 3TD7A 3CZ6A 3LAYA 4XAXB 4DR3T 3W4YA 5FKYA 4XPWA 2J9VA 5L0DA 4U9EA 3NKZA 3C50A 3AXJA 2J1DG 2L81A 5LP6E 1IW7F 2L3LA 3B57A 5A1LA 4DMVA 3A5XA 2D0UA 4U31A 1WASA 3BQKA 4G7ZF 3PU8A 3KV9A 2YDSA 2WDRA 2QUPA 4DMWA 2RA1A 4O4JE 1H9GA 3ZT5A 3Q7LA 2HHHT 1FR0A 4YSXA 5B1BC 4W8PA 2HMZA 2LEHA 3ZPOA 5JT4A 4XEKA 4BEJA 4E7ZA 2EHOB 2LKHA 4PJLA 3EFOA 3A11A 4MW3A 4HFIA 2XJ7A 3MYFA 3ZSSA 3QK6A 2XQ6A 2R7XA 4PJMA 1QPUA 1FFHA 2HZ8A 1WTYA 4U5HA 2IOQA 1H9TA 1YZCA 3B0PA 4HEAA 3HKCE 1NAFA 3AA1B 2WB7A 1M7KA 3PUYF 3QVYA 1VYKA 2IW5B 3RYHE 4JW1A 2V3CC 4PNIA 5LG4A 1VB5A 3VKGA 1MIWA 3RH3A 5IY5C 5AQTB 3ZMVB 4NXNT 4CXWA 3ZC1A 4CX9A 3KH2A 4CQIA 2XQ5A 4AX2A 3LK42 4CJOA 5EHHA 3L39A 4IREA 3R84B 4EBBA 2YDRA 4ZLDA 3H3AA 5AQQB 3HI2A 5ETWA 3HA4A 1I5NA 5BQIA 5JDMA 1A7VA 2VCBA 1UCUA 4EGWA 3M4BA 2KJGA 4LDRA 4U5CE 2BG9A 2KLQA 4RD9A 4EAHA 1OR3A 2G3KA 3QTHA 5AC5A 4BPMA 2X67A 3VKHA 3GM2A 3K1HA 4ZS2A 4CIPA 4N6CA 2OEVA 3W15B 5L0GA 2W4MA 2NW8A 3Q2MA 3C8GA 4U33A 3AE2A 4BG0A 2R7VA 4C3DA 2LHNA 1G73A 4LERA 3TK0A 2W9YA 1ORSC 2B1EA 2R25A 3J06A 1QVXA 2AU5A 3Q9DA 2KGOA 2W61A 5HWYA 5EK4A 3AA0B 3HNLA 4UDVA 4TV9E 2Q9QA 2XTLA 2AWCA 4H9SE 5ABHA 3JCFA 5JRCB 3ZQVA 2ZXRA 3JRTA 5AQGB 3RI5A 1OWAA 2KYHA 4AI6A 1VOMA 2MOZA 4KMCA 4DVZA 4YHHT 1FNTc 2EPNA 5B3IA 4JVSA 2LSEA 3I4UA 1D1AA 3CX8B 1WN0A 1C03A 1XWMA 4DXWA 3MACA 3RYFE 2H7OA 2P1AA 4GKJT 3EGDA 2IC6A 3P4QA 2YK0A 2XSAA 4Z91A 4YXDA 4EBJA 3AEFA 3AQCA 2PJQA 3GWNA 2CW0F 2YLIA 4LACB 1VK5A 256BA 3TKLB 2BS4A 2O9XA 4MVZA 3ZCIA 3FHNA 4ILCA 3CEXA 2N1GA 4OHFA 4BAYB 2LP4A 1MIVA 2YL3A 4E0HA 2H89A 2V6XA 3MK7C 2YRFA 1C17M 1H7CA 5JR9A 3UU5A 5IYZE 3GM1A 4MHCA 3G50A 2Q4FA 1HG2A 2LSYA 3VHLA 5FMNA 2Y3GA 2WMOA 1VMAA 5FY7A 2XLVA 3FXEB 2H8AA 2Y8DA 2ZM6T 5EZYE 4GYSA 2YDQA 4F8HA 2BC5A 1TFKB 5BR8T 1EZ3A 3QMKA 1FTSA 3Q5XA 5AQFB 4DR6T 4E18A 2IBFA 2JD3A 4CXYA 2MHRA 1S35A 3UGOA 4P0BA 3CAXA 1D1CA 2ACZA 4JI2T 1JNRA 3RKOA 4XBFB 3I5PA 1XZYA 3I0QA 4ZI3D 2H88A 4AKGA 1MMAA 3S4UA 1N36T 3HLZA 3FZMB 4DV3T 1PV3A 3M15A 2ES0A 5FYMA 1OEDC 3EHNA 3F57A 1V54C 2XM0A 4IDOA 1XZPA 2FJDA 4AE4B 5KYUB 5L3CB 5CA0E 2QTVA 2JX0A 2M6IA 2EHOD 1HTJF 3LS0A 2XLMA 2EPOA 3MBGA 3GMIA 4AKHA 4PK4A 2JMKA 3A8YC 3KDSE 4WGYA 2RPAA 5LGNB 4CN1A 3SXMA 2AVKA 3NZQA 2CEAA 4HFEA 3GEEA 5BMVE 1R4TA 4HTEA 4EV6A 3HNKA 3S0XA 3UMKA 4EUKB 2WVOA 4OIQF 5JS5A 5FY0A 2J7PA 2GDCA 4MVOA 3C64A 2NSGA 3UUXB 2PTFA 3RIUA 2JPFA 5AQIB 2Q9BA 4JLEA 1HW2A 2WZLA 2WCAA 2HV7A 4JTDB 2X9YA 2X0HA 3IQTA 4JI3T 2XQ4A 4BJNA 3SEOA 1TKNA 2Q00A 4O7GA 1FMVA 3KVAA 4JRZA 4Z90A 4DRHB 1AJ3A 5FXWA 2DYSC 4DOZA 2E5VA 4JURI 3U2MA 3ZN1B 4KNWA 2E87A 1SMYF 3RQGA 2UUIA 2CHOA 4TNWA 1LE4A 4YTNA 3Q6MA 2RP4A 3EPVA 2L8KA 2JJ9A 3LESA 4Z9IA 2J4GA 3LLKA 1MMNA 4C3EA 2I15A 4MVSA 5CIVA 1TWHA 3NKEA 4OFZA 3ZVRA 3ZWIA 1XDOA 4L5GA 3US6A 2R03A 2HMQA 4OYKA 2VQFT 2XQ3A 2CNWA 1JAFA 2IXMA 2K24A 3JTLO 5EK2A 4IE6A 4B3RT 1RMVA 2W0GA 1QUUA 2BKNA 4AKLA 3C98B 2V1DB 4FI5A 1ZW3A 3T6BA 5L3VA 4DR4T 3ZTMA 2KMFA 4TZ4C 3C8ZA 2WVQA 3P50A 3SZRA 1R8IA 4PK5A 3JYHA 1O87A 1Z8UA 1K05A 5KYWB 1QKRA 3C4WA 1AVOB 2KNHA 4KHZF 4UR9A 2NTXA 2CDQA 1LS1A 5HXCA 3HTKC 4ONSA 1S7ZA 1YW0A 2R7RA 1NEKA 4I55E 3FDQA 2W4XA 3LNMB 1M6TA 3AG4C 3IQ6A 2N9DA 3FVYA 3U9MA 5JUAA 4E0IA 2CXLA 2OJED 2R6GF 3F46A 4CDVA 5T1DB 3W8HA 3FZHB 1YA7O 1YQ4A 3U0CA 1I4ZA 4KI2A 3ABKC 3DAFA 2CM0A 1XZQA 1SUMB 5J2UE 2WVNA 3M79A 4YL3A 4DNDA 3ZEFB 1IJ5A 2XSBA 1AUEA 3ZYLA 5L3BB 4D4NA 1B68A 2Z15A 2RD9A 3PUZF 3MJXA 2DWGA 2I59A 4I0UA 4IARA 4P6IC 3AA7B 4RDAA 4CBEA 4EZHA 5JDNA 4O6YA 2XXAA 2Q3TA 4DV2T 2H3RA 5CFBA 3PURA 1VRBA 4YJ2E 1WATA 4ISSA 1OCCC 3B71A 3DI5A 2CLYC 2Q7RA 4I43B 2JIWA 1RKCA 3JC6D 2LSIA 3I9WA 1SYQA 5L3FB 4U5EE 2VL8A 1WCRA 2CPTA 3UUBA 2V8SV 2XRHA 2J9BA 2ZPAA 5KYXB 2ETSA 5B1AC 5HSWA 5JREA 3WI3A 2XQYA 5C3JA 4AXPA 3EH2A 3HR0A 4KP3C 5EK0A 3AG1C 1N1CA 3AEDA 5KMGP 3B0UX 1N34T 2ODUA 3KV6A 3RX6A 1WYBA 3M65A 2R02A 2XLDA 1MMDA 4YSYA 4BEMJ 4BJ1A 3K3OA 5LYJE 4C90A 1HE1A 1T6QA 3ZMSB 2VC9A 5L2LA 1APCA 2OQMA 1G8XA 5C8YE 2NTYA 2X9HA 4A4AA 4H4KC 2HN2A 3U3IA 3MX3A 3T6JA 1WRDA 4IL9A 4UV8B 1M56C 4EXTA 1TR2A 1WOLA 3O55A 5L4EA 2E9XC 1LI5A 3V5XA 4ADZA 4CN6A 1HR0T 3CQXC 5EK3A 3AVSA 3PU3A 5HYAA 1UX4A 3M1CB 4K0UA 4NUVA 2M67A 4JIOA 1D0ZA 2CE7A 1ZHZA 2ZMAA 4YT2A 4QXCB 5AQUB 3QW0A 4CSAA 1OW7A 1A7DA 2ZXOA 1BBHA 3E70C 1ZEEA 3ZCJA 5HXHA 1HFAA 3AG3C 5L0IA 4LFAT 3X1OA 2XSEA 3RF3A 4MVUA 4ZI7E 4GEHA 2WS3A 1OEDB 2J47A 3P4PA 5E3AA 4JI7T 4ZZBA 5F3JA 3QZCA 4XLNF 4C7OB 3J7Yq 1G4US 3WODF 3JCUQ 3IA3A 3T4RA 3JAFA 3B0VC 2BDEA 1H6GA 4I3MA 2H7BA 2CXDA 5LA6E 1VCSA 4C91A 5CA1E 3C63A 4E17A 3C62A 3W8IA 2A3DA 2EIKC 1E1HB 2WY2A 2OCCC 2YL1A 3MXZA 1WLXA 5T3TA 1EQ1A 3NRHA 2WU5A 2BG9C 1LRZA 2A68F 5J1GA 4XEVA 3WHNA 3LLIA 3O1HA 1YARO 3EZHA 1KTMA 2CXFA 4IE7A 2DGJA 5FNVE 2C5KT 1HW1A 1D0XA 3QUJA 4IE0A 2V5DA 2R7WA 1FIOA 5L0JA 4DV6T 4DV7T 2MYSA 2KXPB 2EHOA 1BR0A 3KV5A 1LE2A 2BVLA 2PX0A 1HNZT 3DJNB 2Q9QC 5C2TA 5JH7E 2V26A 1RJ9A 3C18A 3Q6NA 3LG7A 3ZIBA 3GWHA 5FY1A 2JPUA 4IGGA 4UF0A 3BEHA 3EDUA 4YTPA 1L7CA 3RKOF 5DLJA 2WZGA 1U0BB 4UELA 3PUVF 4HE8A 3OWTA 4Z9JA 2BBHA 3TJ6A 4X1IE 5TJ5E 3P4WA 4DR7T 1OCRC 4HKAA 1T8BA 2AE9A 5E2QA 1FJGT 2GA0A 1YA9A 1WGWA 4H63V 3AVRA 1HNXT 5JTGA 3VU7H 2WWUA 4OX9T 2LK4A 4AQFA 2XLOA 2WL8A 4DUYT 5HCJA 1KU2A 3ONLC 2VB6A 2FUPA 3CX6B 4EIWA 3QC9A 4IE4A 2A69F 4LF7T 4JEBA 3RW0A 3PTRB 3S27A 2DHRA 5ADXL 4QX8B 5FL1A 4IDNA 1AEPA 2D2SA 1KK7A 1OR2A 4QKNA 4BJ6C 1UFBA 1GQEA 3N9MA 4B3ST 5D91A 2V7JA 4M1PA 1UG7A 2CBJA 2LD6A 4OYJA 2NG1A 3SS1A 2HJ3A 5JR9C 4OK0A 4YTMA 1N32T 3JSEO 4QI0A 2YKZA 4WGZA 2LKGA 1BZ4A 2E2AA 2IMLA 4U5GA 3DMDA 5DABA 1YYXA 2NWBA 3ZSTA 3UNGC 4DVYP 4O6MA 2SPCA 1LVFA 3DKAA 5L0CA 1PCXA 2VWAA 1Q0KA 2B0HA 1RCPA 2DL1A 5LG3A 2XUEA 2FGYA 3OPCA 4PJNA 4YJWA 4EYYR 2XM4A 2A1DD 4YT4A 2IM8A 4QXBB 2Z6EA 1Z7Qc 4H9RC 2OOCA 1YKHB 3K7DA 2JQQA 3GEHA 2NUTB 2CLYB 3I1AA 3NRXA 2R9RB 2HH7A 1ZKEA 4ISTA 3GN5B 1MNEA 4TV8E 4P09A 5HCMA 1TQGA 5A69A 3NDBB 1NENA 2L9JA 5JSLA 3KBUA 1V4AA 2WBLA 1M2VB 3O9XA 4N4WA 3TLTA 3F31A 3O4XE 1KNZA 1ZHWA 2EIMC 2YL7A 1T9KA 3OKQA 1Z3IX 1FFTC 5LHGB 2IXPA 3DZAA 1RKEA 1ZP0A 3ETVA 3U8VA 3HNIA 1ST6A 4U9DA 2IC9A 4Q4ZF 4Q5SF 1W2WA 2YZSA 4KBMB
chains in the Genus database with same CATH topology
3NZPA 5HXSA 2CA5A 2UXXB 4V1Av 2V7IA 3DAGA 2OA5A 3BK9A 2E9XB 3AQBA 1FEWA 2OG2A 2HPJA 3N0TA 2CMRA 3EFOB 5KYYB 2LT3A 3N2KE 3NYJA 4O2AE 5T3WA 2XAHB 4Q7CA 2LHRA 3K3NA 4A56A 1TWCA 3JT1A 3HKDE 5L3EB 2VKOA 3UMIA 2YU2A 5FP3A 3L3PA 3PUAA 2X0LB 4L9IA 1LKXA 5DVWA 5M4YA 4UIGA 2X51A 5JVDE 3ANWA 3CQZA 3NKDA 3LJCA 3ASNC 4CXXA 3EDVA 3EGXA 2UXNB 2J0WA 2R7SA 3NYLA 2QGSA 2R7TA 4PJJA 2N2NA 2Y3DA 1Z0PA 1OKKD 3RRCA 4JEHB 4G0HA 1JPJA 4L0RA 3RYLA 3CPZA 2Q9QB 3FBLA 2C5IT 1D1BA 3ZSUA 3POVA 4BJ5A 3IEEA 2PFDA 2GFHA 4LLCA 3WG7C 4MLKA 2NUPA 3LBXB 5F8PA 3W2VA 4K0DA 4MNDA 4XLPF 5FXZA 3CQCB 2YEVA 2J0XA 3ABLC 3EGDB 4GYRA 4HFKB 2KZ7B 3CKDA 2WAUA 2NP9A 5E33A 1ZHXA 4DO0A 4PW8A 3FBZA 3SNHA 2XAJB 3L09A 2NW7A 2LE8A 5JR9B 2W63A 4PAGA 4YWQA 4TX5A 2Y6XA 3ZJ1A 5TAOA 1U4QA 3VYWA 4XWJA 4B6XA 4IWBA 3AAAB 5LBMA 1U5PA 3OYZA 1B7TA 5LJMA 4CS8A 3ZYKA 2XL4A 4DBRA 5KX5E 4GK5E 4O2BE 3O6XA 3N9PA 4CIHA 4FESA 3FB2A 3MKDA 4MBQA 1X79A 5D92A 2HPLA 4UVBB 4KUMB 3N2OA 3LEVA 5GONE 2XAQB 2A2FX 1OCZC 2E9XD 2Y3BA 4WBNE 4O8SA 5JQGE 3C51A 4WJ0A 2WSSV 4FWVA 3B9QA 3KFWX 2VKJA 2ACXA 4JZAA 4F4BA 4QWNB 4B6IA 3RRWA 3N2ZB 3L0IA 1HS7A 4JJGA 3Q7GA 4OINF 3IHRA 1TWAA 3WAJA 2R7UA 1TWGA 4DBQA 2PP4A 3PE0A 2KINB 4YN0B 2MWQA 2DI4A 4FJOA 4OIPF 4BJTA 2ZM2A 1IZMA 3O39A 3KINB 3UUMA 2QA7A 3B13A 2G3VA 4HFFB 3MZKB 2ZM0A 4BJMA 4CS9A 2MTQA 3K33A 2HV6A 3NG1A 2DYRC 4CI2B 1OXZA 2Q9QD 3LK2B 2KQ9A 4AQFC 2W45A 4UXNB 5FXVA 4X1YE 1D0YA 2D0TA 2KW3C 3N24A 2DLRA 1VYIA 4EWCA 2IXNA 1HCIA 3OYXA 4X0RA 1Z6AA 4OD5A 4IDZA 3CMLA 3KL4A 4QX7B 2IAKA 1M57C 4GYTA 2KWHA 1HG5A 3BQLA 4JJFA 1LVKA 4ASKA 2NW9A 2VK9A 3T8OA 4ZI2C 4GIWA 3FAJA 4LLEA 3ZYMA 4UV9B 2XASB 3N9LA 3DM5A 1J8YF 3H37A 3OBVE 3DP7A 2CWOA 2P7VA 4ILUA 4CZZB 4QXHB 5HAXA 3ZMZB 4A2NB 2K48A 3ZMUB 2K5BB 4BA9A 3V7OA 4X1KE 4W8KA 3BQIA 2H7VC 1NU9C 3GANA 3E9VA 4K7BA 2A72A 5E0OA 2EINC 1ZHYA 3CX7B 2C0SA 4U5FE 2J45A 5F5FA 2W4BA 4J30B 4JEUB 3W2WA 3LFMA 4IGUA 3KBTA 3EH1A 2CWYA 1BR4A 4HEAJ 2JMHA 3CVRA 2BE5F 2ZM8A 3VAYA 4KBLA 1SHZC 3SOLA 4IJJA 5LHHB 1V55C 3V5SA 3AA6B 4AQGA 5AFUL 3EQLF 3ONXA 2DWKA 5HXEA 5KYNA 4ANJA 2J7PD 3P8CD 3EUHA 5E3CA 5LOVE 5JDGA 3N9NA 3UR3C 2IYLD 3HJCA 3U78A 4AK9A 3DTOA 5JDQA 3DD7A 2B0JA 2DCFA 2LSJA 4QHOA 2PX3A 4G7OF 3ETUA 4MQ9F 4O6NA 4HN9A 3NYMA 3H65A 3OEOA 5IHYA 4UVCB 4IAOA 3ITFA 3DXJF 4JUYA 2CNWD 5JRCA 1FMWA 2E9XA 4ERRA 5HWXA 4O79A 3LS1A 5KYYA 3I5QA 4U5DE 3OA1A 3EG9B 1NG1A 1RJ9B 2KT9A 2A6EF 4UF0B 3D0TA 4BJ5C 2VKHA 3C4XA 3ABMC 4WNKA 1Z23A 4ZS3A 1HX8A 3E0ZA 3EVYA 3LNRA 5DQWA 3RYCE 2YEVC 2D5RB 4JCHA 4KNVA 4PFOA 1ZU5A 2I8BA 5LXTE 3V5UA 1V9DA 4QI2A 5L3GB 3LJBA 1T98A 3UT5E 4ZOLE 3X2QC 3RC8A 2YU1A 3L34A 2W62A 4YT5A 2E8IA 2L9QA 1PD1A 2PG8A 3I0OA 3ZN0B 4M63A 3LK3B 1ZYRF 4CS8C 5LGTB 1NU7D 2EIJC 4GK0E 5LCYA 4N06A 3LBXA 1MNDA 2GK9A 3UFEA 3DM9B 2G0UA 5CB4E 5KYUA 4AE4A 5DQZA 2YINA 3KV4A 3ZC4A 1ZU4A 2R7QA 5L3DB 2VASA 5JDFA 2W00A 4YJ3E 4MALA 2LOSA 4BJ6A 2PFVA 3S29A 3KMIA 2VKDA 4NUUA 2XHEB 4H9OC 2ZLYA 4N78D 1QLEC 2KNDA 3J9X1 3PDYA 3R6NA 2IXOA 1IZNB 3AG2C 5LBQB 3ZJ2A 3EJNA 4ZLCA 4I4TE 2WM9A 3P7IA 4DVDA 3KVBA 4EOZB 5B3SC 3O1IA 2X9XA 4CI3B 3FXDB 1SF8A 3DJUB 5J2TE 4IRUA 5DS6A 3S28A 3OJAA 4YHJA 2Y69C 2LSGA 2V7KA 5KYWA 4J2CA 5H6QB 4J32B 4XTKA 2V7MA 4CS9C 4CI1B 5LJNA 3RC3A 1QSDA 2Y48B 4HFVA 2PBIA 4I44A 5L3QA 2CCQA 2Q9AA 2PF4E 3ANWB 2ZXWC 4OIOF 5F5HA 3ZLIA 5DS5A 2YHSA 1ZHCA 4FX5A 3ZG1A 3EGXB 3IBPA 4UEMA 4WW0A 4Z8XA 2ZXPA 2EILC 3PMRA 1YKEB 4HE8D 2Y3HA 3I9YA 2XAFB 3N9OA 3K1IC 5CI8A 2MBGA 4YFSA 3F47A 5FXXA 3UULA 2J9WA 4MFRA 1WYCA 3ESLA 4CSAC 4E7SA 4G7HF 3O1JA 1US7B 3AAIA 3PUQA 2Y39A 2LM9A 2NUPB 2QY9A 5JDHA 2V7LA 2D5UA 3KKBA 5KYXA 2LOPA 3E22E 3AAEB 2ODVA 3SWHA 3UTKA 3JSZA 3IF8B 4OD4A 3PHF2 3NBXX 4ZI2D 1CUNA 4ZI3C 5EGYA 4AKRB 1OCOC 3K8PC 3RFYA 4H9PC 2C04A 3UMHA 4EZ4A 3SP1A 2EHOC 2LSKA 4WBOA 4AKIA 5JDLA 3DJBA 4UVAB 5KDMC 3EHMA 2FFHA 3UGPA 3E08A 3SYNA 2LJLA 4NY3A 1PD0A 4IHJE 4XZCA 4P0AA 3GA8A 4QDLA 4C3BA 4F6RC 3MLGA 5H6RB 3UUNA 2X9WA 4C7OA 5LGUB 3SRZA 3HL6A 2J9UA 4I1MA 4TUYE 4EB6E 3RYIE 3K3QC 1Z5ZA 3CQGB 2A6HF 2KWIB 4CS7A 4H9QC 5DQTA 3K6BA 5BUOA 4U72A 1M2OA 1JPNA 3WAKA 2Q9CA 1ZHTA 1ZV4X 3ASOC 2NOXA 2P6VA 3RPUA 2BZBA 2J46A 4TN7B 1SZIA 4OIRF 5LHIB 2M4EA 3ZMTB 2XAGB 2C03A 3F2EA 2DNXA 4I50E 4IE5A 4O4IE 4I1OB 2R7OA 2VH3A 5CI9A 5HXRA 3N5LA 3NRYA 2C5JA 5FCLA 2XXAB 3EZIA 4RBNA 1Y64B 3PUSA 3MA9A 4ZHQE 1OKKA 4G63A 1IAPA 1UX5A 4YLHA 3CWZB 3CSKA 4HGAA 1NZEA 5LNKA 2K9AA 4G2AA 5DQVA 2JRKA 4ULWA 2WMNA 4H63H 1WR6A 1BR1A 4U74A 4GOUA 4YT8A 1O3XA 3JC6C 1MMGA 1NWMX 4EYUA 3RIPA 1O5HA 1J8MF 1BR2A 2P9BA 1S94A 5DJQC 3HKBE 2WZFA 3ZC0A 1SA0E 3N2GE 1Z63A 5DS4A 3ECSA 3C4ZA 4U5BE 2NUTA 1QZXA 3EG9A 2CGEA 2BVMA 4PFPA 2X68A 3PUGA 1YD8G 2G62A 3Q5WA 4O4HE 3HKEE 3GN5A 1MIYA 4O4LE 3GODA 1IJ6A 3K66A 2X66A 3AB3B 3N9QA 4H9NC 1M2VA 3FHDA 4X20E 4KC9A 4PK6A 1HF8A 4IIJE 3TD7A 3CZ6A 3LAYA 4XAXB 2J9VA 3C50A 2J1DG 2L81A 5LP6E 1IW7F 2L3LA 3B57A 5A1LA 4DMVA 3A5XA 2D0UA 3BQKA 4G7ZF 3PU8A 3KV9A 4DMWA 2RA1A 4O4JE 3Q7LA 5B1BC 2LEHA 3ZPOA 4BEJA 4E7ZA 2EHOB 4PJLA 3EFOA 3QK6A 2R7XA 4PJMA 1FFHA 4U5HA 2IOQA 3B0PA 4HEAA 3HKCE 1NAFA 3AA1B 2WB7A 1VYKA 2IW5B 3RYHE 4JW1A 2V3CC 4PNIA 5LG4A 3VKGA 1MIWA 3RH3A 5IY5C 3ZMVB 4CXWA 3ZC1A 3KH2A 4CQIA 4AX2A 3LK42 5EHHA 3R84B 4EBBA 4ZLDA 3H3AA 3HI2A 5ETWA 3HA4A 5JDMA 1UCUA 2KJGA 4U5CE 2KLQA 4RD9A 4EAHA 2G3KA 2X67A 3VKHA 3K1HA 4ZS2A 3W15B 2W4MA 2NW8A 3Q2MA 4BG0A 2R7VA 4C3DA 2LHNA 1G73A 4LERA 2W9YA 2B1EA 3Q9DA 2KGOA 2W61A 5HWYA 5EK4A 3AA0B 4TV9E 2Q9QA 2XTLA 4H9SE 5JRCB 2ZXRA 3JRTA 1OWAA 4AI6A 1VOMA 2MOZA 4KMCA 4DVZA 4JVSA 2LSEA 3I4UA 1D1AA 3CX8B 3MACA 3RYFE 2H7OA 3EGDA 2IC6A 2YK0A 3AQCA 2PJQA 2CW0F 4LACB 1VK5A 3TKLB 2O9XA 3ZCIA 3FHNA 2N1GA 4OHFA 4BAYB 1MIVA 3MK7C 1H7CA 5JR9A 5IYZE 4MHCA 1HG2A 2LSYA 3VHLA 5FMNA 2Y3GA 2WMOA 1VMAA 5FY7A 3FXEB 2Y8DA 5EZYE 4GYSA 1EZ3A 3QMKA 1FTSA 3Q5XA 2JD3A 4CXYA 1S35A 3UGOA 4P0BA 1D1CA 3RKOA 4XBFB 3I5PA 3I0QA 4ZI3D 4AKGA 1MMAA 3S4UA 3HLZA 2ES0A 5FYMA 3EHNA 3F57A 1V54C 5KYUB 4AE4B 5L3CB 2QTVA 5CA0E 2EHOD 1HTJF 3LS0A 3GMIA 4AKHA 4PK4A 2JMKA 3KDSE 5LGNB 3NZQA 2CEAA 5BMVE 4HTEA 3S0XA 3UMKA 2WVOA 4OIQF 5FY0A 2J7PA 3C64A 3UUXB 2JPFA 2Q9BA 4JLEA 2WZLA 2HV7A 2X9YA 4BJNA 3SEOA 1TKNA 4O7GA 1FMVA 3KVAA 1AJ3A 5FXWA 2DYSC 4DOZA 4JURI 3ZN1B 4KNWA 2E87A 1SMYF 3Q6MA 2RP4A 3EPVA 2L8KA 2JJ9A 3LESA 3LLKA 1MMNA 4C3EA 1TWHA 3NKEA 4OFZA 3ZVRA 4L5GA 4OYKA 2CNWA 2IXMA 2K24A 5EK2A 4IE6A 2W0GA 1QUUA 4AKLA 3C98B 2V1DB 4FI5A 5L3VA 3T6BA 2KMFA 4TZ4C 2WVQA 3SZRA 4PK5A 3JYHA 1O87A 5KYWB 3C4WA 2KNHA 2NTXA 2CDQA 1LS1A 5HXCA 3HTKC 1S7ZA 1YW0A 2R7RA 4I55E 3FDQA 3AG4C 2N9DA 3FVYA 2CXLA 3F46A 5T1DB 3W8HA 4KI2A 3ABKC 3DAFA 2CM0A 5J2UE 2WVNA 4DNDA 3ZEFB 1IJ5A 3ZYLA 5L3BB 2Z15A 3MJXA 2DWGA 2I59A 4P6IC 3AA7B 4RDAA 4CBEA 4EZHA 5JDNA 4O6YA 2XXAA 2Q3TA 2H3RA 3PURA 1VRBA 4YJ2E 4ISSA 1OCCC 2CLYC 4I43B 3JC6D 2LSIA 3I9WA 5L3FB 4U5EE 2VL8A 2XRHA 2ZPAA 5KYXB 5B1AC 5HSWA 3WI3A 5JREA 2XQYA 4AXPA 3EH2A 3HR0A 4KP3C 3AG1C 1N1CA 5KMGP 3B0UX 2ODUA 3KV6A 3RX6A 1WYBA 3M65A 1MMDA 4BJ1A 3K3OA 5LYJE 4C90A 3ZMSB 5L2LA 1G8XA 5C8YE 2NTYA 2X9HA 4H4KC 3U3IA 3MX3A 3T6JA 1WRDA 4UV8B 1M56C 4EXTA 1TR2A 2E9XC 4ADZA 3CQXC 5EK3A 3AVSA 3PU3A 5HYAA 1UX4A 3M1CB 4K0UA 4NUVA 2M67A 1D0ZA 2CE7A 1ZHZA 2ZMAA 4YT2A 4QXCB 4CSAA 3E70C 2ZXOA 1ZEEA 3ZCJA 5HXHA 1HFAA 3AG3C 3X1OA 2XSEA 4ZI7E 4GEHA 5E3AA 5F3JA 3QZCA 4XLNF 4C7OB 3J7Yq 3WODF 3JCUQ 3T4RA 3B0VC 2BDEA 4I3MA 2H7BA 2CXDA 5LA6E 4C91A 5CA1E 3W8IA 2A3DA 2EIKC 1E1HB 2OCCC 3MXZA 1WLXA 5T3TA 3NRHA 1LRZA 2A68F 5J1GA 3LLIA 3O1HA 3EZHA 2CXFA 4IE7A 2DGJA 5FNVE 2C5KT 1D0XA 3QUJA 4IE0A 2R7WA 1FIOA 2MYSA 2KXPB 2EHOA 1BR0A 3KV5A 2BVLA 2PX0A 3DJNB 2Q9QC 5JH7E 1RJ9A 2V26A 3Q6NA 3LG7A 3ZIBA 3GWHA 5FY1A 4UF0A 3EDUA 3RKOF 5DLJA 2WZGA 4UELA 4HE8A 3OWTA 4X1IE 1OCRC 4HKAA 5E2QA 1WGWA 4H63V 3AVRA 3VU7H 2WWUA 4AQFA 2WL8A 1KU2A 2VB6A 3CX6B 4EIWA 3QC9A 4IE4A 2A69F 3PTRB 3S27A 2DHRA 5ADXL 4QX8B 2D2SA 1KK7A 4QKNA 4BJ6C 3N9MA 5D91A 2V7JA 4M1PA 4OYJA 2NG1A 3SS1A 5JR9C 4OK0A 4QI0A 4U5GA 3DMDA 5DABA 3UNGC 2NWBA 4DVYP 4O6MA 2SPCA 1LVFA 1PCXA 2VWAA 2XUEA 2FGYA 4PJNA 4YJWA 4EYYR 2A1DD 4YT4A 4QXBB 2Z6EA 4H9RC 1YKHB 3K7DA 2JQQA 2NUTB 2CLYB 3I1AA 3NRXA 2HH7A 1ZKEA 4ISTA 3GN5B 1MNEA 4TV8E 4P09A 3NDBB 2L9JA 3KBUA 2WBLA 1M2VB 3O9XA 3F31A 3O4XE 1KNZA 1ZHWA 2EIMC 3OKQA 1Z3IX 1FFTC 5LHGB 2IXPA 3DZAA 3ETVA 1ST6A 2IC9A 4Q4ZF 4Q5SF 1W2WA 2YZSA 4KBMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH3 A;  4YJW A;  3IEE A; 
#chains in the Genus database with same CATH topology
 3NZP A;  3AXJ B;  2JQH A;  2D4U A;  5HXS A;  2CA5 A;  2UXX B;  2L6G A;  4V1A v;  2EPL X;  2XS8 A;  2V7I A;  5AQV B;  3AEB A;  4JTC B;  3RIU C;  3QB5 A;  3DAG A;  2OA5 A;  4NTA A;  3BK9 A;  2LCH A;  2E9X B;  4U7Y A;  3AQB A;  1G5Z A;  2KC3 A;  1FEW A;  2OG2 A;  3EI0 A;  3ZTZ A;  4JV5 T;  2HPJ A;  1Q0D A;  3N0T A;  3AEE A;  2CMR A;  3EFO B;  5HEG A;  5KYY B;  2LT3 A;  3N2K E;  3NYJ A;  4O2A E;  5T3W A;  2IDO B;  2XAH B;  4HWD A;  1I94 T;  2IHR 1;  1S05 A;  4Q7C A;  1A0B A;  3L8J A;  2LHR A;  4EEB A;  3IQ5 A;  3K3N A;  4A56 A;  1TWC A;  3JT1 A;  3HKD E;  5L3E B;  2FBW A;  2VKO A;  2RSE B;  3UU4 A;  5GPG B;  3UMI A;  2YU2 A;  2CBI A;  5FP3 A;  3L3P A;  3PUA A;  2X0L B;  2AP3 A;  4L9I A;  1YZA A;  2YKS A;  3AGT A;  5BQG A;  1XNR T;  1W0B A;  4IAQ A;  1IBK T;  1LKX A;  5DVW A;  5M4Y A;  4UIG A;  2X51 A;  5JVD E;  3V5Z A;  3ANW A;  3JZ0 A;  3CQZ A;  3CIR A;  4ILB A;  2P61 A;  3NKD A;  2JQ9 A;  3LJC A;  4X64 T;  3ASN C;  4TWH A;  4CXX A;  3EDV A;  3EGX A;  3EAM A;  2UXN B;  2BG9 B;  3MFN A;  5AQR B;  2YLG A;  3L8I A;  4LML A;  2J0W A;  2R7S A;  3RVY A;  3NYL A;  2QGS A;  4YL0 A;  4PJJ A;  2R7T A;  4DR5 T;  2WZH A;  2QNL A;  2N2N A;  2Y3D A;  1G4W R;  1LIH A;  1Z0P A;  3C8G B;  1OKK D;  2A0U A;  2XLH A;  4MW8 A;  3TJ5 A;  4NIQ A;  3GM3 A;  3NVO A;  5IUX A;  3RRC A;  4JEH B;  4G0H A;  1JPJ A;  4L0R A;  3RYL A;  2XQA A;  3CPZ A;  2Q9Q B;  3FBL A;  2C5I T;  1KFY A;  1D1B A;  2VUR A;  3ZSU A;  3POV A;  2GAQ A;  4BJ5 A;  4X66 T;  3AOU A;  3IEE A;  1YLM A;  5ABF A;  2PFD A;  2GFH A;  4LLC A;  5AQK B;  5AQP B;  3WG7 C;  3HKK A;  4MLK A;  2NUP A;  3LBX B;  5F8P A;  3W2V A;  4K0D A;  1KNP A;  4MND A;  4XLP F;  5FXZ A;  5AQH B;  3CQC B;  2QYW A;  2YEV A;  3VRC A;  3TLW A;  2KSR A;  2J0X A;  3ABL C;  5A6A A;  3EGD B;  4GYR A;  4HFK B;  2AWY A;  1E84 A;  3SXZ A;  1Y01 A;  2KZ7 B;  3RQE A;  3AE7 A;  4JKV A;  3CKD A;  2WAU A;  5F28 E;  2NP9 A;  4YSZ A;  5E33 A;  2XZE A;  1ZHX A;  5COG A;  4DO0 A;  3X1D A;  4PW8 A;  3FBZ A;  2YVK A;  3FZF B;  3SNH A;  1M62 A;  2XAJ B;  1J1J A;  4L6R A;  3L09 A;  5HEO A;  2NW7 A;  4ZEY A;  2V6Y A;  2LE8 A;  2K3W A;  5JR9 B;  2W63 A;  4PAG A;  3QVZ A;  4YWQ A;  4TX5 A;  2Y6X A;  1R5I D;  3ZJ1 A;  2FAP B;  5TAO A;  2XL8 A;  2P0N A;  1U4Q A;  2WWV A;  3VYW A;  4XWJ A;  4B6X A;  1XDP A;  4IWB A;  3AAA B;  3AE1 A;  5LBM A;  3ZT7 A;  4JE9 A;  1U5P A;  3OYZ A;  1B7T A;  5LJM A;  4CS8 A;  1Y6D A;  3ZYK A;  2XL4 A;  4EBK A;  2XL6 A;  3FXH A;  4DBR A;  5KX5 E;  3DE8 A;  4GK5 E;  2UU9 T;  4O2B E;  3O6X A;  3N9P A;  4CIH A;  4JC7 A;  4B3M T;  5AQO B;  4FES A;  3FB2 A;  3MKD A;  5LB7 B;  1LI7 A;  4MBQ A;  1YAU O;  4DID B;  1X79 A;  4CDY A;  5D92 A;  4QH5 A;  2HPL A;  3ZQY A;  3TLV A;  3NWI A;  2WU2 A;  4UVB B;  4KUM B;  3N2O A;  3LEV A;  5GON E;  3BRJ A;  2XAQ B;  2A2F X;  4AIU A;  1OCZ C;  3GEI A;  4TNV A;  3V5Y A;  2E9X D;  2Y3B A;  1XMQ T;  4WBN E;  3U5S A;  4O8S A;  4KHP T;  5JQG E;  1FAP B;  3C51 A;  4MTO A;  4WJ0 A;  2WSS V;  2ASR A;  4FWV A;  3AE6 A;  3B9Q A;  3KFW X;  2VKJ A;  2ACX A;  2QRX A;  4JZA A;  4F4B A;  4QWN B;  4B6I A;  4K0K T;  3RRW A;  3UU8 A;  5JLI A;  1J5E T;  2YL0 A;  3JAE A;  3N2Z B;  3L0I A;  1HS7 A;  2F22 A;  1EI7 A;  2DI3 A;  4JJG A;  2MAW A;  3Q7G A;  3SXY A;  3PJA A;  4OIN F;  5HEH A;  3IHR A;  1TWA A;  1I4Y A;  5A6B D;  3WAJ A;  2R7U A;  1VLT A;  2ICW G;  1TWG A;  4A98 A;  4DBQ A;  2PP4 A;  1KNY A;  3PE0 A;  3RQF A;  2KIN B;  4YN0 B;  2GWW A;  4ULV A;  2EPK X;  4DV0 T;  4JCZ A;  2MWQ A;  3A9C A;  2DI4 A;  3M3Z B;  4FJO A;  4OIP F;  3AE3 A;  4BJT A;  2ZM2 A;  5ABE A;  1IZM A;  3KIN B;  2L6H A;  3O39 A;  3UUM A;  4MS2 A;  2QA7 A;  4NC3 A;  3B13 A;  5JVE A;  2G3V A;  4DR1 T;  4HFF B;  3UU6 A;  3MZK B;  2ZM0 A;  3QNU A;  3FOO A;  1X9B A;  3C8G D;  1W09 A;  4BJM A;  4CS9 A;  2XY8 B;  2HKV A;  4PAC A;  5FZT A;  2MTQ A;  1CGO A;  1IBM T;  3K33 A;  3IHU A;  3U2L A;  5L4H A;  3GWL A;  2HV6 A;  3NG1 A;  2DYR C;  4CI2 B;  1E2A A;  3T1H T;  1OXZ A;  2Q9Q D;  3LK2 B;  2KQ9 A;  3VRB A;  1IBL T;  4AL1 A;  2VVN A;  4AQF C;  2W45 A;  1W9R A;  2LRK A;  4UXN B;  3R7C A;  1H7I A;  2WZI A;  5FXV A;  4X1Y E;  1MQV A;  4KI0 F;  1D0Y A;  2LFD A;  2D0T A;  2KW3 C;  3N24 A;  2DLR A;  1VYI A;  4EWC A;  3K1I A;  1CPR A;  2IXN A;  2OJQ A;  1HCI A;  1VCT A;  3OYX A;  2LIG A;  4X0R A;  4D4X A;  1Z6A A;  4YK5 A;  1OW6 A;  4OD5 A;  4IDZ A;  4NPP A;  3CML A;  3KL4 A;  1SE7 A;  4IL4 A;  4QX7 B;  2IAK A;  1VLS A;  2XLE A;  1VTM P;  3JRM O;  1M57 C;  4GYT A;  2KWH A;  1HG5 A;  3VRA A;  1ORJ A;  3U8P A;  1CPQ A;  3BQL A;  4JYA T;  4JJF A;  1LVK A;  4QH4 A;  4ASK A;  2NW9 A;  4CDA A;  2VK9 A;  2J62 A;  2BBJ A;  3T8O A;  4ZI2 C;  4GIW A;  3FAJ A;  3QW1 A;  3L1M A;  4LLE A;  3S84 A;  3ZYM A;  2IUB A;  4UV9 B;  2XAS B;  3N9L A;  3DM5 A;  1J8Y F;  5ABG A;  3H37 A;  5KXJ A;  5FL0 A;  3OBV E;  3DP7 A;  4LMK A;  2CWO A;  2P7V A;  2OU6 A;  4ILU A;  4P9F A;  4CZZ B;  4XPY A;  4QXH B;  5HAX A;  3SFE A;  3ZMZ B;  3T9O A;  4A2N B;  2K48 A;  3ZMU B;  2K5B B;  1YDI A;  1HNW T;  4BA9 A;  3V7O A;  4X1K E;  1GS9 A;  2VL0 A;  4COF A;  1T6I A;  4W8K A;  3BQI A;  1YYJ A;  2H7V C;  5CGM A;  4LFC T;  1NU9 C;  3GAN A;  2R05 A;  2WB5 A;  3AGU A;  3E9V A;  4K7B A;  3U9J A;  2A72 A;  5E0O A;  2EIN C;  1ZHY A;  3CX7 B;  2B76 A;  1ZVZ A;  2C0S A;  3JYY A;  1JR8 A;  4U5F E;  4AL0 A;  2J45 A;  5F5F A;  2W4B A;  1QQ3 A;  4J30 B;  4U2Z A;  4JEU B;  1U89 A;  3W2W A;  4K1O A;  3RIF A;  3LFM A;  3OTO T;  4IGU A;  3KBT A;  3EH1 A;  2CWY A;  1BR4 A;  4HEA J;  4U2Y A;  2JMH A;  3CVR A;  5AQN B;  2BL2 A;  5AC4 A;  2BE5 F;  4DV5 T;  2ZM8 A;  3AEC A;  3VAY A;  4KBL A;  1SHZ C;  3SOL A;  4IJJ A;  2FJE A;  3ONJ A;  5LHH B;  1V55 C;  3V5S A;  2W67 A;  4MTG A;  4R32 A;  3AA6 B;  4AQG A;  5AFU L;  1HMO A;  1K04 A;  1ORY A;  2PNO A;  3FZK B;  2HFI A;  3EQL F;  1Q0F A;  3ONX A;  4QH1 A;  2DWK A;  2XM1 A;  5HXE A;  3TOL A;  5KYN A;  4ANJ A;  1Q0M A;  2J7P D;  2IIU A;  3P8C D;  3EUH A;  1OXB A;  3UU3 A;  2LM2 A;  2UUA T;  1KF6 A;  5E3C A;  5LOV E;  5JDG A;  3N9N A;  2NSF A;  3UR3 C;  2IYL D;  1LS4 A;  3TQO A;  2I6H A;  2E5L T;  2VCA A;  3NMI A;  3EAB A;  3HJC A;  2WP9 A;  3U78 A;  1WR0 A;  4JI6 T;  4AK9 A;  3DTO A;  5JDQ A;  1JRA A;  3DD7 A;  4AIS A;  2B0J A;  2DCF A;  3AEG A;  2LSJ A;  4QHO A;  2PX3 A;  4G7O F;  3ETU A;  4MQ9 F;  4O6N A;  4JI4 T;  1T72 A;  4HN9 A;  4TWF A;  3NYM A;  1YXR A;  4LF8 T;  3H65 A;  1V74 B;  3OEO A;  3RQU A;  5IHY A;  4UVC B;  2FJA A;  4IAO A;  3ITF A;  3DXJ F;  1CGM E;  3TLU A;  5J0Z A;  3CK6 A;  4A97 A;  4JUY A;  2CNW D;  4EIY A;  5JRC A;  1FMW A;  2E9X A;  4ERR A;  5HWX A;  1OW8 A;  4O79 A;  3LS1 A;  2KSF A;  5KYY A;  4HWI B;  4AQY T;  3I5Q A;  4U5D E;  3OA1 A;  3EG9 B;  1NG1 A;  3Q5D A;  1E2X A;  1RJ9 B;  2KT9 A;  3RGL A;  1YJG A;  5JRA A;  2A6E F;  4UF0 B;  3D0T A;  4BJ5 C;  2VKH A;  1NBB A;  3C4X A;  4EHP A;  3ABM C;  4WNK A;  1J5W A;  1Z23 A;  3H2V A;  4ZS3 A;  1HX8 A;  3UQ7 A;  1Q0G A;  1RXQ A;  2QE9 A;  3WAQ A;  4X5T A;  3FMS A;  3E0Z A;  3EVY A;  4ILA A;  5A6B A;  4HWF A;  3LNR A;  5DQW A;  2XQ7 A;  3RYC E;  2YEV C;  2D5R B;  1WFD A;  4LF4 T;  3AE8 A;  1I6Z A;  2L6F A;  4JCH A;  4KNV A;  4WZX A;  4PFO A;  1ZU5 A;  2I8B A;  5LXT E;  3V5U A;  1V9D A;  2WDQ A;  3R2P A;  2V5C A;  2QLA A;  4QI2 A;  5L3G B;  5L0H A;  2ZD9 A;  3LJB A;  1T98 A;  2WDV A;  3U3B A;  3UT5 E;  1SR2 A;  4ZOL E;  5AQL B;  5CJ5 A;  3UFG A;  5A6J A;  3X2Q C;  3RC8 A;  2YU1 A;  4B3T T;  4J7T A;  3RLF F;  3L8R A;  4JBW F;  3L34 A;  2W62 A;  4YT5 A;  2E8I A;  2L9Q A;  2D9D A;  5IWA T;  1PD1 A;  2PG8 A;  2UUB T;  3I0O A;  3ZN0 B;  1BDJ B;  4M63 A;  3LK3 B;  1ZYR F;  4CS8 C;  3RF1 A;  5LGT B;  1NU7 D;  2EIJ C;  4P9T A;  3ZDL A;  4IT4 A;  4J7Y A;  4U3C A;  4DV1 T;  2MPK A;  2QVA A;  4GK0 E;  2LFF A;  2FJB A;  3ZT6 A;  3OVU A;  5LMU T;  2XS1 A;  5LCY A;  4N06 A;  3LBX A;  1GQA A;  1MND A;  2GK9 A;  3UFE A;  3P4R A;  2OV9 A;  3DM9 B;  2G0U A;  5CB4 E;  5KYU A;  3B29 A;  4AE4 A;  5DQZ A;  2YIN A;  4XQ1 A;  3KV4 A;  2NR4 A;  1KEY A;  2OLT A;  3S90 A;  3ZC4 A;  1N33 T;  1ZU4 A;  2R7Q A;  5L3D B;  2VAS A;  4ZXL A;  5JDF A;  4LDK A;  2W00 A;  2CCY A;  4YJ3 E;  3ZKR A;  4MAL A;  1KNR A;  2BG9 E;  3RQW A;  2LOS A;  4BJ6 A;  2JQK A;  2PFV A;  5AQJ B;  4X62 T;  3S29 A;  1RKE B;  3KMI A;  2XQ9 A;  4HFD A;  4HWH A;  2VKD A;  2UUC T;  4NUU A;  3AE9 A;  2XHE B;  1T01 A;  4H9O C;  4MVM A;  2PBE A;  1HX1 B;  2ZLY A;  3G06 A;  4N78 D;  2J8W A;  3TUL A;  2XQ8 A;  1OQC A;  1EA8 A;  4LF6 T;  1QLE C;  2KND A;  3J9X 1;  1XWJ A;  3PDY A;  3AE4 A;  3R6N A;  3JAD A;  2IXO A;  3EHZ A;  1Y4C A;  1IZN B;  1XNQ T;  2DB4 A;  1T7S A;  4EKW A;  3AG2 C;  4YL1 A;  5LBQ B;  3ZJ2 A;  3H3M A;  3EJN A;  4ZLC A;  4I4T E;  2M6B A;  1HE9 A;  2WM9 A;  2LRL A;  3P7I A;  5FVL A;  2VQE T;  2CRB A;  1C02 A;  4DVD A;  3H2U A;  4EOZ B;  3KVB A;  1UK5 A;  3P4S A;  5B3S C;  2A9U A;  4MTF A;  3O1I A;  3TOM A;  1UGO A;  2X9X A;  3AEA A;  4CI3 B;  3FXD B;  3T1Y T;  1SF8 A;  3DJU B;  4EED A;  5J2T E;  4IRU A;  3RHW A;  5DS6 A;  3SXK A;  3S28 A;  3OJA A;  4YHJ A;  2Y69 C;  2LSG A;  4N6H A;  1T6U A;  2HJM A;  2V7K A;  5KYW A;  4J2C A;  5H6Q B;  1JMW A;  5F5W A;  2LLY A;  1E83 A;  4J32 B;  4XTK A;  2V7M A;  4CS9 C;  4CI1 B;  5LJN A;  3RC3 A;  1QLB A;  1QSD A;  1DOW A;  2Y48 B;  1A41 A;  4HFV A;  2PBI A;  1NFN A;  3LEO A;  4I44 A;  1LPE A;  3RIA A;  1ZW2 A;  4NQF A;  5L3Q A;  2CCQ A;  2Q9A A;  2VCC A;  2BKO A;  2PF4 E;  3ANW B;  2ZXW C;  4OIO F;  5F5H A;  1E7P A;  3ZLI A;  4JTA B;  5DS5 A;  2YHS A;  3PJA J;  1ZHC A;  4HWC A;  4FX5 A;  3ZG1 A;  3EGX B;  2LQG A;  3IBP A;  4UEM A;  4WW0 A;  4Z8X A;  2ZXP A;  4A5X A;  2OKU A;  2EIL C;  1DU2 A;  3PMR A;  1YKE B;  4HE8 D;  2Y3H A;  3I9Y A;  2XAF B;  3N9O A;  3K1I C;  5CI8 A;  2MBG A;  3GOR A;  3KYI A;  1K40 A;  4YFS A;  3F47 A;  4YY3 T;  4MVR A;  5FXX A;  2M64 A;  3AE5 A;  1T5O A;  3UUL A;  2X0Y A;  2J9W A;  4MFR A;  1WWP A;  4NXM T;  1DOV A;  1YQ3 A;  1NFO A;  1TFO B;  2YOE A;  5FVK A;  4MVQ A;  4DUZ T;  1WYC A;  3ESL A;  3LUT B;  4CSA C;  4E7S A;  4G7H F;  4GKK T;  4FAP B;  3O1J A;  2YLD A;  5ABF B;  1US7 B;  3FOP A;  2XPK A;  3AAI A;  3PUQ A;  5COM A;  3O10 A;  3KYJ A;  2Y39 A;  2LM9 A;  2NUP B;  2QY9 A;  5JDH A;  2V7L A;  1A7E A;  2D5U A;  3KKB A;  5KYX A;  2UXB T;  3FZL B;  1NLX A;  2LOP A;  3E22 E;  2XM2 A;  4LFB T;  3AAE B;  5L0F A;  1L0V A;  2ODV A;  4TWD A;  4GQH A;  3SWH A;  3UTK A;  3JSZ A;  2HN1 A;  4G78 A;  1QSP A;  3NMJ A;  3IF8 B;  4OD4 A;  3PHF 2;  3M4C A;  3NBX X;  4ZI2 D;  1JOG A;  3PUX F;  3LDQ B;  2HSQ A;  1CUN A;  3PUW F;  4ZI3 C;  2YN6 A;  1XMO T;  2V6Y B;  5EGY A;  4AKR B;  1OCO C;  3K8P C;  3PCV A;  5HEU A;  2UUH A;  3LSV A;  3RFY A;  2NPU A;  4HFH A;  4H9P C;  4JI5 T;  2C04 A;  3UMH A;  4EZ4 A;  4LF5 T;  3SP1 A;  2EHO C;  1UUR A;  2LSK A;  4WBO A;  4AKI A;  5JDL A;  3DJB A;  4YT0 A;  4PR9 A;  4LF9 T;  3Q5E A;  4UVA B;  1W0A A;  5KDM C;  1CGN A;  3EHM A;  4LMJ A;  2BS3 A;  2EPM X;  2WQY A;  2FFH A;  3UGP A;  3E08 A;  5COF A;  3SYN A;  2LJL A;  1LM3 B;  4NY3 A;  3T6G B;  1PD0 A;  1OED A;  4IHJ E;  4U7I A;  4XZC A;  4HFC A;  4P0A A;  3IPM O;  1OXK A;  3A7M A;  2W2U A;  3K1S A;  3GA8 A;  4QDL A;  4C3B A;  4F6R C;  3MLG A;  5H6R B;  3UUN A;  2X9W A;  4C7O A;  2OEX A;  2TMV P;  5LGU B;  1EKY A;  3SRZ A;  3HL6 A;  5L47 A;  4XPX A;  4DR2 T;  2J9U A;  4P1N A;  4I1M A;  4TUY E;  4EB6 E;  3PV0 F;  3RYI E;  3K3Q C;  1Z5Z A;  3CQG B;  2A6H F;  2KWI B;  3UQ4 A;  4CS7 A;  4H9Q C;  5DQT A;  3K6B A;  4XEF A;  2YWA A;  2YQY A;  5BUO A;  4U72 A;  1M2O A;  1JPN A;  3WAK A;  2Q9C A;  1ZHT A;  3QB5 K;  5LMN T;  3VM6 A;  1ZV4 X;  3AJM A;  3ASO C;  1JNZ A;  2NOX A;  4HFB A;  1U6H A;  2P6V A;  3RPU A;  4JI1 T;  1UUS A;  2BZB A;  2J46 A;  4TN7 B;  1SZI A;  4OIR F;  5LHI B;  3U3F A;  4JI8 T;  4IDP A;  2M4E A;  3ZMT B;  1GM5 A;  1E85 A;  5AQS B;  2HUJ A;  3VR8 A;  3RVZ A;  2XAG B;  4DV4 T;  2C03 A;  3F2E A;  2DNX A;  4I50 E;  4IE5 A;  4O4I E;  3DWW A;  4IDQ A;  4I1O B;  2R7O A;  2VH3 A;  5CI9 A;  5HXR A;  3C7J A;  3N5L A;  3MYI A;  4WYV A;  3NRY A;  2C5J A;  5FCL A;  2XXA B;  3EZI A;  4RBN A;  1OED E;  1Y64 B;  3PUS A;  3MA9 A;  2X0C A;  4ZHQ E;  1OKK A;  3S9O A;  1HY5 A;  4G63 A;  5K0I A;  4DJ9 A;  1IAP A;  1UX5 A;  4YLH A;  3CWZ B;  3CSK A;  3FAP B;  4HGA A;  1NZE A;  2XLW A;  1ZOY A;  3SFD A;  5AGF A;  3IQC A;  5LNK A;  2BS2 A;  2K9A A;  4G2A A;  4ER9 A;  2HSB A;  5DQV A;  4DRI B;  2UXC T;  2JRK A;  2L7A A;  3HNJ A;  2BKP A;  4ULW A;  2WMN A;  4H63 H;  1WR6 A;  3QOF A;  3VR9 A;  1BR1 A;  4U74 A;  4Z9H A;  1ZZP A;  4KX6 A;  4GOU A;  4YT8 A;  2I0M A;  1O3X A;  2CYD A;  5HV9 A;  4DRJ B;  1E86 A;  3ABV A;  3PDM P;  5AQM B;  2CHN A;  3DE9 A;  3JC6 C;  2F4V T;  1MMG A;  1NWM X;  1F1M A;  4EYU A;  3RIP A;  1O5H A;  3VF0 A;  1J8M F;  1BR2 A;  2P9B A;  1O3U A;  1S94 A;  1HMD A;  5DJQ C;  3HKB E;  3KPH A;  2A0B A;  3ATP A;  2WZF A;  3ZC0 A;  4CJG A;  1SA0 E;  4NCQ A;  3N2G E;  1Z63 A;  5DS4 A;  3ECS A;  3C4Z A;  4U5B E;  5JP7 A;  4NTB A;  4JI0 T;  2NUT A;  5A6K A;  1GGQ A;  1QZX A;  2CGE A;  2BVM A;  3EG9 A;  4PFP A;  3G4Z A;  5BQH A;  2X68 A;  3PUG A;  1YD8 G;  2G62 A;  3Q5W A;  4O4H E;  3HKE E;  3GN5 A;  1MIY A;  4O4L E;  3RKG A;  3GOD A;  1IJ6 A;  4JEA A;  4IB4 A;  3G4X A;  4WAB A;  3K66 A;  4H54 A;  2X66 A;  2KK1 A;  4ZZC A;  3AB3 B;  3N9Q A;  4H9N C;  1M2V A;  3FHD A;  4Q25 A;  3B5M A;  3NMK A;  4X65 T;  3TLS A;  2AXD S;  5HEJ A;  4CN4 A;  2VVS A;  4X20 E;  1L3P A;  2HS5 A;  4KC9 A;  2UXD T;  4PK6 A;  1HF8 A;  1NSG B;  1CHU A;  1YVI A;  4LDQ A;  4IIJ E;  2W66 A;  4NTF A;  3TD7 A;  3CZ6 A;  3LAY A;  4XAX B;  4DR3 T;  3W4Y A;  5FKY A;  4XPW A;  2J9V A;  5L0D A;  4U9E A;  3NKZ A;  3C50 A;  3AXJ A;  2J1D G;  2L81 A;  5LP6 E;  1IW7 F;  2L3L A;  3B57 A;  5A1L A;  4DMV A;  3A5X A;  2D0U A;  4U31 A;  1WAS A;  3BQK A;  4G7Z F;  3PU8 A;  3KV9 A;  2YDS A;  2WDR A;  2QUP A;  4DMW A;  2RA1 A;  4O4J E;  1H9G A;  3ZT5 A;  3Q7L A;  2HHH T;  1FR0 A;  4YSX A;  5B1B C;  4W8P A;  2HMZ A;  2LEH A;  3ZPO A;  5JT4 A;  4XEK A;  4BEJ A;  4E7Z A;  2EHO B;  2LKH A;  4PJL A;  3EFO A;  3A11 A;  4MW3 A;  4HFI A;  2XJ7 A;  3MYF A;  3ZSS A;  3QK6 A;  2XQ6 A;  2R7X A;  4PJM A;  1QPU A;  1FFH A;  2HZ8 A;  1WTY A;  4U5H A;  2IOQ A;  1H9T A;  1YZC A;  3B0P A;  4HEA A;  3HKC E;  1NAF A;  3AA1 B;  2WB7 A;  1M7K A;  3PUY F;  3QVY A;  1VYK A;  2IW5 B;  3RYH E;  4JW1 A;  2V3C C;  4PNI A;  5LG4 A;  1VB5 A;  3VKG A;  1MIW A;  3RH3 A;  5IY5 C;  5AQT B;  3ZMV B;  4NXN T;  4CXW A;  3ZC1 A;  4CX9 A;  3KH2 A;  4CQI A;  2XQ5 A;  4AX2 A;  3LK4 2;  4CJO A;  5EHH A;  3L39 A;  4IRE A;  3R84 B;  4EBB A;  2YDR A;  4ZLD A;  3H3A A;  5AQQ B;  3HI2 A;  5ETW A;  3HA4 A;  1I5N A;  5BQI A;  5JDM A;  1A7V A;  2VCB A;  1UCU A;  4EGW A;  3M4B A;  2KJG A;  4LDR A;  4U5C E;  2BG9 A;  2KLQ A;  4RD9 A;  4EAH A;  1OR3 A;  2G3K A;  3QTH A;  5AC5 A;  4BPM A;  2X67 A;  3VKH A;  3GM2 A;  3K1H A;  4ZS2 A;  4CIP A;  4N6C A;  2OEV A;  3W15 B;  5L0G A;  2W4M A;  2NW8 A;  3Q2M A;  3C8G A;  4U33 A;  3AE2 A;  4BG0 A;  2R7V A;  4C3D A;  2LHN A;  1G73 A;  4LER A;  3TK0 A;  2W9Y A;  1ORS C;  2B1E A;  2R25 A;  3J06 A;  1QVX A;  2AU5 A;  3Q9D A;  2KGO A;  2W61 A;  5HWY A;  5EK4 A;  3AA0 B;  3HNL A;  4UDV A;  4TV9 E;  2Q9Q A;  2XTL A;  2AWC A;  4H9S E;  5ABH A;  3JCF A;  5JRC B;  3ZQV A;  2ZXR A;  3JRT A;  5AQG B;  3RI5 A;  1OWA A;  2KYH A;  4AI6 A;  1VOM A;  2MOZ A;  4KMC A;  4DVZ A;  4YHH T;  1FNT c;  2EPN A;  5B3I A;  4JVS A;  2LSE A;  3I4U A;  1D1A A;  3CX8 B;  1WN0 A;  1C03 A;  1XWM A;  4DXW A;  3MAC A;  3RYF E;  2H7O A;  2P1A A;  4GKJ T;  3EGD A;  2IC6 A;  3P4Q A;  2YK0 A;  2XSA A;  4Z91 A;  4YXD A;  4EBJ A;  3AEF A;  3AQC A;  2PJQ A;  3GWN A;  2CW0 F;  2YLI A;  4LAC B;  1VK5 A;  256B A;  3TKL B;  2BS4 A;  2O9X A;  4MVZ A;  3ZCI A;  3FHN A;  4ILC A;  3CEX A;  2N1G A;  4OHF A;  4BAY B;  2LP4 A;  1MIV A;  2YL3 A;  4E0H A;  2H89 A;  2V6X A;  3MK7 C;  2YRF A;  1C17 M;  1H7C A;  5JR9 A;  3UU5 A;  5IYZ E;  3GM1 A;  4MHC A;  3G50 A;  2Q4F A;  1HG2 A;  2LSY A;  3VHL A;  5FMN A;  2Y3G A;  2WMO A;  1VMA A;  5FY7 A;  2XLV A;  3FXE B;  2H8A A;  2Y8D A;  2ZM6 T;  5EZY E;  4GYS A;  2YDQ A;  4F8H A;  2BC5 A;  1TFK B;  5BR8 T;  1EZ3 A;  3QMK A;  1FTS A;  3Q5X A;  5AQF B;  4DR6 T;  4E18 A;  2IBF A;  2JD3 A;  4CXY A;  2MHR A;  1S35 A;  3UGO A;  4P0B A;  3CAX A;  1D1C A;  2ACZ A;  4JI2 T;  1JNR A;  3RKO A;  4XBF B;  3I5P A;  1XZY A;  3I0Q A;  4ZI3 D;  2H88 A;  4AKG A;  1MMA A;  3S4U A;  1N36 T;  3HLZ A;  3FZM B;  4DV3 T;  1PV3 A;  3M15 A;  2ES0 A;  5FYM A;  1OED C;  3EHN A;  3F57 A;  1V54 C;  2XM0 A;  4IDO A;  1XZP A;  2FJD A;  4AE4 B;  5KYU B;  5L3C B;  5CA0 E;  2QTV A;  2JX0 A;  2M6I A;  2EHO D;  1HTJ F;  3LS0 A;  2XLM A;  2EPO A;  3MBG A;  3GMI A;  4AKH A;  4PK4 A;  2JMK A;  3A8Y C;  3KDS E;  4WGY A;  2RPA A;  5LGN B;  4CN1 A;  3SXM A;  2AVK A;  3NZQ A;  2CEA A;  4HFE A;  3GEE A;  5BMV E;  1R4T A;  4HTE A;  4EV6 A;  3HNK A;  3S0X A;  3UMK A;  4EUK B;  2WVO A;  4OIQ F;  5JS5 A;  5FY0 A;  2J7P A;  2GDC A;  4MVO A;  3C64 A;  2NSG A;  3UUX B;  2PTF A;  3RIU A;  2JPF A;  5AQI B;  2Q9B A;  4JLE A;  1HW2 A;  2WZL A;  2WCA A;  2HV7 A;  4JTD B;  2X9Y A;  2X0H A;  3IQT A;  4JI3 T;  2XQ4 A;  4BJN A;  3SEO A;  1TKN A;  2Q00 A;  4O7G A;  1FMV A;  3KVA A;  4JRZ A;  4Z90 A;  4DRH B;  1AJ3 A;  5FXW A;  2DYS C;  4DOZ A;  2E5V A;  4JUR I;  3U2M A;  3ZN1 B;  4KNW A;  2E87 A;  1SMY F;  3RQG A;  2UUI A;  2CHO A;  4TNW A;  1LE4 A;  4YTN A;  3Q6M A;  2RP4 A;  3EPV A;  2L8K A;  2JJ9 A;  3LES A;  4Z9I A;  2J4G A;  3LLK A;  1MMN A;  4C3E A;  2I15 A;  4MVS A;  5CIV A;  1TWH A;  3NKE A;  4OFZ A;  3ZVR A;  3ZWI A;  1XDO A;  4L5G A;  3US6 A;  2R03 A;  2HMQ A;  4OYK A;  2VQF T;  2XQ3 A;  2CNW A;  1JAF A;  2IXM A;  2K24 A;  3JTL O;  5EK2 A;  4IE6 A;  4B3R T;  1RMV A;  2W0G A;  1QUU A;  2BKN A;  4AKL A;  3C98 B;  2V1D B;  4FI5 A;  1ZW3 A;  3T6B A;  5L3V A;  4DR4 T;  3ZTM A;  2KMF A;  4TZ4 C;  3C8Z A;  2WVQ A;  3P50 A;  3SZR A;  1R8I A;  4PK5 A;  3JYH A;  1O87 A;  1Z8U A;  1K05 A;  5KYW B;  1QKR A;  3C4W A;  1AVO B;  2KNH A;  4KHZ F;  4UR9 A;  2NTX A;  2CDQ A;  1LS1 A;  5HXC A;  3HTK C;  4ONS A;  1S7Z A;  1YW0 A;  2R7R A;  1NEK A;  4I55 E;  3FDQ A;  2W4X A;  3LNM B;  1M6T A;  3AG4 C;  3IQ6 A;  2N9D A;  3FVY A;  3U9M A;  5JUA A;  4E0I A;  2CXL A;  2OJE D;  2R6G F;  3F46 A;  4CDV A;  5T1D B;  3W8H A;  3FZH B;  1YA7 O;  1YQ4 A;  3U0C A;  1I4Z A;  4KI2 A;  3ABK C;  3DAF A;  2CM0 A;  1XZQ A;  1SUM B;  5J2U E;  2WVN A;  3M79 A;  4YL3 A;  4DND A;  3ZEF B;  1IJ5 A;  2XSB A;  1AUE A;  3ZYL A;  5L3B B;  4D4N A;  1B68 A;  2Z15 A;  2RD9 A;  3PUZ F;  3MJX A;  2DWG A;  2I59 A;  4I0U A;  4IAR A;  4P6I C;  3AA7 B;  4RDA A;  4CBE A;  4EZH A;  5JDN A;  4O6Y A;  2XXA A;  2Q3T A;  4DV2 T;  2H3R A;  5CFB A;  3PUR A;  1VRB A;  4YJ2 E;  1WAT A;  4ISS A;  1OCC C;  3B71 A;  3DI5 A;  2CLY C;  2Q7R A;  4I43 B;  2JIW A;  1RKC A;  3JC6 D;  2LSI A;  3I9W A;  1SYQ A;  5L3F B;  4U5E E;  2VL8 A;  1WCR A;  2CPT A;  3UUB A;  2V8S V;  2XRH A;  2J9B A;  2ZPA A;  5KYX B;  2ETS A;  5B1A C;  5HSW A;  5JRE A;  3WI3 A;  2XQY A;  5C3J A;  4AXP A;  3EH2 A;  3HR0 A;  4KP3 C;  5EK0 A;  3AG1 C;  1N1C A;  3AED A;  5KMG P;  3B0U X;  1N34 T;  2ODU A;  3KV6 A;  3RX6 A;  1WYB A;  3M65 A;  2R02 A;  2XLD A;  1MMD A;  4YSY A;  4BEM J;  4BJ1 A;  3K3O A;  5LYJ E;  4C90 A;  1HE1 A;  1T6Q A;  3ZMS B;  2VC9 A;  5L2L A;  1APC A;  2OQM A;  1G8X A;  5C8Y E;  2NTY A;  2X9H A;  4A4A A;  4H4K C;  2HN2 A;  3U3I A;  3MX3 A;  3T6J A;  1WRD A;  4IL9 A;  4UV8 B;  1M56 C;  4EXT A;  1TR2 A;  1WOL A;  3O55 A;  5L4E A;  2E9X C;  1LI5 A;  3V5X A;  4ADZ A;  4CN6 A;  1HR0 T;  3CQX C;  5EK3 A;  3AVS A;  3PU3 A;  5HYA A;  1UX4 A;  3M1C B;  4K0U A;  4NUV A;  2M67 A;  4JIO A;  1D0Z A;  2CE7 A;  1ZHZ A;  2ZMA A;  4YT2 A;  4QXC B;  5AQU B;  3QW0 A;  4CSA A;  1OW7 A;  1A7D A;  2ZXO A;  1BBH A;  3E70 C;  1ZEE A;  3ZCJ A;  5HXH A;  1HFA A;  3AG3 C;  5L0I A;  4LFA T;  3X1O A;  2XSE A;  3RF3 A;  4MVU A;  4ZI7 E;  4GEH A;  2WS3 A;  1OED B;  2J47 A;  3P4P A;  5E3A A;  4JI7 T;  4ZZB A;  5F3J A;  3QZC A;  4XLN F;  4C7O B;  3J7Y q;  1G4U S;  3WOD F;  3JCU Q;  3IA3 A;  3T4R A;  3JAF A;  3B0V C;  2BDE A;  1H6G A;  4I3M A;  2H7B A;  2CXD A;  5LA6 E;  1VCS A;  4C91 A;  5CA1 E;  3C63 A;  4E17 A;  3C62 A;  3W8I A;  2A3D A;  2EIK C;  1E1H B;  2WY2 A;  2OCC C;  2YL1 A;  3MXZ A;  1WLX A;  5T3T A;  1EQ1 A;  3NRH A;  2WU5 A;  2BG9 C;  1LRZ A;  2A68 F;  5J1G A;  4XEV A;  3WHN A;  3LLI A;  3O1H A;  1YAR O;  3EZH A;  1KTM A;  2CXF A;  4IE7 A;  2DGJ A;  5FNV E;  2C5K T;  1HW1 A;  1D0X A;  3QUJ A;  4IE0 A;  2V5D A;  2R7W A;  1FIO A;  5L0J A;  4DV6 T;  4DV7 T;  2MYS A;  2KXP B;  2EHO A;  1BR0 A;  3KV5 A;  1LE2 A;  2BVL A;  2PX0 A;  1HNZ T;  3DJN B;  2Q9Q C;  5C2T A;  5JH7 E;  2V26 A;  1RJ9 A;  3C18 A;  3Q6N A;  3LG7 A;  3ZIB A;  3GWH A;  5FY1 A;  2JPU A;  4IGG A;  4UF0 A;  3BEH A;  3EDU A;  4YTP A;  1L7C A;  3RKO F;  5DLJ A;  2WZG A;  1U0B B;  4UEL A;  3PUV F;  4HE8 A;  3OWT A;  4Z9J A;  2BBH A;  3TJ6 A;  4X1I E;  5TJ5 E;  3P4W A;  4DR7 T;  1OCR C;  4HKA A;  1T8B A;  2AE9 A;  5E2Q A;  1FJG T;  2GA0 A;  1YA9 A;  1WGW A;  4H63 V;  3AVR A;  1HNX T;  5JTG A;  3VU7 H;  2WWU A;  4OX9 T;  2LK4 A;  4AQF A;  2XLO A;  2WL8 A;  4DUY T;  5HCJ A;  1KU2 A;  3ONL C;  2VB6 A;  2FUP A;  3CX6 B;  4EIW A;  3QC9 A;  4IE4 A;  2A69 F;  4LF7 T;  4JEB A;  3RW0 A;  3PTR B;  3S27 A;  2DHR A;  5ADX L;  4QX8 B;  5FL1 A;  4IDN A;  1AEP A;  2D2S A;  1KK7 A;  1OR2 A;  4QKN A;  4BJ6 C;  1UFB A;  1GQE A;  3N9M A;  4B3S T;  5D91 A;  2V7J A;  4M1P A;  1UG7 A;  2CBJ A;  2LD6 A;  4OYJ A;  2NG1 A;  3SS1 A;  2HJ3 A;  5JR9 C;  4OK0 A;  4YTM A;  1N32 T;  3JSE O;  4QI0 A;  2YKZ A;  4WGZ A;  2LKG A;  1BZ4 A;  2E2A A;  2IML A;  4U5G A;  3DMD A;  5DAB A;  1YYX A;  2NWB A;  3ZST A;  3UNG C;  4DVY P;  4O6M A;  2SPC A;  1LVF A;  3DKA A;  5L0C A;  1PCX A;  2VWA A;  1Q0K A;  2B0H A;  1RCP A;  2DL1 A;  5LG3 A;  2XUE A;  2FGY A;  3OPC A;  4PJN A;  4YJW A;  4EYY R;  2XM4 A;  2A1D D;  4YT4 A;  2IM8 A;  4QXB B;  2Z6E A;  1Z7Q c;  4H9R C;  2OOC A;  1YKH B;  3K7D A;  2JQQ A;  3GEH A;  2NUT B;  2CLY B;  3I1A A;  3NRX A;  2R9R B;  2HH7 A;  1ZKE A;  4IST A;  3GN5 B;  1MNE A;  4TV8 E;  4P09 A;  5HCM A;  1TQG A;  5A69 A;  3NDB B;  1NEN A;  2L9J A;  5JSL A;  3KBU A;  1V4A A;  2WBL A;  1M2V B;  3O9X A;  4N4W A;  3TLT A;  3F31 A;  3O4X E;  1KNZ A;  1ZHW A;  2EIM C;  2YL7 A;  1T9K A;  3OKQ A;  1Z3I X;  1FFT C;  5LHG B;  2IXP A;  3DZA A;  1RKE A;  1ZP0 A;  3ETV A;  3U8V A;  3HNI A;  1ST6 A;  4U9D A;  2IC9 A;  4Q4Z F;  4Q5S F;  1W2W A;  2YZS A;  4KBM B; 
#chains in the Genus database with same CATH homology
 3NZP A;  5HXS A;  2CA5 A;  2UXX B;  4V1A v;  2V7I A;  3DAG A;  2OA5 A;  3BK9 A;  2E9X B;  3AQB A;  1FEW A;  2OG2 A;  2HPJ A;  3N0T A;  2CMR A;  3EFO B;  5KYY B;  2LT3 A;  3N2K E;  3NYJ A;  4O2A E;  5T3W A;  2XAH B;  4Q7C A;  2LHR A;  3K3N A;  4A56 A;  1TWC A;  3JT1 A;  3HKD E;  5L3E B;  2VKO A;  3UMI A;  2YU2 A;  5FP3 A;  3L3P A;  3PUA A;  2X0L B;  4L9I A;  1LKX A;  5DVW A;  5M4Y A;  4UIG A;  2X51 A;  5JVD E;  3ANW A;  3CQZ A;  3NKD A;  3LJC A;  3ASN C;  4CXX A;  3EDV A;  3EGX A;  2UXN B;  2J0W A;  2R7S A;  3NYL A;  2QGS A;  2R7T A;  4PJJ A;  2N2N A;  2Y3D A;  1Z0P A;  1OKK D;  3RRC A;  4JEH B;  4G0H A;  1JPJ A;  4L0R A;  3RYL A;  3CPZ A;  2Q9Q B;  3FBL A;  2C5I T;  1D1B A;  3ZSU A;  3POV A;  4BJ5 A;  3IEE A;  2PFD A;  2GFH A;  4LLC A;  3WG7 C;  4MLK A;  2NUP A;  3LBX B;  5F8P A;  3W2V A;  4K0D A;  4MND A;  4XLP F;  5FXZ A;  3CQC B;  2YEV A;  2J0X A;  3ABL C;  3EGD B;  4GYR A;  4HFK B;  2KZ7 B;  3CKD A;  2WAU A;  2NP9 A;  5E33 A;  1ZHX A;  4DO0 A;  4PW8 A;  3FBZ A;  3SNH A;  2XAJ B;  3L09 A;  2NW7 A;  2LE8 A;  5JR9 B;  2W63 A;  4PAG A;  4YWQ A;  4TX5 A;  2Y6X A;  3ZJ1 A;  5TAO A;  1U4Q A;  3VYW A;  4XWJ A;  4B6X A;  4IWB A;  3AAA B;  5LBM A;  1U5P A;  3OYZ A;  1B7T A;  5LJM A;  4CS8 A;  3ZYK A;  2XL4 A;  4DBR A;  5KX5 E;  4GK5 E;  4O2B E;  3O6X A;  3N9P A;  4CIH A;  4FES A;  3FB2 A;  3MKD A;  4MBQ A;  1X79 A;  5D92 A;  2HPL A;  4UVB B;  4KUM B;  3N2O A;  3LEV A;  5GON E;  2XAQ B;  2A2F X;  1OCZ C;  2E9X D;  2Y3B A;  4WBN E;  4O8S A;  5JQG E;  3C51 A;  4WJ0 A;  2WSS V;  4FWV A;  3B9Q A;  3KFW X;  2VKJ A;  2ACX A;  4JZA A;  4F4B A;  4QWN B;  4B6I A;  3RRW A;  3N2Z B;  3L0I A;  1HS7 A;  4JJG A;  3Q7G A;  4OIN F;  3IHR A;  1TWA A;  3WAJ A;  2R7U A;  1TWG A;  4DBQ A;  2PP4 A;  3PE0 A;  2KIN B;  4YN0 B;  2MWQ A;  2DI4 A;  4FJO A;  4OIP F;  4BJT A;  2ZM2 A;  1IZM A;  3O39 A;  3KIN B;  3UUM A;  2QA7 A;  3B13 A;  2G3V A;  4HFF B;  3MZK B;  2ZM0 A;  4BJM A;  4CS9 A;  2MTQ A;  3K33 A;  2HV6 A;  3NG1 A;  2DYR C;  4CI2 B;  1OXZ A;  2Q9Q D;  3LK2 B;  2KQ9 A;  4AQF C;  2W45 A;  4UXN B;  5FXV A;  4X1Y E;  1D0Y A;  2D0T A;  2KW3 C;  3N24 A;  2DLR A;  1VYI A;  4EWC A;  2IXN A;  1HCI A;  3OYX A;  4X0R A;  1Z6A A;  4OD5 A;  4IDZ A;  3CML A;  3KL4 A;  4QX7 B;  2IAK A;  1M57 C;  4GYT A;  2KWH A;  1HG5 A;  3BQL A;  4JJF A;  1LVK A;  4ASK A;  2NW9 A;  2VK9 A;  3T8O A;  4ZI2 C;  4GIW A;  3FAJ A;  4LLE A;  3ZYM A;  4UV9 B;  2XAS B;  3N9L A;  3DM5 A;  1J8Y F;  3H37 A;  3OBV E;  3DP7 A;  2CWO A;  2P7V A;  4ILU A;  4CZZ B;  4QXH B;  5HAX A;  3ZMZ B;  4A2N B;  2K48 A;  3ZMU B;  2K5B B;  4BA9 A;  3V7O A;  4X1K E;  4W8K A;  3BQI A;  2H7V C;  1NU9 C;  3GAN A;  3E9V A;  4K7B A;  2A72 A;  5E0O A;  2EIN C;  1ZHY A;  3CX7 B;  2C0S A;  4U5F E;  2J45 A;  5F5F A;  2W4B A;  4J30 B;  4JEU B;  3W2W A;  3LFM A;  4IGU A;  3KBT A;  3EH1 A;  2CWY A;  1BR4 A;  4HEA J;  2JMH A;  3CVR A;  2BE5 F;  2ZM8 A;  3VAY A;  4KBL A;  1SHZ C;  3SOL A;  4IJJ A;  5LHH B;  1V55 C;  3V5S A;  3AA6 B;  4AQG A;  5AFU L;  3EQL F;  3ONX A;  2DWK A;  5HXE A;  5KYN A;  4ANJ A;  2J7P D;  3P8C D;  3EUH A;  5E3C A;  5LOV E;  5JDG A;  3N9N A;  3UR3 C;  2IYL D;  3HJC A;  3U78 A;  4AK9 A;  3DTO A;  5JDQ A;  3DD7 A;  2B0J A;  2DCF A;  2LSJ A;  4QHO A;  2PX3 A;  4G7O F;  3ETU A;  4MQ9 F;  4O6N A;  4HN9 A;  3NYM A;  3H65 A;  3OEO A;  5IHY A;  4UVC B;  4IAO A;  3ITF A;  3DXJ F;  4JUY A;  2CNW D;  5JRC A;  1FMW A;  2E9X A;  4ERR A;  5HWX A;  4O79 A;  3LS1 A;  5KYY A;  3I5Q A;  4U5D E;  3OA1 A;  3EG9 B;  1NG1 A;  1RJ9 B;  2KT9 A;  2A6E F;  4UF0 B;  3D0T A;  4BJ5 C;  2VKH A;  3C4X A;  3ABM C;  4WNK A;  1Z23 A;  4ZS3 A;  1HX8 A;  3E0Z A;  3EVY A;  3LNR A;  5DQW A;  3RYC E;  2YEV C;  2D5R B;  4JCH A;  4KNV A;  4PFO A;  1ZU5 A;  2I8B A;  5LXT E;  3V5U A;  1V9D A;  4QI2 A;  5L3G B;  3LJB A;  1T98 A;  3UT5 E;  4ZOL E;  3X2Q C;  3RC8 A;  2YU1 A;  3L34 A;  2W62 A;  4YT5 A;  2E8I A;  2L9Q A;  1PD1 A;  2PG8 A;  3I0O A;  3ZN0 B;  4M63 A;  3LK3 B;  1ZYR F;  4CS8 C;  5LGT B;  1NU7 D;  2EIJ C;  4GK0 E;  5LCY A;  4N06 A;  3LBX A;  1MND A;  2GK9 A;  3UFE A;  3DM9 B;  2G0U A;  5CB4 E;  5KYU A;  4AE4 A;  5DQZ A;  2YIN A;  3KV4 A;  3ZC4 A;  1ZU4 A;  2R7Q A;  5L3D B;  2VAS A;  5JDF A;  2W00 A;  4YJ3 E;  4MAL A;  2LOS A;  4BJ6 A;  2PFV A;  3S29 A;  3KMI A;  2VKD A;  4NUU A;  2XHE B;  4H9O C;  2ZLY A;  4N78 D;  1QLE C;  2KND A;  3J9X 1;  3PDY A;  3R6N A;  2IXO A;  1IZN B;  3AG2 C;  5LBQ B;  3ZJ2 A;  3EJN A;  4ZLC A;  4I4T E;  2WM9 A;  3P7I A;  4DVD A;  3KVB A;  4EOZ B;  5B3S C;  3O1I A;  2X9X A;  4CI3 B;  3FXD B;  1SF8 A;  3DJU B;  5J2T E;  4IRU A;  5DS6 A;  3S28 A;  3OJA A;  4YHJ A;  2Y69 C;  2LSG A;  2V7K A;  5KYW A;  4J2C A;  5H6Q B;  4J32 B;  4XTK A;  2V7M A;  4CS9 C;  4CI1 B;  5LJN A;  3RC3 A;  1QSD A;  2Y48 B;  4HFV A;  2PBI A;  4I44 A;  5L3Q A;  2CCQ A;  2Q9A A;  2PF4 E;  3ANW B;  2ZXW C;  4OIO F;  5F5H A;  3ZLI A;  5DS5 A;  2YHS A;  1ZHC A;  4FX5 A;  3ZG1 A;  3EGX B;  3IBP A;  4UEM A;  4WW0 A;  4Z8X A;  2ZXP A;  2EIL C;  3PMR A;  1YKE B;  4HE8 D;  2Y3H A;  3I9Y A;  2XAF B;  3N9O A;  3K1I C;  5CI8 A;  2MBG A;  4YFS A;  3F47 A;  5FXX A;  3UUL A;  2J9W A;  4MFR A;  1WYC A;  3ESL A;  4CSA C;  4E7S A;  4G7H F;  3O1J A;  1US7 B;  3AAI A;  3PUQ A;  2Y39 A;  2LM9 A;  2NUP B;  2QY9 A;  5JDH A;  2V7L A;  2D5U A;  3KKB A;  5KYX A;  2LOP A;  3E22 E;  3AAE B;  2ODV A;  3SWH A;  3UTK A;  3JSZ A;  3IF8 B;  4OD4 A;  3PHF 2;  3NBX X;  4ZI2 D;  1CUN A;  4ZI3 C;  5EGY A;  4AKR B;  1OCO C;  3K8P C;  3RFY A;  4H9P C;  2C04 A;  3UMH A;  4EZ4 A;  3SP1 A;  2EHO C;  2LSK A;  4WBO A;  4AKI A;  5JDL A;  3DJB A;  4UVA B;  5KDM C;  3EHM A;  2FFH A;  3UGP A;  3E08 A;  3SYN A;  2LJL A;  4NY3 A;  1PD0 A;  4IHJ E;  4XZC A;  4P0A A;  3GA8 A;  4QDL A;  4C3B A;  4F6R C;  3MLG A;  5H6R B;  3UUN A;  2X9W A;  4C7O A;  5LGU B;  3SRZ A;  3HL6 A;  2J9U A;  4I1M A;  4TUY E;  4EB6 E;  3RYI E;  3K3Q C;  1Z5Z A;  3CQG B;  2A6H F;  2KWI B;  4CS7 A;  4H9Q C;  5DQT A;  3K6B A;  5BUO A;  4U72 A;  1M2O A;  1JPN A;  3WAK A;  2Q9C A;  1ZHT A;  1ZV4 X;  3ASO C;  2NOX A;  2P6V A;  3RPU A;  2BZB A;  2J46 A;  4TN7 B;  1SZI A;  4OIR F;  5LHI B;  2M4E A;  3ZMT B;  2XAG B;  2C03 A;  3F2E A;  2DNX A;  4I50 E;  4IE5 A;  4O4I E;  4I1O B;  2R7O A;  2VH3 A;  5CI9 A;  5HXR A;  3N5L A;  3NRY A;  2C5J A;  5FCL A;  2XXA B;  3EZI A;  4RBN A;  1Y64 B;  3PUS A;  3MA9 A;  4ZHQ E;  1OKK A;  4G63 A;  1IAP A;  1UX5 A;  4YLH A;  3CWZ B;  3CSK A;  4HGA A;  1NZE A;  5LNK A;  2K9A A;  4G2A A;  5DQV A;  2JRK A;  4ULW A;  2WMN A;  4H63 H;  1WR6 A;  1BR1 A;  4U74 A;  4GOU A;  4YT8 A;  1O3X A;  3JC6 C;  1MMG A;  1NWM X;  4EYU A;  3RIP A;  1O5H A;  1J8M F;  1BR2 A;  2P9B A;  1S94 A;  5DJQ C;  3HKB E;  2WZF A;  3ZC0 A;  1SA0 E;  3N2G E;  1Z63 A;  5DS4 A;  3ECS A;  3C4Z A;  4U5B E;  2NUT A;  1QZX A;  3EG9 A;  2CGE A;  2BVM A;  4PFP A;  2X68 A;  3PUG A;  1YD8 G;  2G62 A;  3Q5W A;  4O4H E;  3HKE E;  3GN5 A;  1MIY A;  4O4L E;  3GOD A;  1IJ6 A;  3K66 A;  2X66 A;  3AB3 B;  3N9Q A;  4H9N C;  1M2V A;  3FHD A;  4X20 E;  4KC9 A;  4PK6 A;  1HF8 A;  4IIJ E;  3TD7 A;  3CZ6 A;  3LAY A;  4XAX B;  2J9V A;  3C50 A;  2J1D G;  2L81 A;  5LP6 E;  1IW7 F;  2L3L A;  3B57 A;  5A1L A;  4DMV A;  3A5X A;  2D0U A;  3BQK A;  4G7Z F;  3PU8 A;  3KV9 A;  4DMW A;  2RA1 A;  4O4J E;  3Q7L A;  5B1B C;  2LEH A;  3ZPO A;  4BEJ A;  4E7Z A;  2EHO B;  4PJL A;  3EFO A;  3QK6 A;  2R7X A;  4PJM A;  1FFH A;  4U5H A;  2IOQ A;  3B0P A;  4HEA A;  3HKC E;  1NAF A;  3AA1 B;  2WB7 A;  1VYK A;  2IW5 B;  3RYH E;  4JW1 A;  2V3C C;  4PNI A;  5LG4 A;  3VKG A;  1MIW A;  3RH3 A;  5IY5 C;  3ZMV B;  4CXW A;  3ZC1 A;  3KH2 A;  4CQI A;  4AX2 A;  3LK4 2;  5EHH A;  3R84 B;  4EBB A;  4ZLD A;  3H3A A;  3HI2 A;  5ETW A;  3HA4 A;  5JDM A;  1UCU A;  2KJG A;  4U5C E;  2KLQ A;  4RD9 A;  4EAH A;  2G3K A;  2X67 A;  3VKH A;  3K1H A;  4ZS2 A;  3W15 B;  2W4M A;  2NW8 A;  3Q2M A;  4BG0 A;  2R7V A;  4C3D A;  2LHN A;  1G73 A;  4LER A;  2W9Y A;  2B1E A;  3Q9D A;  2KGO A;  2W61 A;  5HWY A;  5EK4 A;  3AA0 B;  4TV9 E;  2Q9Q A;  2XTL A;  4H9S E;  5JRC B;  2ZXR A;  3JRT A;  1OWA A;  4AI6 A;  1VOM A;  2MOZ A;  4KMC A;  4DVZ A;  4JVS A;  2LSE A;  3I4U A;  1D1A A;  3CX8 B;  3MAC A;  3RYF E;  2H7O A;  3EGD A;  2IC6 A;  2YK0 A;  3AQC A;  2PJQ A;  2CW0 F;  4LAC B;  1VK5 A;  3TKL B;  2O9X A;  3ZCI A;  3FHN A;  2N1G A;  4OHF A;  4BAY B;  1MIV A;  3MK7 C;  1H7C A;  5JR9 A;  5IYZ E;  4MHC A;  1HG2 A;  2LSY A;  3VHL A;  5FMN A;  2Y3G A;  2WMO A;  1VMA A;  5FY7 A;  3FXE B;  2Y8D A;  5EZY E;  4GYS A;  1EZ3 A;  3QMK A;  1FTS A;  3Q5X A;  2JD3 A;  4CXY A;  1S35 A;  3UGO A;  4P0B A;  1D1C A;  3RKO A;  4XBF B;  3I5P A;  3I0Q A;  4ZI3 D;  4AKG A;  1MMA A;  3S4U A;  3HLZ A;  2ES0 A;  5FYM A;  3EHN A;  3F57 A;  1V54 C;  5KYU B;  4AE4 B;  5L3C B;  2QTV A;  5CA0 E;  2EHO D;  1HTJ F;  3LS0 A;  3GMI A;  4AKH A;  4PK4 A;  2JMK A;  3KDS E;  5LGN B;  3NZQ A;  2CEA A;  5BMV E;  4HTE A;  3S0X A;  3UMK A;  2WVO A;  4OIQ F;  5FY0 A;  2J7P A;  3C64 A;  3UUX B;  2JPF A;  2Q9B A;  4JLE A;  2WZL A;  2HV7 A;  2X9Y A;  4BJN A;  3SEO A;  1TKN A;  4O7G A;  1FMV A;  3KVA A;  1AJ3 A;  5FXW A;  2DYS C;  4DOZ A;  4JUR I;  3ZN1 B;  4KNW A;  2E87 A;  1SMY F;  3Q6M A;  2RP4 A;  3EPV A;  2L8K A;  2JJ9 A;  3LES A;  3LLK A;  1MMN A;  4C3E A;  1TWH A;  3NKE A;  4OFZ A;  3ZVR A;  4L5G A;  4OYK A;  2CNW A;  2IXM A;  2K24 A;  5EK2 A;  4IE6 A;  2W0G A;  1QUU A;  4AKL A;  3C98 B;  2V1D B;  4FI5 A;  5L3V A;  3T6B A;  2KMF A;  4TZ4 C;  2WVQ A;  3SZR A;  4PK5 A;  3JYH A;  1O87 A;  5KYW B;  3C4W A;  2KNH A;  2NTX A;  2CDQ A;  1LS1 A;  5HXC A;  3HTK C;  1S7Z A;  1YW0 A;  2R7R A;  4I55 E;  3FDQ A;  3AG4 C;  2N9D A;  3FVY A;  2CXL A;  3F46 A;  5T1D B;  3W8H A;  4KI2 A;  3ABK C;  3DAF A;  2CM0 A;  5J2U E;  2WVN A;  4DND A;  3ZEF B;  1IJ5 A;  3ZYL A;  5L3B B;  2Z15 A;  3MJX A;  2DWG A;  2I59 A;  4P6I C;  3AA7 B;  4RDA A;  4CBE A;  4EZH A;  5JDN A;  4O6Y A;  2XXA A;  2Q3T A;  2H3R A;  3PUR A;  1VRB A;  4YJ2 E;  4ISS A;  1OCC C;  2CLY C;  4I43 B;  3JC6 D;  2LSI A;  3I9W A;  5L3F B;  4U5E E;  2VL8 A;  2XRH A;  2ZPA A;  5KYX B;  5B1A C;  5HSW A;  3WI3 A;  5JRE A;  2XQY A;  4AXP A;  3EH2 A;  3HR0 A;  4KP3 C;  3AG1 C;  1N1C A;  5KMG P;  3B0U X;  2ODU A;  3KV6 A;  3RX6 A;  1WYB A;  3M65 A;  1MMD A;  4BJ1 A;  3K3O A;  5LYJ E;  4C90 A;  3ZMS B;  5L2L A;  1G8X A;  5C8Y E;  2NTY A;  2X9H A;  4H4K C;  3U3I A;  3MX3 A;  3T6J A;  1WRD A;  4UV8 B;  1M56 C;  4EXT A;  1TR2 A;  2E9X C;  4ADZ A;  3CQX C;  5EK3 A;  3AVS A;  3PU3 A;  5HYA A;  1UX4 A;  3M1C B;  4K0U A;  4NUV A;  2M67 A;  1D0Z A;  2CE7 A;  1ZHZ A;  2ZMA A;  4YT2 A;  4QXC B;  4CSA A;  3E70 C;  2ZXO A;  1ZEE A;  3ZCJ A;  5HXH A;  1HFA A;  3AG3 C;  3X1O A;  2XSE A;  4ZI7 E;  4GEH A;  5E3A A;  5F3J A;  3QZC A;  4XLN F;  4C7O B;  3J7Y q;  3WOD F;  3JCU Q;  3T4R A;  3B0V C;  2BDE A;  4I3M A;  2H7B A;  2CXD A;  5LA6 E;  4C91 A;  5CA1 E;  3W8I A;  2A3D A;  2EIK C;  1E1H B;  2OCC C;  3MXZ A;  1WLX A;  5T3T A;  3NRH A;  1LRZ A;  2A68 F;  5J1G A;  3LLI A;  3O1H A;  3EZH A;  2CXF A;  4IE7 A;  2DGJ A;  5FNV E;  2C5K T;  1D0X A;  3QUJ A;  4IE0 A;  2R7W A;  1FIO A;  2MYS A;  2KXP B;  2EHO A;  1BR0 A;  3KV5 A;  2BVL A;  2PX0 A;  3DJN B;  2Q9Q C;  5JH7 E;  1RJ9 A;  2V26 A;  3Q6N A;  3LG7 A;  3ZIB A;  3GWH A;  5FY1 A;  4UF0 A;  3EDU A;  3RKO F;  5DLJ A;  2WZG A;  4UEL A;  4HE8 A;  3OWT A;  4X1I E;  1OCR C;  4HKA A;  5E2Q A;  1WGW A;  4H63 V;  3AVR A;  3VU7 H;  2WWU A;  4AQF A;  2WL8 A;  1KU2 A;  2VB6 A;  3CX6 B;  4EIW A;  3QC9 A;  4IE4 A;  2A69 F;  3PTR B;  3S27 A;  2DHR A;  5ADX L;  4QX8 B;  2D2S A;  1KK7 A;  4QKN A;  4BJ6 C;  3N9M A;  5D91 A;  2V7J A;  4M1P A;  4OYJ A;  2NG1 A;  3SS1 A;  5JR9 C;  4OK0 A;  4QI0 A;  4U5G A;  3DMD A;  5DAB A;  3UNG C;  2NWB A;  4DVY P;  4O6M A;  2SPC A;  1LVF A;  1PCX A;  2VWA A;  2XUE A;  2FGY A;  4PJN A;  4YJW A;  4EYY R;  2A1D D;  4YT4 A;  4QXB B;  2Z6E A;  4H9R C;  1YKH B;  3K7D A;  2JQQ A;  2NUT B;  2CLY B;  3I1A A;  3NRX A;  2HH7 A;  1ZKE A;  4IST A;  3GN5 B;  1MNE A;  4TV8 E;  4P09 A;  3NDB B;  2L9J A;  3KBU A;  2WBL A;  1M2V B;  3O9X A;  3F31 A;  3O4X E;  1KNZ A;  1ZHW A;  2EIM C;  3OKQ A;  1Z3I X;  1FFT C;  5LHG B;  2IXP A;  3DZA A;  3ETV A;  1ST6 A;  2IC9 A;  4Q4Z F;  4Q5S F;  1W2W A;  2YZS A;  4KBM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...