3IEEA

Crystal structure of an alpha helical protein (bf3319) from bacteroides fragilis nctc 9343 at 1.70 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
256
structure length
256
Chain Sequence
b'VSTADIENAAEVIKYYNTSLGVLKDMVKEKDVNAVLDYMEQKGKTPALSAIVPPAVVSKDSAIVLNPGNCFNEETRRNLKQNYTGLFQARTEFYANFDTYLSYLKKKDVTNAKKLLDVNYQLSTQMSEYKQNIFDILSPFTEQAELVLLVDNPLKAQIMSVRKMSSTMQSILNLYARKHRMDGPRIDLKVAELTKQLDAAKKLPVVNGHEGEMKSYQAFLSQVETFIKQVKKVREKGEYSDADYDMLTSAFETSII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative exported protein
publication title Crystal structure of hypothetical protein BF3319 from Bacteroides fragilis (YP_212931.1) from Bacteroides fragilis NCTC 9343 at 1.70 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Structural genomics, unknown function
total genus 104
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ieeA02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ieeA01
3IEEA 3RH3A 4YJWA
chains in the Genus database with same CATH superfamily
4NUUA 2IHR1 5A6BD 3T9OA 2M67A 3RGLA 5BMVE 4K1OA 4KNWA 4DMWA 3RKOA 4ILAA 1VYKA 4EZHA 3FBLA 3ZT7A 3KPHA 2PF4E 2VK9A 4AQFA 3V5UA 4KBMB 3L3PA 3ZMUB 1QPUA 5BQGA 4HFCA 2ZXPA 4YHHT 1FIOA 4JVSA 4JTDB 3S29A 2XS8A 2WCAA 5L4EA 3S4UA 2PTFA 4ILUA 2YL0A 3DM5A 3L8RA 2Q9QA 1N33T 1VLSA 2Q9QB 3EABA 4O4HE 4IT4A 3AE7A 1LVFA 3RQGA 5E3CA 2UUIA 1RKEA 3FDQA 1N36T 3PUSA 1RKEB 1D0YA 4HFVA 3RI5A 3EFOA 3ZLIA 4QI2A 2WS3A 3EFOB 2GDCA 3RFYA 3HNJA 4TX5A 3RLFF 2LFDA 2BVMA 4CN6A 4ONSA 4H63H 4HFBA 4JI8T 3RHWA 3QB5K 3ZT6A 4YTNA 2KNDA 1SHZC 2CDQA 5LHHB 1T8BA 2YZSA 3X2QC 1T01A 2ZD9A 4V1Av 4I1MA 1ZW3A 2W2UA 3NZQA 2YL3A 5BUOA 3J7Yq 3O10A 4JRZA 2X66A 2NW8A 3MACA 2KQ9A 2VASA 2WWVA 4XBFB 3W8HA 1V4AA 4EWCA 1XZPA 3LS1A 2W67A 2D4UA 3ZWIA 1Y4CA 4QXBB 2EPLX 3KMIA 4G7OF 5ABEA 2Y48B 4ILBA 4I1OB 2WU5A 3O1IA 1CPRA 4WNKA 2MYSA 2WZLA 4Z9JA 2AE9A 3P8CD 2IC6A 3ZTZA 4LMLA 1RJ9A 3DTOA 1Q0FA 1RJ9B 5JR9C 2AWYA 4AK9A 1LM3B 3QW1A 2GWWA 4IE0A 3ZMTB 3I9YA 3N2ZB 4A2NB 2XLEA 5IHYA 4LFBT 5AQTB 1CPQA 2VQET 2WZIA 4N78D 1M62A 3WAJA 3CPZA 4CJOA 4I43B 4YJ3E 4JTCB 1HX1B 4G7ZF 4LFAT 2WVOA 3NYMA 3RC8A 1LKXA 3IPMO 3EHNA 3K1HA 3EHZA 4IDOA 3IHRA 2C0SA 2YVKA 4UF0A 3RIUA 1MIVA 4UF0B 4E17A 5H6QB 3RYCE 4E18A 1KEYA 3UUBA 4W8PA 5L0DA 4BA9A 3OYXA 2XAGB 4YL1A 3M65A 3V5SA 2J7PD 1DOWA 3ZCJA 3UQ7A 4DV4T 3EGDA 5LGNB 3EGDB 3H2UA 3UU6A 3U9MA 2OJED 2LM2A 2ZLYA 3LG7A 3S28A 3AEFA 4WZXA 3ABKC 4U31A 4OIQF 2H7OA 4ISSA 2M6BA 2HPJA 4DUYT 3IBPA 2XL6A 1TFOB 2C5JA 4EV6A 4DV6T 4MHCA 2MHRA 2LHRA 2WDQA 1ORYA 1WLXA 2HH7A 1E83A 2JPFA 1NBBA 3G50A 2MWQA 1TKNA 3EZIA 3RIPA 5F5FA 3AB3B 3KINB 5FXXA 3PHF2 1I4ZA 5AQNB 1A7VA 3LJCA 2BE5F 2OQMA 1Z3IX 5AQPB 3ATPA 1BR4A 2B0HA 4AISA 3Q6NA 3L8JA 5FY7A 5BR8T 2BL2A 2E87A 1UGOA 3N2KE 1EQ1A 3QZCA 2X51A 2NW7A 2C04A 5TAOA 4J30B 3DP7A 1R8IA 3B71A 4E0IA 4NTAA 3L0IA 5A6JA 3E70C 1NENA 1SUMB 4BEMJ 2P61A 4KI0F 4U2ZA 5L3GB 1ZHXA 1YQ4A 4QHOA 1ZU4A 5FXWA 3DE9A 3UNGC 2HHHT 1ORJA 1I6ZA 5E33A 4U33A 3AA1B 2XRHA 3UULA 3LBXA 3M15A 3FZFB 4HFDA 2BZBA 3LBXB 3ZMZB 2HFIA 3QTHA 4EKWA 4OYKA 3RQWA 1MMNA 4PJJA 4YHJA 3AEGA 5AQRB 2XQAA 4MLKA 1OR2A 3FHDA 3KVAA 4JIOA 2E9XC 4JEHB 4CIPA 2P9BA 4TWDA 4IRUA 1ZP0A 3C8GD 3SFEA 5L3EB 2AXDS 2C03A 4QH4A 1WYCA 2CLYC 4UIGA 2DLRA 2VKDA 1NFNA 4Q5SF 3QC9A 2IW5B 4W8KA 2KLQA 2W66A 5AQQB 5JR9B 4ILCA 2J9UA 3ZSSA 5ABHA 3PMRA 1D0XA 3SWHA 4DXWA 2ZMAA 5J2TE 3W4YA 1QKRA 3M4CA 5H6RB 3UTKA 3HNLA 5JLIA 4J32B 2R03A 3DWWA 2Q7RA 2M6IA 3S27A 2DI4A 1T6QA 4JCZA 1KFYA 3KV5A 3JYYA 1YKHB 2QVAA 4LLEA 1M6TA 4E0HA 4B3ST 4WYVA 2CNWD 2BG9C 2YL1A 3C62A 3AG2C 2Q4FA 2PFDA 3FZMB 2J9VA 4ZS2A 5FXZA 1M57C 1UUSA 3N9OA 4JCHA 3GWNA 5F8PA 4P0AA 4IE5A 4U2YA 4BJ5C 5LHIB 2XSAA 4PFOA 3JADA 3WAKA 1US7B 2N9DA 4BAYB 4FJOA 2D0UA 2W0GA 3JTLO 1ZHTA 2LSIA 4L9IA 3ZKRA 1XNQT 4BJ6C 2XLDA 5D92A 1FJGT 3Q2MA 5EK0A 2YLGA 2HUJA 3E9VA 3UFGA 2V7MA 3RQEA 4BEJA 1U0BB 2I8BA 1CGNA 4ASKA 2HS5A 3LLKA 2C5KT 1GGQA 3V5YA 4O4LE 4O4IE 4XEFA 4EB6E 3TLTA 2Q9QD 5HXRA 4EEBA 2RSEB 1JR8A 1OW6A 4HEAA 2UXDT 4K0UA 2OEXA 3JCUQ 3H3AA 3L09A 5DLJA 2ES0A 2QE9A 1XZQA 3UMKA 4DNDA 4XTKA 1J1JA 3RYLA 2XZEA 1WATA 2XQ4A 3I0QA 1E86A 2PG8A 2J4GA 3N9QA 4PJMA 3AE6A 3C7JA 3ZN1B 4ZLDA 4G7HF 1UK5A 2F4VT 1QSPA 1RMVA 3VF0A 3K1SA 3TQOA 3AEEA 4DIDB 1ZZPA 3BRJA 3KH2A 3PV0F 4QH1A 3U9JA 1DU2A 2KZ7B 3VHLA 1SR2A 2LRKA 4A56A 2ODVA 3JC6C 2E9XA 3OKQA 2P6VA 4CS9C 2E9XB 3PUWF 5EK3A 4AKHA 4AKGA 1BDJB 3Q5DA 1F1MA 3RQUA 4DV1T 1HS7A 1HG2A 3RYHE 2JMKA 3DE8A 4CS7A 2NSGA 1XWMA 2UU9T 4H9SE 4GK5E 4AKRB 5FP3A 1LE2A 2FBWA 1AJ3A 2YOEA 1VK5A 1I5NA 3ZSTA 5IYZE 3C64A 3BEHA 4A97A 4ZHQE 4GKJT 4GYRA 2K24A 3EDVA 4PK6A 5AQLB 3S0XA 3AA0B 3N9MA 3IQ6A 5LP6E 1FNTc 1FEWA 4C3BA 1NSGB 2J45A 3QVZA 3HKKA 2NUTA 1X79A 2NUTB 4WBNE 2BG9A 3M1CB 3ABLC 2BG9B 3DD7A 3QOFA 3AXJA 3PUZF 2D5RB 2YWAA 4YFSA 2QGSA 5JSLA 2ETSA 2IBFA 3TJ5A 4BJ5A 2WDRA 3QB5A 1ZHWA 4O2BE 5KX5E 4CBEA 3A7MA 4MW8A 4G2AA 4LF5T 2HJMA 5HEHA 2XAJB 4J7TA 1UX4A 3Q5EA 2LK4A 2DWGA 2KINB 2L9QA 2E5LT 1YA7O 4MTFA 5KMGP 3A9CA 4FESA 3ZYMA 1OWAA 3WAQA 2KC3A 2LSYA 4WW0A 4JTAB 5HEGA 2A1DD 3NMJA 2JQ9A 2A6EF 4NC3A 2WSSV 3LJBA 4WGYA 4X66T 5HAXA 1KTMA 4JI2T 3MLGA 2HJ3A 4MS2A 3ZC4A 3FAPB 4TV8E 4DR3T 4TWHA 1MNDA 1JPJA 2EPOA 2WL8A 1VYIA 2WQYA 5CI9A 2PX0A 5LCYA 2HZ8A 4BJTA 3EH2A 1OR3A 3EH1A 3U3FA 2CW0F 3RF3A 1K04A 4U5GA 3NKEA 3JRMO 3JYHA 2IXOA 1S35A 1ZHZA 2YDRA 2ZXRA 3ETUA 4PW8A 3GM3A 3CK6A 5CA0E 3GM1A 2A2FX 2CGEA 3P4PA 3CMLA 1MMAA 2V7IA 3ESLA 4YL3A 4AL0A 5AFUL 3F2EA 4JJGA 3PUQA 1RXQA 2DCFA 2OCCC 3S90A 3AE3A 2OOCA 1YZCA 5JH7E 2A72A 4YTMA 1AEPA 1O5HA 3WI3A 3UGOA 2QYWA 2L6GA 1QSDA 4CS9A 1U89A 3HKEE 4PAGA 3NG1A 2PNOA 3DJNB 2P0NA 2VH3A 1E84A 5A6KA 3CKDA 4I50E 3X1DA 3JZ0A 2XL4A 2XQ6A 2XAHB 1HE9A 3FOOA 4R32A 3ZEFB 2A69F 1T6IA 1WWPA 3QVYA 3AQBA 1ZEEA 3B9QA 5HXHA 3ZVRA 4JI3T 4Q4ZF 2W9YA 2EIMC 5T3TA 5T3WA 4BPMA 3DJBA 3LAYA 256BA 4AQGA 1YDIA 2XQYA 3P7IA 3GEIA 3CX6B 3IHUA 3JRTA 4CS8A 1FMWA 5L47A 3SXMA 4F6RC 4DV0T 1A7DA 4JJFA 5E3AA 3B0VC 1SE7A 4IHJE 3N9NA 2CNWA 1U5PA 5JS5A 5LBMA 1JPNA 3SXZA 4HWCA 5FXVA 5LMNT 4X62T 4TWFA 3GORA 3ASOC 3AOUA 4U7YA 3GA8A 5LYJE 2XSEA 1U4QA 5HCJA 3ABVA 3KFWX 2JPUA 4LDRA 4CQIA 5AQVB 3AECA 4M63A 4NXMT 4N6CA 3LDQB 2BS4A 4IE4A 3N2GE 3KV6A 2V26A 5FVLA 3S84A 4DMVA 2Q00A 4E7SA 3DZAA 2WVQA 3SNHA 4MBQA 1O3UA 1TQGA 4OINF 3ZSUA 5K0IA 3HI2A 5L0GA 3FB2A 1H9GA 2AWCA 3JT1A 4AKLA 1G8XA 4CIHA 3KDSE 2LSKA 1XWJA 4CI2B 3TLWA 1V9DA 2OKUA 3ZG1A 4FX5A 1HX8A 4X0RA 3LNRA 2BKPA 1QLBA 4JEUB 5JDGA 1Z63A 4EOZB 2QNLA 5LGTB 3VKGA 1VTMP 1GQAA 2P7VA 4NY3A 3KV9A 3FZKB 3ZQVA 1Y64B 2YINA 1HCIA 3GODA 5FYMA 1TFKB 4KNVA 1PD0A 2KMFA 2W61A 2QLAA 4O6MA 2PFVA 4IREA 1YW0A 2NUPA 4F8HA 2Q9AA 4X20E 3ZMSB 2ODUA 2NUPB 2FJDA 3AEBA 2NTXA 3L34A 4NTBA 5F5HA 1V74B 1J5ET 2IDOB 4XPYA 1XDPA 2X9YA 4HFFB 4NQFA 2R7VA 1APCA 4LF9T 3CQXC 3VRBA 4GIWA 2LT3A 1J5WA 1ZYRF 3Q6MA 3S9OA 4H9RC 1WFDA 2XQ3A 4QKNA 5KDMC 5ETWA 1G4US 2Y3HA 3HNIA 3AE1A 4UV8B 1JNZA 5B3SC 3X1OA 2XSBA 2JX0A 1BZ4A 2EINC 2V7LA 2ZM0A 4DRIB 4QDLA 5L3DB 3LEVA 2WVNA 1VB5A 2IYLD 2E9XD 4JI1T 2J0XA 4G63A 4KBLA 4MVZA 3RC3A 4HFKB 1GM5A 4HWHA 5BQHA 2R05A 3UFEA 1FR0A 1LS4A 1OXZA 3RF1A 3UUMA 4P9FA 2YKSA 4MW3A 5EK2A 1MIWA 3HKDE 3AJMA 3RRCA 3VM6A 4NUVA 2IOQA 4LF7T 2V1DB 4YK5A 1LVKA 1T5OA 4EBBA 2PJQA 4G78A 1DOVA 3WODF 2MPKA 4Q25A 3HKBE 2CM0A 2PP4A 1GQEA 5J2UE 1HF8A 2IC9A 5LOVE 1VLTA 2EPNA 3NZPA 2IXNA 3VAYA 2JJ9A 3P4SA 5HCMA 3MXZA 1FMVA 3K3QC 4XPWA 2N1GA 3ZPOA 2GK9A 5L2LA 5HWXA 2XY8B 4P6IC 1GS9A 1Q0MA 4CDVA 4H9PC 2VVSA 2I6HA 2FGYA 2J9WA 3VYWA 3CIRA 4YT8A 4QI0A 2UXXB 2CBJA 1ZKEA 2LD6A 4ZZCA 3GANA 1Z5ZA 3UUNA 4U5FE 5AQGB 2F22A 2K48A 3TK0A 3SOLA 1I4YA 1OCOC 2LRLA 4L0RA 1I94T 4IE6A 2HN1A 1D1BA 1YYJA 1UX5A 3W2VA 1WRDA 3CQZA 2X0HA 4IJJA 3KVBA 1ZU5A 1C17M 4GQHA 3OPCA 4OYJA 2H89A 3QNUA 4KHZF 5L0JA 4ZI2C 5AC4A 3ZIBA 2Y3BA 3MKDA 4RBNA 1IAPA 1YZAA 4PJLA 2DI3A 4HFEA 3U2LA 5JDFA 2BG9E 4U7IA 2Z6EA 2XL8A 4XPXA 2XLHA 2XXAA 1ST6A 2XXAB 1PD1A 4DO0A 3C63A 4ZEYA 3NDBB 2WZFA 2IAKA 3H37A 4XWJA 2HKVA 2BKNA 1CGOA 3ITFA 1XMOT 1NU9C 2YDQA 1MQVA 1OCRC 5LNKA 5L0IA 4WGZA 4DR4T 3BQKA 5LXTE 3AVSA 4IL4A 1OW8A 3OWTA 3F47A 2CBIA 4LACB 2YLIA 4WBOA 1S94A 2YU1A 3DAGA 2DNXA 3Q5WA 2Y3GA 5GONE 4CI1B 2VCAA 3MBGA 4NPPA 1E1HB 4UVAB 4I55E 4IE7A 2VWAA 2XAFB 4KMCA 3N2OA 4HFHA 1SMYF 3JCFA 3F46A 1VRBA 3AA7B 4IDNA 2JQKA 2ZPAA 3U3IA 3TJ6A 4XLNF 3JC6D 3Q5XA 4IIJE 2EPMX 4J7YA 4FAPB 4UEMA 2WMOA 5FY0A 4JI6T 2XASB 3PUXF 5JR9A 3HNKA 1YLMA 3AE4A 3ZDLA 3I5QA 2K5BB 2YDSA 1IBKT 4IARA 4OHFA 2YN6A 4EUKB 2LQGA 5F28E 5EK4A 4FWVA 3O9XA 2BVLA 3QW0A 2FJAA 4MFRA 4U72A 3RQFA 3G06A 4OIOF 3RVZA 4QXCB 5KYNA 4C7OA 5EZYE 5JREA 2Y8DA 4C7OB 4U5CE 4DVYP 2Q9BA 3DXJF 2CXDA 3RX6A 4DBRA 3A8YC 3MFNA 3OYZA 4J2CA 1O87A 3K33A 3C4WA 1WASA 3N9LA 3FVYA 2VC9A 3PE0A 1ORSC 2J46A 3UUXB 2FAPB 4C91A 4MVOA 3ZYLA 1C03A 3Q9DA 3ABMC 1XMQT 2JRKA 5L0FA 2AU5A 2YKZA 5CFBA 3LS0A 5FNVE 2VCCA 4P0BA 5FL0A 4YT2A 4AE4A 1QQ3A 4AE4B 1K05A 3E0ZA 4G0HA 3NKZA 4DV3T 1BR1A 5JQGE 2LJLA 4IAOA 2V6YA 1SA0E 4LF8T 2V6YB 2LFFA 4CJGA 3OJAA 4HWFA 3AG3C 4CX9A 3PJAA 2QRXA 1BBHA 4GK0E 1YA9A 3RIFA 3UU5A 2XQ8A 3H2VA 3R7CA 5C8YE 3PDYA 4HGAA 5KYXA 3EJNA 5E0OA 4ULWA 5KYXB 3FBZA 1ZHCA 3A11A 4O79A 5DVWA 1YYXA 5F5WA 4DR5T 4C90A 3C4XA 2C5IT 3EUHA 2H88A 2VKOA 3PU8A 4AI6A 2BC5A 2WBLA 2WB5A 4CSAC 1YVIA 1Q0DA 4L5GA 5A1LA 4PNIA 4PK4A 4H9QC 4YJWA 1A7EA 2L9JA 2R7WA 2XLMA 1T98A 3E22E 4GYTA 3NYLA 3CAXA 5F3JA 5DABA 5HEJA 4UELA 4XEKA 4NXNT 3AE8A 2A0UA 1OCCC 5FCLA 4EYUA 2NR4A 2UXBT 1EZ3A 3PUYF 4KC9A 1G73A 1D1AA 5CJ5A 5B1AC 3TOLA 5A6AA 1B7TA 3KBUA 3U3BA 1SF8A 1OKKA 1IJ6A 3FXEB 3QMKA 2EPKX 4Z90A 2RPAA 3EZHA 5AC5A 3BK9A 5AQMB 3CQGB 3IQ5A 1QUUA 5BQIA 3RH3A 2LOSA 3U8VA 2W4XA 5KYYA 1OXKA 2KK1A 1WYBA 3M3ZB 5KYYB 2FFHA 3RW0A 5DJQC 2CLYB 3GEEA 4JKVA 4PACA 3JSEO 2YEVC 3O55A 3NVOA 4IAQA 2RA1A 2CE7A 4TUYE 1HW1A 3C8ZA 4O6YA 4YJ2E 3UQ4A 3MX3A 4Z9IA 3SYNA 2WB7A 1XNRT 4N6HA 3K3OA 4QWNB 2Y39A 4CN1A 3OTOT 4LF6T 1UFBA 4HEAJ 3UU8A 5CI8A 5ABFA 1HFAA 3LNMB 2CCYA 5ABFB 2EHOC 4PK5A 4WJ0A 3J9X1 3RKOF 4YSXA 4O7GA 3GWHA 3LESA 2SPCA 4DR7T 2L6HA 1IJ5A 1VOMA 2R25A 4X64T 2B0JA 4P1NA 2L81A 4OIPF 3O1HA 5J1GA 1NZEA 2R9RB 4Z9HA 2X9HA 2YK0A 4YT0A 1YARO 4JC7A 4B6IA 2XQ9A 3HL6A 1G5ZA 2KWIB 3U5SA 2W45A 1QLEC 3EG9A 4AXPA 3EG9B 3L39A 1NAFA 4BJ6A 3PU3A 2JMHA 1J8MF 5CB4E 1OEDC 1HW2A 1YQ3A 1NU7D 3PUVF 4JI4T 2LHNA 4KHPT 2IIUA 4DR2T 5HV9A 3KBTA 4X1YE 1L3PA 3UU3A 2X9WA 4B3RT 5LBQB 4AKIA 3WG7C 3AA6B 2J62A 3W15B 3CSKA 3P4QA 4AQFC 3D0TA 1L7CA 2RD9A 4CSAA 2KNHA 3GMIA 4YT5A 2CRBA 1JRAA 4ZXLA 2DYSC 2OV9A 3T1HT 3TLVA 2XS1A 1H6GA 4KX6A 3RYFE 1D0ZA 5L3QA 1RCPA 4X5TA 5C2TA 3C51A 2CMRA 4H54A 1EKYA 4QXHB 4AIUA 2UXCT 2EIKC 2UUBT 2KW3C 5COMA 1HG5A 3TOMA 4CZZB 4JZAA 4BJMA 5L3BB 2KGOA 3EVYA 3K3NA 4WABA 2XLVA 2VVNA 2E8IA 4HE8A 2Z15A 3N9PA 1A0BA 1X9BA 2QY9A 2XLWA 4MNDA 3SRZA 4GKKT 4OD4A 3V5XA 5HSWA 2UUCT 3T8OA 4FI5A 2OU6A 4GYSA 2DYRC 3C18A 4N4WA 4IDPA 5HEUA 2NPUA 2CWYA 5LJNA 3VU7H 5LB7B 2CPTA 3U78A 3G4ZA 1LIHA 3AG1C 3DI5A 2XAQB 3HTKC 2BKOA 4O2AE 2YEVA 5CGMA 5D91A 4B6XA 4MVSA 1XZYA 4H63V 4X65T 3KL4A 2P1AA 3F57A 2W62A 4CI3B 5AQHB 3C50A 4HWDA 2ASRA 1FTSA 3ANWA 3LK2B 2OEVA 3ANWB 3T4RA 3T6BA 3ZJ1A 4P9TA 3HLZA 4PJNA 2X9XA 3AEAA 2EHOA 2GFHA 5FVKA 1K40A 2EHOB 5JP7A 2YHSA 4YL0A 3OEOA 4I4TE 3CVRA 1IW7F 5COFA 2PBEA 2W00A 2CHNA 4YTPA 3ETVA 2L6FA 2OJQA 2J0WA 1H9TA 3I4UA 1Z6AA 2OLTA 3UGPA 5JUAA 5DQTA 3A5XA 4ZI3C 4COFA 5M4YA 4XQ1A 2V8SV 4UR9A 4OD5A 3RIUC 3O6XA 5LHGB 3DAFA 3ZT5A 2J8WA 3NKDA 5FZTA 5J0ZA 2ZM2A 2NOXA 4O4JE 3NWIA 3RVYA 5AQOB 3JAFA 1HMDA 1OEDA 2BS2A 3AE2A 5KYUA 1OEDB 5JRCA 5KYUB 5JRCB 2LSEA 2G3VA 4H9NC 4TZ4C 1MNEA 1RKCA 2XHEB 2CXFA 2DWKA 2VQFT 3GWLA 3KV4A 3RRWA 1YAUO 1NWMX 4AL1A 4MQ9F 4A4AA 1IZNB 3KKBA 4ZI2D 5HXSA 3AGUA 4XEVA 5FKYA 3V5ZA 4DRHB 3ZMVB 5ADXL 4UV9B 4MTGA 2BBHA 4LDKA 2CA5A 1O3XA 2IXPA 3ZCIA 2JD3A 5AQSB 5LG4A 2LE8A 3ZYKA 1WOLA 1IBLT 5IY5C 5L3CB 4JI0T 1FFTC 3B0UX 5EGYA 5AQUB 4PR9A 2LKGA 2QTVA 3UR3C 3AE5A 3B13A 4NIQA 5AQFB 4F4BA 1VCSA 3HR0A 4JEAA 1OXBA 1HY5A 1KNPA 3TKLB 2EIJC 4NTFA 4HTEA 1T72A 3NRXA 4OX9T 2J47A 3I1AA 3PCVA 2TMVP 3LK3B 3UT5E 3UMIA 1HNXT 4YXDA 3FZHB 3H65A 3QK6A 1OKKD 2BS3A 2DGJA 1OCZC 3EHMA 1OQCA 1JMWA 2Q9CA 2CWOA 4TNWA 2IM8A 3IEEA 1ZVZA 2K9AA 4JE9A 4MVMA 1BR2A 3TLUA 1WCRA 3EAMA 3RYIE 1LI7A 3ONJA 1TWHA 3KYJA 3R6NA 5IWAT 3QUJA 2B76A 2DL1A 1Z8UA 3FOPA 4DUZT 2JQQA 4K7BA 4UVBB 1TR2A 2X68A 2JQHA 3PUGA 1M2OA 3CX8B 2G0UA 3DJUB 3RIAA 2LEHA 2QUPA 2Y69C 4EBJA 3O1JA 3FXDB 1E2XA 1KNYA 4JYAT 5IUXA 3P50A 4HKAA 3R2PA 3SZRA 2E2AA 2A68F 1W0BA 4BJNA 3DKAA 5DS5A 4XZCA 2HV6A 4LDQA 2I59A 4CDYA 1CGME 2D2SA 1J8YF 3NRYA 5JVDE 2DHRA 3CQCB 2Y3DA 1T6UA 1A41A 4C3EA 2ACZA 3GM2A 2QA7A 4EEDA 1SYQA 3I9WA 4U9EA 3MK7C 1UURA 2ZXOA 3ZTMA 4ANJA 1W9RA 2R6GF 4IGUA 1V55C 3HKCE 2KSRA 5DS4A 3FZLB 1XDOA 5T1DB 3EI0A 1EI7A 3CWZB 3VKHA 2CYDA 5JT4A 3U2MA 4U5HA 1MIYA 1EA8A 2VCBA 2XM0A 4LFCT 1NFOA 4JI5T 3NMKA 4ADZA 1TWCA 5GPGB 3KYIA 3E08A 3GN5A 4C3DA 3L1MA 3GN5B 2V3CC 4X1KE 2VB6A 3HJCA 3NMIA 4MTOA 3B29A 2XM2A 2XQ7A 4HWIB 2J1DG 4UDVA 4BJ1A 3GEHA 5KYWA 4D4XA 3BQIA 5LG3A 5KYWB 2FJEA 4ZOLE 3AGTA 4CXXA 5ABGA 1ZOYA 2NP9A 3I0OA 3U8PA 3EQLF 3K66A 3M79A 4U3CA 2XTLA 3I5PA 2H7VC 2WZHA 2YRFA 5HEOA 5LGUB 5DQZA 4HFIA 4HN9A 3ASNC 1Z7Qc 3C98B 2H3RA 5AQKB 1Z23A 2LSGA 1MMGA 3US6A 1JNRA 3L8IA 1T9KA 4ZLCA 2AVKA 4HE8D 1NG1A 3TD7A 2IMLA 2YQYA 3LK42 2KJGA 4KI2A 3TLSA 4MVQA 1LS1A 3ZN0B 3OBVE 3T1YT 3CEXA 2E5VA 3RKGA 5A69A 1S7ZA 2LSJA 4JI7T 2LCHA 5FY1A 2ZXWC 3B5MA 2A6HF 2H8AA 4LF4T 2WAUA 1NLXA 4CDAA 3MJXA 4DVDA 1Q0GA 2DB4A 3VRAA 4QX8B 4JV5T 3JAEA 2V7KA 5JDNA 4U5EE 1W0AA 2CXLA 5L4HA 3VR9A 1YKEB 3B57A 2YU2A 2A0BA 3LLIA 2G3KA 4EAHA 3SXKA 4L6RA 3T6JA 4CXWA 2XPKA 1BR0A 1V54C 2IUBA 2EHOD 3PUAA 4PFPA 2FUPA 2LM9A 2K3WA 4M1PA 4IDQA 4LMJA 2KT9A 4U5DE 2A9UA 4LERA 2WDVA 5C3JA 4DOZA 1LRZA 5HXCA 2X0LB 5L3FB 2RP4A 3OVUA 2WY2A 2HSBA 4DJ9A 1N32T 1ZW2A 2R7SA 4YSYA 2XM1A 3DMDA 4DV7T 3MZKB 3EGXA 4OFZA 3FHNA 3NRHA 4IGGA 2GA0A 3EGXB 3B0PA 3P4WA 2ZM6T 5AGFA 3K1IC 2D9DA 2YL7A 5A6BA 2NG1A 2MOZA 4MVUA 3K8PC 3Q7GA 5TJ5E 2LLYA 3Q7LA 2XLOA 2W4BA 4DRJB 2XQ5A 3V7OA 1M2VA 4AX2A 4YT4A 1M2VB 4YSZA 4GOUA 3LFMA 3CX7B 1JOGA 5HWYA 2R7OA 2UXNB 3C4ZA 3N24A 4EZ4A 1H7CA 4KUMB 2ICWG 4I44A 4JW1A 2N2NA 4EYYR 1AUEA 2R02A 4ER9A 1WR6A 4A5XA 5E2QA 1S05A 3MA9A 1VCTA 4DV5T 5DS6A 2I15A 4E7ZA 4X1IE 2VL0A 1IZMA 2HV7A 2CCQA 3LEOA 1YJGA 2VL8A 4TNVA 1HR0T 3JSZA 4UVCB 4TV9E 3N5LA 2O9XA 1M56C 3SFDA 4EHPA 1OEDE 3NBXX 3U0CA 4CXYA 2XM4A 2H7BA 2NWBA 2UUAT 3MYIA 2XJ7A 2NTYA 2R7QA 2PX3A 2BBJA 4U5BE 2HMZA 2GAQA 1C02A 3RPUA 2KSFA 5CIVA 5EHHA 5JRAA 2XUEA 4QX7B 2HSQA 1YXRA 2L7AA 4AQYT 1Z0PA 3PJAJ 4H9OC 4A98A 4DBQA 1B68A 1LPEA 4YY3T 2V5DA 3IQTA 4IL9A 2OA5A 2WWUA 4YN0B 3SXYA 1KNZA 3R84B 2NW9A 3ECSA 4YLHA 5JDHA 3LSVA 2JIWA 2ACXA 4XLPF 1H7IA 3N0TA 1KNRA 4XAXB 5L3VA 3SS1A 2MAWA 2WP9A 4K0DA 2M64A 1OW7A 3AE9A 1WR0A 3HA4A 5B3IA 4NCQA 2MBGA 4O6NA 3AAAB 1QZXA 2HPLA 1LE4A 4JUYA 4IB4A 3F31A 3UMHA 1CHUA 2V6XA 3G4XA 4IWBA 2I0MA 5HYAA 3PDMP 3POVA 4KP3C 2W63A 2LKHA 2WM9A 4EIWA 1D1CA 2X0CA 2KWHA 2IXMA 4CS8C 2YLDA 5FMNA 1L0VA 5L0HA 5FL1A 2PBIA 2L8KA 4ZI3D 4LLCA 1Y01A 3UU4A 3DM9B 3K1IA 1WTYA 2KXPB 4QH5A 3AQCA 5HXEA 1KF6A 3AAEB 2J7PA 4IDZA 1VMAA 4TN7B 4U74A 3AXJB 3EPVA 3NYJA 3ZC1A 1HTJF 1HNZT 1KK7A 1LI5A 4ZS3A 4Z8XA 5AQIB 1W2WA 3ONXA 2CEAA 1HMOA 3FAJA 2NSFA 2R7XA 2LP4A 3FMSA 1NEKA 1G4WR 1YD8G 1M7KA 3AEDA 4JBWF 3IA3A 4K0KT 5JDMA 4DR6T 1QVXA 4OK0A 3K7DA 5LMUT 4BG0A 2L3LA 3J06A 1IBMT 5DQVA 3FXHA 3ZJ2A 5COGA 3TULA 2W4MA 2R7TA 2D5UA 1ZHYA 3M4BA 4Q7CA 4JEBA 1JAFA 1E85A 3O4XE 4P09A 2Q9QC 2A3DA 4ISTA 1E7PA 5KXJA 2BDEA 1CUNA 4DR1T 1PCXA 3IF8B 4GEHA 3T6GB 4YWQA 4RD9A 2VKHA 2HMQA 4ULVA 2Q3TA 1T7SA 3ZC0A 1AVOB 5DQWA 1N1CA 4ERRA 2WMNA 2VURA 1UG7A 3W2WA 2OG2A 4DV2T 4H4KC 4ZZBA 3CZ6A 2V7JA 1U6HA 3AG4C 3LUTB 5LJMA 5AQJB 4LMKA 1HE1A 3IQCA 2Y6XA 3ONLC 1FFHA 4MALA 2VKJA 5JDQA 4B3TT 4CN4A 2R7UA 4UXNB 3P4RA 4U9DA 2X67A 3H3MA 2KYHA 3VR8A 4ZI7E 5B1BC 3BQLA 4EGWA 4RDAA 2UUHA 3C8GA 3SEOA 3C8GB 4D4NA 2HN2A 5JVEA 4JURI 2EILC 4Z91A 4OIRF 1FAPB 2LIGA 1WGWA 2R7RA 1Y6DA 2LOPA 2G62A 4B3MT 4N06A 4I0UA 3K6BA 3ZQYA 2WU2A 1E2AA 2J9BA 2M4EA 5JDLA 1MMDA 1SZIA 1KU2A 1ZV4X 4O8SA 3SP1A 3OA1A 1R5ID 2MTQA 4EBKA 5LA6E 3EDUA 5CA1E 5JTGA 4EIYA 4DVZA 1W09A 3WHNA 2AP3A 2CHOA 3MYFA 1N34T 2ZM8A 1UCUA 4I3MA 5L0CA 4JLEA 3VRCA 2FJBA 3PTRB 4EXTA 3W8IA 3AAIA 1R4TA 1WN0A 2D0TA 1PV3A 2V5CA 1Q0KA 1TWGA 3AVRA 4MVRA 2B1EA 3PURA 1TWAA 1HNWT 2WZGA 2X0YA 3O39A
chains in the Genus database with same CATH topology
4NUUA 2M67A 5BMVE 4KNWA 4DMWA 3RKOA 1VYKA 4EZHA 3FBLA 2PF4E 2VK9A 4AQFA 3V5UA 4KBMB 3L3PA 3ZMUB 2ZXPA 1FIOA 4JVSA 3S29A 3S4UA 4ILUA 3DM5A 2Q9QA 2Q9QB 4O4HE 1LVFA 5E3CA 3FDQA 3PUSA 1D0YA 4HFVA 3EFOA 3ZLIA 4QI2A 3EFOB 3RFYA 4TX5A 2BVMA 4H63H 2KNDA 1SHZC 2CDQA 5LHHB 2YZSA 3X2QC 4I1MA 4V1Av 3NZQA 5BUOA 3J7Yq 2X66A 2NW8A 3MACA 2KQ9A 2VASA 4XBFB 3W8HA 4EWCA 3LS1A 4QXBB 3KMIA 4G7OF 2Y48B 4I1OB 3O1IA 4WNKA 2MYSA 2WZLA 3P8CD 2IC6A 1RJ9A 3DTOA 1RJ9B 5JR9C 4AK9A 4IE0A 3ZMTB 3I9YA 3N2ZB 4A2NB 5IHYA 4N78D 3WAJA 3CPZA 4I43B 4YJ3E 4G7ZF 2WVOA 3NYMA 3RC8A 1LKXA 3EHNA 3K1HA 3IHRA 2C0SA 4UF0A 1MIVA 4UF0B 5H6QB 3RYCE 4BA9A 3OYXA 2XAGB 3M65A 3V5SA 2J7PD 3ZCJA 3EGDA 5LGNB 3EGDB 2ZLYA 3LG7A 3S28A 3ABKC 4OIQF 2H7OA 4ISSA 2HPJA 3IBPA 2C5JA 4MHCA 2LHRA 1WLXA 2HH7A 2JPFA 2MWQA 1TKNA 3EZIA 3RIPA 5F5FA 3AB3B 3KINB 5FXXA 3PHF2 3LJCA 2BE5F 1Z3IX 1BR4A 3Q6NA 5FY7A 2E87A 3N2KE 3QZCA 2X51A 2NW7A 2C04A 5TAOA 4J30B 3DP7A 3L0IA 3E70C 5L3GB 1ZHXA 4QHOA 1ZU4A 5FXWA 3UNGC 5E33A 3AA1B 2XRHA 3UULA 3LBXA 2BZBA 3LBXB 3ZMZB 4OYKA 1MMNA 4PJJA 4YHJA 4MLKA 3FHDA 3KVAA 2E9XC 4JEHB 2P9BA 4IRUA 5L3EB 2C03A 1WYCA 2CLYC 4UIGA 2DLRA 2VKDA 4Q5SF 3QC9A 2IW5B 4W8KA 2KLQA 5JR9B 2J9UA 3PMRA 1D0XA 3SWHA 2ZMAA 5J2TE 5H6RB 3UTKA 4J32B 3S27A 2DI4A 3KV5A 1YKHB 4LLEA 2CNWD 3AG2C 2PFDA 2J9VA 4ZS2A 5FXZA 1M57C 3N9OA 4JCHA 5F8PA 4P0AA 4IE5A 4BJ5C 5LHIB 4PFOA 3WAKA 1US7B 2N9DA 4BAYB 4FJOA 2D0UA 2W0GA 1ZHTA 2LSIA 4L9IA 4BJ6C 5D92A 3Q2MA 3E9VA 2V7MA 4BEJA 2I8BA 4ASKA 3LLKA 2C5KT 4O4LE 4O4IE 4EB6E 2Q9QD 5HXRA 4HEAA 4K0UA 3JCUQ 3H3AA 3L09A 5DLJA 2ES0A 3UMKA 4DNDA 4XTKA 3RYLA 3I0QA 2PG8A 3N9QA 4PJMA 3ZN1B 4ZLDA 4G7HF 3KH2A 2KZ7B 3VHLA 4A56A 2ODVA 3JC6C 2E9XA 3OKQA 2P6VA 4CS9C 2E9XB 4AKGA 5EK3A 4AKHA 1HS7A 1HG2A 3RYHE 2JMKA 4CS7A 4H9SE 4GK5E 4AKRB 5FP3A 1AJ3A 1VK5A 5IYZE 3C64A 4ZHQE 4GYRA 2K24A 3EDVA 4PK6A 3S0XA 3AA0B 3N9MA 5LP6E 1FEWA 4C3BA 2J45A 2NUTA 1X79A 2NUTB 4WBNE 3M1CB 3ABLC 3DD7A 2D5RB 4YFSA 2QGSA 4BJ5A 1ZHWA 4O2BE 5KX5E 4CBEA 4G2AA 2XAJB 1UX4A 2DWGA 2KINB 2L9QA 5KMGP 4FESA 3ZYMA 1OWAA 2LSYA 4WW0A 2A1DD 2A6EF 2WSSV 3LJBA 5HAXA 3MLGA 3ZC4A 4TV8E 1JPJA 1MNDA 2WL8A 1VYIA 5CI9A 2PX0A 5LCYA 4BJTA 3EH2A 3EH1A 2CW0F 4U5GA 3NKEA 3JYHA 2IXOA 1S35A 1ZHZA 2ZXRA 3ETUA 4PW8A 5CA0E 2A2FX 2CGEA 3CMLA 1MMAA 2V7IA 3ESLA 5AFUL 3F2EA 4JJGA 3PUQA 2DCFA 2OCCC 5JH7E 2A72A 1O5HA 3UGOA 3WI3A 1QSDA 4CS9A 3HKEE 4PAGA 3NG1A 3DJNB 2VH3A 3CKDA 4I50E 2XL4A 2XAHB 3ZEFB 2A69F 3AQBA 1ZEEA 3B9QA 5HXHA 3ZVRA 4Q4ZF 2W9YA 2EIMC 5T3TA 5T3WA 3DJBA 3LAYA 4AQGA 2XQYA 3P7IA 3CX6B 3JRTA 4CS8A 1FMWA 4F6RC 4JJFA 5E3AA 3B0VC 4IHJE 3N9NA 2CNWA 1U5PA 5LBMA 1JPNA 5FXVA 3ASOC 5LYJE 3GA8A 2XSEA 1U4QA 3KFWX 4CQIA 4M63A 4IE4A 3N2GE 3KV6A 2V26A 4DMVA 4E7SA 3DZAA 2WVQA 3ZSUA 4MBQA 4OINF 3SNHA 3HI2A 3FB2A 3JT1A 1G8XA 4AKLA 4CIHA 3KDSE 2LSKA 4CI2B 1V9DA 3ZG1A 4FX5A 1HX8A 4X0RA 3LNRA 4JEUB 5JDGA 1Z63A 4EOZB 5LGTB 3VKGA 2P7VA 4NY3A 3KV9A 1Y64B 2YINA 1HCIA 3GODA 5FYMA 4KNVA 1PD0A 2KMFA 2W61A 4O6MA 2PFVA 1YW0A 2NUPA 2Q9AA 4X20E 3ZMSB 2ODUA 2NUPB 2NTXA 3L34A 5F5HA 2R7VA 2X9YA 4HFFB 3CQXC 4GIWA 2LT3A 1ZYRF 3Q6MA 4H9RC 4QKNA 5KDMC 5ETWA 2Y3HA 4UV8B 5B3SC 3X1OA 2EINC 2V7LA 2ZM0A 4QDLA 5L3DB 3LEVA 2WVNA 2IYLD 2E9XD 2J0XA 4G63A 4KBLA 3RC3A 4HFKB 3UFEA 1OXZA 3UUMA 5EK2A 1MIWA 3HKDE 3RRCA 4NUVA 2IOQA 2V1DB 1LVKA 4EBBA 2PJQA 3WODF 3HKBE 2CM0A 2PP4A 5J2UE 1HF8A 2IC9A 5LOVE 2IXNA 3NZPA 3VAYA 2JJ9A 3MXZA 1FMVA 3K3QC 2N1GA 3ZPOA 2GK9A 5L2LA 5HWXA 4P6IC 4H9PC 2FGYA 2J9WA 3VYWA 4YT8A 4QI0A 2UXXB 1ZKEA 3GANA 1Z5ZA 3UUNA 4U5FE 2K48A 3SOLA 1OCOC 4L0RA 4IE6A 1D1BA 1UX5A 3W2VA 1WRDA 3CQZA 4IJJA 3KVBA 1ZU5A 4OYJA 4ZI2C 3ZIBA 2Y3BA 3MKDA 4RBNA 1IAPA 4PJLA 5JDFA 2Z6EA 2XXAA 1ST6A 2XXAB 1PD1A 4DO0A 3NDBB 2WZFA 2IAKA 3H37A 4XWJA 3ITFA 1NU9C 1OCRC 5LNKA 3BQKA 5LXTE 3AVSA 3OWTA 3F47A 4LACB 4WBOA 1S94A 2YU1A 3DAGA 2DNXA 3Q5WA 2Y3GA 5GONE 4CI1B 1E1HB 4UVAB 4I55E 4IE7A 2VWAA 2XAFB 4KMCA 3N2OA 1SMYF 3F46A 1VRBA 3AA7B 2ZPAA 3U3IA 4XLNF 3JC6D 3Q5XA 4IIJE 4UEMA 2WMOA 5FY0A 2XASB 5JR9A 3I5QA 2K5BB 4OHFA 5EK4A 4FWVA 3O9XA 2BVLA 4MFRA 4U72A 4OIOF 4QXCB 5KYNA 4C7OA 5EZYE 5JREA 2Y8DA 4C7OB 4U5CE 4DVYP 2Q9BA 3DXJF 2CXDA 3RX6A 4DBRA 3OYZA 4J2CA 1O87A 3K33A 3C4WA 3N9LA 3FVYA 3PE0A 2J46A 3UUXB 4C91A 3ZYLA 3Q9DA 3ABMC 2JRKA 3LS0A 5FNVE 4P0BA 4YT2A 4AE4A 4AE4B 3E0ZA 4G0HA 1BR1A 5JQGE 2LJLA 4IAOA 1SA0E 3OJAA 3AG3C 4GK0E 5C8YE 3PDYA 4HGAA 5KYXA 3EJNA 5E0OA 4ULWA 5KYXB 3FBZA 1ZHCA 4O79A 5DVWA 4C90A 3C4XA 2C5IT 3EUHA 2VKOA 3PU8A 4AI6A 2WBLA 4CSAC 4L5GA 5A1LA 4PNIA 4PK4A 4H9QC 4YJWA 2L9JA 2R7WA 1T98A 3E22E 4GYTA 3NYLA 5F3JA 5DABA 4UELA 1OCCC 5FCLA 4EYUA 1EZ3A 4KC9A 1G73A 1D1AA 5B1AC 1B7TA 3KBUA 1SF8A 1OKKA 1IJ6A 3FXEB 3QMKA 3EZHA 3BK9A 3CQGB 1QUUA 3RH3A 2LOSA 5KYYA 1WYBA 5KYYB 2FFHA 5DJQC 2CLYB 2YEVC 2RA1A 2CE7A 4TUYE 4O6YA 4YJ2E 3MX3A 3SYNA 2WB7A 3K3OA 4QWNB 2Y39A 4HEAJ 5CI8A 1HFAA 2EHOC 4PK5A 4WJ0A 3J9X1 3RKOF 4O7GA 3GWHA 3LESA 2SPCA 1IJ5A 1VOMA 2B0JA 2L81A 4OIPF 3O1HA 5J1GA 1NZEA 2X9HA 2YK0A 4B6IA 3HL6A 2KWIB 2W45A 1QLEC 3EG9A 4AXPA 3EG9B 1NAFA 4BJ6A 3PU3A 2JMHA 1J8MF 5CB4E 1NU7D 2LHNA 3KBTA 4X1YE 2X9WA 5LBQB 4AKIA 3WG7C 3AA6B 3W15B 3CSKA 4AQFC 3D0TA 4CSAA 2KNHA 3GMIA 4YT5A 2DYSC 3RYFE 1D0ZA 5L3QA 3C51A 2CMRA 4QXHB 2EIKC 2KW3C 1HG5A 4CZZB 4JZAA 4BJMA 5L3BB 2KGOA 3EVYA 3K3NA 2E8IA 4HE8A 2Z15A 3N9PA 2QY9A 4MNDA 3SRZA 4OD4A 5HSWA 3T8OA 4FI5A 4GYSA 2DYRC 2CWYA 5LJNA 3VU7H 3U78A 3AG1C 2XAQB 3HTKC 4O2AE 2YEVA 5D91A 4B6XA 4H63V 3KL4A 3F57A 2W62A 4CI3B 3C50A 1FTSA 3ANWA 3LK2B 3ANWB 3T4RA 3T6BA 3ZJ1A 3HLZA 4PJNA 2X9XA 2EHOA 2GFHA 2EHOB 2YHSA 3OEOA 4I4TE 3CVRA 1IW7F 2W00A 3ETVA 2J0WA 3I4UA 1Z6AA 3UGPA 5DQTA 3A5XA 4ZI3C 5M4YA 4OD5A 3O6XA 5LHGB 3DAFA 3NKDA 2ZM2A 2NOXA 4O4JE 5KYUA 5JRCA 5KYUB 5JRCB 2LSEA 2G3VA 4H9NC 4TZ4C 1MNEA 2XHEB 2CXFA 2DWKA 3KV4A 3RRWA 1NWMX 4MQ9F 1IZNB 3KKBA 4ZI2D 5HXSA 3ZMVB 5ADXL 4UV9B 2CA5A 1O3XA 2IXPA 3ZCIA 2JD3A 5LG4A 2LE8A 3ZYKA 5IY5C 5L3CB 3B0UX 1FFTC 5EGYA 2QTVA 3UR3C 3B13A 4F4BA 3HR0A 3TKLB 2EIJC 4HTEA 3NRXA 3I1AA 3LK3B 3UT5E 3UMIA 3H65A 3QK6A 1OKKD 2DGJA 1OCZC 3EHMA 2Q9CA 2CWOA 3IEEA 2K9AA 1BR2A 3RYIE 1TWHA 3R6NA 3QUJA 2JQQA 4K7BA 4UVBB 1TR2A 2X68A 3PUGA 1M2OA 3CX8B 2G0UA 3DJUB 2LEHA 2Y69C 3O1JA 3FXDB 4HKAA 3SZRA 2A68F 4BJNA 5DS5A 4XZCA 2HV6A 2I59A 2D2SA 1J8YF 3NRYA 5JVDE 2DHRA 3CQCB 2Y3DA 4C3EA 2QA7A 3I9WA 3MK7C 2ZXOA 4ANJA 4IGUA 1V55C 3HKCE 5DS4A 5T1DB 3CWZB 3VKHA 4U5HA 1MIYA 4ADZA 1TWCA 3E08A 3GN5A 4C3DA 3GN5B 2V3CC 4X1KE 2VB6A 3HJCA 2J1DG 4BJ1A 5KYWA 3BQIA 5KYWB 4ZOLE 4CXXA 2NP9A 3I0OA 3EQLF 3K66A 2XTLA 3I5PA 2H7VC 5LGUB 5DQZA 4HN9A 3ASNC 3C98B 2H3RA 1Z23A 2LSGA 1MMGA 4ZLCA 4HE8D 1NG1A 3TD7A 3LK42 2KJGA 4KI2A 1LS1A 3ZN0B 3OBVE 1S7ZA 2LSJA 5FY1A 2ZXWC 2A6HF 2WAUA 3MJXA 4DVDA 4QX8B 2V7KA 5JDNA 4U5EE 2CXLA 1YKEB 3B57A 2YU2A 3LLIA 2G3KA 4EAHA 3T6JA 4CXWA 1BR0A 1V54C 3PUAA 2EHOD 4PFPA 2LM9A 4M1PA 2KT9A 4U5DE 4LERA 4DOZA 1LRZA 5HXCA 2X0LB 5L3FB 2RP4A 2R7SA 3DMDA 3MZKB 3EGXA 4OFZA 3FHNA 3NRHA 3EGXB 3B0PA 3K1IC 2NG1A 2MOZA 3K8PC 3Q7GA 3Q7LA 2W4BA 3V7OA 1M2VA 4AX2A 4YT4A 1M2VB 4GOUA 3LFMA 3CX7B 5HWYA 2R7OA 2UXNB 3C4ZA 3N24A 4EZ4A 1H7CA 4KUMB 4JW1A 4I44A 2N2NA 4EYYR 1WR6A 5E2QA 3MA9A 5DS6A 4E7ZA 4X1IE 1IZMA 2HV7A 2CCQA 2VL8A 3JSZA 4UVCB 4TV9E 3N5LA 2O9XA 1M56C 3NBXX 4CXYA 2H7BA 2NWBA 2NTYA 2R7QA 2PX3A 4U5BE 3RPUA 5EHHA 2XUEA 4QX7B 1Z0PA 4H9OC 4DBQA 2OA5A 2WWUA 4YN0B 1KNZA 3R84B 2NW9A 3ECSA 4YLHA 5JDHA 2ACXA 4XLPF 3N0TA 4XAXB 5L3VA 3SS1A 4K0DA 3HA4A 2MBGA 4O6NA 3AAAB 1QZXA 2HPLA 4JUYA 3F31A 3UMHA 4IWBA 5HYAA 3POVA 4KP3C 2W63A 2WM9A 4EIWA 1D1CA 2KWHA 2IXMA 4CS8C 5FMNA 2PBIA 2L8KA 4ZI3D 4LLCA 3DM9B 2KXPB 3AQCA 5HXEA 3AAEB 2J7PA 4IDZA 1VMAA 4TN7B 4U74A 3EPVA 3NYJA 3ZC1A 1HTJF 1KK7A 4ZS3A 4Z8XA 1W2WA 3ONXA 2CEAA 3FAJA 2R7XA 1YD8G 5JDMA 4OK0A 3K7DA 4BG0A 2L3LA 5DQVA 3ZJ2A 2W4MA 2R7TA 2D5UA 1ZHYA 4Q7CA 3O4XE 4P09A 2Q9QC 2A3DA 4ISTA 2BDEA 1CUNA 1PCXA 3IF8B 4GEHA 4YWQA 4RD9A 2VKHA 2Q3TA 3ZC0A 5DQWA 1N1CA 4ERRA 2WMNA 3W2WA 2OG2A 4H4KC 3CZ6A 2V7JA 3AG4C 5LJMA 2Y6XA 1FFHA 4MALA 2VKJA 5JDQA 2R7UA 4UXNB 2X67A 4ZI7E 5B1BC 3BQLA 4RDAA 3SEOA 4JURI 2EILC 4OIRF 1WGWA 2R7RA 2LOPA 2G62A 4N06A 3K6BA 2M4EA 5JDLA 1MMDA 1SZIA 1KU2A 1ZV4X 4O8SA 3SP1A 3OA1A 2MTQA 5LA6E 3EDUA 5CA1E 4DVZA 2ZM8A 1UCUA 4I3MA 4JLEA 3PTRB 4EXTA 3W8IA 3AAIA 2D0TA 1TWGA 3AVRA 2B1EA 3PURA 2WZGA 1TWAA 3O39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEE A;  3RH3 A;  4YJW A; 
#chains in the Genus database with same CATH topology
 4NUU A;  2IHR 1;  5A6B D;  3T9O A;  2M67 A;  3RGL A;  5BMV E;  4K1O A;  4KNW A;  4DMW A;  3RKO A;  4ILA A;  1VYK A;  4EZH A;  3FBL A;  3ZT7 A;  3KPH A;  2PF4 E;  2VK9 A;  4AQF A;  3V5U A;  4KBM B;  3L3P A;  3ZMU B;  1QPU A;  5BQG A;  4HFC A;  2ZXP A;  4YHH T;  1FIO A;  4JVS A;  4JTD B;  3S29 A;  2XS8 A;  2WCA A;  5L4E A;  3S4U A;  2PTF A;  4ILU A;  2YL0 A;  3DM5 A;  3L8R A;  2Q9Q A;  1N33 T;  1VLS A;  2Q9Q B;  3EAB A;  4O4H E;  4IT4 A;  3AE7 A;  1LVF A;  3RQG A;  5E3C A;  2UUI A;  1RKE A;  3FDQ A;  1N36 T;  3PUS A;  1RKE B;  1D0Y A;  4HFV A;  3RI5 A;  3EFO A;  3ZLI A;  4QI2 A;  2WS3 A;  3EFO B;  2GDC A;  3RFY A;  3HNJ A;  4TX5 A;  3RLF F;  2LFD A;  2BVM A;  4CN6 A;  4ONS A;  4H63 H;  4HFB A;  4JI8 T;  3RHW A;  3QB5 K;  3ZT6 A;  4YTN A;  2KND A;  1SHZ C;  2CDQ A;  5LHH B;  1T8B A;  2YZS A;  3X2Q C;  1T01 A;  2ZD9 A;  4V1A v;  4I1M A;  1ZW3 A;  2W2U A;  3NZQ A;  2YL3 A;  5BUO A;  3J7Y q;  3O10 A;  4JRZ A;  2X66 A;  2NW8 A;  3MAC A;  2KQ9 A;  2VAS A;  2WWV A;  4XBF B;  3W8H A;  1V4A A;  4EWC A;  1XZP A;  3LS1 A;  2W67 A;  2D4U A;  3ZWI A;  1Y4C A;  4QXB B;  2EPL X;  3KMI A;  4G7O F;  5ABE A;  2Y48 B;  4ILB A;  4I1O B;  2WU5 A;  3O1I A;  1CPR A;  4WNK A;  2MYS A;  2WZL A;  4Z9J A;  2AE9 A;  3P8C D;  2IC6 A;  3ZTZ A;  4LML A;  1RJ9 A;  3DTO A;  1Q0F A;  1RJ9 B;  5JR9 C;  2AWY A;  4AK9 A;  1LM3 B;  3QW1 A;  2GWW A;  4IE0 A;  3ZMT B;  3I9Y A;  3N2Z B;  4A2N B;  2XLE A;  5IHY A;  4LFB T;  5AQT B;  1CPQ A;  2VQE T;  2WZI A;  4N78 D;  1M62 A;  3WAJ A;  3CPZ A;  4CJO A;  4I43 B;  4YJ3 E;  4JTC B;  1HX1 B;  4G7Z F;  4LFA T;  2WVO A;  3NYM A;  3RC8 A;  1LKX A;  3IPM O;  3EHN A;  3K1H A;  3EHZ A;  4IDO A;  3IHR A;  2C0S A;  2YVK A;  4UF0 A;  3RIU A;  1MIV A;  4UF0 B;  4E17 A;  5H6Q B;  3RYC E;  4E18 A;  1KEY A;  3UUB A;  4W8P A;  5L0D A;  4BA9 A;  3OYX A;  2XAG B;  4YL1 A;  3M65 A;  3V5S A;  2J7P D;  1DOW A;  3ZCJ A;  3UQ7 A;  4DV4 T;  3EGD A;  5LGN B;  3EGD B;  3H2U A;  3UU6 A;  3U9M A;  2OJE D;  2LM2 A;  2ZLY A;  3LG7 A;  3S28 A;  3AEF A;  4WZX A;  3ABK C;  4U31 A;  4OIQ F;  2H7O A;  4ISS A;  2M6B A;  2HPJ A;  4DUY T;  3IBP A;  2XL6 A;  1TFO B;  2C5J A;  4EV6 A;  4DV6 T;  4MHC A;  2MHR A;  2LHR A;  2WDQ A;  1ORY A;  1WLX A;  2HH7 A;  1E83 A;  2JPF A;  1NBB A;  3G50 A;  2MWQ A;  1TKN A;  3EZI A;  3RIP A;  5F5F A;  3AB3 B;  3KIN B;  5FXX A;  3PHF 2;  1I4Z A;  5AQN B;  1A7V A;  3LJC A;  2BE5 F;  2OQM A;  1Z3I X;  5AQP B;  3ATP A;  1BR4 A;  2B0H A;  4AIS A;  3Q6N A;  3L8J A;  5FY7 A;  5BR8 T;  2BL2 A;  2E87 A;  1UGO A;  3N2K E;  1EQ1 A;  3QZC A;  2X51 A;  2NW7 A;  2C04 A;  5TAO A;  4J30 B;  3DP7 A;  1R8I A;  3B71 A;  4E0I A;  4NTA A;  3L0I A;  5A6J A;  3E70 C;  1NEN A;  1SUM B;  4BEM J;  2P61 A;  4KI0 F;  4U2Z A;  5L3G B;  1ZHX A;  1YQ4 A;  4QHO A;  1ZU4 A;  5FXW A;  3DE9 A;  3UNG C;  2HHH T;  1ORJ A;  1I6Z A;  5E33 A;  4U33 A;  3AA1 B;  2XRH A;  3UUL A;  3LBX A;  3M15 A;  3FZF B;  4HFD A;  2BZB A;  3LBX B;  3ZMZ B;  2HFI A;  3QTH A;  4EKW A;  4OYK A;  3RQW A;  1MMN A;  4PJJ A;  4YHJ A;  3AEG A;  5AQR B;  2XQA A;  4MLK A;  1OR2 A;  3FHD A;  3KVA A;  4JIO A;  2E9X C;  4JEH B;  4CIP A;  2P9B A;  4TWD A;  4IRU A;  1ZP0 A;  3C8G D;  3SFE A;  5L3E B;  2AXD S;  2C03 A;  4QH4 A;  1WYC A;  2CLY C;  4UIG A;  2DLR A;  2VKD A;  1NFN A;  4Q5S F;  3QC9 A;  2IW5 B;  4W8K A;  2KLQ A;  2W66 A;  5AQQ B;  5JR9 B;  4ILC A;  2J9U A;  3ZSS A;  5ABH A;  3PMR A;  1D0X A;  3SWH A;  4DXW A;  2ZMA A;  5J2T E;  3W4Y A;  1QKR A;  3M4C A;  5H6R B;  3UTK A;  3HNL A;  5JLI A;  4J32 B;  2R03 A;  3DWW A;  2Q7R A;  2M6I A;  3S27 A;  2DI4 A;  1T6Q A;  4JCZ A;  1KFY A;  3KV5 A;  3JYY A;  1YKH B;  2QVA A;  4LLE A;  1M6T A;  4E0H A;  4B3S T;  4WYV A;  2CNW D;  2BG9 C;  2YL1 A;  3C62 A;  3AG2 C;  2Q4F A;  2PFD A;  3FZM B;  2J9V A;  4ZS2 A;  5FXZ A;  1M57 C;  1UUS A;  3N9O A;  4JCH A;  3GWN A;  5F8P A;  4P0A A;  4IE5 A;  4U2Y A;  4BJ5 C;  5LHI B;  2XSA A;  4PFO A;  3JAD A;  3WAK A;  1US7 B;  2N9D A;  4BAY B;  4FJO A;  2D0U A;  2W0G A;  3JTL O;  1ZHT A;  2LSI A;  4L9I A;  3ZKR A;  1XNQ T;  4BJ6 C;  2XLD A;  5D92 A;  1FJG T;  3Q2M A;  5EK0 A;  2YLG A;  2HUJ A;  3E9V A;  3UFG A;  2V7M A;  3RQE A;  4BEJ A;  1U0B B;  2I8B A;  1CGN A;  4ASK A;  2HS5 A;  3LLK A;  2C5K T;  1GGQ A;  3V5Y A;  4O4L E;  4O4I E;  4XEF A;  4EB6 E;  3TLT A;  2Q9Q D;  5HXR A;  4EEB A;  2RSE B;  1JR8 A;  1OW6 A;  4HEA A;  2UXD T;  4K0U A;  2OEX A;  3JCU Q;  3H3A A;  3L09 A;  5DLJ A;  2ES0 A;  2QE9 A;  1XZQ A;  3UMK A;  4DND A;  4XTK A;  1J1J A;  3RYL A;  2XZE A;  1WAT A;  2XQ4 A;  3I0Q A;  1E86 A;  2PG8 A;  2J4G A;  3N9Q A;  4PJM A;  3AE6 A;  3C7J A;  3ZN1 B;  4ZLD A;  4G7H F;  1UK5 A;  2F4V T;  1QSP A;  1RMV A;  3VF0 A;  3K1S A;  3TQO A;  3AEE A;  4DID B;  1ZZP A;  3BRJ A;  3KH2 A;  3PV0 F;  4QH1 A;  3U9J A;  1DU2 A;  2KZ7 B;  3VHL A;  1SR2 A;  2LRK A;  4A56 A;  2ODV A;  3JC6 C;  2E9X A;  3OKQ A;  2P6V A;  4CS9 C;  2E9X B;  3PUW F;  5EK3 A;  4AKH A;  4AKG A;  1BDJ B;  3Q5D A;  1F1M A;  3RQU A;  4DV1 T;  1HS7 A;  1HG2 A;  3RYH E;  2JMK A;  3DE8 A;  4CS7 A;  2NSG A;  1XWM A;  2UU9 T;  4H9S E;  4GK5 E;  4AKR B;  5FP3 A;  1LE2 A;  2FBW A;  1AJ3 A;  2YOE A;  1VK5 A;  1I5N A;  3ZST A;  5IYZ E;  3C64 A;  3BEH A;  4A97 A;  4ZHQ E;  4GKJ T;  4GYR A;  2K24 A;  3EDV A;  4PK6 A;  5AQL B;  3S0X A;  3AA0 B;  3N9M A;  3IQ6 A;  5LP6 E;  1FNT c;  1FEW A;  4C3B A;  1NSG B;  2J45 A;  3QVZ A;  3HKK A;  2NUT A;  1X79 A;  2NUT B;  4WBN E;  2BG9 A;  3M1C B;  3ABL C;  2BG9 B;  3DD7 A;  3QOF A;  3AXJ A;  3PUZ F;  2D5R B;  2YWA A;  4YFS A;  2QGS A;  5JSL A;  2ETS A;  2IBF A;  3TJ5 A;  4BJ5 A;  2WDR A;  3QB5 A;  1ZHW A;  4O2B E;  5KX5 E;  4CBE A;  3A7M A;  4MW8 A;  4G2A A;  4LF5 T;  2HJM A;  5HEH A;  2XAJ B;  4J7T A;  1UX4 A;  3Q5E A;  2LK4 A;  2DWG A;  2KIN B;  2L9Q A;  2E5L T;  1YA7 O;  4MTF A;  5KMG P;  3A9C A;  4FES A;  3ZYM A;  1OWA A;  3WAQ A;  2KC3 A;  2LSY A;  4WW0 A;  4JTA B;  5HEG A;  2A1D D;  3NMJ A;  2JQ9 A;  2A6E F;  4NC3 A;  2WSS V;  3LJB A;  4WGY A;  4X66 T;  5HAX A;  1KTM A;  4JI2 T;  3MLG A;  2HJ3 A;  4MS2 A;  3ZC4 A;  3FAP B;  4TV8 E;  4DR3 T;  4TWH A;  1MND A;  1JPJ A;  2EPO A;  2WL8 A;  1VYI A;  2WQY A;  5CI9 A;  2PX0 A;  5LCY A;  2HZ8 A;  4BJT A;  3EH2 A;  1OR3 A;  3EH1 A;  3U3F A;  2CW0 F;  3RF3 A;  1K04 A;  4U5G A;  3NKE A;  3JRM O;  3JYH A;  2IXO A;  1S35 A;  1ZHZ A;  2YDR A;  2ZXR A;  3ETU A;  4PW8 A;  3GM3 A;  3CK6 A;  5CA0 E;  3GM1 A;  2A2F X;  2CGE A;  3P4P A;  3CML A;  1MMA A;  2V7I A;  3ESL A;  4YL3 A;  4AL0 A;  5AFU L;  3F2E A;  4JJG A;  3PUQ A;  1RXQ A;  2DCF A;  2OCC C;  3S90 A;  3AE3 A;  2OOC A;  1YZC A;  5JH7 E;  2A72 A;  4YTM A;  1AEP A;  1O5H A;  3WI3 A;  3UGO A;  2QYW A;  2L6G A;  1QSD A;  4CS9 A;  1U89 A;  3HKE E;  4PAG A;  3NG1 A;  2PNO A;  3DJN B;  2P0N A;  2VH3 A;  1E84 A;  5A6K A;  3CKD A;  4I50 E;  3X1D A;  3JZ0 A;  2XL4 A;  2XQ6 A;  2XAH B;  1HE9 A;  3FOO A;  4R32 A;  3ZEF B;  2A69 F;  1T6I A;  1WWP A;  3QVY A;  3AQB A;  1ZEE A;  3B9Q A;  5HXH A;  3ZVR A;  4JI3 T;  4Q4Z F;  2W9Y A;  2EIM C;  5T3T A;  5T3W A;  4BPM A;  3DJB A;  3LAY A;  256B A;  4AQG A;  1YDI A;  2XQY A;  3P7I A;  3GEI A;  3CX6 B;  3IHU A;  3JRT A;  4CS8 A;  1FMW A;  5L47 A;  3SXM A;  4F6R C;  4DV0 T;  1A7D A;  4JJF A;  5E3A A;  3B0V C;  1SE7 A;  4IHJ E;  3N9N A;  2CNW A;  1U5P A;  5JS5 A;  5LBM A;  1JPN A;  3SXZ A;  4HWC A;  5FXV A;  5LMN T;  4X62 T;  4TWF A;  3GOR A;  3ASO C;  3AOU A;  4U7Y A;  3GA8 A;  5LYJ E;  2XSE A;  1U4Q A;  5HCJ A;  3ABV A;  3KFW X;  2JPU A;  4LDR A;  4CQI A;  5AQV B;  3AEC A;  4M63 A;  4NXM T;  4N6C A;  3LDQ B;  2BS4 A;  4IE4 A;  3N2G E;  3KV6 A;  2V26 A;  5FVL A;  3S84 A;  4DMV A;  2Q00 A;  4E7S A;  3DZA A;  2WVQ A;  3SNH A;  4MBQ A;  1O3U A;  1TQG A;  4OIN F;  3ZSU A;  5K0I A;  3HI2 A;  5L0G A;  3FB2 A;  1H9G A;  2AWC A;  3JT1 A;  4AKL A;  1G8X A;  4CIH A;  3KDS E;  2LSK A;  1XWJ A;  4CI2 B;  3TLW A;  1V9D A;  2OKU A;  3ZG1 A;  4FX5 A;  1HX8 A;  4X0R A;  3LNR A;  2BKP A;  1QLB A;  4JEU B;  5JDG A;  1Z63 A;  4EOZ B;  2QNL A;  5LGT B;  3VKG A;  1VTM P;  1GQA A;  2P7V A;  4NY3 A;  3KV9 A;  3FZK B;  3ZQV A;  1Y64 B;  2YIN A;  1HCI A;  3GOD A;  5FYM A;  1TFK B;  4KNV A;  1PD0 A;  2KMF A;  2W61 A;  2QLA A;  4O6M A;  2PFV A;  4IRE A;  1YW0 A;  2NUP A;  4F8H A;  2Q9A A;  4X20 E;  3ZMS B;  2ODU A;  2NUP B;  2FJD A;  3AEB A;  2NTX A;  3L34 A;  4NTB A;  5F5H A;  1V74 B;  1J5E T;  2IDO B;  4XPY A;  1XDP A;  2X9Y A;  4HFF B;  4NQF A;  2R7V A;  1APC A;  4LF9 T;  3CQX C;  3VRB A;  4GIW A;  2LT3 A;  1J5W A;  1ZYR F;  3Q6M A;  3S9O A;  4H9R C;  1WFD A;  2XQ3 A;  4QKN A;  5KDM C;  5ETW A;  1G4U S;  2Y3H A;  3HNI A;  3AE1 A;  4UV8 B;  1JNZ A;  5B3S C;  3X1O A;  2XSB A;  2JX0 A;  1BZ4 A;  2EIN C;  2V7L A;  2ZM0 A;  4DRI B;  4QDL A;  5L3D B;  3LEV A;  2WVN A;  1VB5 A;  2IYL D;  2E9X D;  4JI1 T;  2J0X A;  4G63 A;  4KBL A;  4MVZ A;  3RC3 A;  4HFK B;  1GM5 A;  4HWH A;  5BQH A;  2R05 A;  3UFE A;  1FR0 A;  1LS4 A;  1OXZ A;  3RF1 A;  3UUM A;  4P9F A;  2YKS A;  4MW3 A;  5EK2 A;  1MIW A;  3HKD E;  3AJM A;  3RRC A;  3VM6 A;  4NUV A;  2IOQ A;  4LF7 T;  2V1D B;  4YK5 A;  1LVK A;  1T5O A;  4EBB A;  2PJQ A;  4G78 A;  1DOV A;  3WOD F;  2MPK A;  4Q25 A;  3HKB E;  2CM0 A;  2PP4 A;  1GQE A;  5J2U E;  1HF8 A;  2IC9 A;  5LOV E;  1VLT A;  2EPN A;  3NZP A;  2IXN A;  3VAY A;  2JJ9 A;  3P4S A;  5HCM A;  3MXZ A;  1FMV A;  3K3Q C;  4XPW A;  2N1G A;  3ZPO A;  2GK9 A;  5L2L A;  5HWX A;  2XY8 B;  4P6I C;  1GS9 A;  1Q0M A;  4CDV A;  4H9P C;  2VVS A;  2I6H A;  2FGY A;  2J9W A;  3VYW A;  3CIR A;  4YT8 A;  4QI0 A;  2UXX B;  2CBJ A;  1ZKE A;  2LD6 A;  4ZZC A;  3GAN A;  1Z5Z A;  3UUN A;  4U5F E;  5AQG B;  2F22 A;  2K48 A;  3TK0 A;  3SOL A;  1I4Y A;  1OCO C;  2LRL A;  4L0R A;  1I94 T;  4IE6 A;  2HN1 A;  1D1B A;  1YYJ A;  1UX5 A;  3W2V A;  1WRD A;  3CQZ A;  2X0H A;  4IJJ A;  3KVB A;  1ZU5 A;  1C17 M;  4GQH A;  3OPC A;  4OYJ A;  2H89 A;  3QNU A;  4KHZ F;  5L0J A;  4ZI2 C;  5AC4 A;  3ZIB A;  2Y3B A;  3MKD A;  4RBN A;  1IAP A;  1YZA A;  4PJL A;  2DI3 A;  4HFE A;  3U2L A;  5JDF A;  2BG9 E;  4U7I A;  2Z6E A;  2XL8 A;  4XPX A;  2XLH A;  2XXA A;  1ST6 A;  2XXA B;  1PD1 A;  4DO0 A;  3C63 A;  4ZEY A;  3NDB B;  2WZF A;  2IAK A;  3H37 A;  4XWJ A;  2HKV A;  2BKN A;  1CGO A;  3ITF A;  1XMO T;  1NU9 C;  2YDQ A;  1MQV A;  1OCR C;  5LNK A;  5L0I A;  4WGZ A;  4DR4 T;  3BQK A;  5LXT E;  3AVS A;  4IL4 A;  1OW8 A;  3OWT A;  3F47 A;  2CBI A;  4LAC B;  2YLI A;  4WBO A;  1S94 A;  2YU1 A;  3DAG A;  2DNX A;  3Q5W A;  2Y3G A;  5GON E;  4CI1 B;  2VCA A;  3MBG A;  4NPP A;  1E1H B;  4UVA B;  4I55 E;  4IE7 A;  2VWA A;  2XAF B;  4KMC A;  3N2O A;  4HFH A;  1SMY F;  3JCF A;  3F46 A;  1VRB A;  3AA7 B;  4IDN A;  2JQK A;  2ZPA A;  3U3I A;  3TJ6 A;  4XLN F;  3JC6 D;  3Q5X A;  4IIJ E;  2EPM X;  4J7Y A;  4FAP B;  4UEM A;  2WMO A;  5FY0 A;  4JI6 T;  2XAS B;  3PUX F;  5JR9 A;  3HNK A;  1YLM A;  3AE4 A;  3ZDL A;  3I5Q A;  2K5B B;  2YDS A;  1IBK T;  4IAR A;  4OHF A;  2YN6 A;  4EUK B;  2LQG A;  5F28 E;  5EK4 A;  4FWV A;  3O9X A;  2BVL A;  3QW0 A;  2FJA A;  4MFR A;  4U72 A;  3RQF A;  3G06 A;  4OIO F;  3RVZ A;  4QXC B;  5KYN A;  4C7O A;  5EZY E;  5JRE A;  2Y8D A;  4C7O B;  4U5C E;  4DVY P;  2Q9B A;  3DXJ F;  2CXD A;  3RX6 A;  4DBR A;  3A8Y C;  3MFN A;  3OYZ A;  4J2C A;  1O87 A;  3K33 A;  3C4W A;  1WAS A;  3N9L A;  3FVY A;  2VC9 A;  3PE0 A;  1ORS C;  2J46 A;  3UUX B;  2FAP B;  4C91 A;  4MVO A;  3ZYL A;  1C03 A;  3Q9D A;  3ABM C;  1XMQ T;  2JRK A;  5L0F A;  2AU5 A;  2YKZ A;  5CFB A;  3LS0 A;  5FNV E;  2VCC A;  4P0B A;  5FL0 A;  4YT2 A;  4AE4 A;  1QQ3 A;  4AE4 B;  1K05 A;  3E0Z A;  4G0H A;  3NKZ A;  4DV3 T;  1BR1 A;  5JQG E;  2LJL A;  4IAO A;  2V6Y A;  1SA0 E;  4LF8 T;  2V6Y B;  2LFF A;  4CJG A;  3OJA A;  4HWF A;  3AG3 C;  4CX9 A;  3PJA A;  2QRX A;  1BBH A;  4GK0 E;  1YA9 A;  3RIF A;  3UU5 A;  2XQ8 A;  3H2V A;  3R7C A;  5C8Y E;  3PDY A;  4HGA A;  5KYX A;  3EJN A;  5E0O A;  4ULW A;  5KYX B;  3FBZ A;  1ZHC A;  3A11 A;  4O79 A;  5DVW A;  1YYX A;  5F5W A;  4DR5 T;  4C90 A;  3C4X A;  2C5I T;  3EUH A;  2H88 A;  2VKO A;  3PU8 A;  4AI6 A;  2BC5 A;  2WBL A;  2WB5 A;  4CSA C;  1YVI A;  1Q0D A;  4L5G A;  5A1L A;  4PNI A;  4PK4 A;  4H9Q C;  4YJW A;  1A7E A;  2L9J A;  2R7W A;  2XLM A;  1T98 A;  3E22 E;  4GYT A;  3NYL A;  3CAX A;  5F3J A;  5DAB A;  5HEJ A;  4UEL A;  4XEK A;  4NXN T;  3AE8 A;  2A0U A;  1OCC C;  5FCL A;  4EYU A;  2NR4 A;  2UXB T;  1EZ3 A;  3PUY F;  4KC9 A;  1G73 A;  1D1A A;  5CJ5 A;  5B1A C;  3TOL A;  5A6A A;  1B7T A;  3KBU A;  3U3B A;  1SF8 A;  1OKK A;  1IJ6 A;  3FXE B;  3QMK A;  2EPK X;  4Z90 A;  2RPA A;  3EZH A;  5AC5 A;  3BK9 A;  5AQM B;  3CQG B;  3IQ5 A;  1QUU A;  5BQI A;  3RH3 A;  2LOS A;  3U8V A;  2W4X A;  5KYY A;  1OXK A;  2KK1 A;  1WYB A;  3M3Z B;  5KYY B;  2FFH A;  3RW0 A;  5DJQ C;  2CLY B;  3GEE A;  4JKV A;  4PAC A;  3JSE O;  2YEV C;  3O55 A;  3NVO A;  4IAQ A;  2RA1 A;  2CE7 A;  4TUY E;  1HW1 A;  3C8Z A;  4O6Y A;  4YJ2 E;  3UQ4 A;  3MX3 A;  4Z9I A;  3SYN A;  2WB7 A;  1XNR T;  4N6H A;  3K3O A;  4QWN B;  2Y39 A;  4CN1 A;  3OTO T;  4LF6 T;  1UFB A;  4HEA J;  3UU8 A;  5CI8 A;  5ABF A;  1HFA A;  3LNM B;  2CCY A;  5ABF B;  2EHO C;  4PK5 A;  4WJ0 A;  3J9X 1;  3RKO F;  4YSX A;  4O7G A;  3GWH A;  3LES A;  2SPC A;  4DR7 T;  2L6H A;  1IJ5 A;  1VOM A;  2R25 A;  4X64 T;  2B0J A;  4P1N A;  2L81 A;  4OIP F;  3O1H A;  5J1G A;  1NZE A;  2R9R B;  4Z9H A;  2X9H A;  2YK0 A;  4YT0 A;  1YAR O;  4JC7 A;  4B6I A;  2XQ9 A;  3HL6 A;  1G5Z A;  2KWI B;  3U5S A;  2W45 A;  1QLE C;  3EG9 A;  4AXP A;  3EG9 B;  3L39 A;  1NAF A;  4BJ6 A;  3PU3 A;  2JMH A;  1J8M F;  5CB4 E;  1OED C;  1HW2 A;  1YQ3 A;  1NU7 D;  3PUV F;  4JI4 T;  2LHN A;  4KHP T;  2IIU A;  4DR2 T;  5HV9 A;  3KBT A;  4X1Y E;  1L3P A;  3UU3 A;  2X9W A;  4B3R T;  5LBQ B;  4AKI A;  3WG7 C;  3AA6 B;  2J62 A;  3W15 B;  3CSK A;  3P4Q A;  4AQF C;  3D0T A;  1L7C A;  2RD9 A;  4CSA A;  2KNH A;  3GMI A;  4YT5 A;  2CRB A;  1JRA A;  4ZXL A;  2DYS C;  2OV9 A;  3T1H T;  3TLV A;  2XS1 A;  1H6G A;  4KX6 A;  3RYF E;  1D0Z A;  5L3Q A;  1RCP A;  4X5T A;  5C2T A;  3C51 A;  2CMR A;  4H54 A;  1EKY A;  4QXH B;  4AIU A;  2UXC T;  2EIK C;  2UUB T;  2KW3 C;  5COM A;  1HG5 A;  3TOM A;  4CZZ B;  4JZA A;  4BJM A;  5L3B B;  2KGO A;  3EVY A;  3K3N A;  4WAB A;  2XLV A;  2VVN A;  2E8I A;  4HE8 A;  2Z15 A;  3N9P A;  1A0B A;  1X9B A;  2QY9 A;  2XLW A;  4MND A;  3SRZ A;  4GKK T;  4OD4 A;  3V5X A;  5HSW A;  2UUC T;  3T8O A;  4FI5 A;  2OU6 A;  4GYS A;  2DYR C;  3C18 A;  4N4W A;  4IDP A;  5HEU A;  2NPU A;  2CWY A;  5LJN A;  3VU7 H;  5LB7 B;  2CPT A;  3U78 A;  3G4Z A;  1LIH A;  3AG1 C;  3DI5 A;  2XAQ B;  3HTK C;  2BKO A;  4O2A E;  2YEV A;  5CGM A;  5D91 A;  4B6X A;  4MVS A;  1XZY A;  4H63 V;  4X65 T;  3KL4 A;  2P1A A;  3F57 A;  2W62 A;  4CI3 B;  5AQH B;  3C50 A;  4HWD A;  2ASR A;  1FTS A;  3ANW A;  3LK2 B;  2OEV A;  3ANW B;  3T4R A;  3T6B A;  3ZJ1 A;  4P9T A;  3HLZ A;  4PJN A;  2X9X A;  3AEA A;  2EHO A;  2GFH A;  5FVK A;  1K40 A;  2EHO B;  5JP7 A;  2YHS A;  4YL0 A;  3OEO A;  4I4T E;  3CVR A;  1IW7 F;  5COF A;  2PBE A;  2W00 A;  2CHN A;  4YTP A;  3ETV A;  2L6F A;  2OJQ A;  2J0W A;  1H9T A;  3I4U A;  1Z6A A;  2OLT A;  3UGP A;  5JUA A;  5DQT A;  3A5X A;  4ZI3 C;  4COF A;  5M4Y A;  4XQ1 A;  2V8S V;  4UR9 A;  4OD5 A;  3RIU C;  3O6X A;  5LHG B;  3DAF A;  3ZT5 A;  2J8W A;  3NKD A;  5FZT A;  5J0Z A;  2ZM2 A;  2NOX A;  4O4J E;  3NWI A;  3RVY A;  5AQO B;  3JAF A;  1HMD A;  1OED A;  2BS2 A;  3AE2 A;  5KYU A;  1OED B;  5JRC A;  5KYU B;  5JRC B;  2LSE A;  2G3V A;  4H9N C;  4TZ4 C;  1MNE A;  1RKC A;  2XHE B;  2CXF A;  2DWK A;  2VQF T;  3GWL A;  3KV4 A;  3RRW A;  1YAU O;  1NWM X;  4AL1 A;  4MQ9 F;  4A4A A;  1IZN B;  3KKB A;  4ZI2 D;  5HXS A;  3AGU A;  4XEV A;  5FKY A;  3V5Z A;  4DRH B;  3ZMV B;  5ADX L;  4UV9 B;  4MTG A;  2BBH A;  4LDK A;  2CA5 A;  1O3X A;  2IXP A;  3ZCI A;  2JD3 A;  5AQS B;  5LG4 A;  2LE8 A;  3ZYK A;  1WOL A;  1IBL T;  5IY5 C;  5L3C B;  4JI0 T;  1FFT C;  3B0U X;  5EGY A;  5AQU B;  4PR9 A;  2LKG A;  2QTV A;  3UR3 C;  3AE5 A;  3B13 A;  4NIQ A;  5AQF B;  4F4B A;  1VCS A;  3HR0 A;  4JEA A;  1OXB A;  1HY5 A;  1KNP A;  3TKL B;  2EIJ C;  4NTF A;  4HTE A;  1T72 A;  3NRX A;  4OX9 T;  2J47 A;  3I1A A;  3PCV A;  2TMV P;  3LK3 B;  3UT5 E;  3UMI A;  1HNX T;  4YXD A;  3FZH B;  3H65 A;  3QK6 A;  1OKK D;  2BS3 A;  2DGJ A;  1OCZ C;  3EHM A;  1OQC A;  1JMW A;  2Q9C A;  2CWO A;  4TNW A;  2IM8 A;  3IEE A;  1ZVZ A;  2K9A A;  4JE9 A;  4MVM A;  1BR2 A;  3TLU A;  1WCR A;  3EAM A;  3RYI E;  1LI7 A;  3ONJ A;  1TWH A;  3KYJ A;  3R6N A;  5IWA T;  3QUJ A;  2B76 A;  2DL1 A;  1Z8U A;  3FOP A;  4DUZ T;  2JQQ A;  4K7B A;  4UVB B;  1TR2 A;  2X68 A;  2JQH A;  3PUG A;  1M2O A;  3CX8 B;  2G0U A;  3DJU B;  3RIA A;  2LEH A;  2QUP A;  2Y69 C;  4EBJ A;  3O1J A;  3FXD B;  1E2X A;  1KNY A;  4JYA T;  5IUX A;  3P50 A;  4HKA A;  3R2P A;  3SZR A;  2E2A A;  2A68 F;  1W0B A;  4BJN A;  3DKA A;  5DS5 A;  4XZC A;  2HV6 A;  4LDQ A;  2I59 A;  4CDY A;  1CGM E;  2D2S A;  1J8Y F;  3NRY A;  5JVD E;  2DHR A;  3CQC B;  2Y3D A;  1T6U A;  1A41 A;  4C3E A;  2ACZ A;  3GM2 A;  2QA7 A;  4EED A;  1SYQ A;  3I9W A;  4U9E A;  3MK7 C;  1UUR A;  2ZXO A;  3ZTM A;  4ANJ A;  1W9R A;  2R6G F;  4IGU A;  1V55 C;  3HKC E;  2KSR A;  5DS4 A;  3FZL B;  1XDO A;  5T1D B;  3EI0 A;  1EI7 A;  3CWZ B;  3VKH A;  2CYD A;  5JT4 A;  3U2M A;  4U5H A;  1MIY A;  1EA8 A;  2VCB A;  2XM0 A;  4LFC T;  1NFO A;  4JI5 T;  3NMK A;  4ADZ A;  1TWC A;  5GPG B;  3KYI A;  3E08 A;  3GN5 A;  4C3D A;  3L1M A;  3GN5 B;  2V3C C;  4X1K E;  2VB6 A;  3HJC A;  3NMI A;  4MTO A;  3B29 A;  2XM2 A;  2XQ7 A;  4HWI B;  2J1D G;  4UDV A;  4BJ1 A;  3GEH A;  5KYW A;  4D4X A;  3BQI A;  5LG3 A;  5KYW B;  2FJE A;  4ZOL E;  3AGT A;  4CXX A;  5ABG A;  1ZOY A;  2NP9 A;  3I0O A;  3U8P A;  3EQL F;  3K66 A;  3M79 A;  4U3C A;  2XTL A;  3I5P A;  2H7V C;  2WZH A;  2YRF A;  5HEO A;  5LGU B;  5DQZ A;  4HFI A;  4HN9 A;  3ASN C;  1Z7Q c;  3C98 B;  2H3R A;  5AQK B;  1Z23 A;  2LSG A;  1MMG A;  3US6 A;  1JNR A;  3L8I A;  1T9K A;  4ZLC A;  2AVK A;  4HE8 D;  1NG1 A;  3TD7 A;  2IML A;  2YQY A;  3LK4 2;  2KJG A;  4KI2 A;  3TLS A;  4MVQ A;  1LS1 A;  3ZN0 B;  3OBV E;  3T1Y T;  3CEX A;  2E5V A;  3RKG A;  5A69 A;  1S7Z A;  2LSJ A;  4JI7 T;  2LCH A;  5FY1 A;  2ZXW C;  3B5M A;  2A6H F;  2H8A A;  4LF4 T;  2WAU A;  1NLX A;  4CDA A;  3MJX A;  4DVD A;  1Q0G A;  2DB4 A;  3VRA A;  4QX8 B;  4JV5 T;  3JAE A;  2V7K A;  5JDN A;  4U5E E;  1W0A A;  2CXL A;  5L4H A;  3VR9 A;  1YKE B;  3B57 A;  2YU2 A;  2A0B A;  3LLI A;  2G3K A;  4EAH A;  3SXK A;  4L6R A;  3T6J A;  4CXW A;  2XPK A;  1BR0 A;  1V54 C;  2IUB A;  2EHO D;  3PUA A;  4PFP A;  2FUP A;  2LM9 A;  2K3W A;  4M1P A;  4IDQ A;  4LMJ A;  2KT9 A;  4U5D E;  2A9U A;  4LER A;  2WDV A;  5C3J A;  4DOZ A;  1LRZ A;  5HXC A;  2X0L B;  5L3F B;  2RP4 A;  3OVU A;  2WY2 A;  2HSB A;  4DJ9 A;  1N32 T;  1ZW2 A;  2R7S A;  4YSY A;  2XM1 A;  3DMD A;  4DV7 T;  3MZK B;  3EGX A;  4OFZ A;  3FHN A;  3NRH A;  4IGG A;  2GA0 A;  3EGX B;  3B0P A;  3P4W A;  2ZM6 T;  5AGF A;  3K1I C;  2D9D A;  2YL7 A;  5A6B A;  2NG1 A;  2MOZ A;  4MVU A;  3K8P C;  3Q7G A;  5TJ5 E;  2LLY A;  3Q7L A;  2XLO A;  2W4B A;  4DRJ B;  2XQ5 A;  3V7O A;  1M2V A;  4AX2 A;  4YT4 A;  1M2V B;  4YSZ A;  4GOU A;  3LFM A;  3CX7 B;  1JOG A;  5HWY A;  2R7O A;  2UXN B;  3C4Z A;  3N24 A;  4EZ4 A;  1H7C A;  4KUM B;  2ICW G;  4I44 A;  4JW1 A;  2N2N A;  4EYY R;  1AUE A;  2R02 A;  4ER9 A;  1WR6 A;  4A5X A;  5E2Q A;  1S05 A;  3MA9 A;  1VCT A;  4DV5 T;  5DS6 A;  2I15 A;  4E7Z A;  4X1I E;  2VL0 A;  1IZM A;  2HV7 A;  2CCQ A;  3LEO A;  1YJG A;  2VL8 A;  4TNV A;  1HR0 T;  3JSZ A;  4UVC B;  4TV9 E;  3N5L A;  2O9X A;  1M56 C;  3SFD A;  4EHP A;  1OED E;  3NBX X;  3U0C A;  4CXY A;  2XM4 A;  2H7B A;  2NWB A;  2UUA T;  3MYI A;  2XJ7 A;  2NTY A;  2R7Q A;  2PX3 A;  2BBJ A;  4U5B E;  2HMZ A;  2GAQ A;  1C02 A;  3RPU A;  2KSF A;  5CIV A;  5EHH A;  5JRA A;  2XUE A;  4QX7 B;  2HSQ A;  1YXR A;  2L7A A;  4AQY T;  1Z0P A;  3PJA J;  4H9O C;  4A98 A;  4DBQ A;  1B68 A;  1LPE A;  4YY3 T;  2V5D A;  3IQT A;  4IL9 A;  2OA5 A;  2WWU A;  4YN0 B;  3SXY A;  1KNZ A;  3R84 B;  2NW9 A;  3ECS A;  4YLH A;  5JDH A;  3LSV A;  2JIW A;  2ACX A;  4XLP F;  1H7I A;  3N0T A;  1KNR A;  4XAX B;  5L3V A;  3SS1 A;  2MAW A;  2WP9 A;  4K0D A;  2M64 A;  1OW7 A;  3AE9 A;  1WR0 A;  3HA4 A;  5B3I A;  4NCQ A;  2MBG A;  4O6N A;  3AAA B;  1QZX A;  2HPL A;  1LE4 A;  4JUY A;  4IB4 A;  3F31 A;  3UMH A;  1CHU A;  2V6X A;  3G4X A;  4IWB A;  2I0M A;  5HYA A;  3PDM P;  3POV A;  4KP3 C;  2W63 A;  2LKH A;  2WM9 A;  4EIW A;  1D1C A;  2X0C A;  2KWH A;  2IXM A;  4CS8 C;  2YLD A;  5FMN A;  1L0V A;  5L0H A;  5FL1 A;  2PBI A;  2L8K A;  4ZI3 D;  4LLC A;  1Y01 A;  3UU4 A;  3DM9 B;  3K1I A;  1WTY A;  2KXP B;  4QH5 A;  3AQC A;  5HXE A;  1KF6 A;  3AAE B;  2J7P A;  4IDZ A;  1VMA A;  4TN7 B;  4U74 A;  3AXJ B;  3EPV A;  3NYJ A;  3ZC1 A;  1HTJ F;  1HNZ T;  1KK7 A;  1LI5 A;  4ZS3 A;  4Z8X A;  5AQI B;  1W2W A;  3ONX A;  2CEA A;  1HMO A;  3FAJ A;  2NSF A;  2R7X A;  2LP4 A;  3FMS A;  1NEK A;  1G4W R;  1YD8 G;  1M7K A;  3AED A;  4JBW F;  3IA3 A;  4K0K T;  5JDM A;  4DR6 T;  1QVX A;  4OK0 A;  3K7D A;  5LMU T;  4BG0 A;  2L3L A;  3J06 A;  1IBM T;  5DQV A;  3FXH A;  3ZJ2 A;  5COG A;  3TUL A;  2W4M A;  2R7T A;  2D5U A;  1ZHY A;  3M4B A;  4Q7C A;  4JEB A;  1JAF A;  1E85 A;  3O4X E;  4P09 A;  2Q9Q C;  2A3D A;  4IST A;  1E7P A;  5KXJ A;  2BDE A;  1CUN A;  4DR1 T;  1PCX A;  3IF8 B;  4GEH A;  3T6G B;  4YWQ A;  4RD9 A;  2VKH A;  2HMQ A;  4ULV A;  2Q3T A;  1T7S A;  3ZC0 A;  1AVO B;  5DQW A;  1N1C A;  4ERR A;  2WMN A;  2VUR A;  1UG7 A;  3W2W A;  2OG2 A;  4DV2 T;  4H4K C;  4ZZB A;  3CZ6 A;  2V7J A;  1U6H A;  3AG4 C;  3LUT B;  5LJM A;  5AQJ B;  4LMK A;  1HE1 A;  3IQC A;  2Y6X A;  3ONL C;  1FFH A;  4MAL A;  2VKJ A;  5JDQ A;  4B3T T;  4CN4 A;  2R7U A;  4UXN B;  3P4R A;  4U9D A;  2X67 A;  3H3M A;  2KYH A;  3VR8 A;  4ZI7 E;  5B1B C;  3BQL A;  4EGW A;  4RDA A;  2UUH A;  3C8G A;  3SEO A;  3C8G B;  4D4N A;  2HN2 A;  5JVE A;  4JUR I;  2EIL C;  4Z91 A;  4OIR F;  1FAP B;  2LIG A;  1WGW A;  2R7R A;  1Y6D A;  2LOP A;  2G62 A;  4B3M T;  4N06 A;  4I0U A;  3K6B A;  3ZQY A;  2WU2 A;  1E2A A;  2J9B A;  2M4E A;  5JDL A;  1MMD A;  1SZI A;  1KU2 A;  1ZV4 X;  4O8S A;  3SP1 A;  3OA1 A;  1R5I D;  2MTQ A;  4EBK A;  5LA6 E;  3EDU A;  5CA1 E;  5JTG A;  4EIY A;  4DVZ A;  1W09 A;  3WHN A;  2AP3 A;  2CHO A;  3MYF A;  1N34 T;  2ZM8 A;  1UCU A;  4I3M A;  5L0C A;  4JLE A;  3VRC A;  2FJB A;  3PTR B;  4EXT A;  3W8I A;  3AAI A;  1R4T A;  1WN0 A;  2D0T A;  1PV3 A;  2V5C A;  1Q0K A;  1TWG A;  3AVR A;  4MVR A;  2B1E A;  3PUR A;  1TWA A;  1HNW T;  2WZG A;  2X0Y A;  3O39 A; 
#chains in the Genus database with same CATH homology
 4NUU A;  2M67 A;  5BMV E;  4KNW A;  4DMW A;  3RKO A;  1VYK A;  4EZH A;  3FBL A;  2PF4 E;  2VK9 A;  4AQF A;  3V5U A;  4KBM B;  3L3P A;  3ZMU B;  2ZXP A;  1FIO A;  4JVS A;  3S29 A;  3S4U A;  4ILU A;  3DM5 A;  2Q9Q A;  2Q9Q B;  4O4H E;  1LVF A;  5E3C A;  3FDQ A;  3PUS A;  1D0Y A;  4HFV A;  3EFO A;  3ZLI A;  4QI2 A;  3EFO B;  3RFY A;  4TX5 A;  2BVM A;  4H63 H;  2KND A;  1SHZ C;  2CDQ A;  5LHH B;  2YZS A;  3X2Q C;  4I1M A;  4V1A v;  3NZQ A;  5BUO A;  3J7Y q;  2X66 A;  2NW8 A;  3MAC A;  2KQ9 A;  2VAS A;  4XBF B;  3W8H A;  4EWC A;  3LS1 A;  4QXB B;  3KMI A;  4G7O F;  2Y48 B;  4I1O B;  3O1I A;  4WNK A;  2MYS A;  2WZL A;  3P8C D;  2IC6 A;  1RJ9 A;  3DTO A;  1RJ9 B;  5JR9 C;  4AK9 A;  4IE0 A;  3ZMT B;  3I9Y A;  3N2Z B;  4A2N B;  5IHY A;  4N78 D;  3WAJ A;  3CPZ A;  4I43 B;  4YJ3 E;  4G7Z F;  2WVO A;  3NYM A;  3RC8 A;  1LKX A;  3EHN A;  3K1H A;  3IHR A;  2C0S A;  4UF0 A;  1MIV A;  4UF0 B;  5H6Q B;  3RYC E;  4BA9 A;  3OYX A;  2XAG B;  3M65 A;  3V5S A;  2J7P D;  3ZCJ A;  3EGD A;  5LGN B;  3EGD B;  2ZLY A;  3LG7 A;  3S28 A;  3ABK C;  4OIQ F;  2H7O A;  4ISS A;  2HPJ A;  3IBP A;  2C5J A;  4MHC A;  2LHR A;  1WLX A;  2HH7 A;  2JPF A;  2MWQ A;  1TKN A;  3EZI A;  3RIP A;  5F5F A;  3AB3 B;  3KIN B;  5FXX A;  3PHF 2;  3LJC A;  2BE5 F;  1Z3I X;  1BR4 A;  3Q6N A;  5FY7 A;  2E87 A;  3N2K E;  3QZC A;  2X51 A;  2NW7 A;  2C04 A;  5TAO A;  4J30 B;  3DP7 A;  3L0I A;  3E70 C;  5L3G B;  1ZHX A;  4QHO A;  1ZU4 A;  5FXW A;  3UNG C;  5E33 A;  3AA1 B;  2XRH A;  3UUL A;  3LBX A;  2BZB A;  3LBX B;  3ZMZ B;  4OYK A;  1MMN A;  4PJJ A;  4YHJ A;  4MLK A;  3FHD A;  3KVA A;  2E9X C;  4JEH B;  2P9B A;  4IRU A;  5L3E B;  2C03 A;  1WYC A;  2CLY C;  4UIG A;  2DLR A;  2VKD A;  4Q5S F;  3QC9 A;  2IW5 B;  4W8K A;  2KLQ A;  5JR9 B;  2J9U A;  3PMR A;  1D0X A;  3SWH A;  2ZMA A;  5J2T E;  5H6R B;  3UTK A;  4J32 B;  3S27 A;  2DI4 A;  3KV5 A;  1YKH B;  4LLE A;  2CNW D;  3AG2 C;  2PFD A;  2J9V A;  4ZS2 A;  5FXZ A;  1M57 C;  3N9O A;  4JCH A;  5F8P A;  4P0A A;  4IE5 A;  4BJ5 C;  5LHI B;  4PFO A;  3WAK A;  1US7 B;  2N9D A;  4BAY B;  4FJO A;  2D0U A;  2W0G A;  1ZHT A;  2LSI A;  4L9I A;  4BJ6 C;  5D92 A;  3Q2M A;  3E9V A;  2V7M A;  4BEJ A;  2I8B A;  4ASK A;  3LLK A;  2C5K T;  4O4L E;  4O4I E;  4EB6 E;  2Q9Q D;  5HXR A;  4HEA A;  4K0U A;  3JCU Q;  3H3A A;  3L09 A;  5DLJ A;  2ES0 A;  3UMK A;  4DND A;  4XTK A;  3RYL A;  3I0Q A;  2PG8 A;  3N9Q A;  4PJM A;  3ZN1 B;  4ZLD A;  4G7H F;  3KH2 A;  2KZ7 B;  3VHL A;  4A56 A;  2ODV A;  3JC6 C;  2E9X A;  3OKQ A;  2P6V A;  4CS9 C;  2E9X B;  4AKG A;  5EK3 A;  4AKH A;  1HS7 A;  1HG2 A;  3RYH E;  2JMK A;  4CS7 A;  4H9S E;  4GK5 E;  4AKR B;  5FP3 A;  1AJ3 A;  1VK5 A;  5IYZ E;  3C64 A;  4ZHQ E;  4GYR A;  2K24 A;  3EDV A;  4PK6 A;  3S0X A;  3AA0 B;  3N9M A;  5LP6 E;  1FEW A;  4C3B A;  2J45 A;  2NUT A;  1X79 A;  2NUT B;  4WBN E;  3M1C B;  3ABL C;  3DD7 A;  2D5R B;  4YFS A;  2QGS A;  4BJ5 A;  1ZHW A;  4O2B E;  5KX5 E;  4CBE A;  4G2A A;  2XAJ B;  1UX4 A;  2DWG A;  2KIN B;  2L9Q A;  5KMG P;  4FES A;  3ZYM A;  1OWA A;  2LSY A;  4WW0 A;  2A1D D;  2A6E F;  2WSS V;  3LJB A;  5HAX A;  3MLG A;  3ZC4 A;  4TV8 E;  1JPJ A;  1MND A;  2WL8 A;  1VYI A;  5CI9 A;  2PX0 A;  5LCY A;  4BJT A;  3EH2 A;  3EH1 A;  2CW0 F;  4U5G A;  3NKE A;  3JYH A;  2IXO A;  1S35 A;  1ZHZ A;  2ZXR A;  3ETU A;  4PW8 A;  5CA0 E;  2A2F X;  2CGE A;  3CML A;  1MMA A;  2V7I A;  3ESL A;  5AFU L;  3F2E A;  4JJG A;  3PUQ A;  2DCF A;  2OCC C;  5JH7 E;  2A72 A;  1O5H A;  3UGO A;  3WI3 A;  1QSD A;  4CS9 A;  3HKE E;  4PAG A;  3NG1 A;  3DJN B;  2VH3 A;  3CKD A;  4I50 E;  2XL4 A;  2XAH B;  3ZEF B;  2A69 F;  3AQB A;  1ZEE A;  3B9Q A;  5HXH A;  3ZVR A;  4Q4Z F;  2W9Y A;  2EIM C;  5T3T A;  5T3W A;  3DJB A;  3LAY A;  4AQG A;  2XQY A;  3P7I A;  3CX6 B;  3JRT A;  4CS8 A;  1FMW A;  4F6R C;  4JJF A;  5E3A A;  3B0V C;  4IHJ E;  3N9N A;  2CNW A;  1U5P A;  5LBM A;  1JPN A;  5FXV A;  3ASO C;  5LYJ E;  3GA8 A;  2XSE A;  1U4Q A;  3KFW X;  4CQI A;  4M63 A;  4IE4 A;  3N2G E;  3KV6 A;  2V26 A;  4DMV A;  4E7S A;  3DZA A;  2WVQ A;  3ZSU A;  4MBQ A;  4OIN F;  3SNH A;  3HI2 A;  3FB2 A;  3JT1 A;  1G8X A;  4AKL A;  4CIH A;  3KDS E;  2LSK A;  4CI2 B;  1V9D A;  3ZG1 A;  4FX5 A;  1HX8 A;  4X0R A;  3LNR A;  4JEU B;  5JDG A;  1Z63 A;  4EOZ B;  5LGT B;  3VKG A;  2P7V A;  4NY3 A;  3KV9 A;  1Y64 B;  2YIN A;  1HCI A;  3GOD A;  5FYM A;  4KNV A;  1PD0 A;  2KMF A;  2W61 A;  4O6M A;  2PFV A;  1YW0 A;  2NUP A;  2Q9A A;  4X20 E;  3ZMS B;  2ODU A;  2NUP B;  2NTX A;  3L34 A;  5F5H A;  2R7V A;  2X9Y A;  4HFF B;  3CQX C;  4GIW A;  2LT3 A;  1ZYR F;  3Q6M A;  4H9R C;  4QKN A;  5KDM C;  5ETW A;  2Y3H A;  4UV8 B;  5B3S C;  3X1O A;  2EIN C;  2V7L A;  2ZM0 A;  4QDL A;  5L3D B;  3LEV A;  2WVN A;  2IYL D;  2E9X D;  2J0X A;  4G63 A;  4KBL A;  3RC3 A;  4HFK B;  3UFE A;  1OXZ A;  3UUM A;  5EK2 A;  1MIW A;  3HKD E;  3RRC A;  4NUV A;  2IOQ A;  2V1D B;  1LVK A;  4EBB A;  2PJQ A;  3WOD F;  3HKB E;  2CM0 A;  2PP4 A;  5J2U E;  1HF8 A;  2IC9 A;  5LOV E;  2IXN A;  3NZP A;  3VAY A;  2JJ9 A;  3MXZ A;  1FMV A;  3K3Q C;  2N1G A;  3ZPO A;  2GK9 A;  5L2L A;  5HWX A;  4P6I C;  4H9P C;  2FGY A;  2J9W A;  3VYW A;  4YT8 A;  4QI0 A;  2UXX B;  1ZKE A;  3GAN A;  1Z5Z A;  3UUN A;  4U5F E;  2K48 A;  3SOL A;  1OCO C;  4L0R A;  4IE6 A;  1D1B A;  1UX5 A;  3W2V A;  1WRD A;  3CQZ A;  4IJJ A;  3KVB A;  1ZU5 A;  4OYJ A;  4ZI2 C;  3ZIB A;  2Y3B A;  3MKD A;  4RBN A;  1IAP A;  4PJL A;  5JDF A;  2Z6E A;  2XXA A;  1ST6 A;  2XXA B;  1PD1 A;  4DO0 A;  3NDB B;  2WZF A;  2IAK A;  3H37 A;  4XWJ A;  3ITF A;  1NU9 C;  1OCR C;  5LNK A;  3BQK A;  5LXT E;  3AVS A;  3OWT A;  3F47 A;  4LAC B;  4WBO A;  1S94 A;  2YU1 A;  3DAG A;  2DNX A;  3Q5W A;  2Y3G A;  5GON E;  4CI1 B;  1E1H B;  4UVA B;  4I55 E;  4IE7 A;  2VWA A;  2XAF B;  4KMC A;  3N2O A;  1SMY F;  3F46 A;  1VRB A;  3AA7 B;  2ZPA A;  3U3I A;  4XLN F;  3JC6 D;  3Q5X A;  4IIJ E;  4UEM A;  2WMO A;  5FY0 A;  2XAS B;  5JR9 A;  3I5Q A;  2K5B B;  4OHF A;  5EK4 A;  4FWV A;  3O9X A;  2BVL A;  4MFR A;  4U72 A;  4OIO F;  4QXC B;  5KYN A;  4C7O A;  5EZY E;  5JRE A;  2Y8D A;  4C7O B;  4U5C E;  4DVY P;  2Q9B A;  3DXJ F;  2CXD A;  3RX6 A;  4DBR A;  3OYZ A;  4J2C A;  1O87 A;  3K33 A;  3C4W A;  3N9L A;  3FVY A;  3PE0 A;  2J46 A;  3UUX B;  4C91 A;  3ZYL A;  3Q9D A;  3ABM C;  2JRK A;  3LS0 A;  5FNV E;  4P0B A;  4YT2 A;  4AE4 A;  4AE4 B;  3E0Z A;  4G0H A;  1BR1 A;  5JQG E;  2LJL A;  4IAO A;  1SA0 E;  3OJA A;  3AG3 C;  4GK0 E;  5C8Y E;  3PDY A;  4HGA A;  5KYX A;  3EJN A;  5E0O A;  4ULW A;  5KYX B;  3FBZ A;  1ZHC A;  4O79 A;  5DVW A;  4C90 A;  3C4X A;  2C5I T;  3EUH A;  2VKO A;  3PU8 A;  4AI6 A;  2WBL A;  4CSA C;  4L5G A;  5A1L A;  4PNI A;  4PK4 A;  4H9Q C;  4YJW A;  2L9J A;  2R7W A;  1T98 A;  3E22 E;  4GYT A;  3NYL A;  5F3J A;  5DAB A;  4UEL A;  1OCC C;  5FCL A;  4EYU A;  1EZ3 A;  4KC9 A;  1G73 A;  1D1A A;  5B1A C;  1B7T A;  3KBU A;  1SF8 A;  1OKK A;  1IJ6 A;  3FXE B;  3QMK A;  3EZH A;  3BK9 A;  3CQG B;  1QUU A;  3RH3 A;  2LOS A;  5KYY A;  1WYB A;  5KYY B;  2FFH A;  5DJQ C;  2CLY B;  2YEV C;  2RA1 A;  2CE7 A;  4TUY E;  4O6Y A;  4YJ2 E;  3MX3 A;  3SYN A;  2WB7 A;  3K3O A;  4QWN B;  2Y39 A;  4HEA J;  5CI8 A;  1HFA A;  2EHO C;  4PK5 A;  4WJ0 A;  3J9X 1;  3RKO F;  4O7G A;  3GWH A;  3LES A;  2SPC A;  1IJ5 A;  1VOM A;  2B0J A;  2L81 A;  4OIP F;  3O1H A;  5J1G A;  1NZE A;  2X9H A;  2YK0 A;  4B6I A;  3HL6 A;  2KWI B;  2W45 A;  1QLE C;  3EG9 A;  4AXP A;  3EG9 B;  1NAF A;  4BJ6 A;  3PU3 A;  2JMH A;  1J8M F;  5CB4 E;  1NU7 D;  2LHN A;  3KBT A;  4X1Y E;  2X9W A;  5LBQ B;  4AKI A;  3WG7 C;  3AA6 B;  3W15 B;  3CSK A;  4AQF C;  3D0T A;  4CSA A;  2KNH A;  3GMI A;  4YT5 A;  2DYS C;  3RYF E;  1D0Z A;  5L3Q A;  3C51 A;  2CMR A;  4QXH B;  2EIK C;  2KW3 C;  1HG5 A;  4CZZ B;  4JZA A;  4BJM A;  5L3B B;  2KGO A;  3EVY A;  3K3N A;  2E8I A;  4HE8 A;  2Z15 A;  3N9P A;  2QY9 A;  4MND A;  3SRZ A;  4OD4 A;  5HSW A;  3T8O A;  4FI5 A;  4GYS A;  2DYR C;  2CWY A;  5LJN A;  3VU7 H;  3U78 A;  3AG1 C;  2XAQ B;  3HTK C;  4O2A E;  2YEV A;  5D91 A;  4B6X A;  4H63 V;  3KL4 A;  3F57 A;  2W62 A;  4CI3 B;  3C50 A;  1FTS A;  3ANW A;  3LK2 B;  3ANW B;  3T4R A;  3T6B A;  3ZJ1 A;  3HLZ A;  4PJN A;  2X9X A;  2EHO A;  2GFH A;  2EHO B;  2YHS A;  3OEO A;  4I4T E;  3CVR A;  1IW7 F;  2W00 A;  3ETV A;  2J0W A;  3I4U A;  1Z6A A;  3UGP A;  5DQT A;  3A5X A;  4ZI3 C;  5M4Y A;  4OD5 A;  3O6X A;  5LHG B;  3DAF A;  3NKD A;  2ZM2 A;  2NOX A;  4O4J E;  5KYU A;  5JRC A;  5KYU B;  5JRC B;  2LSE A;  2G3V A;  4H9N C;  4TZ4 C;  1MNE A;  2XHE B;  2CXF A;  2DWK A;  3KV4 A;  3RRW A;  1NWM X;  4MQ9 F;  1IZN B;  3KKB A;  4ZI2 D;  5HXS A;  3ZMV B;  5ADX L;  4UV9 B;  2CA5 A;  1O3X A;  2IXP A;  3ZCI A;  2JD3 A;  5LG4 A;  2LE8 A;  3ZYK A;  5IY5 C;  5L3C B;  3B0U X;  1FFT C;  5EGY A;  2QTV A;  3UR3 C;  3B13 A;  4F4B A;  3HR0 A;  3TKL B;  2EIJ C;  4HTE A;  3NRX A;  3I1A A;  3LK3 B;  3UT5 E;  3UMI A;  3H65 A;  3QK6 A;  1OKK D;  2DGJ A;  1OCZ C;  3EHM A;  2Q9C A;  2CWO A;  3IEE A;  2K9A A;  1BR2 A;  3RYI E;  1TWH A;  3R6N A;  3QUJ A;  2JQQ A;  4K7B A;  4UVB B;  1TR2 A;  2X68 A;  3PUG A;  1M2O A;  3CX8 B;  2G0U A;  3DJU B;  2LEH A;  2Y69 C;  3O1J A;  3FXD B;  4HKA A;  3SZR A;  2A68 F;  4BJN A;  5DS5 A;  4XZC A;  2HV6 A;  2I59 A;  2D2S A;  1J8Y F;  3NRY A;  5JVD E;  2DHR A;  3CQC B;  2Y3D A;  4C3E A;  2QA7 A;  3I9W A;  3MK7 C;  2ZXO A;  4ANJ A;  4IGU A;  1V55 C;  3HKC E;  5DS4 A;  5T1D B;  3CWZ B;  3VKH A;  4U5H A;  1MIY A;  4ADZ A;  1TWC A;  3E08 A;  3GN5 A;  4C3D A;  3GN5 B;  2V3C C;  4X1K E;  2VB6 A;  3HJC A;  2J1D G;  4BJ1 A;  5KYW A;  3BQI A;  5KYW B;  4ZOL E;  4CXX A;  2NP9 A;  3I0O A;  3EQL F;  3K66 A;  2XTL A;  3I5P A;  2H7V C;  5LGU B;  5DQZ A;  4HN9 A;  3ASN C;  3C98 B;  2H3R A;  1Z23 A;  2LSG A;  1MMG A;  4ZLC A;  4HE8 D;  1NG1 A;  3TD7 A;  3LK4 2;  2KJG A;  4KI2 A;  1LS1 A;  3ZN0 B;  3OBV E;  1S7Z A;  2LSJ A;  5FY1 A;  2ZXW C;  2A6H F;  2WAU A;  3MJX A;  4DVD A;  4QX8 B;  2V7K A;  5JDN A;  4U5E E;  2CXL A;  1YKE B;  3B57 A;  2YU2 A;  3LLI A;  2G3K A;  4EAH A;  3T6J A;  4CXW A;  1BR0 A;  1V54 C;  3PUA A;  2EHO D;  4PFP A;  2LM9 A;  4M1P A;  2KT9 A;  4U5D E;  4LER A;  4DOZ A;  1LRZ A;  5HXC A;  2X0L B;  5L3F B;  2RP4 A;  2R7S A;  3DMD A;  3MZK B;  3EGX A;  4OFZ A;  3FHN A;  3NRH A;  3EGX B;  3B0P A;  3K1I C;  2NG1 A;  2MOZ A;  3K8P C;  3Q7G A;  3Q7L A;  2W4B A;  3V7O A;  1M2V A;  4AX2 A;  4YT4 A;  1M2V B;  4GOU A;  3LFM A;  3CX7 B;  5HWY A;  2R7O A;  2UXN B;  3C4Z A;  3N24 A;  4EZ4 A;  1H7C A;  4KUM B;  4JW1 A;  4I44 A;  2N2N A;  4EYY R;  1WR6 A;  5E2Q A;  3MA9 A;  5DS6 A;  4E7Z A;  4X1I E;  1IZM A;  2HV7 A;  2CCQ A;  2VL8 A;  3JSZ A;  4UVC B;  4TV9 E;  3N5L A;  2O9X A;  1M56 C;  3NBX X;  4CXY A;  2H7B A;  2NWB A;  2NTY A;  2R7Q A;  2PX3 A;  4U5B E;  3RPU A;  5EHH A;  2XUE A;  4QX7 B;  1Z0P A;  4H9O C;  4DBQ A;  2OA5 A;  2WWU A;  4YN0 B;  1KNZ A;  3R84 B;  2NW9 A;  3ECS A;  4YLH A;  5JDH A;  2ACX A;  4XLP F;  3N0T A;  4XAX B;  5L3V A;  3SS1 A;  4K0D A;  3HA4 A;  2MBG A;  4O6N A;  3AAA B;  1QZX A;  2HPL A;  4JUY A;  3F31 A;  3UMH A;  4IWB A;  5HYA A;  3POV A;  4KP3 C;  2W63 A;  2WM9 A;  4EIW A;  1D1C A;  2KWH A;  2IXM A;  4CS8 C;  5FMN A;  2PBI A;  2L8K A;  4ZI3 D;  4LLC A;  3DM9 B;  2KXP B;  3AQC A;  5HXE A;  3AAE B;  2J7P A;  4IDZ A;  1VMA A;  4TN7 B;  4U74 A;  3EPV A;  3NYJ A;  3ZC1 A;  1HTJ F;  1KK7 A;  4ZS3 A;  4Z8X A;  1W2W A;  3ONX A;  2CEA A;  3FAJ A;  2R7X A;  1YD8 G;  5JDM A;  4OK0 A;  3K7D A;  4BG0 A;  2L3L A;  5DQV A;  3ZJ2 A;  2W4M A;  2R7T A;  2D5U A;  1ZHY A;  4Q7C A;  3O4X E;  4P09 A;  2Q9Q C;  2A3D A;  4IST A;  2BDE A;  1CUN A;  1PCX A;  3IF8 B;  4GEH A;  4YWQ A;  4RD9 A;  2VKH A;  2Q3T A;  3ZC0 A;  5DQW A;  1N1C A;  4ERR A;  2WMN A;  3W2W A;  2OG2 A;  4H4K C;  3CZ6 A;  2V7J A;  3AG4 C;  5LJM A;  2Y6X A;  1FFH A;  4MAL A;  2VKJ A;  5JDQ A;  2R7U A;  4UXN B;  2X67 A;  4ZI7 E;  5B1B C;  3BQL A;  4RDA A;  3SEO A;  4JUR I;  2EIL C;  4OIR F;  1WGW A;  2R7R A;  2LOP A;  2G62 A;  4N06 A;  3K6B A;  2M4E A;  5JDL A;  1MMD A;  1SZI A;  1KU2 A;  1ZV4 X;  4O8S A;  3SP1 A;  3OA1 A;  2MTQ A;  5LA6 E;  3EDU A;  5CA1 E;  4DVZ A;  2ZM8 A;  1UCU A;  4I3M A;  4JLE A;  3PTR B;  4EXT A;  3W8I A;  3AAI A;  2D0T A;  1TWG A;  3AVR A;  2B1E A;  3PUR A;  2WZG A;  1TWA A;  3O39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...