4BJTA

Crystal structure of the rap1 c-terminal domain (rap1-rct) in complex with the rap1 binding module of rif1 (rif1-rbm)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
152
Chain Sequence
DFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-BINDING PROTEIN RAP1
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription
total genus 52
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bjtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bjtA01
3K6GA 4BJTA 4BJ5C 3OWTA 4BJ6C 3CZ6A
chains in the Genus database with same CATH superfamily
1BIAA 2Y48A 1M2OA 1VZ0A 2F22A 2LLKA 4ZYAA 2FOKA 4PSXA 4HDVA 1AEPA 4HW0A 3GFIA 1ZKGA 1RNLA 2CG4A 1D8KA 3LAYA 4AIKA 2LYCA 3S32A 4AYBA 3JCUC 3UR3C 1ZTRA 5EF6A 3BTJA 1RC9A 3T9OA 5HNHA 5B66C 1T6QA 1XD7A 4CZZA 1LI7A 5FO5A 1FPQA 2CUEA 3K10A 2EPFA 1C17M 4G7OF 2RVCA 1YYJA 4FE7A 2YPRA 4A0ZA 2VB6A 2M30A 3A4CA 4MHGA 1FC3A 1O3TA 4H54A 2X85A 3NRHA 2M2EA 1IJWC 4MVZA 2CJJA 3I64A 2EZIA 2A6HF 2M1BA 5K7HA 2AVKA 2W4BA 3Q7GA 4N06A 2HUJA 4J32B 3JTLO 2X6OA 1WH5A 3T1BA 1ZRDA 4KC9A 4BE1A 1RJ9B 2ZXIA 4S04A 3K6GA 4LD5A 4MVSA 1TW2A 4NQWB 4Y52J 3AG3H 2W7NA 3PFIA 5LD2C 3BJAA 3R4KA 3B9QA 3ZMZA 3GX4X 3G73A 2O9LA 4YJWA 5E1ZB 2HEOA 1LE4A 2CSOA 2L01A 4I3MA 3I58A 2NOJB 3W2WA 2STWA 1TQPA 1MQVA 1U0BB 2CGPA 3RI4A 1CF7B 5BQTA 1VQLI 3CCQI 4Z9JA 2XS1A 2YL0A 2KRFA 3H65A 1OCCC 1SFXA 2R7UA 1IRZA 2AQEA 5K0IA 1FP2A 3LWFA 3EUHC 2W4MA 2EK5A 1NHAA 2H8WA 3KLOA 3JRHA 4HDUA 1IXSB 2Y0MA 5TGTA 1T01A 2XLVA 1IN4A 3HHHA 3LSIA 4MO7A 2XXAB 3U2RA 1ZHWA 2M8EA 2Z3YA 2V1NA 3QU3A 1X2MA 2ASRA 2H27A 1VTNC 4ZZDA 5ICCA 3AG1C 5F1RA 4LK1F 4CCLA 4A3LJ 1D1AA 4IB4A 5KYXB 3SDGA 3ZG1A 1ENHA 5DS5A 2Z16A 1DOVA 3ABMC 1LE2A 1ORYA 2H7VC 2HNHA 4AYBN 3L8IA 5HNFA 1FR0A 1RKEA 1HDDC 3A1YA 1SFOJ 2ESNA 3RTRA 2WB1A 3CP2A 3KP4A 4UV8A 2J5OA 2IXNA 3OOPA 4JURI 2P6TA 1MMNA 1QVXA 4OINF 4XIDA 4FHTA 2NSFA 3DKYA 2FF4A 3I9V2 3V4GA 3NG1A 1O3UA 5GADJ 1BL0A 4PZJA 2CCYA 2LFDA 4XEVA 3ZMUA 2E36A 4RLFA 4JTCB 1EH8A 2UUIA 2OKUA 2FSWA 2PJPA 2FFHA 2GOXB 1TT0A 1FJLA 3DWWA 4I99C 4BS9A 3C8ZA 1BR4A 3CDIA 1QPIA 3BQYA 1S8NA 4NC8A 3DFGA 1EKEA 4ABZA 1Q0DA 1P4XA 5T1DB 1XSXA 2ZNZA 4KN4X 3OWTA 1V55C 5ED4A 5B1BH 2RN7A 1SFUA 4L5EA 4KMFA 1LKXA 5GP9A 2ZXPA 3P9KA 5E3MA 2XF7A 2K5CA 4U5GA 4CO8A 2IYLD 4F3QA 3JREA 1ZYRF 2KQRA 2OF7A 3W3CA 2H7OA 3DZAA 2DT5A 2VASA 3IWZA 1Y8QB 5DQZA 3K9TA 2L3DA 3QYEA 1WJ5A 4ENKA 1JPJA 1QHHD 1SF8A 2IXMA 2QBYB 3ASOC 1G3SA 3W2VA 1FYKA 3OY9A 4BBRJ 2ZD9A 2M64A 3ZOBA 5E3CA 3TBIA 3R0AA 2EFWA 4CS8A 3QPLA 1ZVZA 5EG0B 2KJBA 3HKZA 2AWYA 4NC7A 3K70C 3HG9A 3TJ5A 2Q1ZB 4BEMJ 3HSFA 4RMNA 4I76A 2IXPA 2FD5A 4M74A 1F43A 4I98B 3PIPF 4A3IJ 2E2JJ 3JZ0A 3P9CA 2HFIA 5FROA 3FMQA 5J4YA 4Y15A 5D4SA 3SXKA 3RIPA 1POGA 3VYWA 2A07F 2EILH 1J8MF 3IQCA 1O3SA 3HOZJ 4E4HA 1D5YA 1I5ZA 3K4CA 4EEFG 3I0TA 2E5NA 1KQ8A 5KK1A 3TMOA 5GAEJ 4JZAA 2JA5J 2WB1N 4IXAA 5DEQA 4JEBA 3MZ8A 4XLPF 2XL6A 3NKDA 2EV6A 3HBLA 3SYNA 2NXNB 5L3BA 2EIKH 1IGNA 4CHUA 3WU0A 4JYKA 1ODDA 4OOIA 3RYPA 1I27A 4TV7A 3C3WA 2DYRH 3V5XA 5IOYA 1YZCA 3HOVJ 1GS9A 3E6CC 2ZXOA 3NWTA 4E70A 3M4OJ 1KQ0A 2BXYA 3DCFA 1CPQA 3BTIA 5ILVA 3GYHX 1GT0C 2EFPA 2EIJC 3RKOF 3V8LA 2FBHA 3HOUJ 1W5SA 2EZKA 2JUCA 3FAJA 2TMVP 2XS8A 3IHUA 4R32A 5EGYA 2V1UA 4R8HA 3I5PA 1Q0MA 1BI2A 2QSFX 5HLIA 4BY7J 2JPCA 1LS1A 3K6BA 3BR2A 5L0JA 5DCMB 2O7OA 1QLEC 3RIRA 5DVWA 1TL8A 3VODA 4BDYA 1VQ4I 3F6VA 3EUHA 1YRNB 3VSLA 2DDBA 1QZEA 2C03A 3M79A 2CUJA 2P5KA 3EGXA 5B3SH 1U3EM 1ZRFA 5KYUA 5COMA 3HKZN 2CMPA 2HQRA 3RKYA 5IYDJ 3C2BA 3HNJA 4HZFA 2WB7A 1WWPA 3RKQA 2ZSHB 4EM2A 1ZG1A 2JVGA 4FAPB 3D1NI 2GZWA 3J80K 2LRDA 3MD2A 4YIRX 2P61A 3DKAA 4EWCA 4QSHA 3N4MA 3VYTB 2FX0A 4ENNA 1YJ9I 4XBFA 4XQFA 3LS1A 1ORKA 1FLIA 4G9YA 3FHNA 3WTZA 3GFLA 3SEZA 3EZHA 4U0WA 2ZJRF 1K79A 2HSBA 3X1OA 2MABA 1QKRA 1LIHA 2QQ9A 4BHPA 2JJ7A 1YA9A 1B9NA 3GORA 2PEXA 4OAZA 2ZJPF 3EDPA 1BA5A 3OS1A 4FWVA 4E7JA 1OR7C 1WCMJ 2EA2A 1MSFC 3FXUA 1S5LC 2PN6A 4GYIA 2KQ9A 3K70D 2R7QA 2FBIA 2Z2SB 2QEXI 2IA1A 1NBBA 1RKEB 4BG0A 1WGXA 5LHIA 3KEYA 3R2PA 3C1DA 2DQRA 3NAUA 3ULQB 3U9GA 1DGWY 2MC4A 4B3AA 1JRAA 3ZQYA 3HOWJ 3ESWB 2ECBA 2LREA 4HLYA 4MEXF 2NYXA 2JVHA 3N05A 1N1CA 3TOLA 1UZCA 2P6VA 5CKTA 2Q3TA 4O6MA 4DYQA 4F91B 1ON1A 2XAFA 2LSEA 3RVZA 1MJ9A 3D5LA 5C44J 4HOBA 2NG1A 1I3QJ 3IC7A 4GO1A 3EZIA 3U1KA 1TC3C 1L0OC 3NEUA 2X1CA 3BC8A 5EEGA 4DYRA 4CYCB 3GTQJ 2R05A 1X3UA 4C30A 2R5ZB 3MYFA 3KL4A 3KZYA 2DLLA 1TQIA 2ADUA 4RAZA 3ZQHA 4A3KJ 4DZPA 4IHVA 2XDVA 2JA7J 3DEEA 4BPMA 4PR9A 4YWQA 4BAYA 2RNGA 4XKWA 1TQMA 2L7MP 1KYZA 3CLQA 3SZPA 5DDGA 3DE8A 3FOPA 1VQ7I 3BG5A 4XLEA 2J5PA 4L9TA 3AGUA 1U5TB 3H0DA 2E5ZA 1ZU5A 1Y39A 5KAIC 2LP0A 4D5FA 4HEAJ 5A6AA 5FD5A 5KYWB 1NU7D 1E83A 4YFNF 3IWFA 3TW7A 1YLMA 3QW1A 1P4WA 3AFHA 3DTIA 1MH3A 2HYJA 3U9JA 4DVZA 2LK2A 4BBSJ 1RR7A 3TJ6A 2VCBA 1JHFA 3L2WA 3E3VA 4Y13A 2UXXA 5J1YA 1E17A 2DTRA 3JRDA 4LLCA 1RCPA 2NVUB 3MFNA 5A6JA 1E3OC 5J1UA 2AS5F 3KYDB 1OXBA 2QYOA 2F4IA 2M4KA 2E1MC 1ZHFA 2TDXA 1L7CA 1I50J 3KH2A 4J7YA 1WJCA 3BY6A 3DPUA 3E5QA 1H8AC 2TRTA 2XLDA 1OW8A 2KZVA 3DEUA 4V2FA 4A6EA 3CO7C 2FNAA 3FX3A 1F5TA 1ZHYA 4XTKA 4MIMA 5DCFA 4FCYA 4AM3A 4HX4A 3QQAA 2LTPA 3EPVA 5F28E 4G94A 1J59A 1LDDA 3GLXA 2NUTB 4ZLCA 2XGCA 5FJ8J 3AL0C 4AUXA 4KMUX 4RB2C 2IGOA 1O57A 1WN0A 1YG2A 3HJEA 1VYKA 2MG4A 1DP7P 1OCPA 3BPVA 3OIQA 1O7LA 1K83J 2KRCA 2AP3A 5CQGA 4CZCA 3WG7C 2LD6A 5FLXK 3GEZA 4ZDLA 3S2WA 4HQEA 1MDMA 3CF2A 1HKSA 1E3PA 2QQAA 3K1IC 1SFEA 3HRSA 2EIMH 2BZTA 3BOQA 1ACIA 3AG2H 1W36C 2C04A 3DAGA 5EJCA 1JPNA 4UB8C 1BIBA 2IS2A 2IRFG 1TWGA 3OYGA 1NZEA 4M9ZA 3RSNA 5E8IA 4LLEA 2W00A 4RGUA 4U5DE 1WATA 5E2QA 2L7ZA 1RPWA 2UUHA 4ZLDA 4C7OA 4UDVA 3LSKA 2L7AA 1KU7A 1WWXA 3QWLA 4S0HB 1VQOI 2JA8J 2NUPA 2Y3DA 1SZIA 3S9OA 2DFHA 4IJAA 4Y3OA 3CJRB 1W5TA 4G7ZF 4RB0A 2PJRA 4WABA 5JI6A 2RC4A 3EYYA 3J81K 4HE8D 1E84A 5TRDA 4E7LA 3A01A 4LG0B 3NDBB 4MVRA 2CQXA 2Z5UA 3IQ5A 5HODA 4GFBA 2H6BA 3FBIB 4GRIA 4KUMA 4A3DJ 2K3PA 4A5MA 1Y56A 3BLYA 5M3FJ 1DUXC 5LRRA 1JJ8C 2F4MB 2HPMA 1ZLKA 4HV6A 2XB5A 1Z9CA 4XLNF 2CQ7A 4N4WA 1YO5C 5J4VA 3RDIA 3SZRA 3WTVC 2FMLA 1RI7A 1OR7A 5D5WB 5L0GA 1FBSA 2KMUA 2O8XA 2BGCA 3MZYA 5JHFA 3GTPJ 2ID6A 1G3YA 3F8FA 3DXJF 1K6OA 4K0DA 3GEIA 4XPXA 3H5AA 2BBYA 3U3BA 1XX5A 1M56C 1R71A 3F3XA 2DCEA 2XV4S 3KP6A 2GXAA 5F6FA 4NTFA 2QSHX 2VJIA 2LVSA 4AE4A 1EF4A 1S7OA 3HTUA 1VQMI 1OW7A 2XPVA 2MLGA 3ZXSA 3BEHA 3G1LA 2JN6A 4P9UA 2IBDA 4H4KC 2XVCA 5DM6F 3E5UA 3N0TA 3HEFA 2K02A 3MZHA 3Q5FA 1R49A 1USTA 3NYLA 1BI3A 1D8JA 2JRTA 4I2OA 4BEJA 3EG9B 1SD4A 2QE9A 3JTGA 2CH0A 3M8EA 1JT6A 2BVMA 2JWTA 2MBFA 2IXSA 2WTEA 5CPRB 3KMIA 4PFOA 4IRUA 1U78A 1ZU4A 2DDAA 1W4MA 2HOEA 2QCOA 5FKMA 2HSQA 3KP5A 1WI9A 4YL1A 3AG4C 3BDDA 2WVNA 3EGDB 2W57A 4EBBA 3W2AA 3IP4B 1E0EA 4N9IA 5A69A 3CUQB 4AVZA 4BGDA 1YS7A 3M1CA 4AIHA 4IAOA 1QA6A 4UVAA 3PJRA 3ZGKA 1YE9A 4C2TA 1X19A 3HPGA 5B1AC 3S90A 1J0RA 4L6RA 1FWZA 1D1CA 1F1ZA 4G6QA 1V4AA 1AA7A 1MD0A 4C9YA 3K1NA 1YITI 1Y4CA 1WTYA 2L81A 1FX7A 4HF0A 2R93J 2DOFA 5HDNA 4UXNA 3TP0A 5M3MJ 1IN7A 2P7VA 4HX8A 3TP3A 2R9RB 1B1BA 2MFZA 2ZBKA 3SQNA 1T0FC 1IUFA 3DEWA 5B5EC 4KNWA 1T38A 1TWGJ 4NB5A 2HZTA 3RPUD 4X6AJ 2ZFWA 2GFHA 5COFA 1IZMA 2WVOA 2EPNA 3ECSA 3WTTC 4EGZA 2XSJC 4A2UA 2MH2A 1CGOA 3Q0VA 5J47A 4BL0B 3KZIC 2K40A 4HX7A 3TQNA 1DOWA 3UGOA 2Y9ZA 1H7IA 4YIIA 1UMQA 2BY1A 1X58A 2MC3A 3K4JA 1FEXA 1H9TA 1LUJB 2FU4A 5F5FA 2PX0A 5AONA 3FXOA 4EBKA 1XGSA 3SFIA 3FXLA 3BG9A 2VCCA 3C2HA 2XAHA 4WXHA 3CCUI 1PUFB 1HY5A 3K1IA 1QHGA 5C3EJ 1Y0UA 2M34A 4D7NA 3CCLI 2LIGA 1IV8A 3M4BA 2ID3A 4W1UA 3RPUA 1OYWA 5EDNA 3GODA 3V42A 1Z7Qc 1SR2A 4EQQA 3LSTA 4RM3A 1A7DA 4MVOA 1S7ZA 5JVEA 3PFYA 2FBKA 4A0YA 3GO5A 1EH7A 2RNJA 4A69C 5TJJA 2Q2EA 4BNCA 1MDMB 1REPC 3G2BA 1NU9C 4ER9A 4M6YA 4G7HF 2FRHA 2GXGA 4I7HA 4M3BA 3AAFA 4IHXA 2RAEA 2XF6A 4KICA 3RQFA 3QP5A 1VNDA 3EYIA 1V74B 5CVRA 2BHYA 2DA7A 3KP3A 4XLAA 4C7OB 4HPQA 1KQ9A 1OYIA 4PCQA 2I10A 3VDXA 4D4NA 2DA1A 2O0YA 2WBMA 2XKPA 1M1EB 2OAZA 4IL6C 2K9NA 3ZR8X 4A12A 4IHSA 3IH2A 2FNPA 5BQIA 4XKCA 4NHJA 2KPMA 1OXKA 2FQ3A 1KU9A 3CMYA 1AUEA 4IHWA 3ECOA 3A01B 3FBNB 2WZGA 3JRTA 5IY5C 2L6HA 4JX6A 1OCOC 4QI2A 1MMSA 1GM5A 1KGSA 2CW7A 2Z99A 4HSTA 2R7WA 3LUTB 1IUYA 3O39A 3OYNA 1Z05A 2ZXJA 4EM1A 2COMA 3K4NA 4KISA 4QPOA 4WGZA 2YX4A 4H0EA 2XIGA 4JOMA 4II2A 3JRCA 4Z2YA 1T95A 3KETA 3EH1A 3O8HA 5FKOA 2DMTA 4BQQA 1P9QC 3GWNA 3GWZA 3K4MA 1A5JA 1XMKA 2H7BA 3A0BC 4HG2A 3ZCOA 3F22A 3I4MJ 1GXQA 3V8JA 1A41A 3VB2A 4D5CA 2LG4A 5FB2A 5E1WA 2G7HA 5IP6A 2K86A 3WG9A 4QLCU 2XGDA 3RH3A 1WKMA 4OAYA 1XS9A 2PBIA 2NOGA 3DBLB 1VQ6I 2CNWD 4G0HA 1IRXA 3FKJA 4PJLA 5FLVA 2L6GA 5JLXA 3LSJA 4KFCA 4PJJA 2CV0A 1U9NA 3LA3A 5K5RA 4WXDA 4E17A 3RQEA 3CLOA 4BACA 1J2XA 3E6BA 4WJ0A 2M3AA 3GTOJ 2X6WA 3S2HJ 2LQGA 3SXYA 2DK8A 4CJGA 1VQ8I 4O6JA 4E0IA 4JVSA 1GLNA 2WY8Q 3FK7A 3LQQA 2OCCH 5HS8A 2HDWA 3J7AO 3GLLA 4NTAA 2W85A 1T0FA 3F23A 1QZZA 1T08B 5CJ9A 4C2UA 1NK2P 3Q0UA 2LBFA 1ETXA 2QUPA 3BR3A 2YL3A 2VIXA 2MHRA 5J8FA 3HPHA 2PMZA 3PO2J 4QIWN 1ZELA 2CNWA 2L4MA 3M15A 2D4UA 2VT3A 3K66A 4IARA 3QU6A 2VE9A 2VJJA 1UG0A 1I6XA 4ZYDA 1K4SA 1HE1A 4D4XA 3H9QA 3QPTA 1Q1HA 3BG7A 3L8JA 3RW0A 2M0MA 3AG1H 5K5OA 3MBGA 2L9NA 3KYJA 5D5XB 1FOWA 2IXOA 3K1HA 3Q7LA 2DXIA 2E1MB 2J7PD 1UHWA 3PCVA 2KKOA 1EI7A 4N9HA 5M5YJ 1IDYA 3S16J 2N8GA 2EA4A 3HRUA 2J9BA 4DGWB 2I15A 1I6HJ 2X48A 1C02A 5E1XA 4U5CE 3SEOA 3OIPA 2NS7A 2QSGX 3BROA 4AL1A 3HLZA 3M8FA 2X6XA 2MLKA 1PVEA 1BW6A 4NC6A 1LE8B 4P96A 1SFKA 2L5QA 2XM4A 3LMMA 2XKOA 5ICEA 2LH9A 4IPAA 1YW9A 4AD9A 1GGQA 2O5RA 1D1BA 2AHQA 3JR9A 1OFCX 2IJLA 3WGIA 3J80Z 2BYVE 3R6SA 3DJUB 3QOEA 3FK6A 4XSXF 1YX3A 2YL7A 1G4DA 3QW0A 3HOXJ 3D0SA 1TLHB 3SYTA 1YTYA 4M6XA 3MVPA 1TNTA 1K4TA 2B63J 2J7PA 1OCZH 1XGMA 2HKXA 2AXLA 4KJZA 2VC9A 2OUMA 3B02A 3DV8A 4CDGA 1HXDA 4I6ZA 1PCXA 2A0UA 2Z15A 1W7PD 1IO2A 3MX3A 3L1MA 3NMKA 4PACA 1K6YA 5HDKA 1BR1A 4BQAA 3S93A 4MQ9F 4ZZLA 2XLMA 2EPLX 3VOEA 2ZPAA 2KDOA 1Z3IX 2Q2EB 3IL2A 4F52A 3KEOA 2L02A 3T0YA 3RFYA 2F4OB 4IOCF 1ZARA 2Y2ZA 4M71A 3MKLA 2G9WA 1LDJA 3JSZA 3OYLA 2XHKA 4EV0A 2PMZN 3FKIJ 1R1TA 3UNGC 2CO5A 4BJ1A 1G5ZA 1JI8A 2O9XA 2YLDA 4D7MA 2GIZA 1YIJI 4WGYA 4ESJA 2Y31A 3SDBA 5HVQC 3WAQA 3JRIA 1BDJB 3BG6A 1EA3A 2DYSC 2I5UA 3RF3A 2XPUA 4U87A 1GDTA 1W7PA 3GBGA 2BW3A 3JW4A 4GGGA 4Z6YA 1AVOB 1SAUA 5L3GA 2DN0A 1VOMA 2LP4A 2OG2A 1D0YA 4M3FA 4RS8A 3E70C 3L9FA 3ML6A 4CGZA 3O10A 4CBEA 4EJVA 1JKRC 2E87A 5FGMA 2HVQA 2C6YA 2A5YB 2GBYA 3KYCB 2G7UA 3GVAA 4OU0A 2VXDA 4IX7A 3NMIA 4YFXF 3GEEA 2CYYA 3EETA 1Q1VA 1WASA 3OA1A 3C2GA 4ITVA 3VYRB 2IOQA 2R03A 2DQLA 1MJAA 2JTVA 3PUFA 2EWNA 4KIGA 1BR2A 1R58A 1ZREA 3ASNH 5COGA 3VFZA 2XLWA 2V3CC 4HFKB 3HNKA 3ATPA 1WJFA 1MBJA 4UB6C 1AOYA 3I59B 3IUOA 4E18A 2VKVA 2P0NA 3I5QA 2EIJH 1N77A 1P2FA 1D0ZA 2DT7B 1UCRA 3S15J 3LSPA 2V9VA 1R5HA 4X1EA 2LF7A 2P5VA 4BJ6C 1B72B 3HOYJ 3Q3SA 2HVSA 4XN3A 3HGYA 3F72A 2ACJA 1VMAA 4UUSB 1QQIA 1JHHA 1H0MA 3IEEA 2XRHA 2A5WA 2E7XA 1RUOA 1Z77A 4O79A 5LLQA 5IT9K 1TWAA 2XF5A 2XAUA 3BR1A 4E7KA 4LDKA 3ZP5A 5BQHA 2DA3A 4K1OA 2KW3C 1J5YA 1R1VA 1U89A 2W45A 2HTJA 2QKLB 2GAUA 1A0BA 1V5GA 3HSRA 3GMEA 4JK1X 2Q0OA 5KYYB 3OYBA 1KONA 4XOTA 3GUDA 2VQCA 2LKSA 2XSEA 1IDZA 3OR2C 2IW5A 1LB2A 2CYDA 1HW1A 5FLXZ 2JRMA 1K78A 5K1YA 1BM9A 2GA2A 3M07A 1G2HA 2QZ8A 4GYGA 3R60A 1WH7A 3W6JB 3FXHA 5AIPA 2ZMEC 1ERDA 2ZXWC 2YKZA 1DGRM 1SD5A 4AX2A 3L2QA 3I56I 2ELJA 4C3IJ 3AOUA 1BI0A 1Z1DA 2LY1A 2ZO4A 4BKXA 1OKKD 2MD5A 1RMVA 3HYIA 3L2UA 1TKNA 5GAGJ 2YWAA 3DLAA 4IAQA 3T6JA 3O3KA 3B71A 3LJBA 4KI2A 3QAHA 2IM8A 1JGGA 1JUMA 2ZJ2A 3SXMA 2OA4A 5L3EA 3A11A 2OOCA 3HKKA 1HLVA 1HC8A 4EKWA 2ZXRA 5JT4A 4DOZA 1SD6A 2BHZA 1OW6A 2AWCA 5L0CA 4YIFA 4Y4RA 3LAJA 1TWFJ 1HCRA 1I4ZA 5L3QA 3QP6A 2ZCWA 4JKVA 2L9RA 4B8XA 2XRNA 4XICA 1EA8A 3ABLC 5EHHA 3K7DA 2M45A 5CVJA 2HGCA 3BJOA 2ZFUA 2YRFA 3HJCA 2E19A 3CCVI 4Q47A 1TWHA 1Z7UA 2IA2A 1OKKA 3MKYB 4ZH4F 3VYUB 2Q9CA 4MS2A 4C3DA 3V7RA 1PYVA 3LEVA 5E3LA 4EJOA 2CW8A 3FZVA 2VBXA 3IQ6A 3W6KB 4KNYA 3FXRA 2P1AA 2R7FA 3X2QC 2DMPA 4B47A 3BCBA 3QPSA 4OMZA 3PNTA 4ANJA 5JVTA 1BZ4A 4FETA 2KYHA 3QZCA 5B1BC 3S0XA 1J8YF 2HMZA 5DUIA 2ME0A 2IGNA 4C3BA 3BCAA 2VODA 4LACB 2VONA 2MGQA 2DODA 3H3ZA 3RVYA 3T6BA 1R4TA 1TWCA 1X4OA 2JZYA 1ULYA 3EQLF 2PMUA 1O7FA 3EFOA 1G4WR 3C8GD 1OCRH 3G3ZA 2QM3A 2W4SA 2JQ7A 2PF4E 1T56A 2A69F 2DA5A 3CDHA 1W1WE 2VE8A 2QVOA 1BC8C 4YT8A 3OYIA 4CCJA 3KIOA 3OYHA 4RBOA 3JSPA 1F9NA 3G71I 2OD5A 1X1DA 2M9HA 4F92B 2O03A 4OIPF 3VAYA 1OCTC 2M7AA 3DP7A 3IV5A 3IRQA 2NVTJ 5CLSA 4CCOA 1C0WA 1ST6A 5E33A 1ETKA 1CGME 3CUOA 1TNSA 1TWAJ 4HYEA 4MLOA 4OIOF 4MW3A 4YT2A 3HNLA 4XRSA 4A2NB 2ZC2A 3DF8A 5KVRA 3CMEI 1HOMA 1IV6A 2ZSIB 1SEUA 2DA4A 1IXRC 1W0UA 3ZN1A 2PX9A 3PIOF 3C63A 5JP7A 1L3PA 1JTXA 3V7CA 4B48A 4NDLA 1XDUA 5D5UB 2EILC 1S3JA 1SVMA 2YQYA 4RLQA 3H35A 3C8GA 1J09A 2H09A 3V7OA 1WJEA 4PSWA 3K4BA 1Y6IA 3ZC4A 3LQRA 3ZQIA 3ZQVA 4EBJA 2IP2A 1V5FA 4A5NA 4E7SA 4CS9C 3QPHA 4ENMA 4C3EA 1UHMA 4PGHA 3OOUA 4M63A 2DT6A 3BZKA 4BJ6A 1EH6A 2BY3A 4KT5C 3TQOA 1NG7A 2KLOA 3CESA 1CPRA 4N6CA 5E3OA 4BY1J 4R1HA 4BUPA 4PDKA 4WX9A 4U5BE 3LESA 2L9VA 1S7AA 4M3GA 1AWCA 1I1SA 3LSHA 1WGWA 1JKOC 2ZKZA 3QYFA 5E8GA 5F64A 3IRRA 1XWJA 3CQZA 2Y9YA 2DFEA 4ETSA 4M9XA 4RAFA 3EHMA 1MBFA 4YN0B 1FZPB 2LKPA 2P81A 1UG7A 4GDFA 2UUZA 2X1DA 4G78A 1ETQA 4JJGA 5GPGB 3ECHA 4KDPA 3BR0A 2KNHA 2VJ4A 4W8PA 2AXTC 4KN7X 3F8BA 9ANTA 1VF9A 4XLFA 5AGFA 2V6CA 4ON0A 2CQQA 1RKCA 2EPKX 1NG6A 5LEJA 4FQGA 1QZYA 3HRTA 1USSA 2VKEA 4AWXB 4UVCA 1MIJA 1P4AA 1XB4A 2VBZA 4KNVA 3B0VC 4JJFA 2HFHA 3F8NA 2ZMEA 3EUKL 1JOGA 2NVYJ 3MYIA 3TOMA 4MEYF 4JEAA 4XEFA 5DLJA 2PG4A 2R7SA 1IN6A 2BY2A 3E5XA 4LDQA 4X0RA 4LIVA 3R0JA 4V2GA 3SZGA 1YIOA 5D8LB 1TWHJ 3Q6NA 3SNHA 2QGUA 4IQ4A 3RCOA 4DJ9A 5B3SC 1TTYA 4U0YA 2IS1A 3O6XA 4LLLA 3FMSA 4CSWA 2DMNA 3I54A 3WHCA 2LKXA 1LEBA 2Q9AA 4Z9HA 2DO7A 3HTSB 2HOAA 3TO7A 3E1SA 1K78B 1YYXA 3MWMA 4J7TA 2CS3A 3HUGA 4U7DA 1T98A 4UUTA 1NTCA 1HA8A 3ZVRA 5EGOA 1JKPC 5T3TA 2V7FA 3PUBA 1E86A 1ETYA 1WFXA 5FRNA 1WJBA 3K4KA 1SMYF 1SMTA 4EJWA 1TWCJ 2K4BA 4MNUA 2XGXA 3K0LA 3RPQA 3VWBA 1I1GA 1VLSA 3HHGA 2EV0A 1G3WA 3K4LA 1IZ1A 4HA8A 2K9QA 2J0XA 3U9MA 5JLIA 2K85A 2EINC 4L0ZB 1MMGA 5BMZA 3LEOA 4LDRA 1T2KA 1M2VA 3CCJI 3ELKA 1Z7LA 1Z23A 3RZOJ 3HXLA 1OR3A 4CDVA 4O6NA 3QYBA 4YFKF 4F4BA 2FJ1A 1LFBA 1ORJA 2LK4A 2E71A 1DQUA 4NNJA 3CDLA 5LGTA 2XAJA 4BE2A 1Q0KA 3FISA 2OU6A 1JMWA 3L2CA 2IPQX 5JR3A 4AVPA 3CMMA 3C18A 2FUG2 4B44A 2HJ3A 3QTHA 1LVAA 2V9PA 3FWEA 3O8GA 2VLAA 4BEHA 2RD9A 2KIFA 1TT5B 3HRMA 5EZGA 3HL2A 1M6TA 2HMQA 2HR3A 2Z33A 3ZPLA 3VPRA 4A3JJ 1ZR4A 5B1AH 2F48A 4HLXA 1YAUO 1S7EA 1XCVA 2X51A 1RZ4A 3QOPA 1RKTA 5C4XJ 3EGXB 2UXNA 2ISZA 4LERA 4CYDA 3AQBA 4LMYA 5KYUB 3TW6A 5BS6A 5IYCJ 1MNDA 1XMAA 2BL2A 3N24A 3IH4A 3PHF2 4LITA 4LOCA 3LFUA 3H92A 3MLGA 2A6EF 4ENJA 1QNTA 5EEHA 5DTDA 2P6SA 2R5YA 3DD7A 2A68F 3CQZJ 1ZN2A 5HDGA 5KNLA 1FT9A 1LPEA 1N25A 1RR8C 3CSKA 2HWVA 5F04A 5F08A 2LY2A 1OQCA 4KA4A 2NRAC 5FRMA 5D5VB 2DJNA 1FOKA 4DBQA 2B0LA 4F7ZA 3GTLJ 4JX5A 2IBFA 1Z6RA 3LSGA 3P9IA 5IP9J 1FYMA 3DJNB 3OSFA 4CS9A 2MH9A 4FTHA 4M3DA 1RETA 3M7GA 3ZSUA 4XKVA 1MBGA 2XB0X 3RJPA 1SYQA 4LB6B 1D3YA 3US6A 1PP7U 4CJOA 1T6UA 2DMUA 3CEXA 3U8VA 1JKQC 5DS6A 3L7WA 1APCA 3BR6A 2DBBA 3A9CA 2WVQA 1IXCA 3H9GA 1FFTC 2BV6A 2QKMB 3T6GB 5JFRA 1DU0A 5KHDA 2LCHA 5EEAA 3VRCA 2EV5A 4EJUA 3A03A 4RDAA 1A6IA 2OJED 5FLMJ 1PD0A 3U2MA 5BOXA 2VKHA 5LRSA 2DOAA 4ESBA 2WWYA 2HV7A 1UAAA 2W1OA 3S1MJ 4XNFA 3IKVA 3GANA 3AKZA 5L3FA 5EK0A 4BE0A 2PP4A 4NUBA 1KA8A 3M9AA 1IRGA 4R79A 2JX0A 3D5SC 4XONA 3ABKH 1V5EA 2OZ6A 1A35A 3AG2C 3JRMO 5A6KA 3NARA 4BXUA 1T9KA 5E20A 1XCBA 4JIOA 5TISC 3RYRA 1PJRA 4FASD 1A31A 2F5VA 3Q9SA 2PMHA 4IO9F 4YRVA 3DLLF 4RD9A 4HBLA 1QO0D 1FSEA 1ZK8A 3WE2A 3WHBA 6PAXA 3PQKA 1AKHA 1XSDA 4FT8A 3FXQA 3ONQA 1W36D 4DRHB 2Y69C 5HLTA 3EUAA 2NPUA 1E85A 4P9FA 3LNRA 2QTVA 3QVYA 2KIMA 3K1MA 1QVUA 4J30B 2K9MA 1YVIA 5FFZA 1XG1A 2PX3A 2JA2A 2Y75A 1MH4A 3QODA 5F0HA 4WXCA 3MAJA 4MTGA 2VPRA 3I4UA 2DGJA 3N2ZB 2RGVA 2J0WA 2YUSA 1EQ1A 1E3HA 1FMVA 3LLIA 3VM6A 2NVXJ 2NNYA 5BPIA 1MZBA 3I4NJ 3G6EI 4BXXJ 1H9GA 2WAQA 2EFNA 2XPWA 4MQVA 2KK1A 2XLEA 2YLGA 5GPCA 1YDIA 2Z9OA 3GZNB 5L3CA 4CSAC 2HYFA 1IC8A 5JUAA 1MBKA 3N97A 2M5WA 2MD0A 2OEXA 5FCLA 4M72A 5HS9A 5E3NA 1ONVA 2YZSA 4U9DA 4DXWA 4XK4A 3OV8A 1QQ3A 4HAMA 2PI0A 3U21A 2CV1A 3DI5A 2D5RB 2DI3A 1Z6AA 5A2QK 1RESA 1R22A 2CRGA 2R3SA 3OYJA 2KGOA 1RJ9A 2JSPA 4EVIA 4RAGA 1MBEA 4U5FE 1CGPA 4NQWA 4KT6A 4DIQA 2WL8A 4CUGA 3E97A 2CQKA 1ITYA 1FOYA 3OYDA 1Y1VJ 1OPCA 2R7OA 4L0YB 2L2OA 3SP1A 1K7AA 1ZHZA 4IEJA 4LFUA 4W97A 2KHMA 4XPYA 5IPAA 3HSEA 3JYHA 3VF0A 4HSRA 2CU7A 3EHNA 3ZQGA 1OISA 2OZUA 4MGRA 2ECCA 2R0QC 2HXOA 1CF7A 2NUPB 1L3LA 3DTKA 3TK0A 2WAEA 1JUPA 2P4WA 2OQGA 2XGEA 2E1NA 2PJRB 1TR2A 2WADA 1LNWA 2V1XA 2GA0A 2LSOA 3OS0A 2R25A 3HNIA 4PJ0C 1S72I 3HOSA 4DJAA 4GEHA 4MW8A 3DAFA 5CI9A 1U2WA 1YFHA 2VUMJ 3ZQQA 2Q7RA 1IRFA 2IS6A 4EUKB 3OYAA 2XXAA 3H9JA 4IHYA 1JAFA 3BWGA 1FAPB 1HW2A 3S17J 2KRHA 2DAOA 5KYXA 5IT9Z 3DWLE 3RKWA 2H1LA 3TOBA 4K2EA 4QPQA 3K2AA 2MW8A 4N4NB 5H2FC 3IQTA 3NYMA 5CIVA 2WAQN 1FNTc 3JRFA 2E35A 3TGNA 3LNMB 2MYSA 3CCEI 1O3RA 2JK3A 3TDUC 4GQHA 4IRGA 5L3DA 2EH3A 3T5XA 1ZGAA 3G4SI 1YHQI 1B59A 1ZAOA 3CCYA 2KSFA 1ZW2A 3WHNA 4Y33A 1YARO 4AE4B 2GOMA 5E79C 3K2ZA 5K7ZA 3ZMTA 5T3WA 1TW3A 1MJBA 2ESHA 4QDLA 1EKYA 4MTEA 2EQRA 2HKOA 1S29A 2HS5A 2QLZA 2EFOA 2NVQJ 2FQ4A 4KBLA 5D91A 2W82A 2FGYA 3O2PE 2XL4A 4LLGF 3PDMP 3ROUA 1ON2A 4Y17A 2VXZA 1OJLA 2ELKA 2HVRA 2OEVA 2D1VA 3H3VK 3DM5A 3M1EA 2HOTA 4ZC3A 3GM2A 2DFIA 2OC6A 1WVRA 5DYMA 1NG1A 3NRVA 1WI3A 3BR5A 3TO6A 2I8BA 2RDPA 3BZCA 2R7ZJ 3FIWA 1M57C 3ERED 4QI0A 1E2XA 4E7ZA 4B1RA 3GXOA 3H5NA 3KPHA 1ZH5A 3CZ6A 1I4YA 2JPUA 4DVYP 4A0XA 2VN2A 2F6CA 2VI6A 3B6CA 2H1KA 4DYCA 2E7WA 2ETHA 3M1CB 3MEXA 2HPIA 4L9NA 1OCCH 3FVYA 3K7AJ 4AIJA 4I0BA 2A0BA 4Q4ZF 4CDYA 1WSUA 3OYFA 2QBYA 1J7KA 2OQRA 4NC3A 1YJNI 3TULA 1PDNC 1F1MA 4KITB 2IGKA 1PV3A 2VQGA 2XASA 3S84A 1Z3YA 4NQFA 2JT1A 2K4JA 3OS2A 4ZYGA 4W8KA 5EG0A 1QPMA 3PSIA 1VK5A 4MVQA 3CCRI 4YT4A 5JS5A 1J9IA 3L0IA 1N75A 3PMRA 3A02A 1X3WB 3LA2A 2P7VB 4D1QA 2DYSH 1ZQ3P 3T8TA 1G8XA 2A61A 2ICWG 5L3VA 3SZTA 3W8IA 2F5FA 2W84A 4XWJA 4WF2A 4B6IA 1OQYA 3I71A 3NWSA 5CVIA 3W6VA 2L6FA 3ABMH 3ZMSA 3H36A 4B3XA 4BH9A 5H20A 4DW6A 2HZDA 3BTCA 3FDYA 1U5TC 3Q6MA 4E0HA 2VKDA 3FMRA 2QA4I 3HOTA 4X0GA 1H89C 4BU2A 4CSAA 3F46A 1R7JA 4HFFB 1IN8A 2O61A 4L5JA 1SANA 5D92A 4PFPA 4ZDPA 1RRJA 1BW5A 4RBNA 3D5RC 2OQMA 3ITFA 3AL0B 1SD7A 2FA5A 3BQZA 3CJNA 4XOPA 3TDZC 1CQTA 5L0HA 1FMWA 2V79A 3Q0WA 3WTXC 1BBHA 2CUZA 2MA3A 4PGGA 1VYIA 1R1UA 4ULWA 4IJJA 1MMDA 1BC7C 3I3LA 5JLWA 2D5VA 5E3AA 2A1DD 1P6RA 2Q9BA 1R36A 4FESA 2YL1A 4LIUA 5M5WJ 4ONSA 2MSYA 1V55H 2VCAA 2RREA 4YL3A 3I5UA 5DM7F 1W0TA 3KFWX 5E17F 4LGWA 2STTA 3RQ4A 1FTTA 1OR2A 3R7CA 3FDQA 3GZ6A 1O5HA 2V26A 2KIQA 2Y39A 2E2IJ 5AIQA 1YOVB 3JAMK 4QWQA 4A3CJ 256BA 2XL8A 4ZJZA 3GCMA 5DV5A 2E1CA 4L18B 2PFDA 5J40A 1DPUA 4U5EE 2V4JC 1X1CA 5J3LA 4JCZA 4ZYHA 1ZHTA 2KIUA 3ASOH 3ABUA 2HTSA 3S3NA 1QBJA 3J7YJ 1TFKB 1NSGB 4MFEA 5DCMA 4L9VA 4LG3A 2WZLA 4UNOA 1V54C 1IN5A 3S1RJ 4XL9A 1YRNA 2VH3A 2QY9A 2YS9A 4IKFA 1Z91A 2W24A 3K1PA 4XEKA 4OD4A 3SHFA 2IA0A 4U7BA 1XGOA 2NAZA 4XRFA 3SXZA 3ZQ7A 1STZA 2FMYA 3HIFA 2OCCC 5J6XA 3BPXA 4BJ5C 4ULVA 1RUNA 1JE8A 3TL4X 3FXMA 2J45A 2ZXWH 3PSFA 1HSJA 2L54A 3CC2I 2X4HA 3B29A 3DE9A 2QUFA 1G59A 2DTZA 2LNBA 2DPDA 4ESFA 3JSEO 3V5YA 2Y3GA 2HQAA 3FF5A 4PK4A 1V3FA 1MW7A 1BI1A 1BOBA 3PL8A 1NK3P 1BN5A 1ZG3A 2IGMA 2K27A 1X2NA 1P92A 1K04A 3FM5A 2G62A 2W48A 3J7AY 2BVLA 5IP7J 1YA7O 2LMDA 5BUOA 4UVBA 3S1QJ 3JYYA 4JBAA 4AC0A 4MTDA 1GXPA 3E6MA 4II3A 1VQKI 5L0IA 3GW2A 4BXFA 2GQQA 3C62A 1WZ2A 1Z63A 1Z21A 1MNMC 3ABLH 2OPTA 1GV2A 3CP8A 4FISA 3WGGA 3UKGA 3U3FA 1JUSA 3F9KA 3S1NJ 1ETVA 3L09A 2VPLA 1B4AA 1XN7A 1YW7A 2HI3A 3CC4I 4P6IC 5FKKA 2VC1A 5ILSA 2QENA 5LHGA 2XAGA 3M4CA 3MKZA 4FX5A 4YEJA 1XMXA 4YL0A 3UGPA 1X1BA 2E34A 2KP6A 5AC4A 4FX4A 4A3FJ 2UV1A 4NBQA 1GHCA 3GTGJ 4B43A 1A7EA 3V8KA 3X2QH 4XRMA 3AG3C 4OIQF 1OCZC 3W8HA 4CYCA 3H5RA 2DFFA 2R5ZA 2KISA 3DU6A 1LQ1A 2WZFA 3JCUQ 2R7XA 5TJ5E 3U8PA 4U5HA 2LFFA 2XLOA 4E7IA 2JSCA 1CGNA 5DD8A 4XRSG 1XGNA 1RKWA 2OJQA 1SC7A 3QMKA 3FXKA 2EZLA 2NS8A 4BQNA 4GYTA 4PUSA 3B0PA 4EHPA 4A3GJ 3GM1A 3CUQC 5HLGA 1T5OA 3HZJA 5D8KB 3H3UA 2LBFB 4EMSA 1U5TA 2DOEA 4HRIA 4IRIA 3KKBA 4F93B 2M0CA 3DKXA 5KYWA 2DA6A 4UHTA 4UV9A 1K40A 4HNTA 3GZ5A 3KX2A 2LF8A 3HB9A 2EPMX 3J7ZI 5CI8A 2D2WA 3AQCA 4I1OB 4JTDB 1MMAA 5L0FA 2DU9A 3E6DA 3B73A 2DA2A 1BOAA 3S3OA 1X3ZB 3FOOA 2FAPB 3JSOA 3V7SA 1P7JA 1KTMA 2CQNA 2VT2A 2YR2A 3ZMVA 2O6GE 2QQ8A 3J81Z 1W5CC 4XMYA 2R7RA 1BJAA 2F5DA 3J06A 3OIOA 2CDQA 2EZHA 2UWMA 2HKVA 1OKRA 3DTEA 2KL4A 1XC5A 5F0CA 2M4EA 2A3SA 4P55A 2Q8KA 2K7LA 4Q48A 2KC3A 1NFOA 4J00A 1YS6A 3FHZA 2XLHA 3H1CA 4HNVA 3ZWIA 2DW4A 1G6NA 3GFMA 3F47A 2EB7A 3S14J 4NTBA 1QU3A 4ZTFA 4D9JA 2LD5A 2YEVA 2QQBA 1TFOB 5CVUA 1YZAA 4I44A 3KP7A 1B9MA 2NSGA 3ASNC 2ISYA 2L4AA 5AC5A 3WODF 1R4NB 3OL4A 4ASNA 2LFBA 3JRAA 2W9YA 2VL8A 4Q7CA 1GVJA 4CS7A 5LHHA 1XZQA 4IVNA 4UY8I 1IF1A 1DU6A 2GAQA 2RV8A 2CWEA 3M3YJ 4BYYA 4PJMA 3GF2A 5HLHA 2J9VA 2Q4FA 3LFKA 1XTAA 1HMDA 4BJ5A 3IPMO 2JMWA 4RB1A 5C4JJ 2J8WA 5DS4A 2EPOA 1FTZA 3T4RA 2JPBA 1X1AA 2YX7A 2XSDC 2ZJQF 3WTUC 3WTYC 3TO9A 1VQPI 1APLC 2G3KA 3BT9A 3S8PA 2GM4A 4LG0A 2VOOA 3MQ0A 2HZ8A 2YSRA 5HV9A 3NKEA 3KCCA 4JCHA 3MN2A 1B8IA 1Z6TA 3LSMA 1K61A 4MVMA 3U2LA 2PQ8A 1FTSA 2HQ5A 4N4OB 1UELB 2WAFA 2R7TA 2F5CA 4K7BA 3SEQA 1VTMP 3I4PA 3W4YA 1W7PB 2BW3B 4DZJA 2HV6A 4UUVA 1QPUA 2YU9J 2Y0SA 3S3MA 4J19A 2LOOA 4L9JA 3R61A 4I02A 5F27A 4YK5A 2A6TA 3BG3A 3NYJA 3OMYA 3QVZA 3WU1B 4CA0A 2F5EA 2A05A 3KYLA 2M7BA 1LVKA 4XORA 3JRGA 3GTKJ 2B0HA 4AL0A 2YU3A 2Y30A 1YX5A 4IRHA 3B0UX 2XUBA 3REOA 2RQPA 3SJMA 2EINH 1G4US 2L0KA 1EJ9A 2EIKC 4CX9A 1QRYA 3WG7H 2ELHA 1LI5A 2OV7A 1PP8F 3DMDA 1F4KA 3CF5F 3CTAA 1TZLA 1B68A 2P7CB 2DYRC 2R4GA 5M5XJ 3KZZA 3OR1C 3EG9A 3QRFF 4XN0A 3T8RA 5GAHJ 3BJ6A 2AQFA 3BTLA 3CCMI 2FE3A 1T6SA 3H2UA 3LL7A 2B9SA 1KU2A 3AGTA 2VOPA 4LJZF 3KLNA 2BE5F 4CICA 2HDCA 2R02A 3EGDA 1GVDA 4XLCA 2P8TA 2BEOA 1D0XA 5GTHC 3CUQA 3RQGA 4IWBA 1VQ9I 1S9HA 2OBPA 5A6BD 3F0CA 1FBUA 4C3HJ 5JVGF 3LNQA 3OYEA 1Z5ZA 3ZN0A 1BJZA 4CIHA 1LM3B 1QVTA 2FEZA 2DPUA 1T33A 4FX0A 2J9UA 2WA0A 4DRIB 3KP2A 4S05A 4WK8F 3GTMJ 5A2QZ 1U8RA 1Y0NA 1XDSA 2LY9A 2B7EA 5J1RA 2VQHA 1OCRC 3EJNA 2PFBA 2I8DA 2UZKA 3DBRB 3DU5A 3MFKA 1FSHA 1F36A 2LDUA 2Y0SN 4XM3A 2Z1DA 3WU2C 5BPDA 3ABTA 3S29A 4A3EJ 1LPQA 1FIAA 2V6EA 2OCEA 4I01A 2GXBA 4NCQA 5A6BA 3MMYB 4RGSA 2DB4A 4CXFA 3PQJA 4MVUA 5DUKA 1S6LA 2BY0A 1I5NA 1QGPA 5JRAA 3HC7A 2DK5A 1U8BA 2HOSA 3ZRGA 5D4RA 4EJTA 2WC2A 4IHTA 3E0JB 3BP8A 1O87A 4XPWA 4JX4A 3ISPA 4XR6A 3L2VA 2KJCA 3RQIA 3K33A 1V4RA 1PUFA 2G0EA 1WOLA 2X0LA 2QF7A 3C7JA 2H8RA 1ZZPA 4GCVA 5HSWA 1UB9A 3A2KA 1A6QA 5HOOA 2DJIA 2QLAA 4XQ1A 2J9WA 1LJ9A 1U6GA 2GWRA 1YJGA 3AG4H 1X1PA 2JD3A 4O7GA 3E9VA 3PNVA 2CUFA 4A3MJ 2QNLA 3LLKA 5FFXA 4XLHA 2H6CA 3F8MA 3G50A 5K5QA 2GIVA 4N0BA 4RDUA 2YLIA 3P5JA 3POVA 4HQMA 1UFMA 2VBYA 4U9EA 2BXZA 3PNYA 5F1JA 1KU3A 1HKQA 1UHSA 1J75A 1VQNI 1C03A 3DM9B 3GM3A 3H2VA 2OU2A 4G12A 4C2MJ 3OL3A 2KJGA 1HW5A 4EATA 4JC7A 4OIRF 1FBQA 1LDKB 5GPAA 3EFOB 1YW8A 3K69A 3JTHA 5EYRA 3KEQA 2Y69H 5ICGA 3ZQCA 2NUTA 1HBXG 3CD6I 3COAC 4AK9A 1BBYA 3RZDJ 4JP0A 3GTJJ 3LSRA 5L0DA 2K3FA 1VB5A 4Z9IA 1A36A 5F0FA 2OTJI 3GWLA 4XSZF 1P7IA 1YYVA 2IAIA 4IQJA 3S28A 3OYCA 1LEAA 1B8IB 1UFBA 3F21A 3HGGA 2AO9A 1ZGJA 3MKWB 4KIFA 5GTIC 4QTRA 3E7LA 4V19K 3FHDA 2H8AA 1HMOA 1RXQA 4BDZA 1A04A 2NS0A 4XKBA 4RB3C 2DMQA 1OLTA 4A4AA 2X6YA 2P0WA 3F8CA 1WHUA 3OYKA 3I55I 4G8XA 1JJ6C 3C8GB 1AU7A 4I1MA 1TP4A 4I0AA 3NQOA 1WJDA 1ZW3A 2CGEA 1R4MB 1R6RA 4F55A 4OD5A 1S05A 3FM3A 4Q5SF 5KYNA 4DQ2A 4LK0F 2KFDA 4MNDA 2XAQA 4B09A 5DS9A 2L9JA 2J46A 4CDAA 4HF2A 3IAS2 1D5VA 3ZMDA 1MSEC 1DPRA 1A7VA 3FXJA 2VC0A 3ERMA 2E2HJ 1IAWA 3ZDLA 3I53A 3L1PA 3JT1A 2O3FA 4B4CA 2EBIA 1R5GA 2CW0F 4FE4A 4ZTJA 1XZPA 2EIMC 3DKWA 4P9TA 4RGXA 1VFCA 1Z3XA 1YJWI 1Q0FA 1SVLA 3U5SA 4O6YA 5K7FA 2H94A 4CCMA 1FP1D 1YLFA 2HYGD 5FKLA 1Y1WJ 1NH3A 3NMJA 3CC7I 2RQQA 5LBQA 2X0CA 1R9TJ 2CFXA 2PBEA 2HU9A 3S27A 2X1EA 3PO3J 2L7KA 4P1WA 1LFUP 5H6RA 4P5OA 3SFZA 1FYLA 1K05A 5D6FA 4HF1A 1PD1A 4MTOA 2L9SA 1TBXA 1HQCA 2ZMEB 5D6EA 3CO6C 1FFHA 5E18F 4IZZA 2HJMA 4JRZA 4U0VA 5IY5H 5LEKA 1AHDP 2Y3BA 4RAYA 1OCOH 1GUUA 3DPTA 3HTKC 2COBA 1OYYA 3BZ6A 4HNUA 1MNEA 3O55A 1KNYA 1ZG5A 3JAMZ 4ZDOA 3WTSC 3ZQFA 4U88A 1MBHA 2GLOA 5ILUA 1NFNA 1RIOH 5HS7A 3TD7A 1IW7F 2VJ5A 2R7DA 1LFPA 4BJTA 3TEDA 3HUGB 2D1HA 4M3EA 1DP3A 4E7HA 2CV2A 3DPLC 5EGOB 3WTWC 5ICFA 2YVKA 4YELA 3UMHA 5BNGA 3M8JA 2PLYA 2KT0A 1U6HA 1WRJA 3CJTB 4IF4A 2WV1A 2RKHA 4BHCA 2F2EA 3CMAI 1LE8A 2HXIA 5CQEA 4O5VA 2NNNA 2IEKA 3IH3A 4YG2F 2XROA 1PUEE 3H0GJ 4BQOA 1I3AA 3O6BB 1H88C 1LS4A 2HDDA 2XM0A 1WJAA 4AIDA 3L00A 3RKXA 2EJRA 2JA6J 5F5HA 1M2VB 4KYWA 2BOLA 2M4GA 2V1DA 1JGSA 4I09A 1HF0A 4NY3A 5JHUA 3OEOA 4CIPA 2QWWA 5KCMA 3FAPB 4DRJB 4ZYEA 3UMKA 1U0JA 2VBWA 4IGGA 3IKTA 3ZQLA 4RGRA 1Y6DA 1I39A 2B0JA 4AU7A 2BC5A 3VEPA 2GA1A 3OYMA 2MWQA 2YHSA 4M73A 3ZTZA 2L7FP 1H6GA 5B3IA 1N78A 3CAXA 3F6OA 1VLTA 1GV5A 2X9DA 1VI0A 3HDDA 4PJNA 2XRLA 1FIPA 4BEHB 1R5ID 1ZHXA 5BQGA 1IG7A 2FXAA 5FZTA 5EZHA 1U9OA 1XSVA 1MKMA 3AJMA 2XC7A 2LC2A 2IS4A 3V5ZA 4Y7NJ 2K9SA 3U1DA 5IOZA 3GEHA 3A0HC 3JRBA 3S2DJ 1GQAA 3KE2A 2G3VA 3LS0A 3UMIA 4G6TB 2IT0A 1KYWA 3CCSI 2OTLI 1T6IA 4LLNA 3ABKC 2GWWA 2CFOA 3IAM2 1MGTA 1JTYA 4MFDA 1X4PA 5IYBJ 3U0CA 3VYSB 1QZXA 1T39A 3MCZA 3Q9VA 5JSLA 2R5YB 1WQ2A 1EV7A 1FOXA 4EIYA 1ZRCA 2R92J 4GXOA 3EH2A 4G6DA 3GFJA 2WV0A 4OWRB 5DQTA 2M8GX 5LGNA 2GDCA 2M87A 5ERIA 2KDZA 3BRJA 2IVMA 2V9KA 1R23A 3TOAA 4A6DA 2HQNA 4D0PA 2AU5A 2R7VA 3CJQB 5CVVA 1QSPA 5KAFC 5J8CA 4JW1A 4BHBA 2EFQA 5LFAA 1Q0GA 2WY7Q 4L5IA 1O4XA 1O3QA 4DBRA 4HV5A 4KIBA 1XPXA 1JXSA 1ZLJA 3WE3A 1Y8RB 3L34A 1UJ8A 1G3TA 1HE9A 1YQAA 3ZIBA 5CYVA 1DDNA 1WPKA 1FY7A 2PNOA 3B6AA 3I59A 2LR8A 1W2WA 1JR8A 3LOCA 4JE9A 2TCTA 2K9LA 1SAXA 2W25A 3EPZA 1B72A 1YI2I 3G4XA 4WCGA 2ZB9A 1OMIA 4JQFA 3LAPA 4UUSA 1Z67A 4M6VA 4HEA2 1SVOA 5DD4A 4MTFA 3VSKA 1ZR2A 4J01A 4YT5A 3OSGA 2FOWA 1T8IA 3WGHA 1HDPA 1FNNA 2E1OA 2JUGA 1B6AA 2ZXHA 1HKTA 3KYIA 1V54H 4E6KG 1ZGWA 3HM5A 1JT0A 1R00A 2VQLA 3P7NA 4M9SA 2KZGA 4O3MA 2ZNYA 4CCNA 4A93J 2D45A 4N6HA 2P5LC 5KYYA 1Z0XA 3TKYA 4CCKA 4OMYA 2RSEB 1TQGA 1VQ5I 3RYLA 3L2RA 1AKHB 2ME6A 4LB5A 3G1OA 2O8KA 4IOAF 4RA2A 2Q00A 4EGYA 5IT3A 5FD6A 4A3BJ 4RM2A 1KZHA 2Y3HA 4DNCA 5FKNA 1ETWA 5LGUA 3DBHB 2ETSA 3LA7A 3ZTMA 2E60A 1ETOA 4EM0B 3G1MA 4CH7A 4WWCA 1NLXA 1HSTA 3DQVC 4C3JJ 1ORSC 4CS8C 5H6QA 4JTAB 1UG2A 3G4ZA 3PM1A
chains in the Genus database with same CATH topology
3S3OA 1M2OA 1HA8A 1VZ0A 3ZVRA 5T3TA 2V7FA 4BL0B 3PUBA 4ZYAA 3UGOA 4PSXA 1WFXA 5FRNA 1WJBA 4XMYA 2R7RA 3K4KA 1SMYF 3LAYA 3K4JA 2CDQA 2LYCA 3S32A 4AYBA 2UWMA 3VWBA 2PX0A 5F5FA 3UR3C 5HNHA 3DTEA 2KL4A 3K4LA 2J0XA 2M4EA 3C2HA 2EINC 3K10A 4J00A 4G7OF 1MMGA 1QHGA 1M2VA 2VB6A 3A4CA 3F47A 2X85A 3NRHA 1Z7LA 1QU3A 1Z23A 3HXLA 4ZTFA 4D9JA 2YEVA 3GODA 3V42A 3QYBA 2A6HF 2W4BA 3Q7GA 4O6NA 4I44A 4F4BA 4N06A 4J32B 1DQUA 4RM3A 3ASNC 1S7ZA 4KC9A 4BE1A 4NNJA 1RJ9B 3PFYA 4BE2A 2ZXIA 3WODF 2W9YA 3OL4A 3K6GA 3CMMA 4B44A 2FUG2 2VL8A 4NQWB 4Q7CA 4CS7A 2W7NA 2VLAA 5LD2C 3B9QA 3G2BA 4BEHA 1NU9C 4G7HF 2J9VA 4PJMA 3HL2A 4YJWA 4I3MA 2NOJB 3W2WA 4BJ5A 2XF6A 5DS4A 2X51A 3T4RA 1X1AA 3EGXB 4LERA 3AQBA 2G3KA 5KYUB 4C7OB 4XLAA 4HPQA 3S8PA 3H65A 1MNDA 2R7UA 1OCCC 3N24A 3PHF2 4LITA 2AQEA 3VDXA 3LFUA 3NKEA 2NUTB 2WBMA 3ZR8X 3EUHC 2A6EF 2W4MA 3MLGA 4JCHA 3DD7A 4XKCA 2KPMA 2A68F 5TGTA 3LSMA 3LSIA 5KNLA 2XXAB 3FBNB 1FTSA 4N4OB 3CSKA 1UELB 2WZGA 2WAFA 2R7TA 2LY2A 3JRTA 3SEQA 4K7BA 5IY5C 1ZHWA 2BW3B 2V1NA 2HV6A 1OCOC 5FRMA 4QI2A 3AG1C 3O39A 2CW7A 2R7WA 2Y0SA 4HSTA 3S3MA 4DBQA 4CCLA 3DJNB 1D1AA 2LOOA 3LSGA 3OYNA 5KYXB 3ZG1A 5DS5A 2Z16A 3ABMC 4KISA 3K4NA 4CS9A 4QPOA 2H7VC 2A6TA 2HNHA 4JOMA 4II2A 3OMYA 3NYJA 5HNFA 3ZSUA 4XKVA 4CA0A 1T95A 3A1YA 3KYLA 3EH1A 2M7BA 1LVKA 2WB1A 3CP2A 4XORA 3RTRA 4BQQA 1P9QC 2IXNA 4JURI 1YX5A 3B0UX 5DS6A 3K4MA 2H7BA 1MMNA 2EIKC 4OINF 4HG2A 3ZCOA 3DKYA 2OV7A 3I9V2 2WVQA 3H9GA 3DMDA 1FFTC 3NG1A 2QKMB 1TZLA 2LG4A 2DYRC 2R4GA 4RLFA 3OR1C 5KHDA 3EG9A 4XN0A 3RH3A 4OAYA 2FFHA 4RDAA 2GOXB 1TT0A 2AQFA 2CNWD 4BS9A 1PD0A 4G0HA 1IRXA 1BR4A 3FKJA 4NC8A 3LL7A 4PJLA 2VKHA 5T1DB 2DOAA 1KU2A 3OWTA 1V55C 2HV7A 4PJJA 2CV0A 1UAAA 2W1OA 2BE5F 4XNFA 3GANA 1LKXA 3AKZA 3EGDA 2ZXPA 4XLCA 4BACA 4BE0A 2PP4A 4NUBA 4WJ0A 2M3AA 2XF7A 1D0XA 2K5CA 4R79A 4U5GA 2X6WA 3D5SC 2IYLD 4IWBA 4F3QA 2KQRA 1S9HA 4XONA 1V5EA 3W3CA 1ZYRF 2H7OA 3AG2C 3DZAA 4JVSA 2VASA 1GLNA 2WY8Q 5DQZA 3QYEA 1WJ5A 2HDWA 1JPJA 1PJRA 1QHHD 4FASD 1SF8A 2F5VA 2IXMA 3ASOC 3W2VA 4YRVA 4RD9A 3OYEA 3OY9A 1Z5ZA 4CIHA 5E3CA 3TBIA 3ONQA 4C2UA 2LBFA 2J9UA 4CS8A 1W36D 2WA0A 2VIXA 3HPHA 2PMZA 3HKZA 4NC7A 1ZELA 3HG9A 5HLTA 2Q1ZB 3K70C 2CNWA 4RMNA 2Y69C 2IXPA 3K66A 3EUAA 3LNRA 2QTVA 2VJJA 1UG0A 2VQHA 1OCRC 3EJNA 4J30B 2I8DA 2K9MA 3DU5A 3H9QA 5FROA 3BG7A 4XM3A 2M0MA 2JA2A 2Z1DA 2PX3A 3S29A 3RIPA 3QODA 2L9NA 3VYWA 3I4UA 2IXOA 2V6EA 2DGJA 3N2ZB 3K1HA 1J8MF 3Q7LA 2DXIA 2E1MB 2J7PD 4E4HA 2J0WA 1FMVA 3K4CA 3MMYB 3LLIA 2E5NA 3TMOA 4DGWB 4JZAA 4U5CE 5D92A 3SEOA 2WAQA 3OIPA 4XLPF 3NKDA 3HLZA 3HC7A 2X6XA 3ZRGA 1O87A 3E0JB 3SYNA 4CSAC 1SFKA 4XR6A 2L5QA 2MD0A 3LMMA 3L2VA 3K33A 2LH9A 5FCLA 2O5RA 1D1BA 2YZSA 5HSWA 3UMHA 3A2KA 5HOOA 2DJIA 2J9WA 2ZXOA 3NWTA 3DJUB 3QOEA 3U21A 1YX3A 2CV1A 2D5RB 1Z6AA 2JD3A 2KGOA 4O7GA 2EIJC 3PNVA 3OYJA 3SYTA 2J7PA 1RJ9A 3E9VA 3RKOF 2JSPA 3LLKA 4KJZA 3FAJA 4XLHA 2OUMA 4U5FE 4KT6A 4DIQA 1PCXA 4CUGA 2WL8A 5EGYA 3I5PA 2Z15A 3POVA 3OYDA 3MX3A 2R7OA 2L2OA 1K6YA 3SP1A 1LS1A 1ZHZA 3K6BA 1BR1A 3PNYA 3S93A 4MQ9F 2KHMA 1QLEC 5DVWA 2ZPAA 2KDOA 4HSRA 4BDYA 1Z3IX 2Q2EB 3DM9B 3EHNA 3JYHA 4F52A 3VSLA 3RFYA 3OL3A 2C03A 2KJGA 2CUJA 2NUPB 4EATA 3EGXA 3DTKA 2WAEA 4OIRF 5KYUA 3JSZA 3OYLA 1LDKB 3EFOB 2PJRB 2CMPA 3UNGC 1TR2A 4BJ1A 2WADA 1JI8A 3OS0A 2O9XA 3HOSA 2NUTA 2WB7A 4DJAA 4GEHA 2ZSHB 3SDBA 3DAFA 4AK9A 2JVGA 5HVQC 5CI9A 3BG6A 1EA3A 3ZQQA 2DYSC 2IS6A 2XXAA 2LRDA 3MD2A 3OYAA 3S28A 4IQJA 3H9JA 4EWCA 3OYCA 3VYTB 4U87A 3GBGA 1VOMA 2BW3A 2KRHA 4XQFA 1SAUA 3LS1A 2OG2A 1D0YA 3E70C 3FHNA 3MKWB 5KYXA 3DWLE 3SEZA 3EZHA 4CBEA 4QPQA 4N4NB 3NYMA 3FHDA 3X1OA 2MABA 2E87A 2HVQA 2MYSA 4BDZA 4IX7A 4XKBA 2VXDA 4OAZA 1OLTA 2X6YA 2P0WA 4I1MA 3OS1A 3OYKA 4FWVA 4E7JA 3OA1A 1OR7C 3C2GA 1WJDA 4ITVA 4Y33A 3VYRB 2IOQA 2GOMA 2KQ9A 3K70D 2R7QA 2CGEA 2Z2SB 1R6RA 4BG0A 4F55A 4OD5A 3KEYA 5T3WA 5KYNA 4Q5SF 1BR2A 4QDLA 4MNDA 2V3CC 4HFKB 2L9JA 1WJFA 2J46A 1DGWY 2MC4A 3IUOA 4KBLA 3I5QA 5D91A 2W82A 2FGYA 2XL4A 3IAS2 1N77A 2LREA 1D0ZA 2DT7B 2JVHA 2VXZA 3N05A 2HVRA 1N1CA 4BJ6C 2P6VA 3DM5A 5CKTA 4ZC3A 2HVSA 3JT1A 4XN3A 2OC6A 2Q3TA 1NG1A 1VMAA 4ZTJA 2CW0F 2EIMC 2I8BA 4F91B 1M57C 2LSEA 4QI0A 1Z3XA 3D5LA 4E7ZA 2XRHA 2A5WA 3IEEA 3H5NA 4O6YA 4O79A 3CZ6A 4CCMA 4DVYP 2NG1A 1TWAA 2XF5A 2F6CA 2XAUA 4E7KA 3EZIA 2RQQA 2X1CA 3BC8A 4AX2A 3M1CB 2HPIA 4C30A 3FVYA 2KW3C 3KL4A 4Q4ZF 2W45A 4YWQA 2HU9A 2QKLB 2XDVA 3OYFA 3DEEA 3S27A 2X1EA 2RNGA 2L7KA 4P1WA 4AE4B 4XKWA 2IGKA 4KITB 1V5GA 2VQGA 4P5OA 5KYYB 1Z3YA 3OYBA 1PD1A 2L9SA 3OS2A 1KONA 4XOTA 2VQCA 1FFHA 4XLEA 2XSEA 1VK5A 3PSIA 3OR2C 4IZZA 4W8KA 4YT4A 3L0IA 3H0DA 1N75A 2Y3BA 3PMRA 2E5ZA 1ZU5A 4D1QA 4HEAJ 5KYWB 3DPTA 3HTKC 1G8XA 4HNUA 1NU7D 5L3VA 3W8IA 1MNEA 4XWJA 3AFHA 3DTIA 3NWSA 4ZDOA 4B6IA 1ERDA 4DVZA 2ZXWC 1DGRM 4B3XA 3TD7A 1IW7F 2HZDA 2VJ5A 3FDYA 4BJTA 1LFPA 3L2WA 2VKDA 3Q6MA 3L2QA 3HOTA 3HUGB 4X0GA 4BU2A 2ELJA 4CSAA 3F46A 1OKKD 1DP3A 2LY1A 4E7HA 2CV2A 4HFFB 3DPLC 2F4IA 2M4KA 2E1MC 4PFPA 4YELA 4ZDPA 3L2UA 3M8JA 1TKNA 1WJCA 3KH2A 4RBNA 3DLAA 3DPUA 3T6JA 3D5RC 3ITFA 3AL0B 2KZVA 4XOPA 3LJBA 1ZHYA 4KI2A 4XTKA 5CQEA 1FMWA 3EPVA 2CUZA 2ZXRA 4LLCA 4DOZA 4BQOA 1VYIA 4ZLCA 4ULWA 4Y4RA 4IJJA 5L3QA 1MMDA 1WJAA 3I3LA 3ABLC 5E3AA 3AL0C 2A1DD 2Q9BA 5EHHA 3K7DA 5F5HA 2IGOA 1M2VB 4FESA 2BOLA 4LIUA 2M4GA 2RREA 1VYKA 4NY3A 2ZFUA 3OEOA 3HJCA 3OIQA 5KCMA 2KRCA 3RQ4A 5CQGA 4CZCA 3WG7C 3UMKA 1TWHA 3FDQA 1U0JA 1O5HA 4ZDLA 2V26A 3CF2A 1OKKA 2Y39A 2B0JA 3MKYB 4AU7A 3K1IC 3VYUB 3OYMA 2YHSA 2MWQA 2Q9CA 3DAGA 1W36C 2C04A 4C3DA 4ZJZA 1PYVA 1JPNA 2PFDA 3LEVA 1N78A 2IS2A 2CW8A 3OYGA 1TWGA 1NZEA 4U5EE 2V4JC 1X1CA 3RSNA 1ZHTA 4LLEA 4PJNA 2W00A 3S3NA 3X2QC 4BEHB 4U5DE 4B47A 5E2QA 1ZHXA 4LG3A 3BCBA 2WZLA 1V54C 3PNTA 4ANJA 3QZCA 4C7OA 4FETA 4ZLDA 4XL9A 3LSKA 5B1BC 1J8YF 4C3BA 2XC7A 2LC2A 2IGNA 2IS4A 3BCAA 2QY9A 2VH3A 4LACB 2Y3DA 2NUPA 2G3VA 3LS0A 1SZIA 4IKFA 3T6BA 3UMIA 3S0XA 4G6TB 1X4OA 1TWCA 4OD4A 4Y3OA 3EQLF 3CJRB 4G7ZF 3EFOA 2PJRA 3ABKC 2CFOA 3IAM2 4U7BA 4HE8D 3NDBB 2W4SA 4E7LA 2OCCC 2PF4E 1X4PA 2A69F 3VYSB 4BJ5C 1QZXA 4YT8A 3OYIA 3FBIB 4GRIA 4CCJA 2K3PA 1Y56A 3BLYA 3TL4X 3OYHA 2J45A 3VAYA 1X1DA 4F92B 3PSFA 4OIPF 2M7AA 3EH2A 4OWRB 2HPMA 5DQTA 1G59A 4CCOA 1ST6A 5E33A 2Y3GA 2HQAA 4XLNF 4PK4A 3SZRA 4OIOF 1MW7A 4MLOA 4YT2A 2V9KA 4A2NB 1BOBA 2KMUA 3PL8A 2IGMA 5JHFA 2ZSIB 2R7VA 3CJQB 2G62A 3J7AY 2BVLA 3DXJF 4JW1A 4K0DA 5BUOA 4B48A 3H5AA 2EILC 5LFAA 1M56C 2DCEA 4RLQA 3H35A 4II3A 1J09A 3V7OA 1WJEA 2WY7Q 2VJIA 4PSWA 4AE4A 4BXFA 3K4BA 4DBRA 1Y6IA 3ZC4A 4E7SA 1V5FA 3ZXSA 1Z63A 4CS9C 1Z21A 3L34A 4C3EA 4BJ6A 3OOUA 4M63A 2DT6A 4H4KC 3N0TA 3CP8A 3ZIBA 3NYLA 1NG7A 2KLOA 3CESA 3F9KA 4BUPA 4BEJA 3EG9B 2VPLA 1W2WA 4U5BE 3LESA 4P6IC 2CH0A 5CPRB 2BVMA 2K9LA 2IXSA 3KMIA 4IRUA 3EPZA 3LSHA 4PFOA 1WGWA 3QYFA 1ZU4A 3CQZA 4JQFA 3MKZA 4FX5A 4YEJA 3UGPA 4HEA2 1X1BA 2KP6A 3EHMA 3VSKA 2UV1A 4J01A 4YT5A 4B43A 3AG4C 4YN0B 2WVNA 3EGDB 4EBBA 2UUZA 2JUGA 2X1DA 2ZXHA 3IP4B 3W2AA 1E0EA 3AG3C 4JJGA 4OIQF 4E6KG 1OCZC 3W8HA 4AVZA 4BGDA 3M1CA 2KNHA 2VJ4A 3H5RA 4IAOA 3DU6A 2WZFA 3PJRA 2VQLA 3ZGKA 2R7XA 4XLFA 3JCUQ 1YE9A 4C2TA 1X19A 4U5HA 3HPGA 5B1AC 4E7IA 1NG6A 4CCNA 4O6MA 1D1CA 3QMKA 4GYTA 1AA7A 4BQNA 4KNVA 5KYYA 4PUSA 4C9YA 4CCKA 3B0PA 4JJFA 3B0VC 3EUKL 2L81A 3RYLA 3L2RA 5DLJA 2LBFB 2R7SA 4HRIA 4X0RA 4LIVA 3SZGA 3KKBA 4F93B 3Q6NA 2P7VA 3SNHA 3DKXA 5KYWA 4IQ4A 3RCOA 5B3SC 4RM2A 2IS1A 4HNTA 3KX2A 2Y3HA 2MFZA 4CSWA 2Q9AA 3O6XA 1T0FC 4KNWA 5CI8A 2E60A 3AQCA 3E1SA 4CH7A 3RPUD 2GFHA 3DQVC 1IZMA 1MMAA 4I1OB 4CS8C 2CS3A 2WVOA 3ECSA 2XSJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6G A;  4BJT A;  4BJ5 C;  3OWT A;  4BJ6 C;  3CZ6 A; 
#chains in the Genus database with same CATH topology
 1BIA A;  2Y48 A;  1M2O A;  1VZ0 A;  2F22 A;  2LLK A;  4ZYA A;  2FOK A;  4PSX A;  4HDV A;  1AEP A;  4HW0 A;  3GFI A;  1ZKG A;  1RNL A;  2CG4 A;  1D8K A;  3LAY A;  4AIK A;  2LYC A;  3S32 A;  4AYB A;  3JCU C;  3UR3 C;  1ZTR A;  5EF6 A;  3BTJ A;  1RC9 A;  3T9O A;  5HNH A;  5B66 C;  1T6Q A;  1XD7 A;  4CZZ A;  1LI7 A;  5FO5 A;  1FPQ A;  2CUE A;  3K10 A;  2EPF A;  1C17 M;  4G7O F;  2RVC A;  1YYJ A;  4FE7 A;  2YPR A;  4A0Z A;  2VB6 A;  2M30 A;  3A4C A;  4MHG A;  1FC3 A;  1O3T A;  4H54 A;  2X85 A;  3NRH A;  2M2E A;  1IJW C;  4MVZ A;  2CJJ A;  3I64 A;  2EZI A;  2A6H F;  2M1B A;  5K7H A;  2AVK A;  2W4B A;  3Q7G A;  4N06 A;  2HUJ A;  4J32 B;  3JTL O;  2X6O A;  1WH5 A;  3T1B A;  1ZRD A;  4KC9 A;  4BE1 A;  1RJ9 B;  2ZXI A;  4S04 A;  3K6G A;  4LD5 A;  4MVS A;  1TW2 A;  4NQW B;  4Y52 J;  3AG3 H;  2W7N A;  3PFI A;  5LD2 C;  3BJA A;  3R4K A;  3B9Q A;  3ZMZ A;  3GX4 X;  3G73 A;  2O9L A;  4YJW A;  5E1Z B;  2HEO A;  1LE4 A;  2CSO A;  2L01 A;  4I3M A;  3I58 A;  2NOJ B;  3W2W A;  2STW A;  1TQP A;  1MQV A;  1U0B B;  2CGP A;  3RI4 A;  1CF7 B;  5BQT A;  1VQL I;  3CCQ I;  4Z9J A;  2XS1 A;  2YL0 A;  2KRF A;  3H65 A;  1OCC C;  1SFX A;  2R7U A;  1IRZ A;  2AQE A;  5K0I A;  1FP2 A;  3LWF A;  3EUH C;  2W4M A;  2EK5 A;  1NHA A;  2H8W A;  3KLO A;  3JRH A;  4HDU A;  1IXS B;  2Y0M A;  5TGT A;  1T01 A;  2XLV A;  1IN4 A;  3HHH A;  3LSI A;  4MO7 A;  2XXA B;  3U2R A;  1ZHW A;  2M8E A;  2Z3Y A;  2V1N A;  3QU3 A;  1X2M A;  2ASR A;  2H27 A;  1VTN C;  4ZZD A;  5ICC A;  3AG1 C;  5F1R A;  4LK1 F;  4CCL A;  4A3L J;  1D1A A;  4IB4 A;  5KYX B;  3SDG A;  3ZG1 A;  1ENH A;  5DS5 A;  2Z16 A;  1DOV A;  3ABM C;  1LE2 A;  1ORY A;  2H7V C;  2HNH A;  4AYB N;  3L8I A;  5HNF A;  1FR0 A;  1RKE A;  1HDD C;  3A1Y A;  1SFO J;  2ESN A;  3RTR A;  2WB1 A;  3CP2 A;  3KP4 A;  4UV8 A;  2J5O A;  2IXN A;  3OOP A;  4JUR I;  2P6T A;  1MMN A;  1QVX A;  4OIN F;  4XID A;  4FHT A;  2NSF A;  3DKY A;  2FF4 A;  3I9V 2;  3V4G A;  3NG1 A;  1O3U A;  5GAD J;  1BL0 A;  4PZJ A;  2CCY A;  2LFD A;  4XEV A;  3ZMU A;  2E36 A;  4RLF A;  4JTC B;  1EH8 A;  2UUI A;  2OKU A;  2FSW A;  2PJP A;  2FFH A;  2GOX B;  1TT0 A;  1FJL A;  3DWW A;  4I99 C;  4BS9 A;  3C8Z A;  1BR4 A;  3CDI A;  1QPI A;  3BQY A;  1S8N A;  4NC8 A;  3DFG A;  1EKE A;  4ABZ A;  1Q0D A;  1P4X A;  5T1D B;  1XSX A;  2ZNZ A;  4KN4 X;  3OWT A;  1V55 C;  5ED4 A;  5B1B H;  2RN7 A;  1SFU A;  4L5E A;  4KMF A;  1LKX A;  5GP9 A;  2ZXP A;  3P9K A;  5E3M A;  2XF7 A;  2K5C A;  4U5G A;  4CO8 A;  2IYL D;  4F3Q A;  3JRE A;  1ZYR F;  2KQR A;  2OF7 A;  3W3C A;  2H7O A;  3DZA A;  2DT5 A;  2VAS A;  3IWZ A;  1Y8Q B;  5DQZ A;  3K9T A;  2L3D A;  3QYE A;  1WJ5 A;  4ENK A;  1JPJ A;  1QHH D;  1SF8 A;  2IXM A;  2QBY B;  3ASO C;  1G3S A;  3W2V A;  1FYK A;  3OY9 A;  4BBR J;  2ZD9 A;  2M64 A;  3ZOB A;  5E3C A;  3TBI A;  3R0A A;  2EFW A;  4CS8 A;  3QPL A;  1ZVZ A;  5EG0 B;  2KJB A;  3HKZ A;  2AWY A;  4NC7 A;  3K70 C;  3HG9 A;  3TJ5 A;  2Q1Z B;  4BEM J;  3HSF A;  4RMN A;  4I76 A;  2IXP A;  2FD5 A;  4M74 A;  1F43 A;  4I98 B;  3PIP F;  4A3I J;  2E2J J;  3JZ0 A;  3P9C A;  2HFI A;  5FRO A;  3FMQ A;  5J4Y A;  4Y15 A;  5D4S A;  3SXK A;  3RIP A;  1POG A;  3VYW A;  2A07 F;  2EIL H;  1J8M F;  3IQC A;  1O3S A;  3HOZ J;  4E4H A;  1D5Y A;  1I5Z A;  3K4C A;  4EEF G;  3I0T A;  2E5N A;  1KQ8 A;  5KK1 A;  3TMO A;  5GAE J;  4JZA A;  2JA5 J;  2WB1 N;  4IXA A;  5DEQ A;  4JEB A;  3MZ8 A;  4XLP F;  2XL6 A;  3NKD A;  2EV6 A;  3HBL A;  3SYN A;  2NXN B;  5L3B A;  2EIK H;  1IGN A;  4CHU A;  3WU0 A;  4JYK A;  1ODD A;  4OOI A;  3RYP A;  1I27 A;  4TV7 A;  3C3W A;  2DYR H;  3V5X A;  5IOY A;  1YZC A;  3HOV J;  1GS9 A;  3E6C C;  2ZXO A;  3NWT A;  4E70 A;  3M4O J;  1KQ0 A;  2BXY A;  3DCF A;  1CPQ A;  3BTI A;  5ILV A;  3GYH X;  1GT0 C;  2EFP A;  2EIJ C;  3RKO F;  3V8L A;  2FBH A;  3HOU J;  1W5S A;  2EZK A;  2JUC A;  3FAJ A;  2TMV P;  2XS8 A;  3IHU A;  4R32 A;  5EGY A;  2V1U A;  4R8H A;  3I5P A;  1Q0M A;  1BI2 A;  2QSF X;  5HLI A;  4BY7 J;  2JPC A;  1LS1 A;  3K6B A;  3BR2 A;  5L0J A;  5DCM B;  2O7O A;  1QLE C;  3RIR A;  5DVW A;  1TL8 A;  3VOD A;  4BDY A;  1VQ4 I;  3F6V A;  3EUH A;  1YRN B;  3VSL A;  2DDB A;  1QZE A;  2C03 A;  3M79 A;  2CUJ A;  2P5K A;  3EGX A;  5B3S H;  1U3E M;  1ZRF A;  5KYU A;  5COM A;  3HKZ N;  2CMP A;  2HQR A;  3RKY A;  5IYD J;  3C2B A;  3HNJ A;  4HZF A;  2WB7 A;  1WWP A;  3RKQ A;  2ZSH B;  4EM2 A;  1ZG1 A;  2JVG A;  4FAP B;  3D1N I;  2GZW A;  3J80 K;  2LRD A;  3MD2 A;  4YIR X;  2P61 A;  3DKA A;  4EWC A;  4QSH A;  3N4M A;  3VYT B;  2FX0 A;  4ENN A;  1YJ9 I;  4XBF A;  4XQF A;  3LS1 A;  1ORK A;  1FLI A;  4G9Y A;  3FHN A;  3WTZ A;  3GFL A;  3SEZ A;  3EZH A;  4U0W A;  2ZJR F;  1K79 A;  2HSB A;  3X1O A;  2MAB A;  1QKR A;  1LIH A;  2QQ9 A;  4BHP A;  2JJ7 A;  1YA9 A;  1B9N A;  3GOR A;  2PEX A;  4OAZ A;  2ZJP F;  3EDP A;  1BA5 A;  3OS1 A;  4FWV A;  4E7J A;  1OR7 C;  1WCM J;  2EA2 A;  1MSF C;  3FXU A;  1S5L C;  2PN6 A;  4GYI A;  2KQ9 A;  3K70 D;  2R7Q A;  2FBI A;  2Z2S B;  2QEX I;  2IA1 A;  1NBB A;  1RKE B;  4BG0 A;  1WGX A;  5LHI A;  3KEY A;  3R2P A;  3C1D A;  2DQR A;  3NAU A;  3ULQ B;  3U9G A;  1DGW Y;  2MC4 A;  4B3A A;  1JRA A;  3ZQY A;  3HOW J;  3ESW B;  2ECB A;  2LRE A;  4HLY A;  4MEX F;  2NYX A;  2JVH A;  3N05 A;  1N1C A;  3TOL A;  1UZC A;  2P6V A;  5CKT A;  2Q3T A;  4O6M A;  4DYQ A;  4F91 B;  1ON1 A;  2XAF A;  2LSE A;  3RVZ A;  1MJ9 A;  3D5L A;  5C44 J;  4HOB A;  2NG1 A;  1I3Q J;  3IC7 A;  4GO1 A;  3EZI A;  3U1K A;  1TC3 C;  1L0O C;  3NEU A;  2X1C A;  3BC8 A;  5EEG A;  4DYR A;  4CYC B;  3GTQ J;  2R05 A;  1X3U A;  4C30 A;  2R5Z B;  3MYF A;  3KL4 A;  3KZY A;  2DLL A;  1TQI A;  2ADU A;  4RAZ A;  3ZQH A;  4A3K J;  4DZP A;  4IHV A;  2XDV A;  2JA7 J;  3DEE A;  4BPM A;  4PR9 A;  4YWQ A;  4BAY A;  2RNG A;  4XKW A;  1TQM A;  2L7M P;  1KYZ A;  3CLQ A;  3SZP A;  5DDG A;  3DE8 A;  3FOP A;  1VQ7 I;  3BG5 A;  4XLE A;  2J5P A;  4L9T A;  3AGU A;  1U5T B;  3H0D A;  2E5Z A;  1ZU5 A;  1Y39 A;  5KAI C;  2LP0 A;  4D5F A;  4HEA J;  5A6A A;  5FD5 A;  5KYW B;  1NU7 D;  1E83 A;  4YFN F;  3IWF A;  3TW7 A;  1YLM A;  3QW1 A;  1P4W A;  3AFH A;  3DTI A;  1MH3 A;  2HYJ A;  3U9J A;  4DVZ A;  2LK2 A;  4BBS J;  1RR7 A;  3TJ6 A;  2VCB A;  1JHF A;  3L2W A;  3E3V A;  4Y13 A;  2UXX A;  5J1Y A;  1E17 A;  2DTR A;  3JRD A;  4LLC A;  1RCP A;  2NVU B;  3MFN A;  5A6J A;  1E3O C;  5J1U A;  2AS5 F;  3KYD B;  1OXB A;  2QYO A;  2F4I A;  2M4K A;  2E1M C;  1ZHF A;  2TDX A;  1L7C A;  1I50 J;  3KH2 A;  4J7Y A;  1WJC A;  3BY6 A;  3DPU A;  3E5Q A;  1H8A C;  2TRT A;  2XLD A;  1OW8 A;  2KZV A;  3DEU A;  4V2F A;  4A6E A;  3CO7 C;  2FNA A;  3FX3 A;  1F5T A;  1ZHY A;  4XTK A;  4MIM A;  5DCF A;  4FCY A;  4AM3 A;  4HX4 A;  3QQA A;  2LTP A;  3EPV A;  5F28 E;  4G94 A;  1J59 A;  1LDD A;  3GLX A;  2NUT B;  4ZLC A;  2XGC A;  5FJ8 J;  3AL0 C;  4AUX A;  4KMU X;  4RB2 C;  2IGO A;  1O57 A;  1WN0 A;  1YG2 A;  3HJE A;  1VYK A;  2MG4 A;  1DP7 P;  1OCP A;  3BPV A;  3OIQ A;  1O7L A;  1K83 J;  2KRC A;  2AP3 A;  5CQG A;  4CZC A;  3WG7 C;  2LD6 A;  5FLX K;  3GEZ A;  4ZDL A;  3S2W A;  4HQE A;  1MDM A;  3CF2 A;  1HKS A;  1E3P A;  2QQA A;  3K1I C;  1SFE A;  3HRS A;  2EIM H;  2BZT A;  3BOQ A;  1ACI A;  3AG2 H;  1W36 C;  2C04 A;  3DAG A;  5EJC A;  1JPN A;  4UB8 C;  1BIB A;  2IS2 A;  2IRF G;  1TWG A;  3OYG A;  1NZE A;  4M9Z A;  3RSN A;  5E8I A;  4LLE A;  2W00 A;  4RGU A;  4U5D E;  1WAT A;  5E2Q A;  2L7Z A;  1RPW A;  2UUH A;  4ZLD A;  4C7O A;  4UDV A;  3LSK A;  2L7A A;  1KU7 A;  1WWX A;  3QWL A;  4S0H B;  1VQO I;  2JA8 J;  2NUP A;  2Y3D A;  1SZI A;  3S9O A;  2DFH A;  4IJA A;  4Y3O A;  3CJR B;  1W5T A;  4G7Z F;  4RB0 A;  2PJR A;  4WAB A;  5JI6 A;  2RC4 A;  3EYY A;  3J81 K;  4HE8 D;  1E84 A;  5TRD A;  4E7L A;  3A01 A;  4LG0 B;  3NDB B;  4MVR A;  2CQX A;  2Z5U A;  3IQ5 A;  5HOD A;  4GFB A;  2H6B A;  3FBI B;  4GRI A;  4KUM A;  4A3D J;  2K3P A;  4A5M A;  1Y56 A;  3BLY A;  5M3F J;  1DUX C;  5LRR A;  1JJ8 C;  2F4M B;  2HPM A;  1ZLK A;  4HV6 A;  2XB5 A;  1Z9C A;  4XLN F;  2CQ7 A;  4N4W A;  1YO5 C;  5J4V A;  3RDI A;  3SZR A;  3WTV C;  2FML A;  1RI7 A;  1OR7 A;  5D5W B;  5L0G A;  1FBS A;  2KMU A;  2O8X A;  2BGC A;  3MZY A;  5JHF A;  3GTP J;  2ID6 A;  1G3Y A;  3F8F A;  3DXJ F;  1K6O A;  4K0D A;  3GEI A;  4XPX A;  3H5A A;  2BBY A;  3U3B A;  1XX5 A;  1M56 C;  1R71 A;  3F3X A;  2DCE A;  2XV4 S;  3KP6 A;  2GXA A;  5F6F A;  4NTF A;  2QSH X;  2VJI A;  2LVS A;  4AE4 A;  1EF4 A;  1S7O A;  3HTU A;  1VQM I;  1OW7 A;  2XPV A;  2MLG A;  3ZXS A;  3BEH A;  3G1L A;  2JN6 A;  4P9U A;  2IBD A;  4H4K C;  2XVC A;  5DM6 F;  3E5U A;  3N0T A;  3HEF A;  2K02 A;  3MZH A;  3Q5F A;  1R49 A;  1UST A;  3NYL A;  1BI3 A;  1D8J A;  2JRT A;  4I2O A;  4BEJ A;  3EG9 B;  1SD4 A;  2QE9 A;  3JTG A;  2CH0 A;  3M8E A;  1JT6 A;  2BVM A;  2JWT A;  2MBF A;  2IXS A;  2WTE A;  5CPR B;  3KMI A;  4PFO A;  4IRU A;  1U78 A;  1ZU4 A;  2DDA A;  1W4M A;  2HOE A;  2QCO A;  5FKM A;  2HSQ A;  3KP5 A;  1WI9 A;  4YL1 A;  3AG4 C;  3BDD A;  2WVN A;  3EGD B;  2W57 A;  4EBB A;  3W2A A;  3IP4 B;  1E0E A;  4N9I A;  5A69 A;  3CUQ B;  4AVZ A;  4BGD A;  1YS7 A;  3M1C A;  4AIH A;  4IAO A;  1QA6 A;  4UVA A;  3PJR A;  3ZGK A;  1YE9 A;  4C2T A;  1X19 A;  3HPG A;  5B1A C;  3S90 A;  1J0R A;  4L6R A;  1FWZ A;  1D1C A;  1F1Z A;  4G6Q A;  1V4A A;  1AA7 A;  1MD0 A;  4C9Y A;  3K1N A;  1YIT I;  1Y4C A;  1WTY A;  2L81 A;  1FX7 A;  4HF0 A;  2R93 J;  2DOF A;  5HDN A;  4UXN A;  3TP0 A;  5M3M J;  1IN7 A;  2P7V A;  4HX8 A;  3TP3 A;  2R9R B;  1B1B A;  2MFZ A;  2ZBK A;  3SQN A;  1T0F C;  1IUF A;  3DEW A;  5B5E C;  4KNW A;  1T38 A;  1TWG J;  4NB5 A;  2HZT A;  3RPU D;  4X6A J;  2ZFW A;  2GFH A;  5COF A;  1IZM A;  2WVO A;  2EPN A;  3ECS A;  3WTT C;  4EGZ A;  2XSJ C;  4A2U A;  2MH2 A;  1CGO A;  3Q0V A;  5J47 A;  4BL0 B;  3KZI C;  2K40 A;  4HX7 A;  3TQN A;  1DOW A;  3UGO A;  2Y9Z A;  1H7I A;  4YII A;  1UMQ A;  2BY1 A;  1X58 A;  2MC3 A;  3K4J A;  1FEX A;  1H9T A;  1LUJ B;  2FU4 A;  5F5F A;  2PX0 A;  5AON A;  3FXO A;  4EBK A;  1XGS A;  3SFI A;  3FXL A;  3BG9 A;  2VCC A;  3C2H A;  2XAH A;  4WXH A;  3CCU I;  1PUF B;  1HY5 A;  3K1I A;  1QHG A;  5C3E J;  1Y0U A;  2M34 A;  4D7N A;  3CCL I;  2LIG A;  1IV8 A;  3M4B A;  2ID3 A;  4W1U A;  3RPU A;  1OYW A;  5EDN A;  3GOD A;  3V42 A;  1Z7Q c;  1SR2 A;  4EQQ A;  3LST A;  4RM3 A;  1A7D A;  4MVO A;  1S7Z A;  5JVE A;  3PFY A;  2FBK A;  4A0Y A;  3GO5 A;  1EH7 A;  2RNJ A;  4A69 C;  5TJJ A;  2Q2E A;  4BNC A;  1MDM B;  1REP C;  3G2B A;  1NU9 C;  4ER9 A;  4M6Y A;  4G7H F;  2FRH A;  2GXG A;  4I7H A;  4M3B A;  3AAF A;  4IHX A;  2RAE A;  2XF6 A;  4KIC A;  3RQF A;  3QP5 A;  1VND A;  3EYI A;  1V74 B;  5CVR A;  2BHY A;  2DA7 A;  3KP3 A;  4XLA A;  4C7O B;  4HPQ A;  1KQ9 A;  1OYI A;  4PCQ A;  2I10 A;  3VDX A;  4D4N A;  2DA1 A;  2O0Y A;  2WBM A;  2XKP A;  1M1E B;  2OAZ A;  4IL6 C;  2K9N A;  3ZR8 X;  4A12 A;  4IHS A;  3IH2 A;  2FNP A;  5BQI A;  4XKC A;  4NHJ A;  2KPM A;  1OXK A;  2FQ3 A;  1KU9 A;  3CMY A;  1AUE A;  4IHW A;  3ECO A;  3A01 B;  3FBN B;  2WZG A;  3JRT A;  5IY5 C;  2L6H A;  4JX6 A;  1OCO C;  4QI2 A;  1MMS A;  1GM5 A;  1KGS A;  2CW7 A;  2Z99 A;  4HST A;  2R7W A;  3LUT B;  1IUY A;  3O39 A;  3OYN A;  1Z05 A;  2ZXJ A;  4EM1 A;  2COM A;  3K4N A;  4KIS A;  4QPO A;  4WGZ A;  2YX4 A;  4H0E A;  2XIG A;  4JOM A;  4II2 A;  3JRC A;  4Z2Y A;  1T95 A;  3KET A;  3EH1 A;  3O8H A;  5FKO A;  2DMT A;  4BQQ A;  1P9Q C;  3GWN A;  3GWZ A;  3K4M A;  1A5J A;  1XMK A;  2H7B A;  3A0B C;  4HG2 A;  3ZCO A;  3F22 A;  3I4M J;  1GXQ A;  3V8J A;  1A41 A;  3VB2 A;  4D5C A;  2LG4 A;  5FB2 A;  5E1W A;  2G7H A;  5IP6 A;  2K86 A;  3WG9 A;  4QLC U;  2XGD A;  3RH3 A;  1WKM A;  4OAY A;  1XS9 A;  2PBI A;  2NOG A;  3DBL B;  1VQ6 I;  2CNW D;  4G0H A;  1IRX A;  3FKJ A;  4PJL A;  5FLV A;  2L6G A;  5JLX A;  3LSJ A;  4KFC A;  4PJJ A;  2CV0 A;  1U9N A;  3LA3 A;  5K5R A;  4WXD A;  4E17 A;  3RQE A;  3CLO A;  4BAC A;  1J2X A;  3E6B A;  4WJ0 A;  2M3A A;  3GTO J;  2X6W A;  3S2H J;  2LQG A;  3SXY A;  2DK8 A;  4CJG A;  1VQ8 I;  4O6J A;  4E0I A;  4JVS A;  1GLN A;  2WY8 Q;  3FK7 A;  3LQQ A;  2OCC H;  5HS8 A;  2HDW A;  3J7A O;  3GLL A;  4NTA A;  2W85 A;  1T0F A;  3F23 A;  1QZZ A;  1T08 B;  5CJ9 A;  4C2U A;  1NK2 P;  3Q0U A;  2LBF A;  1ETX A;  2QUP A;  3BR3 A;  2YL3 A;  2VIX A;  2MHR A;  5J8F A;  3HPH A;  2PMZ A;  3PO2 J;  4QIW N;  1ZEL A;  2CNW A;  2L4M A;  3M15 A;  2D4U A;  2VT3 A;  3K66 A;  4IAR A;  3QU6 A;  2VE9 A;  2VJJ A;  1UG0 A;  1I6X A;  4ZYD A;  1K4S A;  1HE1 A;  4D4X A;  3H9Q A;  3QPT A;  1Q1H A;  3BG7 A;  3L8J A;  3RW0 A;  2M0M A;  3AG1 H;  5K5O A;  3MBG A;  2L9N A;  3KYJ A;  5D5X B;  1FOW A;  2IXO A;  3K1H A;  3Q7L A;  2DXI A;  2E1M B;  2J7P D;  1UHW A;  3PCV A;  2KKO A;  1EI7 A;  4N9H A;  5M5Y J;  1IDY A;  3S16 J;  2N8G A;  2EA4 A;  3HRU A;  2J9B A;  4DGW B;  2I15 A;  1I6H J;  2X48 A;  1C02 A;  5E1X A;  4U5C E;  3SEO A;  3OIP A;  2NS7 A;  2QSG X;  3BRO A;  4AL1 A;  3HLZ A;  3M8F A;  2X6X A;  2MLK A;  1PVE A;  1BW6 A;  4NC6 A;  1LE8 B;  4P96 A;  1SFK A;  2L5Q A;  2XM4 A;  3LMM A;  2XKO A;  5ICE A;  2LH9 A;  4IPA A;  1YW9 A;  4AD9 A;  1GGQ A;  2O5R A;  1D1B A;  2AHQ A;  3JR9 A;  1OFC X;  2IJL A;  3WGI A;  3J80 Z;  2BYV E;  3R6S A;  3DJU B;  3QOE A;  3FK6 A;  4XSX F;  1YX3 A;  2YL7 A;  1G4D A;  3QW0 A;  3HOX J;  3D0S A;  1TLH B;  3SYT A;  1YTY A;  4M6X A;  3MVP A;  1TNT A;  1K4T A;  2B63 J;  2J7P A;  1OCZ H;  1XGM A;  2HKX A;  2AXL A;  4KJZ A;  2VC9 A;  2OUM A;  3B02 A;  3DV8 A;  4CDG A;  1HXD A;  4I6Z A;  1PCX A;  2A0U A;  2Z15 A;  1W7P D;  1IO2 A;  3MX3 A;  3L1M A;  3NMK A;  4PAC A;  1K6Y A;  5HDK A;  1BR1 A;  4BQA A;  3S93 A;  4MQ9 F;  4ZZL A;  2XLM A;  2EPL X;  3VOE A;  2ZPA A;  2KDO A;  1Z3I X;  2Q2E B;  3IL2 A;  4F52 A;  3KEO A;  2L02 A;  3T0Y A;  3RFY A;  2F4O B;  4IOC F;  1ZAR A;  2Y2Z A;  4M71 A;  3MKL A;  2G9W A;  1LDJ A;  3JSZ A;  3OYL A;  2XHK A;  4EV0 A;  2PMZ N;  3FKI J;  1R1T A;  3UNG C;  2CO5 A;  4BJ1 A;  1G5Z A;  1JI8 A;  2O9X A;  2YLD A;  4D7M A;  2GIZ A;  1YIJ I;  4WGY A;  4ESJ A;  2Y31 A;  3SDB A;  5HVQ C;  3WAQ A;  3JRI A;  1BDJ B;  3BG6 A;  1EA3 A;  2DYS C;  2I5U A;  3RF3 A;  2XPU A;  4U87 A;  1GDT A;  1W7P A;  3GBG A;  2BW3 A;  3JW4 A;  4GGG A;  4Z6Y A;  1AVO B;  1SAU A;  5L3G A;  2DN0 A;  1VOM A;  2LP4 A;  2OG2 A;  1D0Y A;  4M3F A;  4RS8 A;  3E70 C;  3L9F A;  3ML6 A;  4CGZ A;  3O10 A;  4CBE A;  4EJV A;  1JKR C;  2E87 A;  5FGM A;  2HVQ A;  2C6Y A;  2A5Y B;  2GBY A;  3KYC B;  2G7U A;  3GVA A;  4OU0 A;  2VXD A;  4IX7 A;  3NMI A;  4YFX F;  3GEE A;  2CYY A;  3EET A;  1Q1V A;  1WAS A;  3OA1 A;  3C2G A;  4ITV A;  3VYR B;  2IOQ A;  2R03 A;  2DQL A;  1MJA A;  2JTV A;  3PUF A;  2EWN A;  4KIG A;  1BR2 A;  1R58 A;  1ZRE A;  3ASN H;  5COG A;  3VFZ A;  2XLW A;  2V3C C;  4HFK B;  3HNK A;  3ATP A;  1WJF A;  1MBJ A;  4UB6 C;  1AOY A;  3I59 B;  3IUO A;  4E18 A;  2VKV A;  2P0N A;  3I5Q A;  2EIJ H;  1N77 A;  1P2F A;  1D0Z A;  2DT7 B;  1UCR A;  3S15 J;  3LSP A;  2V9V A;  1R5H A;  4X1E A;  2LF7 A;  2P5V A;  4BJ6 C;  1B72 B;  3HOY J;  3Q3S A;  2HVS A;  4XN3 A;  3HGY A;  3F72 A;  2ACJ A;  1VMA A;  4UUS B;  1QQI A;  1JHH A;  1H0M A;  3IEE A;  2XRH A;  2A5W A;  2E7X A;  1RUO A;  1Z77 A;  4O79 A;  5LLQ A;  5IT9 K;  1TWA A;  2XF5 A;  2XAU A;  3BR1 A;  4E7K A;  4LDK A;  3ZP5 A;  5BQH A;  2DA3 A;  4K1O A;  2KW3 C;  1J5Y A;  1R1V A;  1U89 A;  2W45 A;  2HTJ A;  2QKL B;  2GAU A;  1A0B A;  1V5G A;  3HSR A;  3GME A;  4JK1 X;  2Q0O A;  5KYY B;  3OYB A;  1KON A;  4XOT A;  3GUD A;  2VQC A;  2LKS A;  2XSE A;  1IDZ A;  3OR2 C;  2IW5 A;  1LB2 A;  2CYD A;  1HW1 A;  5FLX Z;  2JRM A;  1K78 A;  5K1Y A;  1BM9 A;  2GA2 A;  3M07 A;  1G2H A;  2QZ8 A;  4GYG A;  3R60 A;  1WH7 A;  3W6J B;  3FXH A;  5AIP A;  2ZME C;  1ERD A;  2ZXW C;  2YKZ A;  1DGR M;  1SD5 A;  4AX2 A;  3L2Q A;  3I56 I;  2ELJ A;  4C3I J;  3AOU A;  1BI0 A;  1Z1D A;  2LY1 A;  2ZO4 A;  4BKX A;  1OKK D;  2MD5 A;  1RMV A;  3HYI A;  3L2U A;  1TKN A;  5GAG J;  2YWA A;  3DLA A;  4IAQ A;  3T6J A;  3O3K A;  3B71 A;  3LJB A;  4KI2 A;  3QAH A;  2IM8 A;  1JGG A;  1JUM A;  2ZJ2 A;  3SXM A;  2OA4 A;  5L3E A;  3A11 A;  2OOC A;  3HKK A;  1HLV A;  1HC8 A;  4EKW A;  2ZXR A;  5JT4 A;  4DOZ A;  1SD6 A;  2BHZ A;  1OW6 A;  2AWC A;  5L0C A;  4YIF A;  4Y4R A;  3LAJ A;  1TWF J;  1HCR A;  1I4Z A;  5L3Q A;  3QP6 A;  2ZCW A;  4JKV A;  2L9R A;  4B8X A;  2XRN A;  4XIC A;  1EA8 A;  3ABL C;  5EHH A;  3K7D A;  2M45 A;  5CVJ A;  2HGC A;  3BJO A;  2ZFU A;  2YRF A;  3HJC A;  2E19 A;  3CCV I;  4Q47 A;  1TWH A;  1Z7U A;  2IA2 A;  1OKK A;  3MKY B;  4ZH4 F;  3VYU B;  2Q9C A;  4MS2 A;  4C3D A;  3V7R A;  1PYV A;  3LEV A;  5E3L A;  4EJO A;  2CW8 A;  3FZV A;  2VBX A;  3IQ6 A;  3W6K B;  4KNY A;  3FXR A;  2P1A A;  2R7F A;  3X2Q C;  2DMP A;  4B47 A;  3BCB A;  3QPS A;  4OMZ A;  3PNT A;  4ANJ A;  5JVT A;  1BZ4 A;  4FET A;  2KYH A;  3QZC A;  5B1B C;  3S0X A;  1J8Y F;  2HMZ A;  5DUI A;  2ME0 A;  2IGN A;  4C3B A;  3BCA A;  2VOD A;  4LAC B;  2VON A;  2MGQ A;  2DOD A;  3H3Z A;  3RVY A;  3T6B A;  1R4T A;  1TWC A;  1X4O A;  2JZY A;  1ULY A;  3EQL F;  2PMU A;  1O7F A;  3EFO A;  1G4W R;  3C8G D;  1OCR H;  3G3Z A;  2QM3 A;  2W4S A;  2JQ7 A;  2PF4 E;  1T56 A;  2A69 F;  2DA5 A;  3CDH A;  1W1W E;  2VE8 A;  2QVO A;  1BC8 C;  4YT8 A;  3OYI A;  4CCJ A;  3KIO A;  3OYH A;  4RBO A;  3JSP A;  1F9N A;  3G71 I;  2OD5 A;  1X1D A;  2M9H A;  4F92 B;  2O03 A;  4OIP F;  3VAY A;  1OCT C;  2M7A A;  3DP7 A;  3IV5 A;  3IRQ A;  2NVT J;  5CLS A;  4CCO A;  1C0W A;  1ST6 A;  5E33 A;  1ETK A;  1CGM E;  3CUO A;  1TNS A;  1TWA J;  4HYE A;  4MLO A;  4OIO F;  4MW3 A;  4YT2 A;  3HNL A;  4XRS A;  4A2N B;  2ZC2 A;  3DF8 A;  5KVR A;  3CME I;  1HOM A;  1IV6 A;  2ZSI B;  1SEU A;  2DA4 A;  1IXR C;  1W0U A;  3ZN1 A;  2PX9 A;  3PIO F;  3C63 A;  5JP7 A;  1L3P A;  1JTX A;  3V7C A;  4B48 A;  4NDL A;  1XDU A;  5D5U B;  2EIL C;  1S3J A;  1SVM A;  2YQY A;  4RLQ A;  3H35 A;  3C8G A;  1J09 A;  2H09 A;  3V7O A;  1WJE A;  4PSW A;  3K4B A;  1Y6I A;  3ZC4 A;  3LQR A;  3ZQI A;  3ZQV A;  4EBJ A;  2IP2 A;  1V5F A;  4A5N A;  4E7S A;  4CS9 C;  3QPH A;  4ENM A;  4C3E A;  1UHM A;  4PGH A;  3OOU A;  4M63 A;  2DT6 A;  3BZK A;  4BJ6 A;  1EH6 A;  2BY3 A;  4KT5 C;  3TQO A;  1NG7 A;  2KLO A;  3CES A;  1CPR A;  4N6C A;  5E3O A;  4BY1 J;  4R1H A;  4BUP A;  4PDK A;  4WX9 A;  4U5B E;  3LES A;  2L9V A;  1S7A A;  4M3G A;  1AWC A;  1I1S A;  3LSH A;  1WGW A;  1JKO C;  2ZKZ A;  3QYF A;  5E8G A;  5F64 A;  3IRR A;  1XWJ A;  3CQZ A;  2Y9Y A;  2DFE A;  4ETS A;  4M9X A;  4RAF A;  3EHM A;  1MBF A;  4YN0 B;  1FZP B;  2LKP A;  2P81 A;  1UG7 A;  4GDF A;  2UUZ A;  2X1D A;  4G78 A;  1ETQ A;  4JJG A;  5GPG B;  3ECH A;  4KDP A;  3BR0 A;  2KNH A;  2VJ4 A;  4W8P A;  2AXT C;  4KN7 X;  3F8B A;  9ANT A;  1VF9 A;  4XLF A;  5AGF A;  2V6C A;  4ON0 A;  2CQQ A;  1RKC A;  2EPK X;  1NG6 A;  5LEJ A;  4FQG A;  1QZY A;  3HRT A;  1USS A;  2VKE A;  4AWX B;  4UVC A;  1MIJ A;  1P4A A;  1XB4 A;  2VBZ A;  4KNV A;  3B0V C;  4JJF A;  2HFH A;  3F8N A;  2ZME A;  3EUK L;  1JOG A;  2NVY J;  3MYI A;  3TOM A;  4MEY F;  4JEA A;  4XEF A;  5DLJ A;  2PG4 A;  2R7S A;  1IN6 A;  2BY2 A;  3E5X A;  4LDQ A;  4X0R A;  4LIV A;  3R0J A;  4V2G A;  3SZG A;  1YIO A;  5D8L B;  1TWH J;  3Q6N A;  3SNH A;  2QGU A;  4IQ4 A;  3RCO A;  4DJ9 A;  5B3S C;  1TTY A;  4U0Y A;  2IS1 A;  3O6X A;  4LLL A;  3FMS A;  4CSW A;  2DMN A;  3I54 A;  3WHC A;  2LKX A;  1LEB A;  2Q9A A;  4Z9H A;  2DO7 A;  3HTS B;  2HOA A;  3TO7 A;  3E1S A;  1K78 B;  1YYX A;  3MWM A;  4J7T A;  2CS3 A;  3HUG A;  4U7D A;  1T98 A;  4UUT A;  1NTC A;  1HA8 A;  3ZVR A;  5EGO A;  1JKP C;  5T3T A;  2V7F A;  3PUB A;  1E86 A;  1ETY A;  1WFX A;  5FRN A;  1WJB A;  3K4K A;  1SMY F;  1SMT A;  4EJW A;  1TWC J;  2K4B A;  4MNU A;  2XGX A;  3K0L A;  3RPQ A;  3VWB A;  1I1G A;  1VLS A;  3HHG A;  2EV0 A;  1G3W A;  3K4L A;  1IZ1 A;  4HA8 A;  2K9Q A;  2J0X A;  3U9M A;  5JLI A;  2K85 A;  2EIN C;  4L0Z B;  1MMG A;  5BMZ A;  3LEO A;  4LDR A;  1T2K A;  1M2V A;  3CCJ I;  3ELK A;  1Z7L A;  1Z23 A;  3RZO J;  3HXL A;  1OR3 A;  4CDV A;  4O6N A;  3QYB A;  4YFK F;  4F4B A;  2FJ1 A;  1LFB A;  1ORJ A;  2LK4 A;  2E71 A;  1DQU A;  4NNJ A;  3CDL A;  5LGT A;  2XAJ A;  4BE2 A;  1Q0K A;  3FIS A;  2OU6 A;  1JMW A;  3L2C A;  2IPQ X;  5JR3 A;  4AVP A;  3CMM A;  3C18 A;  2FUG 2;  4B44 A;  2HJ3 A;  3QTH A;  1LVA A;  2V9P A;  3FWE A;  3O8G A;  2VLA A;  4BEH A;  2RD9 A;  2KIF A;  1TT5 B;  3HRM A;  5EZG A;  3HL2 A;  1M6T A;  2HMQ A;  2HR3 A;  2Z33 A;  3ZPL A;  3VPR A;  4A3J J;  1ZR4 A;  5B1A H;  2F48 A;  4HLX A;  1YAU O;  1S7E A;  1XCV A;  2X51 A;  1RZ4 A;  3QOP A;  1RKT A;  5C4X J;  3EGX B;  2UXN A;  2ISZ A;  4LER A;  4CYD A;  3AQB A;  4LMY A;  5KYU B;  3TW6 A;  5BS6 A;  5IYC J;  1MND A;  1XMA A;  2BL2 A;  3N24 A;  3IH4 A;  3PHF 2;  4LIT A;  4LOC A;  3LFU A;  3H92 A;  3MLG A;  2A6E F;  4ENJ A;  1QNT A;  5EEH A;  5DTD A;  2P6S A;  2R5Y A;  3DD7 A;  2A68 F;  3CQZ J;  1ZN2 A;  5HDG A;  5KNL A;  1FT9 A;  1LPE A;  1N25 A;  1RR8 C;  3CSK A;  2HWV A;  5F04 A;  5F08 A;  2LY2 A;  1OQC A;  4KA4 A;  2NRA C;  5FRM A;  5D5V B;  2DJN A;  1FOK A;  4DBQ A;  2B0L A;  4F7Z A;  3GTL J;  4JX5 A;  2IBF A;  1Z6R A;  3LSG A;  3P9I A;  5IP9 J;  1FYM A;  3DJN B;  3OSF A;  4CS9 A;  2MH9 A;  4FTH A;  4M3D A;  1RET A;  3M7G A;  3ZSU A;  4XKV A;  1MBG A;  2XB0 X;  3RJP A;  1SYQ A;  4LB6 B;  1D3Y A;  3US6 A;  1PP7 U;  4CJO A;  1T6U A;  2DMU A;  3CEX A;  3U8V A;  1JKQ C;  5DS6 A;  3L7W A;  1APC A;  3BR6 A;  2DBB A;  3A9C A;  2WVQ A;  1IXC A;  3H9G A;  1FFT C;  2BV6 A;  2QKM B;  3T6G B;  5JFR A;  1DU0 A;  5KHD A;  2LCH A;  5EEA A;  3VRC A;  2EV5 A;  4EJU A;  3A03 A;  4RDA A;  1A6I A;  2OJE D;  5FLM J;  1PD0 A;  3U2M A;  5BOX A;  2VKH A;  5LRS A;  2DOA A;  4ESB A;  2WWY A;  2HV7 A;  1UAA A;  2W1O A;  3S1M J;  4XNF A;  3IKV A;  3GAN A;  3AKZ A;  5L3F A;  5EK0 A;  4BE0 A;  2PP4 A;  4NUB A;  1KA8 A;  3M9A A;  1IRG A;  4R79 A;  2JX0 A;  3D5S C;  4XON A;  3ABK H;  1V5E A;  2OZ6 A;  1A35 A;  3AG2 C;  3JRM O;  5A6K A;  3NAR A;  4BXU A;  1T9K A;  5E20 A;  1XCB A;  4JIO A;  5TIS C;  3RYR A;  1PJR A;  4FAS D;  1A31 A;  2F5V A;  3Q9S A;  2PMH A;  4IO9 F;  4YRV A;  3DLL F;  4RD9 A;  4HBL A;  1QO0 D;  1FSE A;  1ZK8 A;  3WE2 A;  3WHB A;  6PAX A;  3PQK A;  1AKH A;  1XSD A;  4FT8 A;  3FXQ A;  3ONQ A;  1W36 D;  4DRH B;  2Y69 C;  5HLT A;  3EUA A;  2NPU A;  1E85 A;  4P9F A;  3LNR A;  2QTV A;  3QVY A;  2KIM A;  3K1M A;  1QVU A;  4J30 B;  2K9M A;  1YVI A;  5FFZ A;  1XG1 A;  2PX3 A;  2JA2 A;  2Y75 A;  1MH4 A;  3QOD A;  5F0H A;  4WXC A;  3MAJ A;  4MTG A;  2VPR A;  3I4U A;  2DGJ A;  3N2Z B;  2RGV A;  2J0W A;  2YUS A;  1EQ1 A;  1E3H A;  1FMV A;  3LLI A;  3VM6 A;  2NVX J;  2NNY A;  5BPI A;  1MZB A;  3I4N J;  3G6E I;  4BXX J;  1H9G A;  2WAQ A;  2EFN A;  2XPW A;  4MQV A;  2KK1 A;  2XLE A;  2YLG A;  5GPC A;  1YDI A;  2Z9O A;  3GZN B;  5L3C A;  4CSA C;  2HYF A;  1IC8 A;  5JUA A;  1MBK A;  3N97 A;  2M5W A;  2MD0 A;  2OEX A;  5FCL A;  4M72 A;  5HS9 A;  5E3N A;  1ONV A;  2YZS A;  4U9D A;  4DXW A;  4XK4 A;  3OV8 A;  1QQ3 A;  4HAM A;  2PI0 A;  3U21 A;  2CV1 A;  3DI5 A;  2D5R B;  2DI3 A;  1Z6A A;  5A2Q K;  1RES A;  1R22 A;  2CRG A;  2R3S A;  3OYJ A;  2KGO A;  1RJ9 A;  2JSP A;  4EVI A;  4RAG A;  1MBE A;  4U5F E;  1CGP A;  4NQW A;  4KT6 A;  4DIQ A;  2WL8 A;  4CUG A;  3E97 A;  2CQK A;  1ITY A;  1FOY A;  3OYD A;  1Y1V J;  1OPC A;  2R7O A;  4L0Y B;  2L2O A;  3SP1 A;  1K7A A;  1ZHZ A;  4IEJ A;  4LFU A;  4W97 A;  2KHM A;  4XPY A;  5IPA A;  3HSE A;  3JYH A;  3VF0 A;  4HSR A;  2CU7 A;  3EHN A;  3ZQG A;  1OIS A;  2OZU A;  4MGR A;  2ECC A;  2R0Q C;  2HXO A;  1CF7 A;  2NUP B;  1L3L A;  3DTK A;  3TK0 A;  2WAE A;  1JUP A;  2P4W A;  2OQG A;  2XGE A;  2E1N A;  2PJR B;  1TR2 A;  2WAD A;  1LNW A;  2V1X A;  2GA0 A;  2LSO A;  3OS0 A;  2R25 A;  3HNI A;  4PJ0 C;  1S72 I;  3HOS A;  4DJA A;  4GEH A;  4MW8 A;  3DAF A;  5CI9 A;  1U2W A;  1YFH A;  2VUM J;  3ZQQ A;  2Q7R A;  1IRF A;  2IS6 A;  4EUK B;  3OYA A;  2XXA A;  3H9J A;  4IHY A;  1JAF A;  3BWG A;  1FAP B;  1HW2 A;  3S17 J;  2KRH A;  2DAO A;  5KYX A;  5IT9 Z;  3DWL E;  3RKW A;  2H1L A;  3TOB A;  4K2E A;  4QPQ A;  3K2A A;  2MW8 A;  4N4N B;  5H2F C;  3IQT A;  3NYM A;  5CIV A;  2WAQ N;  1FNT c;  3JRF A;  2E35 A;  3TGN A;  3LNM B;  2MYS A;  3CCE I;  1O3R A;  2JK3 A;  3TDU C;  4GQH A;  4IRG A;  5L3D A;  2EH3 A;  3T5X A;  1ZGA A;  3G4S I;  1YHQ I;  1B59 A;  1ZAO A;  3CCY A;  2KSF A;  1ZW2 A;  3WHN A;  4Y33 A;  1YAR O;  4AE4 B;  2GOM A;  5E79 C;  3K2Z A;  5K7Z A;  3ZMT A;  5T3W A;  1TW3 A;  1MJB A;  2ESH A;  4QDL A;  1EKY A;  4MTE A;  2EQR A;  2HKO A;  1S29 A;  2HS5 A;  2QLZ A;  2EFO A;  2NVQ J;  2FQ4 A;  4KBL A;  5D91 A;  2W82 A;  2FGY A;  3O2P E;  2XL4 A;  4LLG F;  3PDM P;  3ROU A;  1ON2 A;  4Y17 A;  2VXZ A;  1OJL A;  2ELK A;  2HVR A;  2OEV A;  2D1V A;  3H3V K;  3DM5 A;  3M1E A;  2HOT A;  4ZC3 A;  3GM2 A;  2DFI A;  2OC6 A;  1WVR A;  5DYM A;  1NG1 A;  3NRV A;  1WI3 A;  3BR5 A;  3TO6 A;  2I8B A;  2RDP A;  3BZC A;  2R7Z J;  3FIW A;  1M57 C;  3ERE D;  4QI0 A;  1E2X A;  4E7Z A;  4B1R A;  3GXO A;  3H5N A;  3KPH A;  1ZH5 A;  3CZ6 A;  1I4Y A;  2JPU A;  4DVY P;  4A0X A;  2VN2 A;  2F6C A;  2VI6 A;  3B6C A;  2H1K A;  4DYC A;  2E7W A;  2ETH A;  3M1C B;  3MEX A;  2HPI A;  4L9N A;  1OCC H;  3FVY A;  3K7A J;  4AIJ A;  4I0B A;  2A0B A;  4Q4Z F;  4CDY A;  1WSU A;  3OYF A;  2QBY A;  1J7K A;  2OQR A;  4NC3 A;  1YJN I;  3TUL A;  1PDN C;  1F1M A;  4KIT B;  2IGK A;  1PV3 A;  2VQG A;  2XAS A;  3S84 A;  1Z3Y A;  4NQF A;  2JT1 A;  2K4J A;  3OS2 A;  4ZYG A;  4W8K A;  5EG0 A;  1QPM A;  3PSI A;  1VK5 A;  4MVQ A;  3CCR I;  4YT4 A;  5JS5 A;  1J9I A;  3L0I A;  1N75 A;  3PMR A;  3A02 A;  1X3W B;  3LA2 A;  2P7V B;  4D1Q A;  2DYS H;  1ZQ3 P;  3T8T A;  1G8X A;  2A61 A;  2ICW G;  5L3V A;  3SZT A;  3W8I A;  2F5F A;  2W84 A;  4XWJ A;  4WF2 A;  4B6I A;  1OQY A;  3I71 A;  3NWS A;  5CVI A;  3W6V A;  2L6F A;  3ABM H;  3ZMS A;  3H36 A;  4B3X A;  4BH9 A;  5H20 A;  4DW6 A;  2HZD A;  3BTC A;  3FDY A;  1U5T C;  3Q6M A;  4E0H A;  2VKD A;  3FMR A;  2QA4 I;  3HOT A;  4X0G A;  1H89 C;  4BU2 A;  4CSA A;  3F46 A;  1R7J A;  4HFF B;  1IN8 A;  2O61 A;  4L5J A;  1SAN A;  5D92 A;  4PFP A;  4ZDP A;  1RRJ A;  1BW5 A;  4RBN A;  3D5R C;  2OQM A;  3ITF A;  3AL0 B;  1SD7 A;  2FA5 A;  3BQZ A;  3CJN A;  4XOP A;  3TDZ C;  1CQT A;  5L0H A;  1FMW A;  2V79 A;  3Q0W A;  3WTX C;  1BBH A;  2CUZ A;  2MA3 A;  4PGG A;  1VYI A;  1R1U A;  4ULW A;  4IJJ A;  1MMD A;  1BC7 C;  3I3L A;  5JLW A;  2D5V A;  5E3A A;  2A1D D;  1P6R A;  2Q9B A;  1R36 A;  4FES A;  2YL1 A;  4LIU A;  5M5W J;  4ONS A;  2MSY A;  1V55 H;  2VCA A;  2RRE A;  4YL3 A;  3I5U A;  5DM7 F;  1W0T A;  3KFW X;  5E17 F;  4LGW A;  2STT A;  3RQ4 A;  1FTT A;  1OR2 A;  3R7C A;  3FDQ A;  3GZ6 A;  1O5H A;  2V26 A;  2KIQ A;  2Y39 A;  2E2I J;  5AIQ A;  1YOV B;  3JAM K;  4QWQ A;  4A3C J;  256B A;  2XL8 A;  4ZJZ A;  3GCM A;  5DV5 A;  2E1C A;  4L18 B;  2PFD A;  5J40 A;  1DPU A;  4U5E E;  2V4J C;  1X1C A;  5J3L A;  4JCZ A;  4ZYH A;  1ZHT A;  2KIU A;  3ASO H;  3ABU A;  2HTS A;  3S3N A;  1QBJ A;  3J7Y J;  1TFK B;  1NSG B;  4MFE A;  5DCM A;  4L9V A;  4LG3 A;  2WZL A;  4UNO A;  1V54 C;  1IN5 A;  3S1R J;  4XL9 A;  1YRN A;  2VH3 A;  2QY9 A;  2YS9 A;  4IKF A;  1Z91 A;  2W24 A;  3K1P A;  4XEK A;  4OD4 A;  3SHF A;  2IA0 A;  4U7B A;  1XGO A;  2NAZ A;  4XRF A;  3SXZ A;  3ZQ7 A;  1STZ A;  2FMY A;  3HIF A;  2OCC C;  5J6X A;  3BPX A;  4BJ5 C;  4ULV A;  1RUN A;  1JE8 A;  3TL4 X;  3FXM A;  2J45 A;  2ZXW H;  3PSF A;  1HSJ A;  2L54 A;  3CC2 I;  2X4H A;  3B29 A;  3DE9 A;  2QUF A;  1G59 A;  2DTZ A;  2LNB A;  2DPD A;  4ESF A;  3JSE O;  3V5Y A;  2Y3G A;  2HQA A;  3FF5 A;  4PK4 A;  1V3F A;  1MW7 A;  1BI1 A;  1BOB A;  3PL8 A;  1NK3 P;  1BN5 A;  1ZG3 A;  2IGM A;  2K27 A;  1X2N A;  1P92 A;  1K04 A;  3FM5 A;  2G62 A;  2W48 A;  3J7A Y;  2BVL A;  5IP7 J;  1YA7 O;  2LMD A;  5BUO A;  4UVB A;  3S1Q J;  3JYY A;  4JBA A;  4AC0 A;  4MTD A;  1GXP A;  3E6M A;  4II3 A;  1VQK I;  5L0I A;  3GW2 A;  4BXF A;  2GQQ A;  3C62 A;  1WZ2 A;  1Z63 A;  1Z21 A;  1MNM C;  3ABL H;  2OPT A;  1GV2 A;  3CP8 A;  4FIS A;  3WGG A;  3UKG A;  3U3F A;  1JUS A;  3F9K A;  3S1N J;  1ETV A;  3L09 A;  2VPL A;  1B4A A;  1XN7 A;  1YW7 A;  2HI3 A;  3CC4 I;  4P6I C;  5FKK A;  2VC1 A;  5ILS A;  2QEN A;  5LHG A;  2XAG A;  3M4C A;  3MKZ A;  4FX5 A;  4YEJ A;  1XMX A;  4YL0 A;  3UGP A;  1X1B A;  2E34 A;  2KP6 A;  5AC4 A;  4FX4 A;  4A3F J;  2UV1 A;  4NBQ A;  1GHC A;  3GTG J;  4B43 A;  1A7E A;  3V8K A;  3X2Q H;  4XRM A;  3AG3 C;  4OIQ F;  1OCZ C;  3W8H A;  4CYC A;  3H5R A;  2DFF A;  2R5Z A;  2KIS A;  3DU6 A;  1LQ1 A;  2WZF A;  3JCU Q;  2R7X A;  5TJ5 E;  3U8P A;  4U5H A;  2LFF A;  2XLO A;  4E7I A;  2JSC A;  1CGN A;  5DD8 A;  4XRS G;  1XGN A;  1RKW A;  2OJQ A;  1SC7 A;  3QMK A;  3FXK A;  2EZL A;  2NS8 A;  4BQN A;  4GYT A;  4PUS A;  3B0P A;  4EHP A;  4A3G J;  3GM1 A;  3CUQ C;  5HLG A;  1T5O A;  3HZJ A;  5D8K B;  3H3U A;  2LBF B;  4EMS A;  1U5T A;  2DOE A;  4HRI A;  4IRI A;  3KKB A;  4F93 B;  2M0C A;  3DKX A;  5KYW A;  2DA6 A;  4UHT A;  4UV9 A;  1K40 A;  4HNT A;  3GZ5 A;  3KX2 A;  2LF8 A;  3HB9 A;  2EPM X;  3J7Z I;  5CI8 A;  2D2W A;  3AQC A;  4I1O B;  4JTD B;  1MMA A;  5L0F A;  2DU9 A;  3E6D A;  3B73 A;  2DA2 A;  1BOA A;  3S3O A;  1X3Z B;  3FOO A;  2FAP B;  3JSO A;  3V7S A;  1P7J A;  1KTM A;  2CQN A;  2VT2 A;  2YR2 A;  3ZMV A;  2O6G E;  2QQ8 A;  3J81 Z;  1W5C C;  4XMY A;  2R7R A;  1BJA A;  2F5D A;  3J06 A;  3OIO A;  2CDQ A;  2EZH A;  2UWM A;  2HKV A;  1OKR A;  3DTE A;  2KL4 A;  1XC5 A;  5F0C A;  2M4E A;  2A3S A;  4P55 A;  2Q8K A;  2K7L A;  4Q48 A;  2KC3 A;  1NFO A;  4J00 A;  1YS6 A;  3FHZ A;  2XLH A;  3H1C A;  4HNV A;  3ZWI A;  2DW4 A;  1G6N A;  3GFM A;  3F47 A;  2EB7 A;  3S14 J;  4NTB A;  1QU3 A;  4ZTF A;  4D9J A;  2LD5 A;  2YEV A;  2QQB A;  1TFO B;  5CVU A;  1YZA A;  4I44 A;  3KP7 A;  1B9M A;  2NSG A;  3ASN C;  2ISY A;  2L4A A;  5AC5 A;  3WOD F;  1R4N B;  3OL4 A;  4ASN A;  2LFB A;  3JRA A;  2W9Y A;  2VL8 A;  4Q7C A;  1GVJ A;  4CS7 A;  5LHH A;  1XZQ A;  4IVN A;  4UY8 I;  1IF1 A;  1DU6 A;  2GAQ A;  2RV8 A;  2CWE A;  3M3Y J;  4BYY A;  4PJM A;  3GF2 A;  5HLH A;  2J9V A;  2Q4F A;  3LFK A;  1XTA A;  1HMD A;  4BJ5 A;  3IPM O;  2JMW A;  4RB1 A;  5C4J J;  2J8W A;  5DS4 A;  2EPO A;  1FTZ A;  3T4R A;  2JPB A;  1X1A A;  2YX7 A;  2XSD C;  2ZJQ F;  3WTU C;  3WTY C;  3TO9 A;  1VQP I;  1APL C;  2G3K A;  3BT9 A;  3S8P A;  2GM4 A;  4LG0 A;  2VOO A;  3MQ0 A;  2HZ8 A;  2YSR A;  5HV9 A;  3NKE A;  3KCC A;  4JCH A;  3MN2 A;  1B8I A;  1Z6T A;  3LSM A;  1K61 A;  4MVM A;  3U2L A;  2PQ8 A;  1FTS A;  2HQ5 A;  4N4O B;  1UEL B;  2WAF A;  2R7T A;  2F5C A;  4K7B A;  3SEQ A;  1VTM P;  3I4P A;  3W4Y A;  1W7P B;  2BW3 B;  4DZJ A;  2HV6 A;  4UUV A;  1QPU A;  2YU9 J;  2Y0S A;  3S3M A;  4J19 A;  2LOO A;  4L9J A;  3R61 A;  4I02 A;  5F27 A;  4YK5 A;  2A6T A;  3BG3 A;  3NYJ A;  3OMY A;  3QVZ A;  3WU1 B;  4CA0 A;  2F5E A;  2A05 A;  3KYL A;  2M7B A;  1LVK A;  4XOR A;  3JRG A;  3GTK J;  2B0H A;  4AL0 A;  2YU3 A;  2Y30 A;  1YX5 A;  4IRH A;  3B0U X;  2XUB A;  3REO A;  2RQP A;  3SJM A;  2EIN H;  1G4U S;  2L0K A;  1EJ9 A;  2EIK C;  4CX9 A;  1QRY A;  3WG7 H;  2ELH A;  1LI5 A;  2OV7 A;  1PP8 F;  3DMD A;  1F4K A;  3CF5 F;  3CTA A;  1TZL A;  1B68 A;  2P7C B;  2DYR C;  2R4G A;  5M5X J;  3KZZ A;  3OR1 C;  3EG9 A;  3QRF F;  4XN0 A;  3T8R A;  5GAH J;  3BJ6 A;  2AQF A;  3BTL A;  3CCM I;  2FE3 A;  1T6S A;  3H2U A;  3LL7 A;  2B9S A;  1KU2 A;  3AGT A;  2VOP A;  4LJZ F;  3KLN A;  2BE5 F;  4CIC A;  2HDC A;  2R02 A;  3EGD A;  1GVD A;  4XLC A;  2P8T A;  2BEO A;  1D0X A;  5GTH C;  3CUQ A;  3RQG A;  4IWB A;  1VQ9 I;  1S9H A;  2OBP A;  5A6B D;  3F0C A;  1FBU A;  4C3H J;  5JVG F;  3LNQ A;  3OYE A;  1Z5Z A;  3ZN0 A;  1BJZ A;  4CIH A;  1LM3 B;  1QVT A;  2FEZ A;  2DPU A;  1T33 A;  4FX0 A;  2J9U A;  2WA0 A;  4DRI B;  3KP2 A;  4S05 A;  4WK8 F;  3GTM J;  5A2Q Z;  1U8R A;  1Y0N A;  1XDS A;  2LY9 A;  2B7E A;  5J1R A;  2VQH A;  1OCR C;  3EJN A;  2PFB A;  2I8D A;  2UZK A;  3DBR B;  3DU5 A;  3MFK A;  1FSH A;  1F36 A;  2LDU A;  2Y0S N;  4XM3 A;  2Z1D A;  3WU2 C;  5BPD A;  3ABT A;  3S29 A;  4A3E J;  1LPQ A;  1FIA A;  2V6E A;  2OCE A;  4I01 A;  2GXB A;  4NCQ A;  5A6B A;  3MMY B;  4RGS A;  2DB4 A;  4CXF A;  3PQJ A;  4MVU A;  5DUK A;  1S6L A;  2BY0 A;  1I5N A;  1QGP A;  5JRA A;  3HC7 A;  2DK5 A;  1U8B A;  2HOS A;  3ZRG A;  5D4R A;  4EJT A;  2WC2 A;  4IHT A;  3E0J B;  3BP8 A;  1O87 A;  4XPW A;  4JX4 A;  3ISP A;  4XR6 A;  3L2V A;  2KJC A;  3RQI A;  3K33 A;  1V4R A;  1PUF A;  2G0E A;  1WOL A;  2X0L A;  2QF7 A;  3C7J A;  2H8R A;  1ZZP A;  4GCV A;  5HSW A;  1UB9 A;  3A2K A;  1A6Q A;  5HOO A;  2DJI A;  2QLA A;  4XQ1 A;  2J9W A;  1LJ9 A;  1U6G A;  2GWR A;  1YJG A;  3AG4 H;  1X1P A;  2JD3 A;  4O7G A;  3E9V A;  3PNV A;  2CUF A;  4A3M J;  2QNL A;  3LLK A;  5FFX A;  4XLH A;  2H6C A;  3F8M A;  3G50 A;  5K5Q A;  2GIV A;  4N0B A;  4RDU A;  2YLI A;  3P5J A;  3POV A;  4HQM A;  1UFM A;  2VBY A;  4U9E A;  2BXZ A;  3PNY A;  5F1J A;  1KU3 A;  1HKQ A;  1UHS A;  1J75 A;  1VQN I;  1C03 A;  3DM9 B;  3GM3 A;  3H2V A;  2OU2 A;  4G12 A;  4C2M J;  3OL3 A;  2KJG A;  1HW5 A;  4EAT A;  4JC7 A;  4OIR F;  1FBQ A;  1LDK B;  5GPA A;  3EFO B;  1YW8 A;  3K69 A;  3JTH A;  5EYR A;  3KEQ A;  2Y69 H;  5ICG A;  3ZQC A;  2NUT A;  1HBX G;  3CD6 I;  3COA C;  4AK9 A;  1BBY A;  3RZD J;  4JP0 A;  3GTJ J;  3LSR A;  5L0D A;  2K3F A;  1VB5 A;  4Z9I A;  1A36 A;  5F0F A;  2OTJ I;  3GWL A;  4XSZ F;  1P7I A;  1YYV A;  2IAI A;  4IQJ A;  3S28 A;  3OYC A;  1LEA A;  1B8I B;  1UFB A;  3F21 A;  3HGG A;  2AO9 A;  1ZGJ A;  3MKW B;  4KIF A;  5GTI C;  4QTR A;  3E7L A;  4V19 K;  3FHD A;  2H8A A;  1HMO A;  1RXQ A;  4BDZ A;  1A04 A;  2NS0 A;  4XKB A;  4RB3 C;  2DMQ A;  1OLT A;  4A4A A;  2X6Y A;  2P0W A;  3F8C A;  1WHU A;  3OYK A;  3I55 I;  4G8X A;  1JJ6 C;  3C8G B;  1AU7 A;  4I1M A;  1TP4 A;  4I0A A;  3NQO A;  1WJD A;  1ZW3 A;  2CGE A;  1R4M B;  1R6R A;  4F55 A;  4OD5 A;  1S05 A;  3FM3 A;  4Q5S F;  5KYN A;  4DQ2 A;  4LK0 F;  2KFD A;  4MND A;  2XAQ A;  4B09 A;  5DS9 A;  2L9J A;  2J46 A;  4CDA A;  4HF2 A;  3IAS 2;  1D5V A;  3ZMD A;  1MSE C;  1DPR A;  1A7V A;  3FXJ A;  2VC0 A;  3ERM A;  2E2H J;  1IAW A;  3ZDL A;  3I53 A;  3L1P A;  3JT1 A;  2O3F A;  4B4C A;  2EBI A;  1R5G A;  2CW0 F;  4FE4 A;  4ZTJ A;  1XZP A;  2EIM C;  3DKW A;  4P9T A;  4RGX A;  1VFC A;  1Z3X A;  1YJW I;  1Q0F A;  1SVL A;  3U5S A;  4O6Y A;  5K7F A;  2H94 A;  4CCM A;  1FP1 D;  1YLF A;  2HYG D;  5FKL A;  1Y1W J;  1NH3 A;  3NMJ A;  3CC7 I;  2RQQ A;  5LBQ A;  2X0C A;  1R9T J;  2CFX A;  2PBE A;  2HU9 A;  3S27 A;  2X1E A;  3PO3 J;  2L7K A;  4P1W A;  1LFU P;  5H6R A;  4P5O A;  3SFZ A;  1FYL A;  1K05 A;  5D6F A;  4HF1 A;  1PD1 A;  4MTO A;  2L9S A;  1TBX A;  1HQC A;  2ZME B;  5D6E A;  3CO6 C;  1FFH A;  5E18 F;  4IZZ A;  2HJM A;  4JRZ A;  4U0V A;  5IY5 H;  5LEK A;  1AHD P;  2Y3B A;  4RAY A;  1OCO H;  1GUU A;  3DPT A;  3HTK C;  2COB A;  1OYY A;  3BZ6 A;  4HNU A;  1MNE A;  3O55 A;  1KNY A;  1ZG5 A;  3JAM Z;  4ZDO A;  3WTS C;  3ZQF A;  4U88 A;  1MBH A;  2GLO A;  5ILU A;  1NFN A;  1RIO H;  5HS7 A;  3TD7 A;  1IW7 F;  2VJ5 A;  2R7D A;  1LFP A;  4BJT A;  3TED A;  3HUG B;  2D1H A;  4M3E A;  1DP3 A;  4E7H A;  2CV2 A;  3DPL C;  5EGO B;  3WTW C;  5ICF A;  2YVK A;  4YEL A;  3UMH A;  5BNG A;  3M8J A;  2PLY A;  2KT0 A;  1U6H A;  1WRJ A;  3CJT B;  4IF4 A;  2WV1 A;  2RKH A;  4BHC A;  2F2E A;  3CMA I;  1LE8 A;  2HXI A;  5CQE A;  4O5V A;  2NNN A;  2IEK A;  3IH3 A;  4YG2 F;  2XRO A;  1PUE E;  3H0G J;  4BQO A;  1I3A A;  3O6B B;  1H88 C;  1LS4 A;  2HDD A;  2XM0 A;  1WJA A;  4AID A;  3L00 A;  3RKX A;  2EJR A;  2JA6 J;  5F5H A;  1M2V B;  4KYW A;  2BOL A;  2M4G A;  2V1D A;  1JGS A;  4I09 A;  1HF0 A;  4NY3 A;  5JHU A;  3OEO A;  4CIP A;  2QWW A;  5KCM A;  3FAP B;  4DRJ B;  4ZYE A;  3UMK A;  1U0J A;  2VBW A;  4IGG A;  3IKT A;  3ZQL A;  4RGR A;  1Y6D A;  1I39 A;  2B0J A;  4AU7 A;  2BC5 A;  3VEP A;  2GA1 A;  3OYM A;  2MWQ A;  2YHS A;  4M73 A;  3ZTZ A;  2L7F P;  1H6G A;  5B3I A;  1N78 A;  3CAX A;  3F6O A;  1VLT A;  1GV5 A;  2X9D A;  1VI0 A;  3HDD A;  4PJN A;  2XRL A;  1FIP A;  4BEH B;  1R5I D;  1ZHX A;  5BQG A;  1IG7 A;  2FXA A;  5FZT A;  5EZH A;  1U9O A;  1XSV A;  1MKM A;  3AJM A;  2XC7 A;  2LC2 A;  2IS4 A;  3V5Z A;  4Y7N J;  2K9S A;  3U1D A;  5IOZ A;  3GEH A;  3A0H C;  3JRB A;  3S2D J;  1GQA A;  3KE2 A;  2G3V A;  3LS0 A;  3UMI A;  4G6T B;  2IT0 A;  1KYW A;  3CCS I;  2OTL I;  1T6I A;  4LLN A;  3ABK C;  2GWW A;  2CFO A;  3IAM 2;  1MGT A;  1JTY A;  4MFD A;  1X4P A;  5IYB J;  3U0C A;  3VYS B;  1QZX A;  1T39 A;  3MCZ A;  3Q9V A;  5JSL A;  2R5Y B;  1WQ2 A;  1EV7 A;  1FOX A;  4EIY A;  1ZRC A;  2R92 J;  4GXO A;  3EH2 A;  4G6D A;  3GFJ A;  2WV0 A;  4OWR B;  5DQT A;  2M8G X;  5LGN A;  2GDC A;  2M87 A;  5ERI A;  2KDZ A;  3BRJ A;  2IVM A;  2V9K A;  1R23 A;  3TOA A;  4A6D A;  2HQN A;  4D0P A;  2AU5 A;  2R7V A;  3CJQ B;  5CVV A;  1QSP A;  5KAF C;  5J8C A;  4JW1 A;  4BHB A;  2EFQ A;  5LFA A;  1Q0G A;  2WY7 Q;  4L5I A;  1O4X A;  1O3Q A;  4DBR A;  4HV5 A;  4KIB A;  1XPX A;  1JXS A;  1ZLJ A;  3WE3 A;  1Y8R B;  3L34 A;  1UJ8 A;  1G3T A;  1HE9 A;  1YQA A;  3ZIB A;  5CYV A;  1DDN A;  1WPK A;  1FY7 A;  2PNO A;  3B6A A;  3I59 A;  2LR8 A;  1W2W A;  1JR8 A;  3LOC A;  4JE9 A;  2TCT A;  2K9L A;  1SAX A;  2W25 A;  3EPZ A;  1B72 A;  1YI2 I;  3G4X A;  4WCG A;  2ZB9 A;  1OMI A;  4JQF A;  3LAP A;  4UUS A;  1Z67 A;  4M6V A;  4HEA 2;  1SVO A;  5DD4 A;  4MTF A;  3VSK A;  1ZR2 A;  4J01 A;  4YT5 A;  3OSG A;  2FOW A;  1T8I A;  3WGH A;  1HDP A;  1FNN A;  2E1O A;  2JUG A;  1B6A A;  2ZXH A;  1HKT A;  3KYI A;  1V54 H;  4E6K G;  1ZGW A;  3HM5 A;  1JT0 A;  1R00 A;  2VQL A;  3P7N A;  4M9S A;  2KZG A;  4O3M A;  2ZNY A;  4CCN A;  4A93 J;  2D45 A;  4N6H A;  2P5L C;  5KYY A;  1Z0X A;  3TKY A;  4CCK A;  4OMY A;  2RSE B;  1TQG A;  1VQ5 I;  3RYL A;  3L2R A;  1AKH B;  2ME6 A;  4LB5 A;  3G1O A;  2O8K A;  4IOA F;  4RA2 A;  2Q00 A;  4EGY A;  5IT3 A;  5FD6 A;  4A3B J;  4RM2 A;  1KZH A;  2Y3H A;  4DNC A;  5FKN A;  1ETW A;  5LGU A;  3DBH B;  2ETS A;  3LA7 A;  3ZTM A;  2E60 A;  1ETO A;  4EM0 B;  3G1M A;  4CH7 A;  4WWC A;  1NLX A;  1HST A;  3DQV C;  4C3J J;  1ORS C;  4CS8 C;  5H6Q A;  4JTA B;  1UG2 A;  3G4Z A;  3PM1 A; 
#chains in the Genus database with same CATH homology
 3S3O A;  1M2O A;  1HA8 A;  1VZ0 A;  3ZVR A;  5T3T A;  2V7F A;  4BL0 B;  3PUB A;  4ZYA A;  3UGO A;  4PSX A;  1WFX A;  5FRN A;  1WJB A;  4XMY A;  2R7R A;  3K4K A;  1SMY F;  3LAY A;  3K4J A;  2CDQ A;  2LYC A;  3S32 A;  4AYB A;  2UWM A;  3VWB A;  2PX0 A;  5F5F A;  3UR3 C;  5HNH A;  3DTE A;  2KL4 A;  3K4L A;  2J0X A;  2M4E A;  3C2H A;  2EIN C;  3K10 A;  4J00 A;  4G7O F;  1MMG A;  1QHG A;  1M2V A;  2VB6 A;  3A4C A;  3F47 A;  2X85 A;  3NRH A;  1Z7L A;  1QU3 A;  1Z23 A;  3HXL A;  4ZTF A;  4D9J A;  2YEV A;  3GOD A;  3V42 A;  3QYB A;  2A6H F;  2W4B A;  3Q7G A;  4O6N A;  4I44 A;  4F4B A;  4N06 A;  4J32 B;  1DQU A;  4RM3 A;  3ASN C;  1S7Z A;  4KC9 A;  4BE1 A;  4NNJ A;  1RJ9 B;  3PFY A;  4BE2 A;  2ZXI A;  3WOD F;  2W9Y A;  3OL4 A;  3K6G A;  3CMM A;  4B44 A;  2FUG 2;  2VL8 A;  4NQW B;  4Q7C A;  4CS7 A;  2W7N A;  2VLA A;  5LD2 C;  3B9Q A;  3G2B A;  4BEH A;  1NU9 C;  4G7H F;  2J9V A;  4PJM A;  3HL2 A;  4YJW A;  4I3M A;  2NOJ B;  3W2W A;  4BJ5 A;  2XF6 A;  5DS4 A;  2X51 A;  3T4R A;  1X1A A;  3EGX B;  4LER A;  3AQB A;  2G3K A;  5KYU B;  4C7O B;  4XLA A;  4HPQ A;  3S8P A;  3H65 A;  1MND A;  2R7U A;  1OCC C;  3N24 A;  3PHF 2;  4LIT A;  2AQE A;  3VDX A;  3LFU A;  3NKE A;  2NUT B;  2WBM A;  3ZR8 X;  3EUH C;  2A6E F;  2W4M A;  3MLG A;  4JCH A;  3DD7 A;  4XKC A;  2KPM A;  2A68 F;  5TGT A;  3LSM A;  3LSI A;  5KNL A;  2XXA B;  3FBN B;  1FTS A;  4N4O B;  3CSK A;  1UEL B;  2WZG A;  2WAF A;  2R7T A;  2LY2 A;  3JRT A;  3SEQ A;  4K7B A;  5IY5 C;  1ZHW A;  2BW3 B;  2V1N A;  2HV6 A;  1OCO C;  5FRM A;  4QI2 A;  3AG1 C;  3O39 A;  2CW7 A;  2R7W A;  2Y0S A;  4HST A;  3S3M A;  4DBQ A;  4CCL A;  3DJN B;  1D1A A;  2LOO A;  3LSG A;  3OYN A;  5KYX B;  3ZG1 A;  5DS5 A;  2Z16 A;  3ABM C;  4KIS A;  3K4N A;  4CS9 A;  4QPO A;  2H7V C;  2A6T A;  2HNH A;  4JOM A;  4II2 A;  3OMY A;  3NYJ A;  5HNF A;  3ZSU A;  4XKV A;  4CA0 A;  1T95 A;  3A1Y A;  3KYL A;  3EH1 A;  2M7B A;  1LVK A;  2WB1 A;  3CP2 A;  4XOR A;  3RTR A;  4BQQ A;  1P9Q C;  2IXN A;  4JUR I;  1YX5 A;  3B0U X;  5DS6 A;  3K4M A;  2H7B A;  1MMN A;  2EIK C;  4OIN F;  4HG2 A;  3ZCO A;  3DKY A;  2OV7 A;  3I9V 2;  2WVQ A;  3H9G A;  3DMD A;  1FFT C;  3NG1 A;  2QKM B;  1TZL A;  2LG4 A;  2DYR C;  2R4G A;  4RLF A;  3OR1 C;  5KHD A;  3EG9 A;  4XN0 A;  3RH3 A;  4OAY A;  2FFH A;  4RDA A;  2GOX B;  1TT0 A;  2AQF A;  2CNW D;  4BS9 A;  1PD0 A;  4G0H A;  1IRX A;  1BR4 A;  3FKJ A;  4NC8 A;  3LL7 A;  4PJL A;  2VKH A;  5T1D B;  2DOA A;  1KU2 A;  3OWT A;  1V55 C;  2HV7 A;  4PJJ A;  2CV0 A;  1UAA A;  2W1O A;  2BE5 F;  4XNF A;  3GAN A;  1LKX A;  3AKZ A;  3EGD A;  2ZXP A;  4XLC A;  4BAC A;  4BE0 A;  2PP4 A;  4NUB A;  4WJ0 A;  2M3A A;  2XF7 A;  1D0X A;  2K5C A;  4R79 A;  4U5G A;  2X6W A;  3D5S C;  2IYL D;  4IWB A;  4F3Q A;  2KQR A;  1S9H A;  4XON A;  1V5E A;  3W3C A;  1ZYR F;  2H7O A;  3AG2 C;  3DZA A;  4JVS A;  2VAS A;  1GLN A;  2WY8 Q;  5DQZ A;  3QYE A;  1WJ5 A;  2HDW A;  1JPJ A;  1PJR A;  1QHH D;  4FAS D;  1SF8 A;  2F5V A;  2IXM A;  3ASO C;  3W2V A;  4YRV A;  4RD9 A;  3OYE A;  3OY9 A;  1Z5Z A;  4CIH A;  5E3C A;  3TBI A;  3ONQ A;  4C2U A;  2LBF A;  2J9U A;  4CS8 A;  1W36 D;  2WA0 A;  2VIX A;  3HPH A;  2PMZ A;  3HKZ A;  4NC7 A;  1ZEL A;  3HG9 A;  5HLT A;  2Q1Z B;  3K70 C;  2CNW A;  4RMN A;  2Y69 C;  2IXP A;  3K66 A;  3EUA A;  3LNR A;  2QTV A;  2VJJ A;  1UG0 A;  2VQH A;  1OCR C;  3EJN A;  4J30 B;  2I8D A;  2K9M A;  3DU5 A;  3H9Q A;  5FRO A;  3BG7 A;  4XM3 A;  2M0M A;  2JA2 A;  2Z1D A;  2PX3 A;  3S29 A;  3RIP A;  3QOD A;  2L9N A;  3VYW A;  3I4U A;  2IXO A;  2V6E A;  2DGJ A;  3N2Z B;  3K1H A;  1J8M F;  3Q7L A;  2DXI A;  2E1M B;  2J7P D;  4E4H A;  2J0W A;  1FMV A;  3K4C A;  3MMY B;  3LLI A;  2E5N A;  3TMO A;  4DGW B;  4JZA A;  4U5C E;  5D92 A;  3SEO A;  2WAQ A;  3OIP A;  4XLP F;  3NKD A;  3HLZ A;  3HC7 A;  2X6X A;  3ZRG A;  1O87 A;  3E0J B;  3SYN A;  4CSA C;  1SFK A;  4XR6 A;  2L5Q A;  2MD0 A;  3LMM A;  3L2V A;  3K33 A;  2LH9 A;  5FCL A;  2O5R A;  1D1B A;  2YZS A;  5HSW A;  3UMH A;  3A2K A;  5HOO A;  2DJI A;  2J9W A;  2ZXO A;  3NWT A;  3DJU B;  3QOE A;  3U21 A;  1YX3 A;  2CV1 A;  2D5R B;  1Z6A A;  2JD3 A;  2KGO A;  4O7G A;  2EIJ C;  3PNV A;  3OYJ A;  3SYT A;  2J7P A;  1RJ9 A;  3E9V A;  3RKO F;  2JSP A;  3LLK A;  4KJZ A;  3FAJ A;  4XLH A;  2OUM A;  4U5F E;  4KT6 A;  4DIQ A;  1PCX A;  4CUG A;  2WL8 A;  5EGY A;  3I5P A;  2Z15 A;  3POV A;  3OYD A;  3MX3 A;  2R7O A;  2L2O A;  1K6Y A;  3SP1 A;  1LS1 A;  1ZHZ A;  3K6B A;  1BR1 A;  3PNY A;  3S93 A;  4MQ9 F;  2KHM A;  1QLE C;  5DVW A;  2ZPA A;  2KDO A;  4HSR A;  4BDY A;  1Z3I X;  2Q2E B;  3DM9 B;  3EHN A;  3JYH A;  4F52 A;  3VSL A;  3RFY A;  3OL3 A;  2C03 A;  2KJG A;  2CUJ A;  2NUP B;  4EAT A;  3EGX A;  3DTK A;  2WAE A;  4OIR F;  5KYU A;  3JSZ A;  3OYL A;  1LDK B;  3EFO B;  2PJR B;  2CMP A;  3UNG C;  1TR2 A;  4BJ1 A;  2WAD A;  1JI8 A;  3OS0 A;  2O9X A;  3HOS A;  2NUT A;  2WB7 A;  4DJA A;  4GEH A;  2ZSH B;  3SDB A;  3DAF A;  4AK9 A;  2JVG A;  5HVQ C;  5CI9 A;  3BG6 A;  1EA3 A;  3ZQQ A;  2DYS C;  2IS6 A;  2XXA A;  2LRD A;  3MD2 A;  3OYA A;  3S28 A;  4IQJ A;  3H9J A;  4EWC A;  3OYC A;  3VYT B;  4U87 A;  3GBG A;  1VOM A;  2BW3 A;  2KRH A;  4XQF A;  1SAU A;  3LS1 A;  2OG2 A;  1D0Y A;  3E70 C;  3FHN A;  3MKW B;  5KYX A;  3DWL E;  3SEZ A;  3EZH A;  4CBE A;  4QPQ A;  4N4N B;  3NYM A;  3FHD A;  3X1O A;  2MAB A;  2E87 A;  2HVQ A;  2MYS A;  4BDZ A;  4IX7 A;  4XKB A;  2VXD A;  4OAZ A;  1OLT A;  2X6Y A;  2P0W A;  4I1M A;  3OS1 A;  3OYK A;  4FWV A;  4E7J A;  3OA1 A;  1OR7 C;  3C2G A;  1WJD A;  4ITV A;  4Y33 A;  3VYR B;  2IOQ A;  2GOM A;  2KQ9 A;  3K70 D;  2R7Q A;  2CGE A;  2Z2S B;  1R6R A;  4BG0 A;  4F55 A;  4OD5 A;  3KEY A;  5T3W A;  5KYN A;  4Q5S F;  1BR2 A;  4QDL A;  4MND A;  2V3C C;  4HFK B;  2L9J A;  1WJF A;  2J46 A;  1DGW Y;  2MC4 A;  3IUO A;  4KBL A;  3I5Q A;  5D91 A;  2W82 A;  2FGY A;  2XL4 A;  3IAS 2;  1N77 A;  2LRE A;  1D0Z A;  2DT7 B;  2JVH A;  2VXZ A;  3N05 A;  2HVR A;  1N1C A;  4BJ6 C;  2P6V A;  3DM5 A;  5CKT A;  4ZC3 A;  2HVS A;  3JT1 A;  4XN3 A;  2OC6 A;  2Q3T A;  1NG1 A;  1VMA A;  4ZTJ A;  2CW0 F;  2EIM C;  2I8B A;  4F91 B;  1M57 C;  2LSE A;  4QI0 A;  1Z3X A;  3D5L A;  4E7Z A;  2XRH A;  2A5W A;  3IEE A;  3H5N A;  4O6Y A;  4O79 A;  3CZ6 A;  4CCM A;  4DVY P;  2NG1 A;  1TWA A;  2XF5 A;  2F6C A;  2XAU A;  4E7K A;  3EZI A;  2RQQ A;  2X1C A;  3BC8 A;  4AX2 A;  3M1C B;  2HPI A;  4C30 A;  3FVY A;  2KW3 C;  3KL4 A;  4Q4Z F;  2W45 A;  4YWQ A;  2HU9 A;  2QKL B;  2XDV A;  3OYF A;  3DEE A;  3S27 A;  2X1E A;  2RNG A;  2L7K A;  4P1W A;  4AE4 B;  4XKW A;  2IGK A;  4KIT B;  1V5G A;  2VQG A;  4P5O A;  5KYY B;  1Z3Y A;  3OYB A;  1PD1 A;  2L9S A;  3OS2 A;  1KON A;  4XOT A;  2VQC A;  1FFH A;  4XLE A;  2XSE A;  1VK5 A;  3PSI A;  3OR2 C;  4IZZ A;  4W8K A;  4YT4 A;  3L0I A;  3H0D A;  1N75 A;  2Y3B A;  3PMR A;  2E5Z A;  1ZU5 A;  4D1Q A;  4HEA J;  5KYW B;  3DPT A;  3HTK C;  1G8X A;  4HNU A;  1NU7 D;  5L3V A;  3W8I A;  1MNE A;  4XWJ A;  3AFH A;  3DTI A;  3NWS A;  4ZDO A;  4B6I A;  1ERD A;  4DVZ A;  2ZXW C;  1DGR M;  4B3X A;  3TD7 A;  1IW7 F;  2HZD A;  2VJ5 A;  3FDY A;  4BJT A;  1LFP A;  3L2W A;  2VKD A;  3Q6M A;  3L2Q A;  3HOT A;  3HUG B;  4X0G A;  4BU2 A;  2ELJ A;  4CSA A;  3F46 A;  1OKK D;  1DP3 A;  2LY1 A;  4E7H A;  2CV2 A;  4HFF B;  3DPL C;  2F4I A;  2M4K A;  2E1M C;  4PFP A;  4YEL A;  4ZDP A;  3L2U A;  3M8J A;  1TKN A;  1WJC A;  3KH2 A;  4RBN A;  3DLA A;  3DPU A;  3T6J A;  3D5R C;  3ITF A;  3AL0 B;  2KZV A;  4XOP A;  3LJB A;  1ZHY A;  4KI2 A;  4XTK A;  5CQE A;  1FMW A;  3EPV A;  2CUZ A;  2ZXR A;  4LLC A;  4DOZ A;  4BQO A;  1VYI A;  4ZLC A;  4ULW A;  4Y4R A;  4IJJ A;  5L3Q A;  1MMD A;  1WJA A;  3I3L A;  3ABL C;  5E3A A;  3AL0 C;  2A1D D;  2Q9B A;  5EHH A;  3K7D A;  5F5H A;  2IGO A;  1M2V B;  4FES A;  2BOL A;  4LIU A;  2M4G A;  2RRE A;  1VYK A;  4NY3 A;  2ZFU A;  3OEO A;  3HJC A;  3OIQ A;  5KCM A;  2KRC A;  3RQ4 A;  5CQG A;  4CZC A;  3WG7 C;  3UMK A;  1TWH A;  3FDQ A;  1U0J A;  1O5H A;  4ZDL A;  2V26 A;  3CF2 A;  1OKK A;  2Y39 A;  2B0J A;  3MKY B;  4AU7 A;  3K1I C;  3VYU B;  3OYM A;  2YHS A;  2MWQ A;  2Q9C A;  3DAG A;  1W36 C;  2C04 A;  4C3D A;  4ZJZ A;  1PYV A;  1JPN A;  2PFD A;  3LEV A;  1N78 A;  2IS2 A;  2CW8 A;  3OYG A;  1TWG A;  1NZE A;  4U5E E;  2V4J C;  1X1C A;  3RSN A;  1ZHT A;  4LLE A;  4PJN A;  2W00 A;  3S3N A;  3X2Q C;  4BEH B;  4U5D E;  4B47 A;  5E2Q A;  1ZHX A;  4LG3 A;  3BCB A;  2WZL A;  1V54 C;  3PNT A;  4ANJ A;  3QZC A;  4C7O A;  4FET A;  4ZLD A;  4XL9 A;  3LSK A;  5B1B C;  1J8Y F;  4C3B A;  2XC7 A;  2LC2 A;  2IGN A;  2IS4 A;  3BCA A;  2QY9 A;  2VH3 A;  4LAC B;  2Y3D A;  2NUP A;  2G3V A;  3LS0 A;  1SZI A;  4IKF A;  3T6B A;  3UMI A;  3S0X A;  4G6T B;  1X4O A;  1TWC A;  4OD4 A;  4Y3O A;  3EQL F;  3CJR B;  4G7Z F;  3EFO A;  2PJR A;  3ABK C;  2CFO A;  3IAM 2;  4U7B A;  4HE8 D;  3NDB B;  2W4S A;  4E7L A;  2OCC C;  2PF4 E;  1X4P A;  2A69 F;  3VYS B;  4BJ5 C;  1QZX A;  4YT8 A;  3OYI A;  3FBI B;  4GRI A;  4CCJ A;  2K3P A;  1Y56 A;  3BLY A;  3TL4 X;  3OYH A;  2J45 A;  3VAY A;  1X1D A;  4F92 B;  3PSF A;  4OIP F;  2M7A A;  3EH2 A;  4OWR B;  2HPM A;  5DQT A;  1G59 A;  4CCO A;  1ST6 A;  5E33 A;  2Y3G A;  2HQA A;  4XLN F;  4PK4 A;  3SZR A;  4OIO F;  1MW7 A;  4MLO A;  4YT2 A;  2V9K A;  4A2N B;  1BOB A;  2KMU A;  3PL8 A;  2IGM A;  5JHF A;  2ZSI B;  2R7V A;  3CJQ B;  2G62 A;  3J7A Y;  2BVL A;  3DXJ F;  4JW1 A;  4K0D A;  5BUO A;  4B48 A;  3H5A A;  2EIL C;  5LFA A;  1M56 C;  2DCE A;  4RLQ A;  3H35 A;  4II3 A;  1J09 A;  3V7O A;  1WJE A;  2WY7 Q;  2VJI A;  4PSW A;  4AE4 A;  4BXF A;  3K4B A;  4DBR A;  1Y6I A;  3ZC4 A;  4E7S A;  1V5F A;  3ZXS A;  1Z63 A;  4CS9 C;  1Z21 A;  3L34 A;  4C3E A;  4BJ6 A;  3OOU A;  4M63 A;  2DT6 A;  4H4K C;  3N0T A;  3CP8 A;  3ZIB A;  3NYL A;  1NG7 A;  2KLO A;  3CES A;  3F9K A;  4BUP A;  4BEJ A;  3EG9 B;  2VPL A;  1W2W A;  4U5B E;  3LES A;  4P6I C;  2CH0 A;  5CPR B;  2BVM A;  2K9L A;  2IXS A;  3KMI A;  4IRU A;  3EPZ A;  3LSH A;  4PFO A;  1WGW A;  3QYF A;  1ZU4 A;  3CQZ A;  4JQF A;  3MKZ A;  4FX5 A;  4YEJ A;  3UGP A;  4HEA 2;  1X1B A;  2KP6 A;  3EHM A;  3VSK A;  2UV1 A;  4J01 A;  4YT5 A;  4B43 A;  3AG4 C;  4YN0 B;  2WVN A;  3EGD B;  4EBB A;  2UUZ A;  2JUG A;  2X1D A;  2ZXH A;  3IP4 B;  3W2A A;  1E0E A;  3AG3 C;  4JJG A;  4OIQ F;  4E6K G;  1OCZ C;  3W8H A;  4AVZ A;  4BGD A;  3M1C A;  2KNH A;  2VJ4 A;  3H5R A;  4IAO A;  3DU6 A;  2WZF A;  3PJR A;  2VQL A;  3ZGK A;  2R7X A;  4XLF A;  3JCU Q;  1YE9 A;  4C2T A;  1X19 A;  4U5H A;  3HPG A;  5B1A C;  4E7I A;  1NG6 A;  4CCN A;  4O6M A;  1D1C A;  3QMK A;  4GYT A;  1AA7 A;  4BQN A;  4KNV A;  5KYY A;  4PUS A;  4C9Y A;  4CCK A;  3B0P A;  4JJF A;  3B0V C;  3EUK L;  2L81 A;  3RYL A;  3L2R A;  5DLJ A;  2LBF B;  2R7S A;  4HRI A;  4X0R A;  4LIV A;  3SZG A;  3KKB A;  4F93 B;  3Q6N A;  2P7V A;  3SNH A;  3DKX A;  5KYW A;  4IQ4 A;  3RCO A;  5B3S C;  4RM2 A;  2IS1 A;  4HNT A;  3KX2 A;  2Y3H A;  2MFZ A;  4CSW A;  2Q9A A;  3O6X A;  1T0F C;  4KNW A;  5CI8 A;  2E60 A;  3AQC A;  3E1S A;  4CH7 A;  3RPU D;  2GFH A;  3DQV C;  1IZM A;  1MMA A;  4I1O B;  4CS8 C;  2CS3 A;  2WVO A;  3ECS A;  2XSJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...