4BJTA

Crystal structure of the rap1 c-terminal domain (rap1-rct) in complex with the rap1 binding module of rif1 (rif1-rbm)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
152
Chain Sequence
DFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords DNA-BINDING PROTEIN RAP1
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 52
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bjtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bjtA01
3CZ6A 3K6GA 3OWTA 4BJ5C 4BJTA 4BJ6C
chains in the Genus database with same CATH superfamily
1MBEA 3HSFA 2GXAA 3C3WA 1UHSA 3ERMA 1W36C 2Z1DA 2AS5F 5L3VA 1WVRA 2V1DA 1SAUA 2JA8J 1V4AA 2A1DD 1DOVA 5B3SC 4NB5A 2P7CB 3JAMK 3B73A 4XORA 1ZRCA 4ZH4F 5J8CA 4LITA 1UZCA 1SVMA 2DOEA 4EATA 1RR8C 1JRAA 1YYJA 3OEOA 4MS2A 1LNWA 4XEVA 4EBKA 2L02A 2PG4A 4N0BA 4Y4RA 2R03A 2HOAA 1IN5A 3RQFA 5E3MA 2O7OA 1XG1A 3O8HA 2VJIA 5HNFA 1ZHZA 2VQGA 4A6DA 3O6BB 2VCBA 1ZG5A 2XLMA 1XGOA 1AU7A 3WHNA 1T0FA 1GVDA 1Y0UA 4RGSA 2DA1A 3N05A 5GPAA 1DDNA 3W2AA 1HMDA 2AU5A 2LD6A 3LAYA 1REPC 3SYNA 3RIRA 2R4GA 2ADUA 4OD4A 4U0WA 2EPMX 2PEXA 4KUMA 2LBFA 4E7ZA 2VH3A 4RD9A 1E0EA 2KL4A 2CV0A 2R93J 1ERDA 2JPBA 3FZVA 3O8GA 4YJWA 3RPUD 2NG1A 4MVOA 2R7DA 5F0FA 4B09A 2WVNA 3TW6A 4A3FJ 3U9MA 1MNEA 2K85A 1HBXG 1F43A 4JE9A 1JE8A 1EQ1A 2J7PA 3E5XA 3R2PA 2L7FP 2D5RB 3C62A 4LK0F 3J7AY 4BEMJ 1MH3A 3K1IA 3G2BA 2COBA 3A03A 3A01A 3IUOA 3GFLA 4PGGA 4I1MA 3H5RA 2Z3YA 2O9LA 2LC2A 3AKZA 2BEOA 4S04A 3DTIA 3GTQJ 4XWJA 2BV6A 3TOAA 3HB9A 3T6BA 2UXNA 2J9UA 2KISA 1OQCA 1MMDA 2HU9A 2LY1A 2NAZA 1S6LA 4PJNA 5CVRA 5BQTA 2KNHA 3SFZA 1XSXA 2EPLX 1O57A 1BI1A 4WXDA 4S0HB 2WAFA 4B4CA 4A3CJ 5F1JA 3OSGA 4S05A 4Y13A 1AKHA 3JSOA 4HNTA 1W4MA 2K9SA 2QM3A 3JREA 3MYFA 4X0RA 5COMA 1PYVA 2DN0A 3H35A 2JRTA 3DCFA 4XR6A 4JIOA 1A36A 4MVZA 3BLYA 1A0BA 3DKAA 3IC7A 3PNTA 4C2UA 2L9SA 2JVGA 3ROUA 4HX4A 3RKQA 4IHSA 5C4XJ 1KQ8A 1KYWA 3OYEA 3U2LA 5JS5A 4RA2A 1YQAA 3HL2A 4KN4X 2QZ8A 2XPUA 3C18A 3BZCA 2M0CA 2DDBA 3PHF2 2VQHA 1RC9A 1T0FC 1SZIA 1VQLI 3HJCA 3OYIA 5CYVA 4DZPA 3LSTA 3REOA 1TLHB 1JAFA 1Q1VA 3ABMH 4UNOA 2G9WA 2ZCWA 3RZOJ 2OQMA 2Y48A 4ZLDA 3H92A 3RPQA 2H1LA 4DJAA 4IO9F 3HOSA 2EILH 1RKEB 2XC7A 2IA0A 2OC6A 1E2XA 4M6XA 1QZXA 3SZPA 3T6GB 1V5EA 2EINC 2MLKA 4CS7A 1LE8A 3K6GA 4EM0B 5JLXA 1G4US 5BQIA 1ZG1A 4V19K 1RETA 5DQTA 4B1RA 3A1YA 2DQLA 3W2WA 3K1IC 3UGOA 3OS2A 3PFIA 2GWWA 1T9KA 4IEJA 3VWBA 3WGGA 2J8WA 5KYYA 2WZGA 1BR2A 3DWLE 3S3MA 2DK5A 4PSXA 3RYRA 1A7DA 3EG9A 5L0CA 2ZJRF 1BN5A 2CV2A 5A6BA 3G50A 2LR8A 3KCCA 1R1UA 3OOPA 4CUGA 3FHZA 1B68A 4D1QA 4D4XA 4O6NA 2K4JA 1RKWA 2EA2A 2HOEA 3O2PE 1WH7A 4DGWB 4GDFA 2W00A 2HZTA 3CMMA 1EA3A 1RESA 5HOOA 1HY5A 5GTIC 2PF4E 3OIPA 5C44J 2EZLA 5M5YJ 2C03A 3BPXA 1Y1VJ 1K7AA 3S1NJ 2NVQJ 1YE9A 2E34A 2J9VA 2R05A 2LFFA 3HSEA 2NPUA 4DXWA 5HV9A 2KZVA 3EYYA 3O39A 2H94A 1J0RA 2K02A 3FDYA 2M1BA 3QODA 2RAEA 3OYDA 2OBPA 3KPHA 2VUMJ 3S16J 1NBBA 5FZTA 4CJGA 4D5CA 1WN0A 3EUHA 1XN7A 2BY3A 2LDUA 1FTTA 1OCCC 1OXBA 1WOLA 2HV7A 1WJCA 2D5VA 1MMSA 2KIMA 3GTKJ 4FESA 4NDLA 5AIQA 4JURI 2Y30A 4I44A 2VKDA 2K9QA 3FWEA 4I2OA 3C7JA 1T6UA 4Y15A 1J8MF 1Q0FA 4RAYA 5F0CA 4JTAB 5FCLA 5HSWA 4HE8D 3M8JA 3NYJA 3TULA 4UXNA 3PM1A 3CUOA 3ZG1A 1JUSA 4J00A 1ZVZA 2HYJA 1IJWC 1OCRC 3MX3A 3CP2A 2Q9AA 4ON0A 1ZRFA 1U0BB 4MEXF 2GM4A 5BNGA 4R1HA 4EV0A 3I58A 1APCA 2XS1A 2DI3A 1WTYA 3LFKA 1SFEA 4C3IJ 2R02A 3HOWJ 2W24A 3ZQCA 3N97A 3QVZA 1BIBA 1QQ3A 3Q0UA 5T3WA 4I0AA 5DYMA 1ZK8A 2VJ5A 1DU0A 1E3HA 3GM2A 2HJMA 3OIOA 2COMA 5E1WA 3L8JA 3LAJA 4B47A 2IGOA 2WAQA 1JTYA 3QW1A 2JPUA 3ABUA 2ZXHA 4ESBA 4K1OA 3POVA 2AO9A 4J01A 3P9KA 1WASA 3X2QH 1POGA 1Z91A 1NG1A 1G4WR 2K4BA 1ZU5A 4HDVA 3VYWA 5B1BC 4P5OA 4ZDPA 3LQQA 4NC8A 2J0WA 4LG0B 4KYWA 3Q9SA 3V7OA 2UUHA 2VKVA 3RVYA 3MZYA 2W4BA 3I55I 1HW1A 4HNVA 5F0HA 4R32A 2CQKA 3ZOBA 2CW7A 3TD7A 1T08B 2L6HA 3EZHA 4IPAA 3AG3C 4BJ5A 5JVTA 1B1BA 3HZJA 2VB6A 4UVCA 3RDIA 1MBHA 2F2EA 1HA8A 4NQFA 2HEOA 3ABKC 1OXKA 4XM3A 1OYYA 3F22A 2IP2A 3CCUI 1ITYA 3N24A 2QE9A 2H7BA 3F3XA 2JZYA 4CICA 1YRNB 4EHPA 2M30A 3CUQA 2QSHX 3SJMA 3EUHC 4CCJA 1JKOC 2E7XA 4ITVA 4BXFA 3GLXA 2DXIA 1IUYA 2VCCA 3B6CA 1M2VA 3WE2A 3I4NJ 2GIZA 2HFHA 1C02A 3P7NA 1ZTRA 3FAJA 4EJWA 1M2OA 2YX4A 1SEUA 4C3JJ 4E7HA 1M56C 4PFOA 3IP4B 3M4OJ 4AL0A 1H0MA 2R5YA 5E3OA 1SD4A 4PK4A 3U5SA 1S72I 1JKPC 5D5WB 4BE2A 4J32B 3US6A 4UDVA 2FD5A 2EZKA 4LIVA 1TL8A 2IRFG 2LIGA 3ZQVA 3GEHA 2J45A 4V2GA 2AVKA 4FQGA 1G59A 3ULQB 3I9V2 2R9RB 1G3SA 1TQMA 3R4KA 4BACA 2LF7A 2VIXA 1JPNA 1VB5A 3ASOC 3WG7C 1Z05A 4XN0A 2QBYA 1U89A 3CDHA 4XLAA 5FGMA 3AG2H 2YS9A 1IAWA 4E17A 4L5IA 4UUVA 1FSHA 3K10A 3HRTA 2PX9A 2W57A 4MW8A 1S3JA 3FHDA 5ILUA 2IS1A 2ZB9A 3KFWX 3M4CA 5LEJA 2WV0A 5B3SH 3L2RA 4L18B 2YQYA 3HOUJ 1WWXA 4AVZA 3W3CA 5T3TA 2DYSC 2LVSA 2XAJA 2UZKA 1LI5A 2NS0A 1R4MB 2P5VA 5LD2C 2RD9A 4DYQA 1CGNA 3RCOA 4BJ5C 3DMDA 2DGJA 3SQNA 1X4OA 3BR2A 3FMRA 1G3TA 3O3KA 3LSGA 3QOPA 3VYTB 4CX9A 1K83J 3KZIC 3FDQA 3GM1A 3JYYA 4RGUA 4U87A 3CUQC 2FNAA 3HUGB 4XLPF 1TWGA 1QO0D 1Q0MA 1KONA 2PJRB 2KLOA 2Q9CA 2ZXOA 3I4UA 4FASD 3FHNA 4W1UA 3TP0A 3I56I 2E1NA 2OUMA 2CFXA 2HQ5A 4JEAA 2P7VB 4N6HA 1R9TJ 3L2WA 1FR0A 3EFOB 1OR2A 5BMZA 3AL0C 2XRNA 2N8GA 4MQVA 2ZXIA 4RGXA 5DEQA 3LWFA 5KAIC 2L2OA 3WU0A 1NU9C 4WJ0A 3ATPA 3FXLA 1OW6A 4LOCA 3C63A 3MEXA 2GAQA 3HGGA 5DV5A 4B3AA 3WE3A 4JOMA 3OYJA 4HV5A 3LA2A 1ZKGA 3L09A 4AC0A 1VF9A 1JGGA 2KJGA 3A02A 4JEBA 3OWTA 4IJAA 2CO5A 1FC3A 2HXIA 2L01A 2ZJ2A 3DJUB 5DLJA 3TK0A 1XZPA 5D4SA 1I6HJ 5EF6A 5FLVA 1XB4A 2A05A 2F5FA 4XLEA 2NNNA 4XSXF 2VC1A 3GANA 2M8GX 2XKPA 2F22A 2K86A 1HKQA 3E0JB 3P9IA 2HOTA 3Q5FA 3ABTA 3CCLI 1W0TA 1YIOA 2YU3A 3C8GD 3J06A 2BXYA 1R00A 1E84A 1CPRA 3FXOA 1JKQC 2JD3A 1A6IA 4ULWA 5FJ8J 2DA2A 2KW3C 1Z77A 2A61A 2MD5A 1LB2A 1FY7A 2ACJA 4OIQF 4AWXB 3I5QA 1TW3A 3OYHA 1LEBA 2RQQA 4RB3C 3WTXC 3WU1B 3R0JA 3V5YA 2V9VA 1X1DA 3OYBA 3LSMA 3TW7A 3BP8A 4IKFA 1PUFB 4NQWA 4E7KA 3GXOA 3I53A 4Y7NJ 4N06A 1HW2A 4RDUA 4RB0A 3E70C 4A3BJ 1VOMA 3KH2A 5K5QA 4X0GA 3I3LA 4ZJZA 4U9DA 2CQNA 2E2HJ 1FYMA 5IYBJ 1YJNI 2Q2EA 1E83A 1GT0C 2MYSA 2CV1A 5AGFA 2HWVA 1BOAA 2EINH 3TGNA 1UHMA 2TDXA 1OKKD 2VQLA 2HI3A 2I15A 1R5GA 5KCMA 5J4VA 1K6OA 5HVQC 5JVEA 1DGRM 1UG7A 3L00A 2VKEA 1ETVA 2P8TA 3BG5A 4XKBA 4CSWA 1R49A 4M6VA 2IS6A 2IXSA 3CCSI 2YLDA 2H8WA 3LOCA 4X1EA 4YIFA 1SFXA 4I7HA 2CQXA 4R79A 2D45A 2LNBA 1NK2P 1A5JA 2EJRA 2GOXB 2J46A 5FROA 5CVUA 4M6YA 4J30B 3PL8A 2VC9A 1U5TB 3OMYA 5DCMA 5KK1A 1TFKB 4A3JJ 2KQ9A 3ECOA 3A0HC 3S29A 5A2QZ 4HFFB 3DM5A 1Z1DA 2CUEA 5L0HA 3MFNA 2FOKA 4XEFA 3K4JA 4UUTA 5DD8A 4ZYAA 3PUBA 5JVGF 3V7SA 3HLZA 4LLEA 5FD6A 1QVTA 1RIOH 3EUAA 2PFDA 3L8IA 2RGVA 2V3CC 5GAGJ 4M3FA 1ZREA 2EV6A 3Q6NA 1N25A 2A69F 2PMZA 3ZQQA 3PIOF 5BPDA 2O8KA 2YU9J 1ZW3A 1TFOB 2V4JC 2R7SA 4BNCA 4ONSA 3S27A 2OJED 2V9KA 4DVZA 1SANA 1OCOC 2YSRA 1K6YA 3ZMZA 4GRIA 1QVXA 2YL7A 3ABLC 3ZPLA 3M4BA 3CEXA 5EGYA 2IM8A 2ID3A 2IBFA 3QYEA 1KGSA 2AWYA 2E87A 5J1UA 4IOCF 3M1CB 5HLIA 1V54C 1ZW2A 4BHCA 4F3QA 3ZRGA 5EEAA 2F48A 4KICA 3RSNA 1J75A 1FFHA 2XPVA 3FXRA 4A5NA 4A3EJ 3S1QJ 4BQQA 3G4SI 1J9IA 4JJGA 1RNLA 3OS0A 3QRFF 1K05A 1BI2A 4F52A 3TO7A 1FZPB 2W45A 2OOCA 3BR3A 4BQAA 3UNGC 1W5CC 4HNUA 1IC8A 5D91A 4YIRX 4L9JA 1P7IA 1QSPA 3E1SA 2PJPA 4BDYA 2YWAA 1NFNA 3H2UA 1WZ2A 3SXKA 2KIFA 3NRHA 2GOMA 1FFTC 3S90A 1SMYF 3DAGA 3CC2I 4NC3A 2K9LA 4CDVA 2W84A 1JUMA 3GUDA 2IEKA 1O5HA 5B1BH 2CNWA 2ZPAA 3DWWA 2XGCA 3A4CA 1TW2A 2YKZA 1P9QC 3Q9VA 5EG0A 4D7MA 1I50J 2DOAA 2R3SA 3CESA 2CGPA 3OS1A 4I76A 1XCBA 3DP7A 1G2HA 4M74A 1H7IA 1SD7A 1STZA 2M87A 4CCOA 5ED4A 3K66A 1OW8A 3JRCA 1BW6A 2OU2A 1Y4CA 3AG3H 4EEFG 2PLYA 2XF6A 4XPXA 1ETYA 4JTCB 5KYNA 2Q9BA 3O6XA 2OZ6A 5B3IA 2KKOA 5T1DB 5D8LB 2DA5A 1R5HA 3X1OA 3RI4A 2K27A 3E5UA 5H2FC 1M57C 1DP3A 2H6BA 2IGNA 1F36A 2E5NA 2NOJB 3E3VA 1O7LA 3HDDA 3GYHX 1D5YA 1Z67A 2QCOA 1LDDA 1HXDA 1AVOB 3SZRA 5DQZA 1AUEA 2J9BA 4FTHA 4LDKA 3K0LA 2OPTA 2KRCA 1DQUA 2IBDA 4EM2A 2WB7A 2OTLI 3D5RC 3J7AO 4ZLCA 1JPJA 4XRFA 1N75A 3MLGA 1WI9A 2IXMA 3COAC 3FXQA 5HLTA 3SZTA 1LFPA 1OQYA 1XSVA 1RZ4A 2E7WA 3HTKC 3DAFA 1X4PA 3AOUA 1CF7A 4G6TB 3NWSA 2P81A 4JYKA 3OYFA 4G94A 3GTLJ 3IQCA 2HYFA 3FXMA 3RPUA 2ZXJA 4MNUA 4U5DE 1BOBA 3NARA 3ZTMA 3WHCA 3C1DA 4L6RA 1MNDA 4DBQA 1I5ZA 4KFCA 3FMSA 4ZDOA 4U5FE 4AIKA 4UVAA 4FCYA 2ECBA 3GX4X 2F5DA 2L81A 3V8LA 4KA4A 1JHHA 4YFNF 1LIHA 2PX3A 4RLFA 3RYPA 2XDVA 5JFRA 3H0GJ 3RQGA 2M4KA 2F5VA 1EF4A 1HLVA 3BG6A 1UHWA 2M8EA 3S9OA 3JCUC 2XM0A 1XGNA 2CQQA 3OOUA 3ZQLA 3ZQ7A 1IF1A 1LPEA 2I8DA 4HDUA 4KMFA 2Z2SB 4KIBA 1OMIA 1VQKI 1B6AA 1UB9A 3K4MA 1XPXA 3B9QA 4QTRA 1FTSA 1YA9A 3KP2A 256BA 2GWRA 4I0BA 2F5CA 3Q0VA 2IA2A 1G8XA 3ASNH 2WC2A 2FRHA 4C7OB 4H0EA 1M1EB 4ANJA 1QZYA 3KEYA 3N2ZB 1Z7Qc 3K1HA 2LY9A 2VC0A 1IRZA 3UMIA 1XMAA 2GAUA 3DKWA 1MMNA 2X0CA 4C30A 1XMKA 5JLWA 1ZHFA 2VJ4A 1R4TA 4BEHB 1BBHA 2WV1A 5J3LA 5J1YA 1FSEA 3CAXA 5E1ZB 5J4YA 3D5LA 4XKWA 3RJPA 3JSPA 4NTAA 5L3CA 2DK8A 2JTVA 4YEJA 2ZMEB 3K4BA 5B1AC 3W8HA 1SR2A 4Y17A 2X1DA 3NMJA 3SNHA 2L4MA 3PJRA 2LF8A 1Z23A 2MC4A 4N6CA 2QVOA 3DJNB 2HDCA 2LTPA 1D1CA 2A3SA 4QIWN 4NUBA 2FAPB 3BTIA 3ZC4A 3MZ8A 2CWEA 3J7YJ 1ZN2A 3FXJA 4Z6YA 3CJTB 2D4UA 4IHTA 2HZDA 3WTWC 2CMPA 2UV1A 4E7SA 1TC3C 4AX2A 3IH2A 2HXOA 4RB2C 3HEFA 5A2QK 5KYWB 3C2HA 4H54A 3I59A 3HM5A 3KEOA 1JT0A 1I6XA 5FKMA 4ZC3A 3R0AA 1K04A 4A3DJ 6PAXA 1Y8RB 5E8IA 2GA0A 2HJ3A 1BIAA 1O4XA 4LLNA 4U5BE 2W4MA 3W2VA 3ZWIA 2QYOA 5JT4A 1JT6A 2R7RA 3U1KA 2GA2A 3G3ZA 1P2FA 2NSFA 1QBJA 2O3FA 2X51A 4F93B 3LUTB 1YJGA 2DCEA 1Q0DA 3S8PA 1F1ZA 1SVLA 1KA8A 4C3HJ 2NNYA 3FK6A 2KIQA 3B6AA 1IZ1A 4DRIB 5CI8A 4YL3A 1TNSA 1YZAA 5L0JA 1TWGJ 2NXNB 3VM6A 1I1SA 4UUSB 5CJ9A 2KFDA 1RI7A 3ZMUA 3ZSUA 3VODA 1W36D 1A6QA 3CJQB 2B63J 2ASRA 4YIIA 4HYEA 5ICEA 5AONA 2G3VA 2VQCA 4OAZA 2HVSA 1KU9A 2HDDA 4LG3A 4HF1A 4XQ1A 1FYKA 3S1MJ 1WJ5A 1FOWA 5FB2A 4U7DA 4A12A 4XLNF 1O3UA 3JRDA 3BEHA 1YOVB 1WH5A 2CJJA 4DJ9A 2Y0MA 4XLFA 3ZTZA 4D4NA 2QA4I 1FBQA 1B72A 1EH7A 1ENHA 1YX5A 2FBKA 2VLAA 1SF8A 2R5ZB 2HTSA 2FMYA 3K69A 4FT8A 4N4OB 3BG9A 1FWZA 5KAFC 2KC3A 3AG1C 4M73A 1OCZC 3GF2A 5D4RA 4MEYF 4RAGA 2LYCA 4AU7A 2EPOA 4R8HA 3S3NA 2OU6A 1WPKA 2XXAB 2UUIA 2XAGA 1HKSA 3BQYA 3K4NA 2JA5J 1I4YA 5JHFA 2B9SA 2CDQA 1R4NB 2F6CA 3TJ5A 1UG2A 3VFZA 1V55C 1P4AA 3AGUA 1E85A 3RW0A 1J8YF 4CIHA 3V5XA 2ZJQF 1N1CA 4FE4A 3EPZA 3Q7GA 3KE2A 4LFUA 1G4DA 2M7BA 2W1OA 4YRVA 1DPUA 3V42A 1OJLA 1LFUP 3DKXA 1EH8A 3M79A 2CW8A 4BE0A 3FOOA 1FYLA 1HMOA 4L9NA 4XNFA 5KYUB 3JRMO 3RTRA 4LK1F 3W6JB 3VF0A 3NRVA 1K78B 1M6TA 2L6GA 3F46A 3IHUA 3FX3A 4N4NB 2YX7A 3QQAA 1T6IA 2BYVE 2VOPA 3H3UA 2X48A 2XLWA 3IKVA 3FISA 5IP9J 5IT3A 1YW8A 3GFMA 5FD5A 2VBXA 5K5RA 3M3YJ 1XCVA 4D5FA 3OYNA 1VYKA 4KN7X 3JR9A 5HLGA 3DPLC 5CPRB 2STWA 4A3KJ 1JR8A 4M3BA 4RM2A 3IV5A 3PQKA 3L2VA 2LG4A 3GZ6A 5LBQA 1D0XA 1YFHA 4LERA 1O3QA 1JI8A 4HW0A 5GAHJ 1U6HA 3PUFA 3DPUA 3GFIA 1V54H 2LLKA 3VB2A 4DQ2A 5BQHA 2OCCH 3EYIA 2V1NA 3CSKA 1K40A 3B71A 5D92A 2ELHA 2YRFA 3DBRB 2ZXWC 1OCPA 4EIYA 1J09A 2RC4A 3CO7C 1MSFC 2MHRA 2LKPA 3RKYA 2YL0A 3BQZA 1ZZPA 1OPCA 4Z2YA 5JLIA 2RNJA 3ZDLA 1Z6TA 2Y31A 4UB8C 3MCZA 2L9VA 4HRIA 3PCVA 4JJFA 2MLGA 2V26A 3CQZA 2WBMA 4YWQA 4G9YA 2QQAA 2HVQA 3F8MA 3K1NA 1I3AA 1WJAA 2WAEA 3I4MJ 2STTA 3H9JA 5AC5A 1WJEA 4KITB 2UWMA 4IOAF 2H8RA 1WATA 3ML6A 2XM4A 4XN3A 1VTMP 3U1DA 1WI3A 1IN4A 4NHJA 4G12A 3BRJA 1FPQA 2I5UA 5COGA 2ESNA 1T33A 1YJ9I 2XF7A 3PSIA 2JA7J 1B59A 3JRIA 1A31A 3UGPA 3KX2A 1GS9A 4BG0A 1LKXA 1IG7A 4MTDA 1S7ZA 2L0KA 2LBFB 2M3AA 4NTFA 2QWWA 4EGYA 2Q4FA 1R1VA 1LDJA 5CQEA 4LDRA 3DE8A 5TJJA 3K33A 3S2HJ 4DNCA 2W82A 3SP1A 4JC7A 5LHHA 3G1MA 1Y6IA 2P6TA 1V4RA 2J7PD 3RKXA 2O8XA 2XSDC 4BAYA 3M1EA 1HE1A 1FBUA 3L2CA 3BR5A 4C9YA 3V8KA 5E33A 3GZ5A 4EGZA 3MN2A 2CRGA 4ENJA 1LPQA 3PDMP 3E6MA 5LHIA 1R58A 1U9OA 3QVYA 3OY9A 3CCMI 2Q8KA 1VYIA 1HQCA 1X2MA 2IS4A 3U8PA 1UMQA 2EIJC 1YS6A 2VBZA 3ZMSA 2QLAA 3IAS2 2IOQA 4C3EA 2NOGA 4WXCA 1TWHA 1QZZA 3M15A 2X85A 3QAHA 1WFXA 1XD7A 4C2MJ 2P4WA 1Y8QB 1D1BA 1V3FA 2EZHA 2K40A 2WB1A 3HJEA 4RGRA 4A3MJ 1SYQA 3OL4A 1TP4A 5BS6A 5JUAA 1BJAA 1VK5A 4HX7A 2IAIA 2P7VA 1Z6RA 2XKOA 3U3BA 5H20A 3F8NA 3QPTA 3VSLA 4XRSG 2IVMA 2ME6A 3V4GA 1Z7UA 3NQOA 4IVNA 3CZ6A 2XV4S 3IWFA 3F8FA 3OYLA 5D8KB 4CCMA 1G5ZA 3H3VK 3IH4A 4HZFA 3K70D 1SFUA 1Y56A 2EV0A 2JUGA 3WU2C 1BJZA 4NY3A 2KRHA 2EIMC 3GTJJ 1U6GA 3WTUC 2HQNA 4RAFA 4KC9A 4U5EE 1ON2A 5GAEJ 5KHDA 4AVPA 4JRZA 5L0DA 3E6DA 4KDPA 3JSZA 2CUJA 1BI3A 1CPQA 4E0HA 3FXUA 1UFBA 5IY5H 2J0XA 3J7ZI 2IT0A 3NKEA 4KIFA 2RREA 1L0OC 3J80Z 3IQ6A 3CC4I 3P9CA 2KIUA 3MKWB 4GGGA 1YJWI 3AJMA 1FOYA 1IDYA 2RV8A 3LSIA 4AIHA 3OYMA 3A11A 5BQGA 3RVZA 1D8JA 1Y6DA 1A41A 2JJ7A 4FX4A 3C8GA 3SFIA 1UCRA 1QHHD 2MSYA 2BE5F 1TWCA 2CYDA 4A4AA 2YR2A 2LSOA 1JJ8C 4CDGA 3W6VA 5IOYA 1WGXA 2PN6A 5B1AH 1PP7U 3CCRI 3FKIJ 3PQJA 3IPMO 1FIPA 2LP0A 4XONA 5A6BD 1MH4A 3WODF 4A93J 3HOYJ 4BHPA 2KT0A 3BJAA 2YL1A 3SEQA 1W7PD 2EQRA 1W7PB 4IQJA 3LL7A 3C2BA 3TP3A 4O3MA 2I10A 5F27A 2XLDA 3CLOA 1RJ9B 2OQGA 5B5EC 5TRDA 4PJLA 1D0ZA 1NFOA 2LRDA 4PJMA 2QQBA 3IQTA 3MKYB 1T39A 1IN8A 5E3NA 2OF7A 4GFBA 2JN6A 1OKKA 2W85A 2JSPA 2MABA 3TOBA 1JTXA 3SZGA 2DW4A 4B48A 1R7JA 3BZ6A 1T56A 2LQGA 4E6KG 2PNOA 3DBHB 3HKZA 2ZJPF 4J7YA 4WXHA 2OV7A 3KP3A 2XS8A 4Z9JA 3HHHA 4P96A 2YLIA 2DMNA 4IRHA 1RKCA 1B9MA 1JUPA 2GXGA 1OR3A 4JX6A 1TNTA 3E7LA 4KMUX 4GYIA 2HOSA 5DS9A 3T0YA 2H6CA 4WF2A 1DUXC 2QLZA 3DBLB 1VMAA 4IXAA 2R7TA 2F4IA 3DM9B 1U5TA 3K4LA 2HGCA 3GFJA 1ZGAA 1A35A 3HKKA 1R71A 2D1VA 4EVIA 2WAQN 3DKYA 3ZQGA 4U0VA 5CIVA 2ZNZA 1YW7A 5EEGA 1LJ9A 2H09A 5HODA 2VXDA 1H6GA 3FIWA 3LFUA 2MD0A 3OL3A 4EMSA 2WB1N 3GW2A 4MHGA 3WHBA 4BH9A 1Z0XA 1JGSA 2DMUA 2NUTB 2Y3GA 4IHXA 2JWTA 3GTOJ 1AA7A 5E18F 5DDGA 2K7LA 3CD6I 2OG2A 2A6HF 3M8EA 3PNVA 2HS5A 5LRSA 4OIPF 3MYIA 3U0CA 2ZXPA 3G4XA 4BY1J 4C3BA 4XKVA 2QKMB 2XHKA 5EGOB 1Q1HA 1GDTA 1V5FA 2B7EA 2MBFA 5DUKA 2W25A 1I1GA 1KU3A 1TZLA 3CMEI 5E3CA 3FF5A 3ECHA 1V55H 1BM9A 4IRIA 1Z21A 2L7ZA 1VQNI 1ZELA 2BY0A 4D9JA 1FT9A 3M1CA 4HV6A 2H1KA 4WABA 1R1TA 4M9SA 1O3SA 3F9KA 5KYXA 2EFOA 3KYJA 2EFPA 4RMNA 1ZR2A 5ILSA 2V6CA 1ONVA 3WTTC 5DVWA 4M3DA 3DLAA 4G7HF 4ZYGA 3LJBA 2CYYA 2V7FA 2GIVA 2XAUA 1S05A 2DT5A 1I27A 2EIKC 4U7BA 3GODA 2A5YB 2XAHA 2O6GE 4A0XA 1QPUA 3BROA 1E3PA 2MWQA 4MNDA 4NBQA 1SAXA 1ZHWA 3CUQB 4LB5A 1ZH5A 1TQIA 3CMAI 4AM3A 2XSEA 3S2DJ 1HKTA 5H6QA 4HBLA 3CJNA 3RH3A 4CSAA 2HDWA 1MDMB 1QLEC 2IXNA 1D8KA 1EH6A 3MZHA 4JVSA 3NDBB 4ASNA 3E97A 2CUFA 3G1OA 1BR1A 3EGDA 2XPWA 4CYCA 4U88A 2WL8A 3N0TA 1IRXA 3SHFA 2E2JJ 2R5YB 4LLGF 2LREA 3H3ZA 2L3DA 2WY7Q 3S2WA 1I3QJ 4PJJA 5EEHA 2R92J 1BR4A 1J59A 4Z9HA 3HGYA 2BW3A 4E70A 3AL0B 2M2EA 1G3WA 1U5TC 1OCTC 2EPFA 3FVYA 1SD5A 4K2EA 5BUOA 1USTA 5LFAA 3B0VC 4BUPA 3OA1A 4AE4A 4BQNA 2BGCA 1N77A 2HQRA 3L7WA 4ENNA 2R7UA 2NS7A 4BS9A 1MJAA 1P92A 5D5UB 4XKCA 3L0IA 2QBYB 2XIGA 1FMWA 1GGQA 5A6JA 2AWCA 5FRMA 3KLNA 3G6EI 2QNLA 3FM3A 5ICGA 3CCYA 5EHHA 2DT6A 4YK5A 4ULVA 3CTAA 4QI2A 2AP3A 1MGTA 1T2KA 3PMRA 3GEIA 2HTJA 4DW6A 1GHCA 2D2WA 4I99C 5F5HA 3BTJA 4HOBA 4OIRF 1Z7LA 1I5NA 4LDQA 4G6DA 3ZQFA 1NLXA 1RXQA 2E36A 4A0YA 2XGDA 1F5TA 1IGNA 2NVXJ 1QZEA 1ODDA 1WHUA 4KT6A 4A5MA 3B0PA 2HKOA 2UXXA 4O6YA 2BY1A 1W0UA 2A07F 3QTHA 3U9JA 2Z33A 3ZVRA 2BXZA 1ST6A 2J5OA 3BC8A 5LGUA 1IZMA 4U9EA 2VOOA 5HDNA 5KNLA 3K1PA 3JSEO 4CS9A 5E3AA 3HNIA 3J80K 1JMWA 3VSKA 5COFA 4O7GA 3HNKA 3P5JA 2DU9A 2WZFA 1OCCH 3K1MA 4QDLA 3EGXB 3TJ6A 2XSJC 4KT5C 1QHGA 3T9OA 1WKMA 4MLOA 2PBIA 3WG9A 3M07A 3NYLA 3TBIA 2RQPA 4CSAC 5L3EA 1T5OA 3HOTA 2M4EA 1F4KA 2H8AA 4IRUA 4OWRB 2DA7A 1MIJA 1FNNA 2R7QA 2A5WA 2KDZA 1OCRH 2IPQX 1DU6A 3E5QA 2X1CA 2K3PA 3HTSB 1VQ7I 4Q5SF 3QU3A 4BXUA 4IWBA 1JXSA 3H36A 3KL4A 1Q0KA 1RR7A 3CP8A 2LSEA 2TRTA 2FE3A 1GV5A 3T6JA 1GVJA 3GMEA 2VT3A 4M9XA 2FBHA 2GXBA 2QUPA 3IEEA 3G71I 3ABMC 2ESHA 4EKWA 2CSOA 3WTYC 3LSHA 4U0YA 2E1CA 3IQ5A 3KLOA 1H88C 2K3FA 1USSA 2EIJH 4G8XA 4EJUA 5HLHA 3BR1A 4GQHA 4C7OA 1B4AA 3I5PA 1IXRC 4YG2F 5ILVA 4KNYA 4F4BA 2IXOA 3NAUA 3AG4C 2PMUA 1OFCX 5LRRA 4ENKA 2XAFA 3HRMA 3OYAA 5GADJ 3LS0A 3MAJA 2HV6A 4CO8A 2FU4A 3ONQA 5F64A 4BE1A 4Q47A 4G7OF 1ORYA 1IRFA 2E5ZA 1JHFA 5IOZA 1DPRA 3CF5F 4D0PA 2WA0A 1RRJA 4LMYA 1ZGJA 3CJRB 3F21A 4IHWA 1CGPA 2HSQA 1OISA 3BT9A 2X6YA 5D6FA 1MZBA 3ZCOA 3VPRA 2L9RA 4JP0A 4D7NA 3JRFA 4H4KC 2FMLA 1VZ0A 3ESWB 3UR3C 4B44A 3ABKH 3JRGA 4EJOA 2R7FA 3HOXJ 4CS9C 4XQFA 4XPYA 2HKXA 2K5CA 2ID6A 2O0YA 3OYKA 5E2QA 1ZLJA 2VN2A 3BR0A 5DTDA 2ISZA 3ZN0A 2P5LC 3S1RJ 2XROA 1CQTA 3HTUA 1GXQA 1I4ZA 4AIJA 4L5JA 4JK1X 1FIAA 2CH0A 5FKNA 2RN7A 2JA2A 4OMZA 2KSFA 3S28A 4QSHA 1FX7A 4MFDA 5EYRA 2M4GA 4NTBA 1GLNA 2E1MC 2Q2EB 2XASA 4G7ZF 5K7FA 4M9ZA 1ETWA 3VYRB 5M3FJ 3TOLA 2NS8A 1Z3IX 1G3YA 4XK4A 1LI7A 1SVOA 5TISC 2KK1A 2Y0SA 1D1AA 2CCYA 4UUSA 2ZNYA 5LEKA 1DOWA 3MFKA 1YZCA 5F6FA 4PJ0C 1IV6A 1IN7A 3ASOH 2XLEA 3WG7H 2B0HA 3HIFA 2NYXA 2WY8Q 1MSEC 2CS3A 3ZQIA 3DZAA 3LQRA 3CMYA 3KZZA 3UMKA 2FGYA 2AHQA 1CGOA 3QP6A 2LKXA 5AC4A 4E7JA 2E60A 1WRJA 3Q0WA 1YITI 3GEZA 2M64A 1YTYA 4YT4A 4CDAA 2Y9YA 2WVOA 3TMOA 1IO2A 3LSJA 4F55A 2M45A 4CZCA 3F6VA 2O5RA 2EV5A 5K7ZA 2R5ZA 3CC7I 2X1EA 1WWPA 1YA7O 3JTLO 2JUCA 3I4PA 2PMZN 4KJZA 5DM7F 1W2WA 1NSGB 3WAQA 3KIOA 2W9YA 1OKRA 2VASA 3X2QC 3S32A 4RAZA 4BJ6A 2XXAA 4OU0A 3FBNB 3SYTA 2DYSH 5J47A 1MQVA 1ORJA 1KNYA 3CCVI 5E1XA 4W8PA 3V7RA 5AIPA 4XRMA 4UV8A 4DRJB 4GO1A 2Z16A 3K7DA 3S3OA 1P4WA 3QYFA 1D3YA 4RB1A 3JZ0A 3W6KB 2MH9A 3HPHA 3M9AA 3PFYA 5GP9A 1ZQ3P 3CDLA 3IKTA 1ZHXA 3H9GA 4IAQA 1O87A 5J8FA 4JX5A 1S7EA 1QQIA 2ECCA 5BOXA 4ZTJA 2XL4A 2NUPB 5KYUA 3LNRA 1TWCJ 1WCMJ 1XMXA 4O5VA 5IP7J 3W8IA 4I6ZA 1Y1WJ 1HSJA 1QPMA 2G0EA 3VEPA 3UKGA 1K78A 2RDPA 3GM3A 2KZGA 3GWNA 1PVEA 1U0JA 4IZZA 1A7VA 4RM3A 5K7HA 4FX5A 4P6IC 3CCEI 5J40A 4QPOA 1VQMI 1H9TA 4WK8F 1NG7A 1O7FA 1OYIA 2FBIA 3JRBA 3F72A 2MGQA 1MBGA 1BC8C 1E17A 2ETSA 4IJJA 4PZJA 1TKNA 4CJOA 4YT2A 2DMPA 3TQNA 4M71A 1T01A 5JI6A 3AGTA 3V7CA 5E17F 4A69C 4LACB 4ZZLA 2RNGA 3M7GA 4M72A 5HDGA 3TKYA 1ETKA 2IGKA 2JMWA 2M0MA 2XB0X 5E20A 4DYRA 1YIJI 2P6VA 1XDSA 4M3GA 2CNWD 3JT1A 3VAYA 2DA6A 1RKEA 1B8IB 2BOLA 2DYRC 5EG0B 2OZUA 3S14J 4IARA 3U3FA 4IB4A 1ON1A 2DA3A 2X4HA 2Q0OA 2R7XA 1T6SA 1GQAA 4L0YB 1YLFA 4MVMA 3AG2C 3FK7A 1PCXA 1UG0A 4IHYA 3RIPA 1PDNC 2VE8A 2P0WA 4PUSA 1KTMA 5LLQA 3JRTA 2EIKH 2DFEA 4BJ6C 3VYSB 2BHZA 1E3OC 4LB6B 3S93A 3G73A 2OJQA 3EH1A 1FP1D 4NNJA 5K5OA 3IL2A 2H27A 1X3ZB 5E8GA 2Y3HA 4MTOA 2AXTC 1Q0GA 3JTGA 1NG6A 4HAMA 2R7WA 2WZLA 3ZMVA 2NRAC 1PD0A 2WTEA 4FWVA 4ZYDA 1MMGA 2EPKX 4ESJA 4KNVA 2X6OA 2Y0SN 2HMQA 4JKVA 2CQ7A 3SXMA 4A3GJ 2YVKA 2CW0F 2E19A 3JTHA 1QNTA 3K7AJ 4MVSA 4OD5A 4II3A 2ZD9A 5JP7A 4FETA 3BWGA 1HCRA 4KI2A 1KU7A 4M63A 3NEUA 1J5YA 1CF7B 4AL1A 4EUKB 1MBKA 2M5WA 2Z5UA 1FOKA 1ORKA 5HNHA 1YYXA 2O03A 2QF7A 1O3TA 2CGEA 5DS6A 4A3LJ 1LUJB 1S8NA 2Y75A 1UAAA 1ZHYA 4EBBA 1YG2A 1BA5A 4P1WA 3B02A 2DQRA 3OYGA 1C03A 3VRCA 5GPCA 5L0GA 5H6RA 2Y69C 5D6EA 2VI6A 1HDPA 3QOEA 3IWZA 1TR2A 2FXAA 4XTKA 5HS8A 4PACA 1BDJB 1X1CA 3ZGKA 1OLTA 3WTVC 3BJ6A 3R61A 4QWQA 3VOEA 3K4CA 3R60A 5B66C 3HNLA 2LP4A 1MW7A 3RQIA 5CLSA 1SD6A 2DAOA 1L3LA 1W1WE 3HOVJ 2DA4A 1X2NA 3RFYA 5FO5A 4IX7A 2HUJA 1ZU4A 5C3EJ 3DLLF 3T5XA 2HVRA 2KP6A 3TOMA 1S9HA 3DXJF 3WTZA 1XX5A 3KP7A 4BL0B 1IRGA 1RUOA 1FMVA 2K9MA 2XAQA 3E6BA 2NVYJ 3VDXA 3HOZJ 4J7TA 4OIOF 4Z9IA 3V5ZA 3CCJI 2EZIA 5L3GA 1U8RA 2HPMA 3CLQA 2L5QA 3LSPA 4MVQA 4HQMA 3EHMA 1H8AC 2LFDA 4BDZA 2C6YA 2LD5A 3H65A 3E9VA 4RLQA 1E86A 1HSTA 5CI9A 4YL0A 4PR9A 4MTEA 4LG0A 4DBRA 4E7LA 2LK4A 2V1XA 4IL6C 1LE2A 4FE7A 5EK0A 4XLCA 5J1RA 4Q48A 1OCOH 1T98A 1BBYA 1MNMC 3GTMJ 3ABLH 4Y33A 1XS9A 2FF4A 3F23A 4BGDA 4Y3OA 5L3QA 3SDGA 5CVIA 4UVBA 4XBFA 3T4RA 1Z3XA 1OR7A 1X1PA 2DODA 5FRNA 1FAPB 4HEAJ 3LMMA 5L3DA 1YRNA 1T8IA 5ICFA 1XC5A 2Z15A 4XL9A 3L1MA 1BL0A 3K2ZA 4DYCA 3DE9A 3BY6A 2Q3TA 3ECSA 4IRGA 1UJ8A 3KETA 5GPGB 2E35A 2VXZA 3F47A 3EPVA 4E4HA 3SEZA 2CFOA 2FSWA 3A0BC 3HBLA 3RKWA 1WJBA 1R23A 1GM5A 4CBEA 5A6KA 1FJLA 3I59B 1AHDP 1ZARA 2L7AA 3D5SC 1LVKA 4WCGA 4NCQA 3AG4H 3BCBA 4N9IA 4FX0A 3A9CA 2KPMA 3FXKA 3CF2A 2L9NA 3LNQA 4IGGA 1V5GA 3JW4A 3KYDB 1X1BA 2KRFA 2YZSA 4BEJA 4L9TA 4RBOA 3QU6A 4EJTA 3LA7A 2RSEB 4DZJA 2OA4A 3J81Z 1VQ8I 2PX0A 3G1LA 1MKMA 1YI2I 2Z9OA 2L7KA 3GLLA 2OQRA 4HQEA 3O55A 3BZKA 1P7JA 1W7PA 3KZYA 2OTJI 1OW7A 4P9FA 4ETSA 3K6BA 3DEWA 4MIMA 2MFZA 1XZQA 1RJ9A 2YUSA 1U78A 1XDUA 3GCMA 1GV2A 2XL6A 1YYVA 4GCVA 4B3XA 2NVTJ 3A2KA 4GXOA 5FFXA 1EJ9A 1QVUA 5LGNA 4WGZA 2G3KA 3GEEA 5E79C 4LIUA 3N4MA 2A6TA 1G6NA 3AAFA 1B72B 3KMIA 2WVQA 2DFFA 1P6RA 3HSRA 3BDDA 4XOPA 4YELA 3TEDA 3BOQA 1S29A 3FAPB 3A01B 4CGZA 3K70C 1KYZA 2L7MP 5K1YA 2HSBA 5DD4A 1U3EM 2EFNA 2H7VC 5IYCJ 2DPDA 4HFKB 1TWFJ 1Y0NA 4YFKF 1MJBA 4HSTA 4GYTA 1OR7C 4PGHA 1R22A 2LMDA 1DGWY 3DTEA 3TO9A 2V79A 1ETXA 5J6XA 2R0QC 1R6RA 1U2WA 3HUGA 2W7NA 1ZGWA 1ZLKA 2R7VA 2HKVA 2PJRA 1NHAA 2IW5A 4UV9A 1DP7P 2Q1ZB 4LGWA 2JA6J 3MD2A 5FFZA 3U21A 4A2NB 2ELKA 1X3WB 2W48A 5FKOA 1LFBA 3KEQA 3ZN1A 5IP6A 3F6OA 3QPHA 1MBFA 1AKHB 2DOFA 1I39A 2B0LA 1N78A 3B0UX 4B8XA 3S17J 2YL3A 4V2FA 2O61A 4JCHA 1ZRDA 3EFOA 4A0ZA 5HS9A 2IGMA 4MGRA 2KMUA 2ZXRA 2XGXA 2NUTA 1LQ1A 3O10A 4FISA 4XEKA 4ABZA 4HF0A 2QSGX 4EBJA 3OR1C 1EA8A 2EBIA 3KP5A 1EI7A 3WTSC 3BPVA 3SXZA 2DFIA 5EGOA 3PO2J 1PJRA 1S7AA 1VTNC 2P61A 4KISA 4J19A 1T6QA 3JRHA 1K4SA 4YT5A 2CUZA 3RQ4A 1F9NA 3ERED 3IAM2 2FOWA 2J5PA 3KP4A 4IQ4A 5L0IA 3H1CA 3S15J 3DPTA 3ZQYA 2Z99A 1TWAA 3ELKA 4HEA2 2BZTA 2X6XA 3MKLA 3MWMA 3L1PA 2PI0A 4BBRJ 1LE8B 2CG4A 1IUFA 2VONA 2DO7A 4N4WA 3ITFA 3TDZC 4BYYA 4MTFA 3OYCA 1CGME 2MH2A 5EDNA 2DTZA 4NC7A 1ZHTA 3RQEA 1KQ0A 5F5FA 1FTZA 2PP4A 2PMHA 3K2AA 5KYYB 1MDMA 2A68F 4Y52J 3R7CA 3EG9B 3L9FA 3B29A 2DLLA 1S7OA 3F0CA 2ZSIB 2ZSHB 1RKTA 1HOMA 4IAOA 1IW7F 2ISYA 1LE4A 2TMVP 1PUFA 3RKOF 4LD5A 4CCKA 3AQCA 1VNDA 2WADA 4OOIA 3ZMDA 3KP6A 5D5VB 1SC7A 3MQ0A 4MVRA 1GXPA 2EWNA 2QKLB 5IYDJ 2VE9A 1TQPA 4YN0B 1J2XA 1YVIA 4EWCA 3L2UA 3DTKA 3TQOA 2FJ1A 2OD5A 5IPAA 1VQ4I 4WX9A 3FMQA 2VT2A 3C2GA 3M8FA 2F5EA 2DYRH 2OCEA 3HHGA 3DF8A 3LAPA 4ZTFA 5TGTA 1EKEA 2G7HA 3I54A 1U8BA 3FOPA 1WQ2A 3MMYB 3EUKL 3IRQA 3L34A 1D0YA 3H0DA 2TCTA 1V74B 2KGOA 1OYWA 2EK5A 2LKSA 3MVPA 4JCZA 4GYGA 2F4OB 3EQLF 2QTVA 3AFHA 2VBYA 3LSRA 4U5CE 3I5UA 2BL2A 4CIPA 2NVUB 2FUG2 4A3IJ 2DTRA 1YX3A 4C2TA 1BW5A 4HA8A 3OSFA 3BJOA 4JZAA 5JHUA 4CDYA 2ETHA 5DS5A 3HPGA 2HNHA 1MMAA 4UY8I 3GTGJ 2NSGA 3RYLA 3FKJA 1ZYRF 5FLXZ 1NH3A 1LS4A 3HRUA 2IS2A 1APLC 1LEAA 1X3UA 1FEXA 3DEUA 2BVLA 3ZR8X 5JR3A 1A7EA 2QENA 3WGIA 4BXXJ 1VQPI 1C0WA 2ZO4A 4B6IA 2AQEA 4MVUA 5FLMJ 2XL8A 3MBGA 2VKHA 3OR2C 3ASNC 2XLVA 5GTHC 4ENMA 3TL4X 2LY2A 3JYHA 3AQBA 4I01A 4MO7A 2X6WA 3DQVC 4BY7J 2VCAA 3EGXA 3AG1H 2DDAA 1OCZH 2KJCA 4CHUA 5A69A 2CU7A 3HXLA 5DS4A 1QU3A 2KYHA 3VYUB 1AEPA 3LA3A 2FA5A 5EZHA 2PFBA 2XLHA 2M7AA 5F1RA 2BVMA 3BTCA 2H7OA 4QPQA 4L9VA 1X1AA 2Y69H 2EFWA 4GEHA 3H2VA 3JCUQ 4WWCA 4B43A 1FOXA 3KYIA 2MC3A 1PD1A 2Y39A 3U8VA 2GDCA 5KVRA 5FKKA 1NZEA 2JRMA 3D0SA 3J81K 4QI0A 2JPCA 1IDZA 1VFCA 4XRSA 1TT5B 3T1BA 2OAZA 4PDKA 4PFPA 4ER9A 3BCAA 4XLHA 3Q3SA 2D1HA 1HE9A 5CQGA 3LNMB 3S0XA 3EJNA 2P5KA 2VL8A 1WJFA 2L54A 3U2MA 4P9UA 1QKRA 3C8ZA 1QGPA 5M5WJ 1FLIA 1ACIA 4F92B 1L3PA 2V6EA 1M2VB 4BPMA 4E18A 2PQ8A 2KHMA 3NKDA 5EZGA 1YDIA 4PSWA 4OMYA 1C17M 2M9HA 2JK3A 4CXFA 1WGWA 2V9PA 2A0UA 1EV7A 2ZC2A 4N9HA 4K7BA 4AYBA 4F7ZA 3IRRA 3RF3A 2XLOA 2K9NA 2A0BA 1JKRC 3NG1A 2YPRA 3C8GB 4XICA 4HF2A 2VPLA 2GQQA 4CYDA 3I64A 2QY9A 1R5ID 1NK3P 2OKUA 4HSRA 3QPLA 4ZYHA 1XGMA 1QA6A 3LSKA 3BG7A 2Q7RA 1VLTA 2XB5A 4MQ9F 5CKTA 5M3MJ 4WGYA 4I09A 2ZXWH 4EM1A 1YAUO 1X19A 1ETQA 3DFGA 4YL1A 1XSDA 1S5LC 2DMQA 1J7KA 1XTAA 1ZR4A 3PIPF 2L9JA 4ZYEA 3HRSA 2ELJA 3HC7A 5ERIA 1BZ4A 2IXPA 4KIGA 5CVJA 5DUIA 5IT9Z 2RVCA 3HKZN 3SDBA 2VBWA 2IA1A 2XF5A 3K9TA 3PO3J 2DBBA 2GFHA 2XRHA 4KBLA 4RBNA 3BG3A 2IYLD 2R7OA 2KJBA 5FKLA 3F8CA 2DJIA 1LS1A 1Z63A 3DEEA 4HX8A 2VODA 2G62A 4G6QA 1T95A 2ZBKA 3GWZA 5DCFA 1AWCA 5L0FA 4PCQA 4JW1A 2ZFUA 4F91B 1H89C 2BC5A 3QZCA 2A6EF 3DI5A 4I98B 1R36A 2JVHA 2EB7A 3TO6A 2DPUA 2QGUA 4G78A 1YARO 5C4JJ 2DFHA 4JQFA 4BQOA 3R6SA 4JTDB 1IN6A 2OEVA 2BY2A 4CCNA 1KU2A 3GZNB 4M3EA 3EZIA 1RCPA 2FQ3A 2C04A 4YT8A 2GBYA 3E6CC 2P0NA 1FBSA 3NWTA 1K4TA 4P55A 1NTCA 3JRAA 2R7ZJ 2EH3A 4BU2A 1P4XA 2GA1A 3JAMZ 3F8BA 3U2RA 2FQ4A 1IXCA 3NYMA 5BPIA 2E1OA 4HLXA 1MBJA 9ANTA 4EQQA 3CCQI 2OEXA 3LLKA 3LLIA 3KYLA 5L3BA 1XWJA 4LLCA 2MW8A 4EJVA 3ZQHA 2EPNA 4AIDA 3DD7A 4QLCU 5ICCA 1VQ9I 4KNWA 3PSFA 2HR3A 2AXLA 4MW3A 4AK9A 1ULYA 2M34A 2UUZA 1YLMA 3H9QA 1BI0A 1X58A 3CQZJ 2R25A 1ZAOA 3BR6A 2EILC 2DMTA 4TV7A 2HQAA 4II2A 2DJNA 3FBIB 5D5XB 2QEXI 4CH7A 2NUPA 4NC6A 5F04A 3I71A 1IXSB 2FEZA 4BKXA 3QP5A 3CDIA 4BEHA 4XIDA 5KYXB 2J9WA 2OCCC 2P1AA 3QYBA 1W5SA 3QPSA 3NMIA 3H5NA 3TDUC 2ZMEA 4LLLA 1SMTA 4HLYA 3GTPJ 2ZFWA 1PP8F 1JJ6C 1YW9A 4BBSJ 2VJJA 2ICWG 4HPQA 4XSZF 1ETOA 1HC8A 3G4ZA 3ZIBA 1MJ9A 4AYBN 2FNPA 3BTLA 5FLXK 2EIMH 2HMZA 1AOYA 4LJZF 4C3DA 1IV8A 2YEVA 3EGDB 5KYWA 4NQWB 1U9NA 4O6JA 4CYCB 1HDDC 4I3MA 1B8IA 2I8BA 4X6AJ 3GO5A 4A6EA 4E7IA 1WJDA 3QW0A 3H5AA 5K0IA 2JT1A 5HDKA 2BW3B 1YO5C 3QMKA 4DOZA 4K0DA 1F1MA 1SFOJ 3QWLA 1K61A 2XUBA 2V1UA 3FM5A 3K4KA 4OINF 5E3LA 2BBYA 4O79A 2JQ7A 4BJ1A 4AE4B 4MTGA 2GLOA 3IH3A 3T8RA 5L3FA 1UELB 3HYIA 5JSLA 2FFHA 3DU6A 4OAYA 4ZDLA 1T38A 1TWHJ 4JBAA 2XGEA 4CA0A 1VQOI 4P9TA 1Z3YA 4L0ZB 4AD9A 2P6SA 1PV3A 4W8KA 1QPIA 4DIQA 2MG4A 2HFIA 2Y9ZA 4E0IA 3OV8A 1YS7A 4L5EA 5DM6F 2EFQA 4Q4ZF 4YFXF 2G7UA 2QQ9A 4I1OB 4DVYP 2PBEA 1KZHA 3LEOA 4CS8A 4IHVA 3SEOA 1ZG3A 4BJTA 4U5HA 5TJ5E 2XRLA 4FHTA 2HYGD 4BHBA 3EH2A 2QQ8A 2KDOA 5DCMB 3EETA 3S84A 4MFEA 2Y2ZA 2LK2A 1Z5ZA 2RKHA 1FNTc 2EA4A 1LM3B 3EDPA 2DB4A 3ZXSA 1VLSA 2BHYA 3RZDJ 1VI0A 1UFMA 5HS7A 3CO6C 1PUEE 2LCHA 2WWYA 4W97A 3ZP5A 4XPWA 2HZ8A 4RS8A 3Q6MA 2ZMEC 2F4MB 1HW5A 2L4AA 2YLGA 1KQ9A 3T8TA 3DV8A 2O9XA 3SXYA 1TBXA 1RMVA 1RUNA 3V8JA 3KKBA 2AQFA 3WGHA 3HNJA 4I02A 1A04A 2ME0A 3LS1A 1MD0A 3NMKA 1O3RA 1VQ6I 4UHTA 4XOTA 2Y3DA 2LOOA 3ZMTA 1TWAJ 1WSUA 2E1MB 3OIQA 1RPWA 2B0JA 3UMHA 3U9GA 2KQRA 3GWLA 4DRHB 3PNYA 2ZKZA 2GZWA 1TT0A 2X0LA 1YHQI 2W4SA 1NU7D 5A6AA 5JRAA 4U5GA 4XMYA 3L2QA 3LESA 1FP2A 2FX0A 1Z6AA 2HPIA 1Y39A 2VPRA 5F08A 1JOGA 1TQGA 2L6FA 3EHNA 1W5TA 3Q7LA 4O6MA 5IY5C 2QSFX 4A2UA 4CCLA 4ESFA 4RDAA 3D1NI 3KYCB 1Z9CA 3I0TA 4CZZA 2JX0A 3LEVA 1D5VA 5IT9K 2LH9A 2DT7B 4HG2A 3GORA 1XGSA 2JSCA 2LFBA 3GBGA 4FAPB 2MA3A 1L7CA 1ORSC 2YHSA 3DU5A 1H9GA 2XVCA 1K79A 4CS8C 1LDKB 1LVAA 2E71A 5M5XJ 2Y3BA 1SFKA 3MKZA 1HF0A 1TTYA 1B9NA 4ZZDA 3ISPA 4Q7CA 5LHGA 1EKYA 4JX4A 4AUXA 5EJCA 1QRYA 4IF4A 2X9DA 3GVAA 1GUUA 1BC7C 3HG9A 1VQ5I 2Q00A 5F28E 2IJLA 4UB6C 5LGTA 3FXHA 4G0HA 3W4YA 5CVVA 2E2IJ 2QUFA
chains in the Genus database with same CATH topology
3DKYA 4F52A 2W45A 4B3XA 3A2KA 2Z1DA 2VXDA 5L3VA 3UNGC 4HNUA 1SAUA 2MD0A 3LFUA 3OL3A 2A1DD 5D91A 5B3SC 2G3KA 4XORA 4LIUA 2A6TA 3E1SA 4LITA 4EATA 4BDYA 3KMIA 2NUTB 2WVQA 2Y3GA 3OEOA 4XOPA 4YELA 1AA7A 4Y4RA 3NRHA 2GOMA 1FFTC 1SMYF 3DAGA 2OG2A 2K9LA 3K70C 2A6HF 3PNVA 1O5HA 4OIPF 2CNWA 2VJIA 5HNFA 2ZPAA 1ZHZA 2VQGA 2H7VC 4XKVA 2QKMB 2ZXPA 4C3BA 3A4CA 4HFKB 1P9QC 1V5FA 1Z23A 2DOAA 4CSAC 3CESA 4HSTA 3OS1A 4GYTA 1OR7C 1TZLA 3W2AA 3N05A 5E3CA 1DGWY 1Z21A 3DTEA 4CCOA 3K66A 3LAYA 1R6RA 1ZELA 4D9JA 3M1CA 2W7NA 2R7VA 3SYNA 5KYXA 2R4GA 3F9KA 2PJRA 4OD4A 2XF6A 2LBFA 2Q1ZB 4RMNA 4E7ZA 2Q9BA 3MD2A 1E0EA 3U21A 2KL4A 2CV0A 3DLAA 1ERDA 3LJBA 3O6XA 5DVWA 5T1DB 3X1OA 4A2NB 4YJWA 2V7FA 1N78A 3B0UX 2XAUA 3RPUD 2EIKC 3GODA 4U7BA 1M57C 1DP3A 2NG1A 2IGNA 2NOJB 2E5NA 2WVNA 2MWQA 4JCHA 3EFOA 4MNDA 1ZHWA 1MNEA 3SZRA 5DQZA 2XSEA 2J7PA 2D5RB 3J7AY 2IGMA 3RH3A 2KMUA 2ZXRA 2NUTA 4CSAA 2HDWA 3G2BA 2KRCA 1QLEC 1DQUA 2IXNA 2WB7A 3D5RC 3IUOA 4ZLCA 1JPJA 3OR1C 4JVSA 1N75A 4I1MA 3H5RA 3NDBB 3MLGA 3EGDA 1BR1A 2LC2A 3AKZA 2IXMA 2WL8A 3DTIA 3N0TA 1PJRA 1IRXA 5HLTA 4XWJA 1LFPA 4KISA 2LREA 4YT5A 2WY7Q 3DAFA 2CUZA 2J9UA 1X4PA 3T6BA 4PJJA 3RQ4A 1BR4A 4G6TB 1MMDA 2BW3A 3IAM2 2HU9A 2LY1A 3NWSA 4IQ4A 4PJNA 3AL0B 2KNHA 3FVYA 5BUOA 5LFAA 3B0VC 3DPTA 4BUPA 3OYFA 3OA1A 4AE4A 2WAFA 4BQNA 1N77A 1TWAA 2R7UA 4HEA2 4BS9A 3L0IA 2X6XA 4XKCA 4HNTA 4U5DE 1BOBA 1FMWA 4X0RA 1PYVA 3H35A 3ITFA 1MNDA 5FRMA 4XR6A 4DBQA 3OYCA 3BLYA 4ZDOA 1ZHTA 4U5FE 4NC7A 3PNTA 4C2UA 2L9SA 2JVGA 5F5FA 2L81A 2PX3A 2DT6A 2PP4A 5EHHA 3OYEA 4RLFA 5KYYB 2A68F 4QI2A 2XDVA 3EG9B 3HL2A 2M4KA 2F5VA 3PMRA 2ZSIB 2ZSHB 3BG6A 4IAOA 3PHF2 2VQHA 1IW7F 3RKOF 1T0FC 3OOUA 4CCKA 1SZIA 3AQCA 5F5HA 2WADA 2I8DA 1Z7LA 3OYIA 3HJCA 4OIRF 2Z2SB 3K4MA 2QKLB 4KT6A 3B0PA 4O6YA 3ZVRA 4YN0B 3B9QA 4EWCA 3L2UA 3DTKA 1FTSA 1ST6A 4ZLDA 3BC8A 1IZMA 3C2GA 5KNLA 4DJAA 1G8XA 4CS9A 3HOSA 4ZTFA 5E3AA 4C7OB 4ANJA 3VSKA 3N2ZB 3KEYA 5TGTA 4O7GA 2XC7A 2OC6A 1QZXA 4CS7A 3K1HA 1V5EA 2EINC 2WZFA 3UMIA 3K6GA 3MMYB 3EUKL 3EGXB 4QDLA 2XSJC 3L34A 1D0YA 3H0DA 2VH3A 1MMNA 1QHGA 2KGOA 4C30A 4MLOA 2VJ4A 4BEHB 5DQTA 3A1YA 3W2WA 3AFHA 3TBIA 2QTVA 3EQLF 3K1IC 3OS2A 3NYLA 4U5CE 3UGOA 3HOTA 2M4EA 2FUG2 3VWBA 1YX3A 3D5LA 4OWRB 4XKWA 4C2TA 2WZGA 4IRUA 4YEJA 4JZAA 5KYYA 1BR2A 3DWLE 3S3MA 2R7QA 2A5WA 3K4BA 4PSXA 3EG9A 5B1AC 3W8HA 2X1CA 2K3PA 2X1DA 3HPGA 2HNHA 2CV2A 1MMAA 3PJRA 3SNHA 4Q5SF 2MC4A 4IWBA 4CUGA 3KL4A 3DJNB 4D1QA 3RYLA 4O6NA 3FKJA 1ZYRF 3CP8A 2LSEA 1D1CA 4DGWB 4NUBA 3ZC4A 2W00A 2IS2A 3T6JA 3CMMA 1EA3A 5HOOA 3IEEA 2BVLA 3OIPA 3ZR8X 2HZDA 2PF4E 2CMPA 2UV1A 4E7SA 2C03A 3ABMC 4AX2A 3LSHA 4B6IA 1YE9A 2AQEA 2J9VA 5KYWB 2VKHA 4C7OA 3C2HA 3OR2C 3ASNC 2KZVA 3I5PA 3O39A 3QODA 4ZC3A 3FDYA 3TL4X 2LY2A 3OYDA 3AQBA 3JYHA 2IXOA 4F4BA 4U5BE 3EGXA 2X6WA 3DQVC 2W4MA 3W2VA 1OCCC 2HV7A 3AG4C 3Q6NA 4FESA 4EBBA 1WJCA 3HXLA 2R7RA 1QU3A 4JURI 5DS4A 3VYUB 3OYAA 4I44A 2VKDA 3LS0A 2HV6A 5FCLA 1J8MF 2M7AA 2BVMA 2H7OA 4QPQA 4HE8D 3ONQA 1X1AA 2X51A 4F93B 4BE1A 3M8JA 3NYJA 5HSWA 2DCEA 4G7OF 4GEHA 3S8PA 3JCUQ 2E5ZA 3ZG1A 4J00A 4B43A 5CI8A 3MX3A 1OCRC 1PD1A 2WA0A 3CP2A 2Q9AA 3CJRB 1NZEA 3ZSUA 2X6YA 1W36D 3ZCOA 4QI0A 3CJQB 4H4KC 2G3VA 1VZ0A 2VQCA 4OAZA 3UR3C 4PFPA 4B44A 2HVSA 4LG3A 5T3WA 3BCAA 4XQFA 4CS9C 1WJ5A 2K5CA 4XLHA 5E2QA 3OYKA 5CQGA 4XLNF 2VJ5A 3S0XA 3EJNA 2VL8A 1WJFA 4XLFA 4B47A 2IGOA 2WAQA 1YX5A 2ZXHA 2VLAA 2CH0A 4F92B 1SF8A 2JA2A 2V6EA 1M2VB 4N4OB 3S28A 3POVA 2KHMA 4J01A 3NKDA 2M4GA 3AG1C 1OCZC 1NG1A 4AU7A 1GLNA 2E1MC 2LYCA 2Q2EB 4PSWA 3S3NA 1ZU5A 3VYWA 4G7ZF 2XXAB 3K4NA 1WGWA 5B1BC 4P5OA 4ZDPA 4NC8A 2J0WA 3VYRB 4K7BA 1Z3IX 4AYBA 3V7OA 5JHFA 2CDQA 2F6CA 3NG1A 2Y0SA 1D1AA 2W4BA 1V55C 2VPLA 1J8YF 2CW7A 4CIHA 3TD7A 1N1CA 2QY9A 3EZHA 3EPZA 3AG3C 4BJ5A 3Q7GA 2WY8Q 4HSRA 2CS3A 3DZAA 2M7BA 2W1OA 4YRVA 3V42A 2VB6A 3DKXA 1HA8A 3UMKA 2CW8A 3BG7A 3LSKA 4BE0A 2FGYA 3ABKC 4XM3A 3N24A 4E7JA 4XNFA 5CKTA 4MQ9F 5KYUB 3RTRA 2E60A 2H7BA 4YT4A 2WVOA 1X19A 3EUHC 3TMOA 4CCJA 4F55A 4ITVA 4BXFA 2DXIA 3F46A 4CZCA 4N4NB 2L9JA 2O5RA 1M2VA 2X1EA 2ELJA 3HC7A 4KJZA 1W2WA 2IXPA 2W9YA 2VASA 3FAJA 3SDBA 3S32A 1M2OA 3X2QC 2GFHA 2XF5A 3FBNB 4BJ6A 2XXAA 4E7HA 1M56C 4PFOA 3IP4B 2XRHA 3SYTA 4KBLA 2IYLD 2R7OA 4RBNA 2DJIA 4PK4A 3OYNA 1LS1A 1VYKA 1Z63A 3DEEA 3DPLC 4J32B 2G62A 4BE2A 5CPRB 4LIVA 2Z16A 1T95A 3K7DA 2J45A 3S3OA 3QYFA 4RM2A 5DS5A 4JW1A 2ZFUA 4F91B 3HPHA 2A6EF 1G59A 3QZCA 2JVHA 3L2VA 2LG4A 3I9V2 3PFYA 1D0XA 4LERA 3ASOC 4BACA 1ZHXA 2VIXA 3H9GA 1JPNA 1O87A 3WG7C 4BQOA 4JQFA 4XN0A 1JI8A 4XLAA 4CCNA 4ZTJA 2XL4A 3DPUA 2NUPB 1KU2A 5KYUA 3EZIA 3LNRA 2V1NA 3CSKA 3W8IA 2C04A 4YT8A 3K10A 5D92A 3NWTA 2ZXWC 1U0JA 4IZZA 1J09A 4FX5A 4RM3A 3FHDA 4P6IC 4QPOA 4BU2A 2IS1A 1NG7A 3NYMA 3LLIA 3L2RA 4HRIA 3LLKA 4JJFA 3KYLA 4IJJA 2V26A 3CQZA 4LLCA 4AVZA 1TKNA 2WBMA 4YT2A 4YWQA 3W3CA 5T3TA 2HVQA 2DYSC 1WJAA 2WAEA 3DD7A 3H9JA 1WJEA 4KITB 5LD2C 2UWMA 3PSFA 4KNWA 2RNGA 2Y39A 4LACB 1W36C 3RCOA 2IGKA 2M0MA 4BJ5C 3HTKC 4XN3A 2P6VA 3DMDA 3JT1A 3VAYA 2CNWD 4AK9A 2DGJA 2UUZA 3H9QA 1X4OA 2BOLA 2DYRC 3LSGA 2EILC 3VYTB 2HQAA 4II2A 2XF7A 3FBIB 3PSIA 3FDQA 4U87A 4CH7A 2NUPA 2R7XA 3UGPA 3KX2A 3HUGB 4BG0A 1LKXA 4XLPF 1TWGA 3AG2C 5KYXB 1PCXA 4BEHA 1UG0A 1KONA 2PJRB 1S7ZA 2J9WA 2KLOA 3QYBA 2OCCC 3RIPA 2Q9CA 2ZXOA 3I4UA 4FASD 2LBFB 2M3AA 2P0WA 3FHNA 4PUSA 3H5NA 3JRTA 5CQEA 4BJ6C 2OUMA 3VYSB 3K33A 3S93A 2W82A 3SP1A 3L2WA 1Y6IA 3EFOB 3EH1A 4NNJA 2Y3HA 2VJJA 4HPQA 2J7PD 3AL0C 1NG6A 2R7WA 2WZLA 3ZIBA 2ZXIA 4WJ0A 1PD0A 2L2OA 1NU9C 4FWVA 4C9YA 5E33A 1MMGA 4KNVA 4C3DA 2YEVA 2CW0F 4JOMA 4NQWB 3OY9A 3EGDB 1VYIA 3OYJA 4I3MA 2IS4A 4II3A 2I8BA 4OD5A 2EIJC 3IAS2 4FETA 2IOQA 4E7IA 4C3EA 4KI2A 1TWHA 4M63A 1WJDA 2KJGA 3H5AA 3OWTA 2BW3B 2X85A 3DJUB 4DOZA 3QMKA 4K0DA 5DLJA 1WFXA 5HNHA 1D1BA 2CGEA 2WB1A 3K4KA 4OINF 1ZHYA 4O79A 1UAAA 4BJ1A 5DS6A 3OL4A 4AE4B 5KYWA 4XLEA 1UELB 4P1WA 2FFHA 3GANA 1VK5A 3DU6A 4OAYA 4ZDLA 3OYGA 3E0JB 4CA0A 2Y69C 1Z3YA 2P7VA 3QOEA 1TR2A 4W8KA 4XTKA 3VSLA 2JD3A 1X1CA 3ZGKA 1OLTA 4DIQA 3CZ6A 4ULWA 2KW3C 3OYLA 4CCMA 3K4CA 4Q4ZF 4OIQF 3K70D 1MW7A 3I5QA 1Y56A 4I1OB 2JUGA 3OYHA 4DVYP 2RQQA 4CS8A 4NY3A 2KRHA 1X1DA 2EIMC 3OYBA 3LSMA 4U5HA 4BJTA 4IX7A 3RFYA 3SEOA 1ZU4A 4IKFA 4KC9A 4U5EE 4E7KA 3EH2A 4N06A 2HVRA 2KP6A 1S9HA 5KHDA 3DXJF 4BL0B 3JSZA 2CUJA 2KDOA 3E70C 1FMVA 2K9MA 1VOMA 3KH2A 3VDXA 1Z5ZA 2J0XA 4OIOF 4X0GA 3NKEA 2RREA 3I3LA 3ZXSA 4ZJZA 2HPMA 3MKWB 2L5QA 3EHMA 2MYSA 4BDZA 2CV1A 3Q6MA 3H65A 4G7HF 3E9VA 4RLQA 3LSIA 5CI9A 3OYMA 1OKKD 2VQLA 4DBRA 4E7LA 2O9XA 5KCMA 5HVQC 1DGRM 1QHHD 3KKBA 2AQFA 2BE5F 4XLCA 1TWCA 3LS1A 4XKBA 4CSWA 2IS6A 2IXSA 4XOTA 4Y33A 2Y3DA 2LOOA 2E1MB 3OIQA 2B0JA 4BGDA 3UMHA 2KQRA 4Y3OA 5L3QA 4RD9A 3PNYA 4XONA 4R79A 1TT0A 3T4RA 2J46A 2GOXB 3WODF 1Z3XA 5FROA 2W4SA 1NU7D 5FRNA 4HEAJ 4U5GA 3LMMA 4XMYA 4J30B 3PL8A 3SEQA 3L2QA 3LESA 3OMYA 4IQJA 2Z15A 3LL7A 2HPIA 4XL9A 1Z6AA 3S29A 2KQ9A 2Q3TA 3ECSA 1RJ9B 3EHNA 4O6MA 4HFFB 3DM5A 3Q7LA 5IY5C 4PJLA 1D0ZA 5KYNA 2VXZA 3F47A 3EPVA 2LRDA 4PJMA 4E4HA 3K4JA 4ZYAA 3SEZA 2CFOA 3PUBA 4CCLA 3MKYB 3HLZA 1WJBA 4LLEA 4RDAA 4CBEA 3LEVA 3EUAA 2PFDA 1OKKA 2V3CC 3D5SC 1LVKA 2JSPA 2LH9A 2MABA 2DT7B 4HG2A 3SZGA 3BCBA 2A69F 2PMZA 3GBGA 3ZQQA 4B48A 4E6KG 2KPMA 3HKZA 2V4JC 2R7SA 3S27A 2OV7A 3CF2A 2L9NA 1V5GA 2V9KA 4DVZA 1X1BA 3DU5A 1OCOC 2YHSA 2YZSA 4BEJA 4CS8C 1LDKB 2Y3BA 1SFKA 3MKZA 1K6YA 3ABLC 4GRIA 5EGYA 3QYEA 4Q7CA 2E87A 2PX0A 3M1CB 1V54C 3HG9A 2L7KA 1VMAA 2R7TA 2F4IA 4F3QA 3ZRGA 3DM9B 3K4LA 3RSNA 4G0HA 1FFHA 4JJGA 3K6BA 4BQQA 2MFZA 3OS0A 1RJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ6 A;  3K6G A;  3OWT A;  4BJ5 C;  4BJT A;  4BJ6 C; 
#chains in the Genus database with same CATH topology
 1MBE A;  3HSF A;  2GXA A;  3C3W A;  1UHS A;  3ERM A;  1W36 C;  2Z1D A;  2AS5 F;  5L3V A;  1WVR A;  2V1D A;  1SAU A;  2JA8 J;  1V4A A;  2A1D D;  1DOV A;  5B3S C;  4NB5 A;  2P7C B;  3JAM K;  3B73 A;  4XOR A;  1ZRC A;  4ZH4 F;  5J8C A;  4LIT A;  1UZC A;  1SVM A;  2DOE A;  4EAT A;  1RR8 C;  1JRA A;  1YYJ A;  3OEO A;  4MS2 A;  1LNW A;  4XEV A;  4EBK A;  2L02 A;  2PG4 A;  4N0B A;  4Y4R A;  2R03 A;  2HOA A;  1IN5 A;  3RQF A;  5E3M A;  2O7O A;  1XG1 A;  3O8H A;  2VJI A;  5HNF A;  1ZHZ A;  2VQG A;  4A6D A;  3O6B B;  2VCB A;  1ZG5 A;  2XLM A;  1XGO A;  1AU7 A;  3WHN A;  1T0F A;  1GVD A;  1Y0U A;  4RGS A;  2DA1 A;  3N05 A;  5GPA A;  1DDN A;  3W2A A;  1HMD A;  2AU5 A;  2LD6 A;  3LAY A;  1REP C;  3SYN A;  3RIR A;  2R4G A;  2ADU A;  4OD4 A;  4U0W A;  2EPM X;  2PEX A;  4KUM A;  2LBF A;  4E7Z A;  2VH3 A;  4RD9 A;  1E0E A;  2KL4 A;  2CV0 A;  2R93 J;  1ERD A;  2JPB A;  3FZV A;  3O8G A;  4YJW A;  3RPU D;  2NG1 A;  4MVO A;  2R7D A;  5F0F A;  4B09 A;  2WVN A;  3TW6 A;  4A3F J;  3U9M A;  1MNE A;  2K85 A;  1HBX G;  1F43 A;  4JE9 A;  1JE8 A;  1EQ1 A;  2J7P A;  3E5X A;  3R2P A;  2L7F P;  2D5R B;  3C62 A;  4LK0 F;  3J7A Y;  4BEM J;  1MH3 A;  3K1I A;  3G2B A;  2COB A;  3A03 A;  3A01 A;  3IUO A;  3GFL A;  4PGG A;  4I1M A;  3H5R A;  2Z3Y A;  2O9L A;  2LC2 A;  3AKZ A;  2BEO A;  4S04 A;  3DTI A;  3GTQ J;  4XWJ A;  2BV6 A;  3TOA A;  3HB9 A;  3T6B A;  2UXN A;  2J9U A;  2KIS A;  1OQC A;  1MMD A;  2HU9 A;  2LY1 A;  2NAZ A;  1S6L A;  4PJN A;  5CVR A;  5BQT A;  2KNH A;  3SFZ A;  1XSX A;  2EPL X;  1O57 A;  1BI1 A;  4WXD A;  4S0H B;  2WAF A;  4B4C A;  4A3C J;  5F1J A;  3OSG A;  4S05 A;  4Y13 A;  1AKH A;  3JSO A;  4HNT A;  1W4M A;  2K9S A;  2QM3 A;  3JRE A;  3MYF A;  4X0R A;  5COM A;  1PYV A;  2DN0 A;  3H35 A;  2JRT A;  3DCF A;  4XR6 A;  4JIO A;  1A36 A;  4MVZ A;  3BLY A;  1A0B A;  3DKA A;  3IC7 A;  3PNT A;  4C2U A;  2L9S A;  2JVG A;  3ROU A;  4HX4 A;  3RKQ A;  4IHS A;  5C4X J;  1KQ8 A;  1KYW A;  3OYE A;  3U2L A;  5JS5 A;  4RA2 A;  1YQA A;  3HL2 A;  4KN4 X;  2QZ8 A;  2XPU A;  3C18 A;  3BZC A;  2M0C A;  2DDB A;  3PHF 2;  2VQH A;  1RC9 A;  1T0F C;  1SZI A;  1VQL I;  3HJC A;  3OYI A;  5CYV A;  4DZP A;  3LST A;  3REO A;  1TLH B;  1JAF A;  1Q1V A;  3ABM H;  4UNO A;  2G9W A;  2ZCW A;  3RZO J;  2OQM A;  2Y48 A;  4ZLD A;  3H92 A;  3RPQ A;  2H1L A;  4DJA A;  4IO9 F;  3HOS A;  2EIL H;  1RKE B;  2XC7 A;  2IA0 A;  2OC6 A;  1E2X A;  4M6X A;  1QZX A;  3SZP A;  3T6G B;  1V5E A;  2EIN C;  2MLK A;  4CS7 A;  1LE8 A;  3K6G A;  4EM0 B;  5JLX A;  1G4U S;  5BQI A;  1ZG1 A;  4V19 K;  1RET A;  5DQT A;  4B1R A;  3A1Y A;  2DQL A;  3W2W A;  3K1I C;  3UGO A;  3OS2 A;  3PFI A;  2GWW A;  1T9K A;  4IEJ A;  3VWB A;  3WGG A;  2J8W A;  5KYY A;  2WZG A;  1BR2 A;  3DWL E;  3S3M A;  2DK5 A;  4PSX A;  3RYR A;  1A7D A;  3EG9 A;  5L0C A;  2ZJR F;  1BN5 A;  2CV2 A;  5A6B A;  3G50 A;  2LR8 A;  3KCC A;  1R1U A;  3OOP A;  4CUG A;  3FHZ A;  1B68 A;  4D1Q A;  4D4X A;  4O6N A;  2K4J A;  1RKW A;  2EA2 A;  2HOE A;  3O2P E;  1WH7 A;  4DGW B;  4GDF A;  2W00 A;  2HZT A;  3CMM A;  1EA3 A;  1RES A;  5HOO A;  1HY5 A;  5GTI C;  2PF4 E;  3OIP A;  5C44 J;  2EZL A;  5M5Y J;  2C03 A;  3BPX A;  1Y1V J;  1K7A A;  3S1N J;  2NVQ J;  1YE9 A;  2E34 A;  2J9V A;  2R05 A;  2LFF A;  3HSE A;  2NPU A;  4DXW A;  5HV9 A;  2KZV A;  3EYY A;  3O39 A;  2H94 A;  1J0R A;  2K02 A;  3FDY A;  2M1B A;  3QOD A;  2RAE A;  3OYD A;  2OBP A;  3KPH A;  2VUM J;  3S16 J;  1NBB A;  5FZT A;  4CJG A;  4D5C A;  1WN0 A;  3EUH A;  1XN7 A;  2BY3 A;  2LDU A;  1FTT A;  1OCC C;  1OXB A;  1WOL A;  2HV7 A;  1WJC A;  2D5V A;  1MMS A;  2KIM A;  3GTK J;  4FES A;  4NDL A;  5AIQ A;  4JUR I;  2Y30 A;  4I44 A;  2VKD A;  2K9Q A;  3FWE A;  4I2O A;  3C7J A;  1T6U A;  4Y15 A;  1J8M F;  1Q0F A;  4RAY A;  5F0C A;  4JTA B;  5FCL A;  5HSW A;  4HE8 D;  3M8J A;  3NYJ A;  3TUL A;  4UXN A;  3PM1 A;  3CUO A;  3ZG1 A;  1JUS A;  4J00 A;  1ZVZ A;  2HYJ A;  1IJW C;  1OCR C;  3MX3 A;  3CP2 A;  2Q9A A;  4ON0 A;  1ZRF A;  1U0B B;  4MEX F;  2GM4 A;  5BNG A;  4R1H A;  4EV0 A;  3I58 A;  1APC A;  2XS1 A;  2DI3 A;  1WTY A;  3LFK A;  1SFE A;  4C3I J;  2R02 A;  3HOW J;  2W24 A;  3ZQC A;  3N97 A;  3QVZ A;  1BIB A;  1QQ3 A;  3Q0U A;  5T3W A;  4I0A A;  5DYM A;  1ZK8 A;  2VJ5 A;  1DU0 A;  1E3H A;  3GM2 A;  2HJM A;  3OIO A;  2COM A;  5E1W A;  3L8J A;  3LAJ A;  4B47 A;  2IGO A;  2WAQ A;  1JTY A;  3QW1 A;  2JPU A;  3ABU A;  2ZXH A;  4ESB A;  4K1O A;  3POV A;  2AO9 A;  4J01 A;  3P9K A;  1WAS A;  3X2Q H;  1POG A;  1Z91 A;  1NG1 A;  1G4W R;  2K4B A;  1ZU5 A;  4HDV A;  3VYW A;  5B1B C;  4P5O A;  4ZDP A;  3LQQ A;  4NC8 A;  2J0W A;  4LG0 B;  4KYW A;  3Q9S A;  3V7O A;  2UUH A;  2VKV A;  3RVY A;  3MZY A;  2W4B A;  3I55 I;  1HW1 A;  4HNV A;  5F0H A;  4R32 A;  2CQK A;  3ZOB A;  2CW7 A;  3TD7 A;  1T08 B;  2L6H A;  3EZH A;  4IPA A;  3AG3 C;  4BJ5 A;  5JVT A;  1B1B A;  3HZJ A;  2VB6 A;  4UVC A;  3RDI A;  1MBH A;  2F2E A;  1HA8 A;  4NQF A;  2HEO A;  3ABK C;  1OXK A;  4XM3 A;  1OYY A;  3F22 A;  2IP2 A;  3CCU I;  1ITY A;  3N24 A;  2QE9 A;  2H7B A;  3F3X A;  2JZY A;  4CIC A;  1YRN B;  4EHP A;  2M30 A;  3CUQ A;  2QSH X;  3SJM A;  3EUH C;  4CCJ A;  1JKO C;  2E7X A;  4ITV A;  4BXF A;  3GLX A;  2DXI A;  1IUY A;  2VCC A;  3B6C A;  1M2V A;  3WE2 A;  3I4N J;  2GIZ A;  2HFH A;  1C02 A;  3P7N A;  1ZTR A;  3FAJ A;  4EJW A;  1M2O A;  2YX4 A;  1SEU A;  4C3J J;  4E7H A;  1M56 C;  4PFO A;  3IP4 B;  3M4O J;  4AL0 A;  1H0M A;  2R5Y A;  5E3O A;  1SD4 A;  4PK4 A;  3U5S A;  1S72 I;  1JKP C;  5D5W B;  4BE2 A;  4J32 B;  3US6 A;  4UDV A;  2FD5 A;  2EZK A;  4LIV A;  1TL8 A;  2IRF G;  2LIG A;  3ZQV A;  3GEH A;  2J45 A;  4V2G A;  2AVK A;  4FQG A;  1G59 A;  3ULQ B;  3I9V 2;  2R9R B;  1G3S A;  1TQM A;  3R4K A;  4BAC A;  2LF7 A;  2VIX A;  1JPN A;  1VB5 A;  3ASO C;  3WG7 C;  1Z05 A;  4XN0 A;  2QBY A;  1U89 A;  3CDH A;  4XLA A;  5FGM A;  3AG2 H;  2YS9 A;  1IAW A;  4E17 A;  4L5I A;  4UUV A;  1FSH A;  3K10 A;  3HRT A;  2PX9 A;  2W57 A;  4MW8 A;  1S3J A;  3FHD A;  5ILU A;  2IS1 A;  2ZB9 A;  3KFW X;  3M4C A;  5LEJ A;  2WV0 A;  5B3S H;  3L2R A;  4L18 B;  2YQY A;  3HOU J;  1WWX A;  4AVZ A;  3W3C A;  5T3T A;  2DYS C;  2LVS A;  2XAJ A;  2UZK A;  1LI5 A;  2NS0 A;  1R4M B;  2P5V A;  5LD2 C;  2RD9 A;  4DYQ A;  1CGN A;  3RCO A;  4BJ5 C;  3DMD A;  2DGJ A;  3SQN A;  1X4O A;  3BR2 A;  3FMR A;  1G3T A;  3O3K A;  3LSG A;  3QOP A;  3VYT B;  4CX9 A;  1K83 J;  3KZI C;  3FDQ A;  3GM1 A;  3JYY A;  4RGU A;  4U87 A;  3CUQ C;  2FNA A;  3HUG B;  4XLP F;  1TWG A;  1QO0 D;  1Q0M A;  1KON A;  2PJR B;  2KLO A;  2Q9C A;  2ZXO A;  3I4U A;  4FAS D;  3FHN A;  4W1U A;  3TP0 A;  3I56 I;  2E1N A;  2OUM A;  2CFX A;  2HQ5 A;  4JEA A;  2P7V B;  4N6H A;  1R9T J;  3L2W A;  1FR0 A;  3EFO B;  1OR2 A;  5BMZ A;  3AL0 C;  2XRN A;  2N8G A;  4MQV A;  2ZXI A;  4RGX A;  5DEQ A;  3LWF A;  5KAI C;  2L2O A;  3WU0 A;  1NU9 C;  4WJ0 A;  3ATP A;  3FXL A;  1OW6 A;  4LOC A;  3C63 A;  3MEX A;  2GAQ A;  3HGG A;  5DV5 A;  4B3A A;  3WE3 A;  4JOM A;  3OYJ A;  4HV5 A;  3LA2 A;  1ZKG A;  3L09 A;  4AC0 A;  1VF9 A;  1JGG A;  2KJG A;  3A02 A;  4JEB A;  3OWT A;  4IJA A;  2CO5 A;  1FC3 A;  2HXI A;  2L01 A;  2ZJ2 A;  3DJU B;  5DLJ A;  3TK0 A;  1XZP A;  5D4S A;  1I6H J;  5EF6 A;  5FLV A;  1XB4 A;  2A05 A;  2F5F A;  4XLE A;  2NNN A;  4XSX F;  2VC1 A;  3GAN A;  2M8G X;  2XKP A;  2F22 A;  2K86 A;  1HKQ A;  3E0J B;  3P9I A;  2HOT A;  3Q5F A;  3ABT A;  3CCL I;  1W0T A;  1YIO A;  2YU3 A;  3C8G D;  3J06 A;  2BXY A;  1R00 A;  1E84 A;  1CPR A;  3FXO A;  1JKQ C;  2JD3 A;  1A6I A;  4ULW A;  5FJ8 J;  2DA2 A;  2KW3 C;  1Z77 A;  2A61 A;  2MD5 A;  1LB2 A;  1FY7 A;  2ACJ A;  4OIQ F;  4AWX B;  3I5Q A;  1TW3 A;  3OYH A;  1LEB A;  2RQQ A;  4RB3 C;  3WTX C;  3WU1 B;  3R0J A;  3V5Y A;  2V9V A;  1X1D A;  3OYB A;  3LSM A;  3TW7 A;  3BP8 A;  4IKF A;  1PUF B;  4NQW A;  4E7K A;  3GXO A;  3I53 A;  4Y7N J;  4N06 A;  1HW2 A;  4RDU A;  4RB0 A;  3E70 C;  4A3B J;  1VOM A;  3KH2 A;  5K5Q A;  4X0G A;  3I3L A;  4ZJZ A;  4U9D A;  2CQN A;  2E2H J;  1FYM A;  5IYB J;  1YJN I;  2Q2E A;  1E83 A;  1GT0 C;  2MYS A;  2CV1 A;  5AGF A;  2HWV A;  1BOA A;  2EIN H;  3TGN A;  1UHM A;  2TDX A;  1OKK D;  2VQL A;  2HI3 A;  2I15 A;  1R5G A;  5KCM A;  5J4V A;  1K6O A;  5HVQ C;  5JVE A;  1DGR M;  1UG7 A;  3L00 A;  2VKE A;  1ETV A;  2P8T A;  3BG5 A;  4XKB A;  4CSW A;  1R49 A;  4M6V A;  2IS6 A;  2IXS A;  3CCS I;  2YLD A;  2H8W A;  3LOC A;  4X1E A;  4YIF A;  1SFX A;  4I7H A;  2CQX A;  4R79 A;  2D45 A;  2LNB A;  1NK2 P;  1A5J A;  2EJR A;  2GOX B;  2J46 A;  5FRO A;  5CVU A;  4M6Y A;  4J30 B;  3PL8 A;  2VC9 A;  1U5T B;  3OMY A;  5DCM A;  5KK1 A;  1TFK B;  4A3J J;  2KQ9 A;  3ECO A;  3A0H C;  3S29 A;  5A2Q Z;  4HFF B;  3DM5 A;  1Z1D A;  2CUE A;  5L0H A;  3MFN A;  2FOK A;  4XEF A;  3K4J A;  4UUT A;  5DD8 A;  4ZYA A;  3PUB A;  5JVG F;  3V7S A;  3HLZ A;  4LLE A;  5FD6 A;  1QVT A;  1RIO H;  3EUA A;  2PFD A;  3L8I A;  2RGV A;  2V3C C;  5GAG J;  4M3F A;  1ZRE A;  2EV6 A;  3Q6N A;  1N25 A;  2A69 F;  2PMZ A;  3ZQQ A;  3PIO F;  5BPD A;  2O8K A;  2YU9 J;  1ZW3 A;  1TFO B;  2V4J C;  2R7S A;  4BNC A;  4ONS A;  3S27 A;  2OJE D;  2V9K A;  4DVZ A;  1SAN A;  1OCO C;  2YSR A;  1K6Y A;  3ZMZ A;  4GRI A;  1QVX A;  2YL7 A;  3ABL C;  3ZPL A;  3M4B A;  3CEX A;  5EGY A;  2IM8 A;  2ID3 A;  2IBF A;  3QYE A;  1KGS A;  2AWY A;  2E87 A;  5J1U A;  4IOC F;  3M1C B;  5HLI A;  1V54 C;  1ZW2 A;  4BHC A;  4F3Q A;  3ZRG A;  5EEA A;  2F48 A;  4KIC A;  3RSN A;  1J75 A;  1FFH A;  2XPV A;  3FXR A;  4A5N A;  4A3E J;  3S1Q J;  4BQQ A;  3G4S I;  1J9I A;  4JJG A;  1RNL A;  3OS0 A;  3QRF F;  1K05 A;  1BI2 A;  4F52 A;  3TO7 A;  1FZP B;  2W45 A;  2OOC A;  3BR3 A;  4BQA A;  3UNG C;  1W5C C;  4HNU A;  1IC8 A;  5D91 A;  4YIR X;  4L9J A;  1P7I A;  1QSP A;  3E1S A;  2PJP A;  4BDY A;  2YWA A;  1NFN A;  3H2U A;  1WZ2 A;  3SXK A;  2KIF A;  3NRH A;  2GOM A;  1FFT C;  3S90 A;  1SMY F;  3DAG A;  3CC2 I;  4NC3 A;  2K9L A;  4CDV A;  2W84 A;  1JUM A;  3GUD A;  2IEK A;  1O5H A;  5B1B H;  2CNW A;  2ZPA A;  3DWW A;  2XGC A;  3A4C A;  1TW2 A;  2YKZ A;  1P9Q C;  3Q9V A;  5EG0 A;  4D7M A;  1I50 J;  2DOA A;  2R3S A;  3CES A;  2CGP A;  3OS1 A;  4I76 A;  1XCB A;  3DP7 A;  1G2H A;  4M74 A;  1H7I A;  1SD7 A;  1STZ A;  2M87 A;  4CCO A;  5ED4 A;  3K66 A;  1OW8 A;  3JRC A;  1BW6 A;  2OU2 A;  1Y4C A;  3AG3 H;  4EEF G;  2PLY A;  2XF6 A;  4XPX A;  1ETY A;  4JTC B;  5KYN A;  2Q9B A;  3O6X A;  2OZ6 A;  5B3I A;  2KKO A;  5T1D B;  5D8L B;  2DA5 A;  1R5H A;  3X1O A;  3RI4 A;  2K27 A;  3E5U A;  5H2F C;  1M57 C;  1DP3 A;  2H6B A;  2IGN A;  1F36 A;  2E5N A;  2NOJ B;  3E3V A;  1O7L A;  3HDD A;  3GYH X;  1D5Y A;  1Z67 A;  2QCO A;  1LDD A;  1HXD A;  1AVO B;  3SZR A;  5DQZ A;  1AUE A;  2J9B A;  4FTH A;  4LDK A;  3K0L A;  2OPT A;  2KRC A;  1DQU A;  2IBD A;  4EM2 A;  2WB7 A;  2OTL I;  3D5R C;  3J7A O;  4ZLC A;  1JPJ A;  4XRF A;  1N75 A;  3MLG A;  1WI9 A;  2IXM A;  3COA C;  3FXQ A;  5HLT A;  3SZT A;  1LFP A;  1OQY A;  1XSV A;  1RZ4 A;  2E7W A;  3HTK C;  3DAF A;  1X4P A;  3AOU A;  1CF7 A;  4G6T B;  3NWS A;  2P81 A;  4JYK A;  3OYF A;  4G94 A;  3GTL J;  3IQC A;  2HYF A;  3FXM A;  3RPU A;  2ZXJ A;  4MNU A;  4U5D E;  1BOB A;  3NAR A;  3ZTM A;  3WHC A;  3C1D A;  4L6R A;  1MND A;  4DBQ A;  1I5Z A;  4KFC A;  3FMS A;  4ZDO A;  4U5F E;  4AIK A;  4UVA A;  4FCY A;  2ECB A;  3GX4 X;  2F5D A;  2L81 A;  3V8L A;  4KA4 A;  1JHH A;  4YFN F;  1LIH A;  2PX3 A;  4RLF A;  3RYP A;  2XDV A;  5JFR A;  3H0G J;  3RQG A;  2M4K A;  2F5V A;  1EF4 A;  1HLV A;  3BG6 A;  1UHW A;  2M8E A;  3S9O A;  3JCU C;  2XM0 A;  1XGN A;  2CQQ A;  3OOU A;  3ZQL A;  3ZQ7 A;  1IF1 A;  1LPE A;  2I8D A;  4HDU A;  4KMF A;  2Z2S B;  4KIB A;  1OMI A;  1VQK I;  1B6A A;  1UB9 A;  3K4M A;  1XPX A;  3B9Q A;  4QTR A;  1FTS A;  1YA9 A;  3KP2 A;  256B A;  2GWR A;  4I0B A;  2F5C A;  3Q0V A;  2IA2 A;  1G8X A;  3ASN H;  2WC2 A;  2FRH A;  4C7O B;  4H0E A;  1M1E B;  4ANJ A;  1QZY A;  3KEY A;  3N2Z B;  1Z7Q c;  3K1H A;  2LY9 A;  2VC0 A;  1IRZ A;  3UMI A;  1XMA A;  2GAU A;  3DKW A;  1MMN A;  2X0C A;  4C30 A;  1XMK A;  5JLW A;  1ZHF A;  2VJ4 A;  1R4T A;  4BEH B;  1BBH A;  2WV1 A;  5J3L A;  5J1Y A;  1FSE A;  3CAX A;  5E1Z B;  5J4Y A;  3D5L A;  4XKW A;  3RJP A;  3JSP A;  4NTA A;  5L3C A;  2DK8 A;  2JTV A;  4YEJ A;  2ZME B;  3K4B A;  5B1A C;  3W8H A;  1SR2 A;  4Y17 A;  2X1D A;  3NMJ A;  3SNH A;  2L4M A;  3PJR A;  2LF8 A;  1Z23 A;  2MC4 A;  4N6C A;  2QVO A;  3DJN B;  2HDC A;  2LTP A;  1D1C A;  2A3S A;  4QIW N;  4NUB A;  2FAP B;  3BTI A;  3ZC4 A;  3MZ8 A;  2CWE A;  3J7Y J;  1ZN2 A;  3FXJ A;  4Z6Y A;  3CJT B;  2D4U A;  4IHT A;  2HZD A;  3WTW C;  2CMP A;  2UV1 A;  4E7S A;  1TC3 C;  4AX2 A;  3IH2 A;  2HXO A;  4RB2 C;  3HEF A;  5A2Q K;  5KYW B;  3C2H A;  4H54 A;  3I59 A;  3HM5 A;  3KEO A;  1JT0 A;  1I6X A;  5FKM A;  4ZC3 A;  3R0A A;  1K04 A;  4A3D J;  6PAX A;  1Y8R B;  5E8I A;  2GA0 A;  2HJ3 A;  1BIA A;  1O4X A;  4LLN A;  4U5B E;  2W4M A;  3W2V A;  3ZWI A;  2QYO A;  5JT4 A;  1JT6 A;  2R7R A;  3U1K A;  2GA2 A;  3G3Z A;  1P2F A;  2NSF A;  1QBJ A;  2O3F A;  2X51 A;  4F93 B;  3LUT B;  1YJG A;  2DCE A;  1Q0D A;  3S8P A;  1F1Z A;  1SVL A;  1KA8 A;  4C3H J;  2NNY A;  3FK6 A;  2KIQ A;  3B6A A;  1IZ1 A;  4DRI B;  5CI8 A;  4YL3 A;  1TNS A;  1YZA A;  5L0J A;  1TWG J;  2NXN B;  3VM6 A;  1I1S A;  4UUS B;  5CJ9 A;  2KFD A;  1RI7 A;  3ZMU A;  3ZSU A;  3VOD A;  1W36 D;  1A6Q A;  3CJQ B;  2B63 J;  2ASR A;  4YII A;  4HYE A;  5ICE A;  5AON A;  2G3V A;  2VQC A;  4OAZ A;  2HVS A;  1KU9 A;  2HDD A;  4LG3 A;  4HF1 A;  4XQ1 A;  1FYK A;  3S1M J;  1WJ5 A;  1FOW A;  5FB2 A;  4U7D A;  4A12 A;  4XLN F;  1O3U A;  3JRD A;  3BEH A;  1YOV B;  1WH5 A;  2CJJ A;  4DJ9 A;  2Y0M A;  4XLF A;  3ZTZ A;  4D4N A;  2QA4 I;  1FBQ A;  1B72 A;  1EH7 A;  1ENH A;  1YX5 A;  2FBK A;  2VLA A;  1SF8 A;  2R5Z B;  2HTS A;  2FMY A;  3K69 A;  4FT8 A;  4N4O B;  3BG9 A;  1FWZ A;  5KAF C;  2KC3 A;  3AG1 C;  4M73 A;  1OCZ C;  3GF2 A;  5D4R A;  4MEY F;  4RAG A;  2LYC A;  4AU7 A;  2EPO A;  4R8H A;  3S3N A;  2OU6 A;  1WPK A;  2XXA B;  2UUI A;  2XAG A;  1HKS A;  3BQY A;  3K4N A;  2JA5 J;  1I4Y A;  5JHF A;  2B9S A;  2CDQ A;  1R4N B;  2F6C A;  3TJ5 A;  1UG2 A;  3VFZ A;  1V55 C;  1P4A A;  3AGU A;  1E85 A;  3RW0 A;  1J8Y F;  4CIH A;  3V5X A;  2ZJQ F;  1N1C A;  4FE4 A;  3EPZ A;  3Q7G A;  3KE2 A;  4LFU A;  1G4D A;  2M7B A;  2W1O A;  4YRV A;  1DPU A;  3V42 A;  1OJL A;  1LFU P;  3DKX A;  1EH8 A;  3M79 A;  2CW8 A;  4BE0 A;  3FOO A;  1FYL A;  1HMO A;  4L9N A;  4XNF A;  5KYU B;  3JRM O;  3RTR A;  4LK1 F;  3W6J B;  3VF0 A;  3NRV A;  1K78 B;  1M6T A;  2L6G A;  3F46 A;  3IHU A;  3FX3 A;  4N4N B;  2YX7 A;  3QQA A;  1T6I A;  2BYV E;  2VOP A;  3H3U A;  2X48 A;  2XLW A;  3IKV A;  3FIS A;  5IP9 J;  5IT3 A;  1YW8 A;  3GFM A;  5FD5 A;  2VBX A;  5K5R A;  3M3Y J;  1XCV A;  4D5F A;  3OYN A;  1VYK A;  4KN7 X;  3JR9 A;  5HLG A;  3DPL C;  5CPR B;  2STW A;  4A3K J;  1JR8 A;  4M3B A;  4RM2 A;  3IV5 A;  3PQK A;  3L2V A;  2LG4 A;  3GZ6 A;  5LBQ A;  1D0X A;  1YFH A;  4LER A;  1O3Q A;  1JI8 A;  4HW0 A;  5GAH J;  1U6H A;  3PUF A;  3DPU A;  3GFI A;  1V54 H;  2LLK A;  3VB2 A;  4DQ2 A;  5BQH A;  2OCC H;  3EYI A;  2V1N A;  3CSK A;  1K40 A;  3B71 A;  5D92 A;  2ELH A;  2YRF A;  3DBR B;  2ZXW C;  1OCP A;  4EIY A;  1J09 A;  2RC4 A;  3CO7 C;  1MSF C;  2MHR A;  2LKP A;  3RKY A;  2YL0 A;  3BQZ A;  1ZZP A;  1OPC A;  4Z2Y A;  5JLI A;  2RNJ A;  3ZDL A;  1Z6T A;  2Y31 A;  4UB8 C;  3MCZ A;  2L9V A;  4HRI A;  3PCV A;  4JJF A;  2MLG A;  2V26 A;  3CQZ A;  2WBM A;  4YWQ A;  4G9Y A;  2QQA A;  2HVQ A;  3F8M A;  3K1N A;  1I3A A;  1WJA A;  2WAE A;  3I4M J;  2STT A;  3H9J A;  5AC5 A;  1WJE A;  4KIT B;  2UWM A;  4IOA F;  2H8R A;  1WAT A;  3ML6 A;  2XM4 A;  4XN3 A;  1VTM P;  3U1D A;  1WI3 A;  1IN4 A;  4NHJ A;  4G12 A;  3BRJ A;  1FPQ A;  2I5U A;  5COG A;  2ESN A;  1T33 A;  1YJ9 I;  2XF7 A;  3PSI A;  2JA7 J;  1B59 A;  3JRI A;  1A31 A;  3UGP A;  3KX2 A;  1GS9 A;  4BG0 A;  1LKX A;  1IG7 A;  4MTD A;  1S7Z A;  2L0K A;  2LBF B;  2M3A A;  4NTF A;  2QWW A;  4EGY A;  2Q4F A;  1R1V A;  1LDJ A;  5CQE A;  4LDR A;  3DE8 A;  5TJJ A;  3K33 A;  3S2H J;  4DNC A;  2W82 A;  3SP1 A;  4JC7 A;  5LHH A;  3G1M A;  1Y6I A;  2P6T A;  1V4R A;  2J7P D;  3RKX A;  2O8X A;  2XSD C;  4BAY A;  3M1E A;  1HE1 A;  1FBU A;  3L2C A;  3BR5 A;  4C9Y A;  3V8K A;  5E33 A;  3GZ5 A;  4EGZ A;  3MN2 A;  2CRG A;  4ENJ A;  1LPQ A;  3PDM P;  3E6M A;  5LHI A;  1R58 A;  1U9O A;  3QVY A;  3OY9 A;  3CCM I;  2Q8K A;  1VYI A;  1HQC A;  1X2M A;  2IS4 A;  3U8P A;  1UMQ A;  2EIJ C;  1YS6 A;  2VBZ A;  3ZMS A;  2QLA A;  3IAS 2;  2IOQ A;  4C3E A;  2NOG A;  4WXC A;  1TWH A;  1QZZ A;  3M15 A;  2X85 A;  3QAH A;  1WFX A;  1XD7 A;  4C2M J;  2P4W A;  1Y8Q B;  1D1B A;  1V3F A;  2EZH A;  2K40 A;  2WB1 A;  3HJE A;  4RGR A;  4A3M J;  1SYQ A;  3OL4 A;  1TP4 A;  5BS6 A;  5JUA A;  1BJA A;  1VK5 A;  4HX7 A;  2IAI A;  2P7V A;  1Z6R A;  2XKO A;  3U3B A;  5H20 A;  3F8N A;  3QPT A;  3VSL A;  4XRS G;  2IVM A;  2ME6 A;  3V4G A;  1Z7U A;  3NQO A;  4IVN A;  3CZ6 A;  2XV4 S;  3IWF A;  3F8F A;  3OYL A;  5D8K B;  4CCM A;  1G5Z A;  3H3V K;  3IH4 A;  4HZF A;  3K70 D;  1SFU A;  1Y56 A;  2EV0 A;  2JUG A;  3WU2 C;  1BJZ A;  4NY3 A;  2KRH A;  2EIM C;  3GTJ J;  1U6G A;  3WTU C;  2HQN A;  4RAF A;  4KC9 A;  4U5E E;  1ON2 A;  5GAE J;  5KHD A;  4AVP A;  4JRZ A;  5L0D A;  3E6D A;  4KDP A;  3JSZ A;  2CUJ A;  1BI3 A;  1CPQ A;  4E0H A;  3FXU A;  1UFB A;  5IY5 H;  2J0X A;  3J7Z I;  2IT0 A;  3NKE A;  4KIF A;  2RRE A;  1L0O C;  3J80 Z;  3IQ6 A;  3CC4 I;  3P9C A;  2KIU A;  3MKW B;  4GGG A;  1YJW I;  3AJM A;  1FOY A;  1IDY A;  2RV8 A;  3LSI A;  4AIH A;  3OYM A;  3A11 A;  5BQG A;  3RVZ A;  1D8J A;  1Y6D A;  1A41 A;  2JJ7 A;  4FX4 A;  3C8G A;  3SFI A;  1UCR A;  1QHH D;  2MSY A;  2BE5 F;  1TWC A;  2CYD A;  4A4A A;  2YR2 A;  2LSO A;  1JJ8 C;  4CDG A;  3W6V A;  5IOY A;  1WGX A;  2PN6 A;  5B1A H;  1PP7 U;  3CCR I;  3FKI J;  3PQJ A;  3IPM O;  1FIP A;  2LP0 A;  4XON A;  5A6B D;  1MH4 A;  3WOD F;  4A93 J;  3HOY J;  4BHP A;  2KT0 A;  3BJA A;  2YL1 A;  3SEQ A;  1W7P D;  2EQR A;  1W7P B;  4IQJ A;  3LL7 A;  3C2B A;  3TP3 A;  4O3M A;  2I10 A;  5F27 A;  2XLD A;  3CLO A;  1RJ9 B;  2OQG A;  5B5E C;  5TRD A;  4PJL A;  1D0Z A;  1NFO A;  2LRD A;  4PJM A;  2QQB A;  3IQT A;  3MKY B;  1T39 A;  1IN8 A;  5E3N A;  2OF7 A;  4GFB A;  2JN6 A;  1OKK A;  2W85 A;  2JSP A;  2MAB A;  3TOB A;  1JTX A;  3SZG A;  2DW4 A;  4B48 A;  1R7J A;  3BZ6 A;  1T56 A;  2LQG A;  4E6K G;  2PNO A;  3DBH B;  3HKZ A;  2ZJP F;  4J7Y A;  4WXH A;  2OV7 A;  3KP3 A;  2XS8 A;  4Z9J A;  3HHH A;  4P96 A;  2YLI A;  2DMN A;  4IRH A;  1RKC A;  1B9M A;  1JUP A;  2GXG A;  1OR3 A;  4JX6 A;  1TNT A;  3E7L A;  4KMU X;  4GYI A;  2HOS A;  5DS9 A;  3T0Y A;  2H6C A;  4WF2 A;  1DUX C;  2QLZ A;  3DBL B;  1VMA A;  4IXA A;  2R7T A;  2F4I A;  3DM9 B;  1U5T A;  3K4L A;  2HGC A;  3GFJ A;  1ZGA A;  1A35 A;  3HKK A;  1R71 A;  2D1V A;  4EVI A;  2WAQ N;  3DKY A;  3ZQG A;  4U0V A;  5CIV A;  2ZNZ A;  1YW7 A;  5EEG A;  1LJ9 A;  2H09 A;  5HOD A;  2VXD A;  1H6G A;  3FIW A;  3LFU A;  2MD0 A;  3OL3 A;  4EMS A;  2WB1 N;  3GW2 A;  4MHG A;  3WHB A;  4BH9 A;  1Z0X A;  1JGS A;  2DMU A;  2NUT B;  2Y3G A;  4IHX A;  2JWT A;  3GTO J;  1AA7 A;  5E18 F;  5DDG A;  2K7L A;  3CD6 I;  2OG2 A;  2A6H F;  3M8E A;  3PNV A;  2HS5 A;  5LRS A;  4OIP F;  3MYI A;  3U0C A;  2ZXP A;  3G4X A;  4BY1 J;  4C3B A;  4XKV A;  2QKM B;  2XHK A;  5EGO B;  1Q1H A;  1GDT A;  1V5F A;  2B7E A;  2MBF A;  5DUK A;  2W25 A;  1I1G A;  1KU3 A;  1TZL A;  3CME I;  5E3C A;  3FF5 A;  3ECH A;  1V55 H;  1BM9 A;  4IRI A;  1Z21 A;  2L7Z A;  1VQN I;  1ZEL A;  2BY0 A;  4D9J A;  1FT9 A;  3M1C A;  4HV6 A;  2H1K A;  4WAB A;  1R1T A;  4M9S A;  1O3S A;  3F9K A;  5KYX A;  2EFO A;  3KYJ A;  2EFP A;  4RMN A;  1ZR2 A;  5ILS A;  2V6C A;  1ONV A;  3WTT C;  5DVW A;  4M3D A;  3DLA A;  4G7H F;  4ZYG A;  3LJB A;  2CYY A;  2V7F A;  2GIV A;  2XAU A;  1S05 A;  2DT5 A;  1I27 A;  2EIK C;  4U7B A;  3GOD A;  2A5Y B;  2XAH A;  2O6G E;  4A0X A;  1QPU A;  3BRO A;  1E3P A;  2MWQ A;  4MND A;  4NBQ A;  1SAX A;  1ZHW A;  3CUQ B;  4LB5 A;  1ZH5 A;  1TQI A;  3CMA I;  4AM3 A;  2XSE A;  3S2D J;  1HKT A;  5H6Q A;  4HBL A;  3CJN A;  3RH3 A;  4CSA A;  2HDW A;  1MDM B;  1QLE C;  2IXN A;  1D8K A;  1EH6 A;  3MZH A;  4JVS A;  3NDB B;  4ASN A;  3E97 A;  2CUF A;  3G1O A;  1BR1 A;  3EGD A;  2XPW A;  4CYC A;  4U88 A;  2WL8 A;  3N0T A;  1IRX A;  3SHF A;  2E2J J;  2R5Y B;  4LLG F;  2LRE A;  3H3Z A;  2L3D A;  2WY7 Q;  3S2W A;  1I3Q J;  4PJJ A;  5EEH A;  2R92 J;  1BR4 A;  1J59 A;  4Z9H A;  3HGY A;  2BW3 A;  4E70 A;  3AL0 B;  2M2E A;  1G3W A;  1U5T C;  1OCT C;  2EPF A;  3FVY A;  1SD5 A;  4K2E A;  5BUO A;  1UST A;  5LFA A;  3B0V C;  4BUP A;  3OA1 A;  4AE4 A;  4BQN A;  2BGC A;  1N77 A;  2HQR A;  3L7W A;  4ENN A;  2R7U A;  2NS7 A;  4BS9 A;  1MJA A;  1P92 A;  5D5U B;  4XKC A;  3L0I A;  2QBY B;  2XIG A;  1FMW A;  1GGQ A;  5A6J A;  2AWC A;  5FRM A;  3KLN A;  3G6E I;  2QNL A;  3FM3 A;  5ICG A;  3CCY A;  5EHH A;  2DT6 A;  4YK5 A;  4ULV A;  3CTA A;  4QI2 A;  2AP3 A;  1MGT A;  1T2K A;  3PMR A;  3GEI A;  2HTJ A;  4DW6 A;  1GHC A;  2D2W A;  4I99 C;  5F5H A;  3BTJ A;  4HOB A;  4OIR F;  1Z7L A;  1I5N A;  4LDQ A;  4G6D A;  3ZQF A;  1NLX A;  1RXQ A;  2E36 A;  4A0Y A;  2XGD A;  1F5T A;  1IGN A;  2NVX J;  1QZE A;  1ODD A;  1WHU A;  4KT6 A;  4A5M A;  3B0P A;  2HKO A;  2UXX A;  4O6Y A;  2BY1 A;  1W0U A;  2A07 F;  3QTH A;  3U9J A;  2Z33 A;  3ZVR A;  2BXZ A;  1ST6 A;  2J5O A;  3BC8 A;  5LGU A;  1IZM A;  4U9E A;  2VOO A;  5HDN A;  5KNL A;  3K1P A;  3JSE O;  4CS9 A;  5E3A A;  3HNI A;  3J80 K;  1JMW A;  3VSK A;  5COF A;  4O7G A;  3HNK A;  3P5J A;  2DU9 A;  2WZF A;  1OCC H;  3K1M A;  4QDL A;  3EGX B;  3TJ6 A;  2XSJ C;  4KT5 C;  1QHG A;  3T9O A;  1WKM A;  4MLO A;  2PBI A;  3WG9 A;  3M07 A;  3NYL A;  3TBI A;  2RQP A;  4CSA C;  5L3E A;  1T5O A;  3HOT A;  2M4E A;  1F4K A;  2H8A A;  4IRU A;  4OWR B;  2DA7 A;  1MIJ A;  1FNN A;  2R7Q A;  2A5W A;  2KDZ A;  1OCR H;  2IPQ X;  1DU6 A;  3E5Q A;  2X1C A;  2K3P A;  3HTS B;  1VQ7 I;  4Q5S F;  3QU3 A;  4BXU A;  4IWB A;  1JXS A;  3H36 A;  3KL4 A;  1Q0K A;  1RR7 A;  3CP8 A;  2LSE A;  2TRT A;  2FE3 A;  1GV5 A;  3T6J A;  1GVJ A;  3GME A;  2VT3 A;  4M9X A;  2FBH A;  2GXB A;  2QUP A;  3IEE A;  3G71 I;  3ABM C;  2ESH A;  4EKW A;  2CSO A;  3WTY C;  3LSH A;  4U0Y A;  2E1C A;  3IQ5 A;  3KLO A;  1H88 C;  2K3F A;  1USS A;  2EIJ H;  4G8X A;  4EJU A;  5HLH A;  3BR1 A;  4GQH A;  4C7O A;  1B4A A;  3I5P A;  1IXR C;  4YG2 F;  5ILV A;  4KNY A;  4F4B A;  2IXO A;  3NAU A;  3AG4 C;  2PMU A;  1OFC X;  5LRR A;  4ENK A;  2XAF A;  3HRM A;  3OYA A;  5GAD J;  3LS0 A;  3MAJ A;  2HV6 A;  4CO8 A;  2FU4 A;  3ONQ A;  5F64 A;  4BE1 A;  4Q47 A;  4G7O F;  1ORY A;  1IRF A;  2E5Z A;  1JHF A;  5IOZ A;  1DPR A;  3CF5 F;  4D0P A;  2WA0 A;  1RRJ A;  4LMY A;  1ZGJ A;  3CJR B;  3F21 A;  4IHW A;  1CGP A;  2HSQ A;  1OIS A;  3BT9 A;  2X6Y A;  5D6F A;  1MZB A;  3ZCO A;  3VPR A;  2L9R A;  4JP0 A;  4D7N A;  3JRF A;  4H4K C;  2FML A;  1VZ0 A;  3ESW B;  3UR3 C;  4B44 A;  3ABK H;  3JRG A;  4EJO A;  2R7F A;  3HOX J;  4CS9 C;  4XQF A;  4XPY A;  2HKX A;  2K5C A;  2ID6 A;  2O0Y A;  3OYK A;  5E2Q A;  1ZLJ A;  2VN2 A;  3BR0 A;  5DTD A;  2ISZ A;  3ZN0 A;  2P5L C;  3S1R J;  2XRO A;  1CQT A;  3HTU A;  1GXQ A;  1I4Z A;  4AIJ A;  4L5J A;  4JK1 X;  1FIA A;  2CH0 A;  5FKN A;  2RN7 A;  2JA2 A;  4OMZ A;  2KSF A;  3S28 A;  4QSH A;  1FX7 A;  4MFD A;  5EYR A;  2M4G A;  4NTB A;  1GLN A;  2E1M C;  2Q2E B;  2XAS A;  4G7Z F;  5K7F A;  4M9Z A;  1ETW A;  3VYR B;  5M3F J;  3TOL A;  2NS8 A;  1Z3I X;  1G3Y A;  4XK4 A;  1LI7 A;  1SVO A;  5TIS C;  2KK1 A;  2Y0S A;  1D1A A;  2CCY A;  4UUS A;  2ZNY A;  5LEK A;  1DOW A;  3MFK A;  1YZC A;  5F6F A;  4PJ0 C;  1IV6 A;  1IN7 A;  3ASO H;  2XLE A;  3WG7 H;  2B0H A;  3HIF A;  2NYX A;  2WY8 Q;  1MSE C;  2CS3 A;  3ZQI A;  3DZA A;  3LQR A;  3CMY A;  3KZZ A;  3UMK A;  2FGY A;  2AHQ A;  1CGO A;  3QP6 A;  2LKX A;  5AC4 A;  4E7J A;  2E60 A;  1WRJ A;  3Q0W A;  1YIT I;  3GEZ A;  2M64 A;  1YTY A;  4YT4 A;  4CDA A;  2Y9Y A;  2WVO A;  3TMO A;  1IO2 A;  3LSJ A;  4F55 A;  2M45 A;  4CZC A;  3F6V A;  2O5R A;  2EV5 A;  5K7Z A;  2R5Z A;  3CC7 I;  2X1E A;  1WWP A;  1YA7 O;  3JTL O;  2JUC A;  3I4P A;  2PMZ N;  4KJZ A;  5DM7 F;  1W2W A;  1NSG B;  3WAQ A;  3KIO A;  2W9Y A;  1OKR A;  2VAS A;  3X2Q C;  3S32 A;  4RAZ A;  4BJ6 A;  2XXA A;  4OU0 A;  3FBN B;  3SYT A;  2DYS H;  5J47 A;  1MQV A;  1ORJ A;  1KNY A;  3CCV I;  5E1X A;  4W8P A;  3V7R A;  5AIP A;  4XRM A;  4UV8 A;  4DRJ B;  4GO1 A;  2Z16 A;  3K7D A;  3S3O A;  1P4W A;  3QYF A;  1D3Y A;  4RB1 A;  3JZ0 A;  3W6K B;  2MH9 A;  3HPH A;  3M9A A;  3PFY A;  5GP9 A;  1ZQ3 P;  3CDL A;  3IKT A;  1ZHX A;  3H9G A;  4IAQ A;  1O87 A;  5J8F A;  4JX5 A;  1S7E A;  1QQI A;  2ECC A;  5BOX A;  4ZTJ A;  2XL4 A;  2NUP B;  5KYU A;  3LNR A;  1TWC J;  1WCM J;  1XMX A;  4O5V A;  5IP7 J;  3W8I A;  4I6Z A;  1Y1W J;  1HSJ A;  1QPM A;  2G0E A;  3VEP A;  3UKG A;  1K78 A;  2RDP A;  3GM3 A;  2KZG A;  3GWN A;  1PVE A;  1U0J A;  4IZZ A;  1A7V A;  4RM3 A;  5K7H A;  4FX5 A;  4P6I C;  3CCE I;  5J40 A;  4QPO A;  1VQM I;  1H9T A;  4WK8 F;  1NG7 A;  1O7F A;  1OYI A;  2FBI A;  3JRB A;  3F72 A;  2MGQ A;  1MBG A;  1BC8 C;  1E17 A;  2ETS A;  4IJJ A;  4PZJ A;  1TKN A;  4CJO A;  4YT2 A;  2DMP A;  3TQN A;  4M71 A;  1T01 A;  5JI6 A;  3AGT A;  3V7C A;  5E17 F;  4A69 C;  4LAC B;  4ZZL A;  2RNG A;  3M7G A;  4M72 A;  5HDG A;  3TKY A;  1ETK A;  2IGK A;  2JMW A;  2M0M A;  2XB0 X;  5E20 A;  4DYR A;  1YIJ I;  2P6V A;  1XDS A;  4M3G A;  2CNW D;  3JT1 A;  3VAY A;  2DA6 A;  1RKE A;  1B8I B;  2BOL A;  2DYR C;  5EG0 B;  2OZU A;  3S14 J;  4IAR A;  3U3F A;  4IB4 A;  1ON1 A;  2DA3 A;  2X4H A;  2Q0O A;  2R7X A;  1T6S A;  1GQA A;  4L0Y B;  1YLF A;  4MVM A;  3AG2 C;  3FK7 A;  1PCX A;  1UG0 A;  4IHY A;  3RIP A;  1PDN C;  2VE8 A;  2P0W A;  4PUS A;  1KTM A;  5LLQ A;  3JRT A;  2EIK H;  2DFE A;  4BJ6 C;  3VYS B;  2BHZ A;  1E3O C;  4LB6 B;  3S93 A;  3G73 A;  2OJQ A;  3EH1 A;  1FP1 D;  4NNJ A;  5K5O A;  3IL2 A;  2H27 A;  1X3Z B;  5E8G A;  2Y3H A;  4MTO A;  2AXT C;  1Q0G A;  3JTG A;  1NG6 A;  4HAM A;  2R7W A;  2WZL A;  3ZMV A;  2NRA C;  1PD0 A;  2WTE A;  4FWV A;  4ZYD A;  1MMG A;  2EPK X;  4ESJ A;  4KNV A;  2X6O A;  2Y0S N;  2HMQ A;  4JKV A;  2CQ7 A;  3SXM A;  4A3G J;  2YVK A;  2CW0 F;  2E19 A;  3JTH A;  1QNT A;  3K7A J;  4MVS A;  4OD5 A;  4II3 A;  2ZD9 A;  5JP7 A;  4FET A;  3BWG A;  1HCR A;  4KI2 A;  1KU7 A;  4M63 A;  3NEU A;  1J5Y A;  1CF7 B;  4AL1 A;  4EUK B;  1MBK A;  2M5W A;  2Z5U A;  1FOK A;  1ORK A;  5HNH A;  1YYX A;  2O03 A;  2QF7 A;  1O3T A;  2CGE A;  5DS6 A;  4A3L J;  1LUJ B;  1S8N A;  2Y75 A;  1UAA A;  1ZHY A;  4EBB A;  1YG2 A;  1BA5 A;  4P1W A;  3B02 A;  2DQR A;  3OYG A;  1C03 A;  3VRC A;  5GPC A;  5L0G A;  5H6R A;  2Y69 C;  5D6E A;  2VI6 A;  1HDP A;  3QOE A;  3IWZ A;  1TR2 A;  2FXA A;  4XTK A;  5HS8 A;  4PAC A;  1BDJ B;  1X1C A;  3ZGK A;  1OLT A;  3WTV C;  3BJ6 A;  3R61 A;  4QWQ A;  3VOE A;  3K4C A;  3R60 A;  5B66 C;  3HNL A;  2LP4 A;  1MW7 A;  3RQI A;  5CLS A;  1SD6 A;  2DAO A;  1L3L A;  1W1W E;  3HOV J;  2DA4 A;  1X2N A;  3RFY A;  5FO5 A;  4IX7 A;  2HUJ A;  1ZU4 A;  5C3E J;  3DLL F;  3T5X A;  2HVR A;  2KP6 A;  3TOM A;  1S9H A;  3DXJ F;  3WTZ A;  1XX5 A;  3KP7 A;  4BL0 B;  1IRG A;  1RUO A;  1FMV A;  2K9M A;  2XAQ A;  3E6B A;  2NVY J;  3VDX A;  3HOZ J;  4J7T A;  4OIO F;  4Z9I A;  3V5Z A;  3CCJ I;  2EZI A;  5L3G A;  1U8R A;  2HPM A;  3CLQ A;  2L5Q A;  3LSP A;  4MVQ A;  4HQM A;  3EHM A;  1H8A C;  2LFD A;  4BDZ A;  2C6Y A;  2LD5 A;  3H65 A;  3E9V A;  4RLQ A;  1E86 A;  1HST A;  5CI9 A;  4YL0 A;  4PR9 A;  4MTE A;  4LG0 A;  4DBR A;  4E7L A;  2LK4 A;  2V1X A;  4IL6 C;  1LE2 A;  4FE7 A;  5EK0 A;  4XLC A;  5J1R A;  4Q48 A;  1OCO H;  1T98 A;  1BBY A;  1MNM C;  3GTM J;  3ABL H;  4Y33 A;  1XS9 A;  2FF4 A;  3F23 A;  4BGD A;  4Y3O A;  5L3Q A;  3SDG A;  5CVI A;  4UVB A;  4XBF A;  3T4R A;  1Z3X A;  1OR7 A;  1X1P A;  2DOD A;  5FRN A;  1FAP B;  4HEA J;  3LMM A;  5L3D A;  1YRN A;  1T8I A;  5ICF A;  1XC5 A;  2Z15 A;  4XL9 A;  3L1M A;  1BL0 A;  3K2Z A;  4DYC A;  3DE9 A;  3BY6 A;  2Q3T A;  3ECS A;  4IRG A;  1UJ8 A;  3KET A;  5GPG B;  2E35 A;  2VXZ A;  3F47 A;  3EPV A;  4E4H A;  3SEZ A;  2CFO A;  2FSW A;  3A0B C;  3HBL A;  3RKW A;  1WJB A;  1R23 A;  1GM5 A;  4CBE A;  5A6K A;  1FJL A;  3I59 B;  1AHD P;  1ZAR A;  2L7A A;  3D5S C;  1LVK A;  4WCG A;  4NCQ A;  3AG4 H;  3BCB A;  4N9I A;  4FX0 A;  3A9C A;  2KPM A;  3FXK A;  3CF2 A;  2L9N A;  3LNQ A;  4IGG A;  1V5G A;  3JW4 A;  3KYD B;  1X1B A;  2KRF A;  2YZS A;  4BEJ A;  4L9T A;  4RBO A;  3QU6 A;  4EJT A;  3LA7 A;  2RSE B;  4DZJ A;  2OA4 A;  3J81 Z;  1VQ8 I;  2PX0 A;  3G1L A;  1MKM A;  1YI2 I;  2Z9O A;  2L7K A;  3GLL A;  2OQR A;  4HQE A;  3O55 A;  3BZK A;  1P7J A;  1W7P A;  3KZY A;  2OTJ I;  1OW7 A;  4P9F A;  4ETS A;  3K6B A;  3DEW A;  4MIM A;  2MFZ A;  1XZQ A;  1RJ9 A;  2YUS A;  1U78 A;  1XDU A;  3GCM A;  1GV2 A;  2XL6 A;  1YYV A;  4GCV A;  4B3X A;  2NVT J;  3A2K A;  4GXO A;  5FFX A;  1EJ9 A;  1QVU A;  5LGN A;  4WGZ A;  2G3K A;  3GEE A;  5E79 C;  4LIU A;  3N4M A;  2A6T A;  1G6N A;  3AAF A;  1B72 B;  3KMI A;  2WVQ A;  2DFF A;  1P6R A;  3HSR A;  3BDD A;  4XOP A;  4YEL A;  3TED A;  3BOQ A;  1S29 A;  3FAP B;  3A01 B;  4CGZ A;  3K70 C;  1KYZ A;  2L7M P;  5K1Y A;  2HSB A;  5DD4 A;  1U3E M;  2EFN A;  2H7V C;  5IYC J;  2DPD A;  4HFK B;  1TWF J;  1Y0N A;  4YFK F;  1MJB A;  4HST A;  4GYT A;  1OR7 C;  4PGH A;  1R22 A;  2LMD A;  1DGW Y;  3DTE A;  3TO9 A;  2V79 A;  1ETX A;  5J6X A;  2R0Q C;  1R6R A;  1U2W A;  3HUG A;  2W7N A;  1ZGW A;  1ZLK A;  2R7V A;  2HKV A;  2PJR A;  1NHA A;  2IW5 A;  4UV9 A;  1DP7 P;  2Q1Z B;  4LGW A;  2JA6 J;  3MD2 A;  5FFZ A;  3U21 A;  4A2N B;  2ELK A;  1X3W B;  2W48 A;  5FKO A;  1LFB A;  3KEQ A;  3ZN1 A;  5IP6 A;  3F6O A;  3QPH A;  1MBF A;  1AKH B;  2DOF A;  1I39 A;  2B0L A;  1N78 A;  3B0U X;  4B8X A;  3S17 J;  2YL3 A;  4V2F A;  2O61 A;  4JCH A;  1ZRD A;  3EFO A;  4A0Z A;  5HS9 A;  2IGM A;  4MGR A;  2KMU A;  2ZXR A;  2XGX A;  2NUT A;  1LQ1 A;  3O10 A;  4FIS A;  4XEK A;  4ABZ A;  4HF0 A;  2QSG X;  4EBJ A;  3OR1 C;  1EA8 A;  2EBI A;  3KP5 A;  1EI7 A;  3WTS C;  3BPV A;  3SXZ A;  2DFI A;  5EGO A;  3PO2 J;  1PJR A;  1S7A A;  1VTN C;  2P61 A;  4KIS A;  4J19 A;  1T6Q A;  3JRH A;  1K4S A;  4YT5 A;  2CUZ A;  3RQ4 A;  1F9N A;  3ERE D;  3IAM 2;  2FOW A;  2J5P A;  3KP4 A;  4IQ4 A;  5L0I A;  3H1C A;  3S15 J;  3DPT A;  3ZQY A;  2Z99 A;  1TWA A;  3ELK A;  4HEA 2;  2BZT A;  2X6X A;  3MKL A;  3MWM A;  3L1P A;  2PI0 A;  4BBR J;  1LE8 B;  2CG4 A;  1IUF A;  2VON A;  2DO7 A;  4N4W A;  3ITF A;  3TDZ C;  4BYY A;  4MTF A;  3OYC A;  1CGM E;  2MH2 A;  5EDN A;  2DTZ A;  4NC7 A;  1ZHT A;  3RQE A;  1KQ0 A;  5F5F A;  1FTZ A;  2PP4 A;  2PMH A;  3K2A A;  5KYY B;  1MDM A;  2A68 F;  4Y52 J;  3R7C A;  3EG9 B;  3L9F A;  3B29 A;  2DLL A;  1S7O A;  3F0C A;  2ZSI B;  2ZSH B;  1RKT A;  1HOM A;  4IAO A;  1IW7 F;  2ISY A;  1LE4 A;  2TMV P;  1PUF A;  3RKO F;  4LD5 A;  4CCK A;  3AQC A;  1VND A;  2WAD A;  4OOI A;  3ZMD A;  3KP6 A;  5D5V B;  1SC7 A;  3MQ0 A;  4MVR A;  1GXP A;  2EWN A;  2QKL B;  5IYD J;  2VE9 A;  1TQP A;  4YN0 B;  1J2X A;  1YVI A;  4EWC A;  3L2U A;  3DTK A;  3TQO A;  2FJ1 A;  2OD5 A;  5IPA A;  1VQ4 I;  4WX9 A;  3FMQ A;  2VT2 A;  3C2G A;  3M8F A;  2F5E A;  2DYR H;  2OCE A;  3HHG A;  3DF8 A;  3LAP A;  4ZTF A;  5TGT A;  1EKE A;  2G7H A;  3I54 A;  1U8B A;  3FOP A;  1WQ2 A;  3MMY B;  3EUK L;  3IRQ A;  3L34 A;  1D0Y A;  3H0D A;  2TCT A;  1V74 B;  2KGO A;  1OYW A;  2EK5 A;  2LKS A;  3MVP A;  4JCZ A;  4GYG A;  2F4O B;  3EQL F;  2QTV A;  3AFH A;  2VBY A;  3LSR A;  4U5C E;  3I5U A;  2BL2 A;  4CIP A;  2NVU B;  2FUG 2;  4A3I J;  2DTR A;  1YX3 A;  4C2T A;  1BW5 A;  4HA8 A;  3OSF A;  3BJO A;  4JZA A;  5JHU A;  4CDY A;  2ETH A;  5DS5 A;  3HPG A;  2HNH A;  1MMA A;  4UY8 I;  3GTG J;  2NSG A;  3RYL A;  3FKJ A;  1ZYR F;  5FLX Z;  1NH3 A;  1LS4 A;  3HRU A;  2IS2 A;  1APL C;  1LEA A;  1X3U A;  1FEX A;  3DEU A;  2BVL A;  3ZR8 X;  5JR3 A;  1A7E A;  2QEN A;  3WGI A;  4BXX J;  1VQP I;  1C0W A;  2ZO4 A;  4B6I A;  2AQE A;  4MVU A;  5FLM J;  2XL8 A;  3MBG A;  2VKH A;  3OR2 C;  3ASN C;  2XLV A;  5GTH C;  4ENM A;  3TL4 X;  2LY2 A;  3JYH A;  3AQB A;  4I01 A;  4MO7 A;  2X6W A;  3DQV C;  4BY7 J;  2VCA A;  3EGX A;  3AG1 H;  2DDA A;  1OCZ H;  2KJC A;  4CHU A;  5A69 A;  2CU7 A;  3HXL A;  5DS4 A;  1QU3 A;  2KYH A;  3VYU B;  1AEP A;  3LA3 A;  2FA5 A;  5EZH A;  2PFB A;  2XLH A;  2M7A A;  5F1R A;  2BVM A;  3BTC A;  2H7O A;  4QPQ A;  4L9V A;  1X1A A;  2Y69 H;  2EFW A;  4GEH A;  3H2V A;  3JCU Q;  4WWC A;  4B43 A;  1FOX A;  3KYI A;  2MC3 A;  1PD1 A;  2Y39 A;  3U8V A;  2GDC A;  5KVR A;  5FKK A;  1NZE A;  2JRM A;  3D0S A;  3J81 K;  4QI0 A;  2JPC A;  1IDZ A;  1VFC A;  4XRS A;  1TT5 B;  3T1B A;  2OAZ A;  4PDK A;  4PFP A;  4ER9 A;  3BCA A;  4XLH A;  3Q3S A;  2D1H A;  1HE9 A;  5CQG A;  3LNM B;  3S0X A;  3EJN A;  2P5K A;  2VL8 A;  1WJF A;  2L54 A;  3U2M A;  4P9U A;  1QKR A;  3C8Z A;  1QGP A;  5M5W J;  1FLI A;  1ACI A;  4F92 B;  1L3P A;  2V6E A;  1M2V B;  4BPM A;  4E18 A;  2PQ8 A;  2KHM A;  3NKD A;  5EZG A;  1YDI A;  4PSW A;  4OMY A;  1C17 M;  2M9H A;  2JK3 A;  4CXF A;  1WGW A;  2V9P A;  2A0U A;  1EV7 A;  2ZC2 A;  4N9H A;  4K7B A;  4AYB A;  4F7Z A;  3IRR A;  3RF3 A;  2XLO A;  2K9N A;  2A0B A;  1JKR C;  3NG1 A;  2YPR A;  3C8G B;  4XIC A;  4HF2 A;  2VPL A;  2GQQ A;  4CYD A;  3I64 A;  2QY9 A;  1R5I D;  1NK3 P;  2OKU A;  4HSR A;  3QPL A;  4ZYH A;  1XGM A;  1QA6 A;  3LSK A;  3BG7 A;  2Q7R A;  1VLT A;  2XB5 A;  4MQ9 F;  5CKT A;  5M3M J;  4WGY A;  4I09 A;  2ZXW H;  4EM1 A;  1YAU O;  1X19 A;  1ETQ A;  3DFG A;  4YL1 A;  1XSD A;  1S5L C;  2DMQ A;  1J7K A;  1XTA A;  1ZR4 A;  3PIP F;  2L9J A;  4ZYE A;  3HRS A;  2ELJ A;  3HC7 A;  5ERI A;  1BZ4 A;  2IXP A;  4KIG A;  5CVJ A;  5DUI A;  5IT9 Z;  2RVC A;  3HKZ N;  3SDB A;  2VBW A;  2IA1 A;  2XF5 A;  3K9T A;  3PO3 J;  2DBB A;  2GFH A;  2XRH A;  4KBL A;  4RBN A;  3BG3 A;  2IYL D;  2R7O A;  2KJB A;  5FKL A;  3F8C A;  2DJI A;  1LS1 A;  1Z63 A;  3DEE A;  4HX8 A;  2VOD A;  2G62 A;  4G6Q A;  1T95 A;  2ZBK A;  3GWZ A;  5DCF A;  1AWC A;  5L0F A;  4PCQ A;  4JW1 A;  2ZFU A;  4F91 B;  1H89 C;  2BC5 A;  3QZC A;  2A6E F;  3DI5 A;  4I98 B;  1R36 A;  2JVH A;  2EB7 A;  3TO6 A;  2DPU A;  2QGU A;  4G78 A;  1YAR O;  5C4J J;  2DFH A;  4JQF A;  4BQO A;  3R6S A;  4JTD B;  1IN6 A;  2OEV A;  2BY2 A;  4CCN A;  1KU2 A;  3GZN B;  4M3E A;  3EZI A;  1RCP A;  2FQ3 A;  2C04 A;  4YT8 A;  2GBY A;  3E6C C;  2P0N A;  1FBS A;  3NWT A;  1K4T A;  4P55 A;  1NTC A;  3JRA A;  2R7Z J;  2EH3 A;  4BU2 A;  1P4X A;  2GA1 A;  3JAM Z;  3F8B A;  3U2R A;  2FQ4 A;  1IXC A;  3NYM A;  5BPI A;  2E1O A;  4HLX A;  1MBJ A;  9ANT A;  4EQQ A;  3CCQ I;  2OEX A;  3LLK A;  3LLI A;  3KYL A;  5L3B A;  1XWJ A;  4LLC A;  2MW8 A;  4EJV A;  3ZQH A;  2EPN A;  4AID A;  3DD7 A;  4QLC U;  5ICC A;  1VQ9 I;  4KNW A;  3PSF A;  2HR3 A;  2AXL A;  4MW3 A;  4AK9 A;  1ULY A;  2M34 A;  2UUZ A;  1YLM A;  3H9Q A;  1BI0 A;  1X58 A;  3CQZ J;  2R25 A;  1ZAO A;  3BR6 A;  2EIL C;  2DMT A;  4TV7 A;  2HQA A;  4II2 A;  2DJN A;  3FBI B;  5D5X B;  2QEX I;  4CH7 A;  2NUP A;  4NC6 A;  5F04 A;  3I71 A;  1IXS B;  2FEZ A;  4BKX A;  3QP5 A;  3CDI A;  4BEH A;  4XID A;  5KYX B;  2J9W A;  2OCC C;  2P1A A;  3QYB A;  1W5S A;  3QPS A;  3NMI A;  3H5N A;  3TDU C;  2ZME A;  4LLL A;  1SMT A;  4HLY A;  3GTP J;  2ZFW A;  1PP8 F;  1JJ6 C;  1YW9 A;  4BBS J;  2VJJ A;  2ICW G;  4HPQ A;  4XSZ F;  1ETO A;  1HC8 A;  3G4Z A;  3ZIB A;  1MJ9 A;  4AYB N;  2FNP A;  3BTL A;  5FLX K;  2EIM H;  2HMZ A;  1AOY A;  4LJZ F;  4C3D A;  1IV8 A;  2YEV A;  3EGD B;  5KYW A;  4NQW B;  1U9N A;  4O6J A;  4CYC B;  1HDD C;  4I3M A;  1B8I A;  2I8B A;  4X6A J;  3GO5 A;  4A6E A;  4E7I A;  1WJD A;  3QW0 A;  3H5A A;  5K0I A;  2JT1 A;  5HDK A;  2BW3 B;  1YO5 C;  3QMK A;  4DOZ A;  4K0D A;  1F1M A;  1SFO J;  3QWL A;  1K61 A;  2XUB A;  2V1U A;  3FM5 A;  3K4K A;  4OIN F;  5E3L A;  2BBY A;  4O79 A;  2JQ7 A;  4BJ1 A;  4AE4 B;  4MTG A;  2GLO A;  3IH3 A;  3T8R A;  5L3F A;  1UEL B;  3HYI A;  5JSL A;  2FFH A;  3DU6 A;  4OAY A;  4ZDL A;  1T38 A;  1TWH J;  4JBA A;  2XGE A;  4CA0 A;  1VQO I;  4P9T A;  1Z3Y A;  4L0Z B;  4AD9 A;  2P6S A;  1PV3 A;  4W8K A;  1QPI A;  4DIQ A;  2MG4 A;  2HFI A;  2Y9Z A;  4E0I A;  3OV8 A;  1YS7 A;  4L5E A;  5DM6 F;  2EFQ A;  4Q4Z F;  4YFX F;  2G7U A;  2QQ9 A;  4I1O B;  4DVY P;  2PBE A;  1KZH A;  3LEO A;  4CS8 A;  4IHV A;  3SEO A;  1ZG3 A;  4BJT A;  4U5H A;  5TJ5 E;  2XRL A;  4FHT A;  2HYG D;  4BHB A;  3EH2 A;  2QQ8 A;  2KDO A;  5DCM B;  3EET A;  3S84 A;  4MFE A;  2Y2Z A;  2LK2 A;  1Z5Z A;  2RKH A;  1FNT c;  2EA4 A;  1LM3 B;  3EDP A;  2DB4 A;  3ZXS A;  1VLS A;  2BHY A;  3RZD J;  1VI0 A;  1UFM A;  5HS7 A;  3CO6 C;  1PUE E;  2LCH A;  2WWY A;  4W97 A;  3ZP5 A;  4XPW A;  2HZ8 A;  4RS8 A;  3Q6M A;  2ZME C;  2F4M B;  1HW5 A;  2L4A A;  2YLG A;  1KQ9 A;  3T8T A;  3DV8 A;  2O9X A;  3SXY A;  1TBX A;  1RMV A;  1RUN A;  3V8J A;  3KKB A;  2AQF A;  3WGH A;  3HNJ A;  4I02 A;  1A04 A;  2ME0 A;  3LS1 A;  1MD0 A;  3NMK A;  1O3R A;  1VQ6 I;  4UHT A;  4XOT A;  2Y3D A;  2LOO A;  3ZMT A;  1TWA J;  1WSU A;  2E1M B;  3OIQ A;  1RPW A;  2B0J A;  3UMH A;  3U9G A;  2KQR A;  3GWL A;  4DRH B;  3PNY A;  2ZKZ A;  2GZW A;  1TT0 A;  2X0L A;  1YHQ I;  2W4S A;  1NU7 D;  5A6A A;  5JRA A;  4U5G A;  4XMY A;  3L2Q A;  3LES A;  1FP2 A;  2FX0 A;  1Z6A A;  2HPI A;  1Y39 A;  2VPR A;  5F08 A;  1JOG A;  1TQG A;  2L6F A;  3EHN A;  1W5T A;  3Q7L A;  4O6M A;  5IY5 C;  2QSF X;  4A2U A;  4CCL A;  4ESF A;  4RDA A;  3D1N I;  3KYC B;  1Z9C A;  3I0T A;  4CZZ A;  2JX0 A;  3LEV A;  1D5V A;  5IT9 K;  2LH9 A;  2DT7 B;  4HG2 A;  3GOR A;  1XGS A;  2JSC A;  2LFB A;  3GBG A;  4FAP B;  2MA3 A;  1L7C A;  1ORS C;  2YHS A;  3DU5 A;  1H9G A;  2XVC A;  1K79 A;  4CS8 C;  1LDK B;  1LVA A;  2E71 A;  5M5X J;  2Y3B A;  1SFK A;  3MKZ A;  1HF0 A;  1TTY A;  1B9N A;  4ZZD A;  3ISP A;  4Q7C A;  5LHG A;  1EKY A;  4JX4 A;  4AUX A;  5EJC A;  1QRY A;  4IF4 A;  2X9D A;  3GVA A;  1GUU A;  1BC7 C;  3HG9 A;  1VQ5 I;  2Q00 A;  5F28 E;  2IJL A;  4UB6 C;  5LGT A;  3FXH A;  4G0H A;  3W4Y A;  5CVV A;  2E2I J;  2QUF A; 
#chains in the Genus database with same CATH homology
 3DKY A;  4F52 A;  2W45 A;  4B3X A;  3A2K A;  2Z1D A;  2VXD A;  5L3V A;  3UNG C;  4HNU A;  1SAU A;  2MD0 A;  3LFU A;  3OL3 A;  2A1D D;  5D91 A;  5B3S C;  2G3K A;  4XOR A;  4LIU A;  2A6T A;  3E1S A;  4LIT A;  4EAT A;  4BDY A;  3KMI A;  2NUT B;  2WVQ A;  2Y3G A;  3OEO A;  4XOP A;  4YEL A;  1AA7 A;  4Y4R A;  3NRH A;  2GOM A;  1FFT C;  1SMY F;  3DAG A;  2OG2 A;  2K9L A;  3K70 C;  2A6H F;  3PNV A;  1O5H A;  4OIP F;  2CNW A;  2VJI A;  5HNF A;  2ZPA A;  1ZHZ A;  2VQG A;  2H7V C;  4XKV A;  2QKM B;  2ZXP A;  4C3B A;  3A4C A;  4HFK B;  1P9Q C;  1V5F A;  1Z23 A;  2DOA A;  4CSA C;  3CES A;  4HST A;  3OS1 A;  4GYT A;  1OR7 C;  1TZL A;  3W2A A;  3N05 A;  5E3C A;  1DGW Y;  1Z21 A;  3DTE A;  4CCO A;  3K66 A;  3LAY A;  1R6R A;  1ZEL A;  4D9J A;  3M1C A;  2W7N A;  2R7V A;  3SYN A;  5KYX A;  2R4G A;  3F9K A;  2PJR A;  4OD4 A;  2XF6 A;  2LBF A;  2Q1Z B;  4RMN A;  4E7Z A;  2Q9B A;  3MD2 A;  1E0E A;  3U21 A;  2KL4 A;  2CV0 A;  3DLA A;  1ERD A;  3LJB A;  3O6X A;  5DVW A;  5T1D B;  3X1O A;  4A2N B;  4YJW A;  2V7F A;  1N78 A;  3B0U X;  2XAU A;  3RPU D;  2EIK C;  3GOD A;  4U7B A;  1M57 C;  1DP3 A;  2NG1 A;  2IGN A;  2NOJ B;  2E5N A;  2WVN A;  2MWQ A;  4JCH A;  3EFO A;  4MND A;  1ZHW A;  1MNE A;  3SZR A;  5DQZ A;  2XSE A;  2J7P A;  2D5R B;  3J7A Y;  2IGM A;  3RH3 A;  2KMU A;  2ZXR A;  2NUT A;  4CSA A;  2HDW A;  3G2B A;  2KRC A;  1QLE C;  1DQU A;  2IXN A;  2WB7 A;  3D5R C;  3IUO A;  4ZLC A;  1JPJ A;  3OR1 C;  4JVS A;  1N75 A;  4I1M A;  3H5R A;  3NDB B;  3MLG A;  3EGD A;  1BR1 A;  2LC2 A;  3AKZ A;  2IXM A;  2WL8 A;  3DTI A;  3N0T A;  1PJR A;  1IRX A;  5HLT A;  4XWJ A;  1LFP A;  4KIS A;  2LRE A;  4YT5 A;  2WY7 Q;  3DAF A;  2CUZ A;  2J9U A;  1X4P A;  3T6B A;  4PJJ A;  3RQ4 A;  1BR4 A;  4G6T B;  1MMD A;  2BW3 A;  3IAM 2;  2HU9 A;  2LY1 A;  3NWS A;  4IQ4 A;  4PJN A;  3AL0 B;  2KNH A;  3FVY A;  5BUO A;  5LFA A;  3B0V C;  3DPT A;  4BUP A;  3OYF A;  3OA1 A;  4AE4 A;  2WAF A;  4BQN A;  1N77 A;  1TWA A;  2R7U A;  4HEA 2;  4BS9 A;  3L0I A;  2X6X A;  4XKC A;  4HNT A;  4U5D E;  1BOB A;  1FMW A;  4X0R A;  1PYV A;  3H35 A;  3ITF A;  1MND A;  5FRM A;  4XR6 A;  4DBQ A;  3OYC A;  3BLY A;  4ZDO A;  1ZHT A;  4U5F E;  4NC7 A;  3PNT A;  4C2U A;  2L9S A;  2JVG A;  5F5F A;  2L81 A;  2PX3 A;  2DT6 A;  2PP4 A;  5EHH A;  3OYE A;  4RLF A;  5KYY B;  2A68 F;  4QI2 A;  2XDV A;  3EG9 B;  3HL2 A;  2M4K A;  2F5V A;  3PMR A;  2ZSI B;  2ZSH B;  3BG6 A;  4IAO A;  3PHF 2;  2VQH A;  1IW7 F;  3RKO F;  1T0F C;  3OOU A;  4CCK A;  1SZI A;  3AQC A;  5F5H A;  2WAD A;  2I8D A;  1Z7L A;  3OYI A;  3HJC A;  4OIR F;  2Z2S B;  3K4M A;  2QKL B;  4KT6 A;  3B0P A;  4O6Y A;  3ZVR A;  4YN0 B;  3B9Q A;  4EWC A;  3L2U A;  3DTK A;  1FTS A;  1ST6 A;  4ZLD A;  3BC8 A;  1IZM A;  3C2G A;  5KNL A;  4DJA A;  1G8X A;  4CS9 A;  3HOS A;  4ZTF A;  5E3A A;  4C7O B;  4ANJ A;  3VSK A;  3N2Z B;  3KEY A;  5TGT A;  4O7G A;  2XC7 A;  2OC6 A;  1QZX A;  4CS7 A;  3K1H A;  1V5E A;  2EIN C;  2WZF A;  3UMI A;  3K6G A;  3MMY B;  3EUK L;  3EGX B;  4QDL A;  2XSJ C;  3L34 A;  1D0Y A;  3H0D A;  2VH3 A;  1MMN A;  1QHG A;  2KGO A;  4C30 A;  4MLO A;  2VJ4 A;  4BEH B;  5DQT A;  3A1Y A;  3W2W A;  3AFH A;  3TBI A;  2QTV A;  3EQL F;  3K1I C;  3OS2 A;  3NYL A;  4U5C E;  3UGO A;  3HOT A;  2M4E A;  2FUG 2;  3VWB A;  1YX3 A;  3D5L A;  4OWR B;  4XKW A;  4C2T A;  2WZG A;  4IRU A;  4YEJ A;  4JZA A;  5KYY A;  1BR2 A;  3DWL E;  3S3M A;  2R7Q A;  2A5W A;  3K4B A;  4PSX A;  3EG9 A;  5B1A C;  3W8H A;  2X1C A;  2K3P A;  2X1D A;  3HPG A;  2HNH A;  2CV2 A;  1MMA A;  3PJR A;  3SNH A;  4Q5S F;  2MC4 A;  4IWB A;  4CUG A;  3KL4 A;  3DJN B;  4D1Q A;  3RYL A;  4O6N A;  3FKJ A;  1ZYR F;  3CP8 A;  2LSE A;  1D1C A;  4DGW B;  4NUB A;  3ZC4 A;  2W00 A;  2IS2 A;  3T6J A;  3CMM A;  1EA3 A;  5HOO A;  3IEE A;  2BVL A;  3OIP A;  3ZR8 X;  2HZD A;  2PF4 E;  2CMP A;  2UV1 A;  4E7S A;  2C03 A;  3ABM C;  4AX2 A;  3LSH A;  4B6I A;  1YE9 A;  2AQE A;  2J9V A;  5KYW B;  2VKH A;  4C7O A;  3C2H A;  3OR2 C;  3ASN C;  2KZV A;  3I5P A;  3O39 A;  3QOD A;  4ZC3 A;  3FDY A;  3TL4 X;  2LY2 A;  3OYD A;  3AQB A;  3JYH A;  2IXO A;  4F4B A;  4U5B E;  3EGX A;  2X6W A;  3DQV C;  2W4M A;  3W2V A;  1OCC C;  2HV7 A;  3AG4 C;  3Q6N A;  4FES A;  4EBB A;  1WJC A;  3HXL A;  2R7R A;  1QU3 A;  4JUR I;  5DS4 A;  3VYU B;  3OYA A;  4I44 A;  2VKD A;  3LS0 A;  2HV6 A;  5FCL A;  1J8M F;  2M7A A;  2BVM A;  2H7O A;  4QPQ A;  4HE8 D;  3ONQ A;  1X1A A;  2X51 A;  4F93 B;  4BE1 A;  3M8J A;  3NYJ A;  5HSW A;  2DCE A;  4G7O F;  4GEH A;  3S8P A;  3JCU Q;  2E5Z A;  3ZG1 A;  4J00 A;  4B43 A;  5CI8 A;  3MX3 A;  1OCR C;  1PD1 A;  2WA0 A;  3CP2 A;  2Q9A A;  3CJR B;  1NZE A;  3ZSU A;  2X6Y A;  1W36 D;  3ZCO A;  4QI0 A;  3CJQ B;  4H4K C;  2G3V A;  1VZ0 A;  2VQC A;  4OAZ A;  3UR3 C;  4PFP A;  4B44 A;  2HVS A;  4LG3 A;  5T3W A;  3BCA A;  4XQF A;  4CS9 C;  1WJ5 A;  2K5C A;  4XLH A;  5E2Q A;  3OYK A;  5CQG A;  4XLN F;  2VJ5 A;  3S0X A;  3EJN A;  2VL8 A;  1WJF A;  4XLF A;  4B47 A;  2IGO A;  2WAQ A;  1YX5 A;  2ZXH A;  2VLA A;  2CH0 A;  4F92 B;  1SF8 A;  2JA2 A;  2V6E A;  1M2V B;  4N4O B;  3S28 A;  3POV A;  2KHM A;  4J01 A;  3NKD A;  2M4G A;  3AG1 C;  1OCZ C;  1NG1 A;  4AU7 A;  1GLN A;  2E1M C;  2LYC A;  2Q2E B;  4PSW A;  3S3N A;  1ZU5 A;  3VYW A;  4G7Z F;  2XXA B;  3K4N A;  1WGW A;  5B1B C;  4P5O A;  4ZDP A;  4NC8 A;  2J0W A;  3VYR B;  4K7B A;  1Z3I X;  4AYB A;  3V7O A;  5JHF A;  2CDQ A;  2F6C A;  3NG1 A;  2Y0S A;  1D1A A;  2W4B A;  1V55 C;  2VPL A;  1J8Y F;  2CW7 A;  4CIH A;  3TD7 A;  1N1C A;  2QY9 A;  3EZH A;  3EPZ A;  3AG3 C;  4BJ5 A;  3Q7G A;  2WY8 Q;  4HSR A;  2CS3 A;  3DZA A;  2M7B A;  2W1O A;  4YRV A;  3V42 A;  2VB6 A;  3DKX A;  1HA8 A;  3UMK A;  2CW8 A;  3BG7 A;  3LSK A;  4BE0 A;  2FGY A;  3ABK C;  4XM3 A;  3N24 A;  4E7J A;  4XNF A;  5CKT A;  4MQ9 F;  5KYU B;  3RTR A;  2E60 A;  2H7B A;  4YT4 A;  2WVO A;  1X19 A;  3EUH C;  3TMO A;  4CCJ A;  4F55 A;  4ITV A;  4BXF A;  2DXI A;  3F46 A;  4CZC A;  4N4N B;  2L9J A;  2O5R A;  1M2V A;  2X1E A;  2ELJ A;  3HC7 A;  4KJZ A;  1W2W A;  2IXP A;  2W9Y A;  2VAS A;  3FAJ A;  3SDB A;  3S32 A;  1M2O A;  3X2Q C;  2GFH A;  2XF5 A;  3FBN B;  4BJ6 A;  2XXA A;  4E7H A;  1M56 C;  4PFO A;  3IP4 B;  2XRH A;  3SYT A;  4KBL A;  2IYL D;  2R7O A;  4RBN A;  2DJI A;  4PK4 A;  3OYN A;  1LS1 A;  1VYK A;  1Z63 A;  3DEE A;  3DPL C;  4J32 B;  2G62 A;  4BE2 A;  5CPR B;  4LIV A;  2Z16 A;  1T95 A;  3K7D A;  2J45 A;  3S3O A;  3QYF A;  4RM2 A;  5DS5 A;  4JW1 A;  2ZFU A;  4F91 B;  3HPH A;  2A6E F;  1G59 A;  3QZC A;  2JVH A;  3L2V A;  2LG4 A;  3I9V 2;  3PFY A;  1D0X A;  4LER A;  3ASO C;  4BAC A;  1ZHX A;  2VIX A;  3H9G A;  1JPN A;  1O87 A;  3WG7 C;  4BQO A;  4JQF A;  4XN0 A;  1JI8 A;  4XLA A;  4CCN A;  4ZTJ A;  2XL4 A;  3DPU A;  2NUP B;  1KU2 A;  5KYU A;  3EZI A;  3LNR A;  2V1N A;  3CSK A;  3W8I A;  2C04 A;  4YT8 A;  3K10 A;  5D92 A;  3NWT A;  2ZXW C;  1U0J A;  4IZZ A;  1J09 A;  4FX5 A;  4RM3 A;  3FHD A;  4P6I C;  4QPO A;  4BU2 A;  2IS1 A;  1NG7 A;  3NYM A;  3LLI A;  3L2R A;  4HRI A;  3LLK A;  4JJF A;  3KYL A;  4IJJ A;  2V26 A;  3CQZ A;  4LLC A;  4AVZ A;  1TKN A;  2WBM A;  4YT2 A;  4YWQ A;  3W3C A;  5T3T A;  2HVQ A;  2DYS C;  1WJA A;  2WAE A;  3DD7 A;  3H9J A;  1WJE A;  4KIT B;  5LD2 C;  2UWM A;  3PSF A;  4KNW A;  2RNG A;  2Y39 A;  4LAC B;  1W36 C;  3RCO A;  2IGK A;  2M0M A;  4BJ5 C;  3HTK C;  4XN3 A;  2P6V A;  3DMD A;  3JT1 A;  3VAY A;  2CNW D;  4AK9 A;  2DGJ A;  2UUZ A;  3H9Q A;  1X4O A;  2BOL A;  2DYR C;  3LSG A;  2EIL C;  3VYT B;  2HQA A;  4II2 A;  2XF7 A;  3FBI B;  3PSI A;  3FDQ A;  4U87 A;  4CH7 A;  2NUP A;  2R7X A;  3UGP A;  3KX2 A;  3HUG B;  4BG0 A;  1LKX A;  4XLP F;  1TWG A;  3AG2 C;  5KYX B;  1PCX A;  4BEH A;  1UG0 A;  1KON A;  2PJR B;  1S7Z A;  2J9W A;  2KLO A;  3QYB A;  2OCC C;  3RIP A;  2Q9C A;  2ZXO A;  3I4U A;  4FAS D;  2LBF B;  2M3A A;  2P0W A;  3FHN A;  4PUS A;  3H5N A;  3JRT A;  5CQE A;  4BJ6 C;  2OUM A;  3VYS B;  3K33 A;  3S93 A;  2W82 A;  3SP1 A;  3L2W A;  1Y6I A;  3EFO B;  3EH1 A;  4NNJ A;  2Y3H A;  2VJJ A;  4HPQ A;  2J7P D;  3AL0 C;  1NG6 A;  2R7W A;  2WZL A;  3ZIB A;  2ZXI A;  4WJ0 A;  1PD0 A;  2L2O A;  1NU9 C;  4FWV A;  4C9Y A;  5E33 A;  1MMG A;  4KNV A;  4C3D A;  2YEV A;  2CW0 F;  4JOM A;  4NQW B;  3OY9 A;  3EGD B;  1VYI A;  3OYJ A;  4I3M A;  2IS4 A;  4II3 A;  2I8B A;  4OD5 A;  2EIJ C;  3IAS 2;  4FET A;  2IOQ A;  4E7I A;  4C3E A;  4KI2 A;  1TWH A;  4M63 A;  1WJD A;  2KJG A;  3H5A A;  3OWT A;  2BW3 B;  2X85 A;  3DJU B;  4DOZ A;  3QMK A;  4K0D A;  5DLJ A;  1WFX A;  5HNH A;  1D1B A;  2CGE A;  2WB1 A;  3K4K A;  4OIN F;  1ZHY A;  4O79 A;  1UAA A;  4BJ1 A;  5DS6 A;  3OL4 A;  4AE4 B;  5KYW A;  4XLE A;  1UEL B;  4P1W A;  2FFH A;  3GAN A;  1VK5 A;  3DU6 A;  4OAY A;  4ZDL A;  3OYG A;  3E0J B;  4CA0 A;  2Y69 C;  1Z3Y A;  2P7V A;  3QOE A;  1TR2 A;  4W8K A;  4XTK A;  3VSL A;  2JD3 A;  1X1C A;  3ZGK A;  1OLT A;  4DIQ A;  3CZ6 A;  4ULW A;  2KW3 C;  3OYL A;  4CCM A;  3K4C A;  4Q4Z F;  4OIQ F;  3K70 D;  1MW7 A;  3I5Q A;  1Y56 A;  4I1O B;  2JUG A;  3OYH A;  4DVY P;  2RQQ A;  4CS8 A;  4NY3 A;  2KRH A;  1X1D A;  2EIM C;  3OYB A;  3LSM A;  4U5H A;  4BJT A;  4IX7 A;  3RFY A;  3SEO A;  1ZU4 A;  4IKF A;  4KC9 A;  4U5E E;  4E7K A;  3EH2 A;  4N06 A;  2HVR A;  2KP6 A;  1S9H A;  5KHD A;  3DXJ F;  4BL0 B;  3JSZ A;  2CUJ A;  2KDO A;  3E70 C;  1FMV A;  2K9M A;  1VOM A;  3KH2 A;  3VDX A;  1Z5Z A;  2J0X A;  4OIO F;  4X0G A;  3NKE A;  2RRE A;  3I3L A;  3ZXS A;  4ZJZ A;  2HPM A;  3MKW B;  2L5Q A;  3EHM A;  2MYS A;  4BDZ A;  2CV1 A;  3Q6M A;  3H65 A;  4G7H F;  3E9V A;  4RLQ A;  3LSI A;  5CI9 A;  3OYM A;  1OKK D;  2VQL A;  4DBR A;  4E7L A;  2O9X A;  5KCM A;  5HVQ C;  1DGR M;  1QHH D;  3KKB A;  2AQF A;  2BE5 F;  4XLC A;  1TWC A;  3LS1 A;  4XKB A;  4CSW A;  2IS6 A;  2IXS A;  4XOT A;  4Y33 A;  2Y3D A;  2LOO A;  2E1M B;  3OIQ A;  2B0J A;  4BGD A;  3UMH A;  2KQR A;  4Y3O A;  5L3Q A;  4RD9 A;  3PNY A;  4XON A;  4R79 A;  1TT0 A;  3T4R A;  2J46 A;  2GOX B;  3WOD F;  1Z3X A;  5FRO A;  2W4S A;  1NU7 D;  5FRN A;  4HEA J;  4U5G A;  3LMM A;  4XMY A;  4J30 B;  3PL8 A;  3SEQ A;  3L2Q A;  3LES A;  3OMY A;  4IQJ A;  2Z15 A;  3LL7 A;  2HPI A;  4XL9 A;  1Z6A A;  3S29 A;  2KQ9 A;  2Q3T A;  3ECS A;  1RJ9 B;  3EHN A;  4O6M A;  4HFF B;  3DM5 A;  3Q7L A;  5IY5 C;  4PJL A;  1D0Z A;  5KYN A;  2VXZ A;  3F47 A;  3EPV A;  2LRD A;  4PJM A;  4E4H A;  3K4J A;  4ZYA A;  3SEZ A;  2CFO A;  3PUB A;  4CCL A;  3MKY B;  3HLZ A;  1WJB A;  4LLE A;  4RDA A;  4CBE A;  3LEV A;  3EUA A;  2PFD A;  1OKK A;  2V3C C;  3D5S C;  1LVK A;  2JSP A;  2LH9 A;  2MAB A;  2DT7 B;  4HG2 A;  3SZG A;  3BCB A;  2A69 F;  2PMZ A;  3GBG A;  3ZQQ A;  4B48 A;  4E6K G;  2KPM A;  3HKZ A;  2V4J C;  2R7S A;  3S27 A;  2OV7 A;  3CF2 A;  2L9N A;  1V5G A;  2V9K A;  4DVZ A;  1X1B A;  3DU5 A;  1OCO C;  2YHS A;  2YZS A;  4BEJ A;  4CS8 C;  1LDK B;  2Y3B A;  1SFK A;  3MKZ A;  1K6Y A;  3ABL C;  4GRI A;  5EGY A;  3QYE A;  4Q7C A;  2E87 A;  2PX0 A;  3M1C B;  1V54 C;  3HG9 A;  2L7K A;  1VMA A;  2R7T A;  2F4I A;  4F3Q A;  3ZRG A;  3DM9 B;  3K4L A;  3RSN A;  4G0H A;  1FFH A;  4JJG A;  3K6B A;  4BQQ A;  2MFZ A;  3OS0 A;  1RJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...