4BJTA

Crystal structure of the rap1 c-terminal domain (rap1-rct) in complex with the rap1 binding module of rif1 (rif1-rbm)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
152
Chain Sequence
DFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-BINDING PROTEIN RAP1
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription
total genus 52
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bjtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bjtA01
4BJ5C 4BJ6C 3CZ6A 3K6GA 3OWTA 4BJTA
chains in the Genus database with same CATH superfamily
1P4WA 2IA2A 4EATA 4JKVA 1R1UA 2QUPA 1PP7U 4W8KA 4IGGA 1WN0A 4GFBA 4V2GA 4DQ2A 1LDKB 1I4YA 1WRJA 1NFNA 1TWGA 3JRHA 2QSHX 4FISA 2W4BA 4AIJA 1S3JA 4MEXF 1R4NB 4L5EA 4ZJZA 4JEBA 2C04A 4YT4A 1YW9A 3MQ0A 2RQPA 3BJ6A 3FDYA 3TGNA 3AOUA 2XGDA 2HJMA 1JOGA 2W24A 3H2VA 3RQIA 2O8KA 1AKHB 2Z3YA 2LFFA 4XLNF 1VB5A 2WZLA 2AS5F 2HOEA 4Z6YA 2E1OA 1NBBA 2P8TA 3M1CA 4LK1F 3C8GD 1XGOA 4IHVA 2GXGA 2VN2A 2F5DA 1K4SA 4EBBA 3G4XA 1ZHZA 3NWTA 1UJ8A 3PQJA 4LLNA 3FBIB 2TMVP 4LERA 1T39A 2GOMA 4X0GA 4YL3A 2F48A 2XC7A 2A05A 1F4KA 2MH9A 4KNYA 3QYFA 3ZQVA 2LC2A 3ZN1A 1SFKA 2V6EA 1R23A 3HOWJ 2JRTA 4YFKF 2HV6A 4JZAA 2DCEA 2UXNA 4QSHA 3ASNC 1PCXA 3BR1A 4IPAA 3REOA 4MVUA 2IM8A 2LCHA 5CVVA 4Q48A 1W36C 2BY2A 2HEOA 1V4AA 4JK1X 2VH3A 1AUEA 3JRBA 3HZJA 2VODA 3TP0A 3M8JA 4OOIA 1JUMA 5KYYA 1O4XA 2MH2A 3RDIA 3TDZC 5B1AH 2K40A 5TJJA 2X1DA 3LAJA 5CVIA 5E3NA 1ZTRA 3ZQFA 4A3IJ 2ELHA 4DJAA 2R5ZB 2X6OA 1I3AA 1JPJA 1OCCC 4AE4A 1XCVA 4FX4A 3I64A 2KISA 2ZO4A 3Q3SA 3Q9SA 3CO6C 4QI0A 3A01B 4IAQA 2D4UA 3FF5A 1ON1A 3Q0WA 3CMEI 5C4XJ 4M3BA 1T38A 1GDTA 4BEHB 3ZMVA 5CPRB 3OS0A 2Y0MA 3Q5FA 5COGA 1R58A 3N24A 2HZDA 3OYKA 1YJGA 3V5YA 3K0LA 4IRIA 4XQ1A 2DA1A 2PI0A 3BQYA 1X1PA 2FRHA 3M79A 1GXQA 2K4JA 2E2JJ 4K0DA 5F5HA 5BMZA 1JXSA 2V1DA 3Q7LA 3RJPA 4XLCA 1OR2A 4ZLCA 3DPUA 3MKLA 2LKSA 3E0JB 4U5BE 1XGMA 4XNFA 2GIVA 1QZEA 3C8GB 3P9IA 5AIPA 2GZWA 4U5EE 2JRMA 2LG4A 2R7DA 5DDGA 4E7LA 2J0XA 2KC3A 3CSKA 5CJ9A 2HOSA 1OW7A 4RS8A 4CS7A 2EINC 3MCZA 1I6XA 3P9KA 1NSGB 1OR7A 3Q0UA 3DBLB 3RIPA 3FM3A 4MFEA 4BQQA 1LQ1A 5HDGA 5ILUA 2RV8A 5E20A 2NOGA 3CD6I 1YO5C 5DS4A 1TWAJ 2EZKA 4JYKA 2W7NA 2G3VA 4N6CA 2DOEA 5FD5A 5A6BD 4D9JA 1FTZA 3L09A 1JR8A 2BY0A 2NAZA 3JSPA 3GWLA 1WH7A 1QVTA 1IDZA 3W2VA 3IV5A 5K0IA 1LI5A 4JRZA 2UZKA 2LD6A 3NMIA 2HXOA 2K85A 1RC9A 4KBLA 2D2WA 4CYDA 3U9JA 1CQTA 1ZLJA 4FQGA 3ITFA 1CPRA 1T0FA 1Z21A 4CDYA 2MW8A 4IXAA 3K6GA 1JI8A 1O87A 1H9TA 1U8BA 4XRSG 4LLCA 3KMIA 5CVJA 4BU2A 2CUFA 2TRTA 1MMDA 1Y6IA 2QQBA 4BBRJ 4E7HA 2B0HA 2W25A 2K3FA 2RN7A 2HZ8A 2AXLA 2F4MB 4L9JA 2KP6A 4OAYA 1WASA 3SJMA 4H54A 2WB1A 2MHRA 5TJ5E 5DUKA 5J40A 1B8IB 2CMPA 1ENHA 5CYVA 2WAFA 1Z1DA 2XSDC 3I59A 2ZPAA 4AK9A 3W4YA 2IS1A 3DE8A 4C3EA 3V7SA 4U5DE 1N1CA 2XB5A 3A03A 3HRUA 2YU3A 2LF7A 4XRMA 2IGKA 2DA7A 3CCRI 2EIJH 2NS0A 1O3RA 2WY8Q 3EZHA 2EFWA 4U5CE 4NNJA 3JCUC 4AIDA 4MTOA 2LKPA 3ZC4A 3VWBA 2VOPA 3LAPA 4IB4A 4UDVA 1ZR4A 2A5WA 1Y1VJ 2HFIA 3V8JA 1XSXA 2EZLA 4UUSB 2HVRA 2QBYA 4LG0A 5D91A 4BQNA 2RVCA 5DUIA 1YJNI 4K1OA 3GWZA 1G3TA 3T1BA 2KRHA 1MDMB 2IRFG 4KN4X 2M8GX 2GAQA 1LFPA 5H6RA 1XZPA 2L6FA 2HOAA 4A3MJ 2Q2EB 1XCBA 3S3MA 3LFKA 2L7ZA 1WZ2A 1HE1A 3DD7A 1TWFJ 5BQIA 5GAEJ 1SD6A 2MGQA 1TFKB 4DBRA 4M9XA 3S2HJ 2V9VA 4ZLDA 2P6TA 1XD7A 4E7KA 2DU9A 2KKOA 1W0UA 1B72B 4E0IA 2VASA 3L0IA 4ONSA 3H35A 3ZVRA 3C7JA 4WXDA 1WSUA 4LJZF 3C1DA 2A6EF 2LYCA 4XMYA 1L3PA 3O39A 2MABA 3RYRA 2RDPA 1RIOH 2QNLA 1IN6A 3K70D 2DODA 1E3PA 2DK5A 3AG4C 3LL7A 3ML6A 3ERMA 5F0CA 4C3IJ 5E79C 1GHCA 3CC2I 1Q1VA 4HV6A 2XS1A 5BS6A 4XK4A 4KC9A 2DTZA 2QENA 2FQ3A 2W84A 5BOXA 3W6VA 2XLHA 1XSVA 4MNUA 1NH3A 1D0YA 2JA7J 5LEKA 2M9HA 2GXBA 1RPWA 2ZD9A 2PEXA 1YRNA 2MBFA 2R7VA 5IYBJ 4AIKA 1R1TA 4KIBA 3EYIA 3ZCOA 3S28A 1W7PD 2E5ZA 1HLVA 2CQNA 3PSFA 1UCRA 2LVSA 4GYGA 3RSNA 2L02A 3DV8A 1FOKA 1I5NA 2XM4A 2STTA 3RKYA 3EPVA 1I50J 2FBHA 2PMHA 4CCNA 3EUKL 5C44J 2Y69C 1Y6DA 1IO2A 2K7LA 3E5UA 2R4GA 2XAGA 3F22A 3ASOC 3CCSI 3HJCA 3GEEA 2XXAA 2D5RB 3BRJA 4I1MA 1OXKA 3S29A 4U7DA 3EZIA 1FR0A 4KISA 3U0CA 1ZELA 4YL0A 2YL3A 1TWAA 1U78A 4P96A 1IDYA 3VYTB 3ASNH 1I5ZA 2K3PA 3K4MA 1PVEA 3HSFA 4BHBA 1YJ9I 1FYMA 2LFBA 4M6XA 1F5TA 1PUEE 3DFGA 2QF7A 4KMUX 3HHGA 4XOTA 5E1WA 4G6QA 3V8LA 3LJBA 3NDBB 1PJRA 1XG1A 4JJGA 5LRRA 1ZH5A 3H5NA 1SR2A 2FMYA 2R7ZJ 5M5XJ 3R0AA 4UHTA 2XUBA 2XF6A 3WTSC 2HYGD 3FK7A 4FHTA 3D5LA 4CCOA 1WWPA 2E7XA 1Z6RA 2VB6A 3CDLA 1Y0UA 2YS9A 1L0OC 3KP3A 1Z7Qc 3QW0A 1VQKI 1DP3A 3X1OA 1K61A 4IHYA 3TJ6A 3JRAA 1VK5A 2JA5J 2VBWA 1BBHA 3FMQA 2XS8A 2X4HA 4L5JA 2J45A 3JSOA 4BXUA 3DQVC 1ITYA 5COMA 3F8FA 3H3ZA 3L1MA 1JHFA 2KJBA 4M71A 1IXCA 4Q47A 1AOYA 3JCUQ 4YN0B 4YT5A 2LREA 1RKEA 1MQVA 3WTXC 5L3BA 5H6QA 1OLTA 4A3LJ 5L0FA 2ACJA 1RR8C 1JMWA 4FX0A 2JA8J 1JGGA 1NG1A 3GODA 2KIFA 2X9DA 2R3SA 4UB8C 1UG7A 1DPUA 2KPMA 2F4OB 2H94A 2MYSA 4XKWA 1NFOA 3LSIA 1WOLA 1LVKA 2X6YA 2FUG2 4EUKB 4IRUA 2Q9BA 4FAPB 3TEDA 4KFCA 4BPMA 3EG9A 1W7PB 3CMMA 4WX9A 1TQIA 4EGZA 2Z5UA 2ZKZA 1MZBA 4LD5A 3EHMA 4EIYA 1T95A 3BT9A 3GXOA 3U1DA 1G4WR 4U9EA 3IH2A 5FKNA 3MZYA 3O8GA 3OMYA 4MTDA 3OOPA 1Y1WJ 3PIPF 2E87A 2LNBA 2B0JA 4X1EA 5JVTA 4O5VA 4RAFA 5IP7J 5HS7A 2R7FA 3MKZA 1ZRFA 1ZHXA 3RKOF 1GM5A 1Q0DA 5L0GA 4EJOA 3BR6A 1HMOA 1PDNC 2HWVA 3QPHA 4IJJA 1KU2A 5EEHA 4HDVA 2Z2SB 2Y3GA 1U3EM 3GTQJ 1KU3A 3BG3A 3FOPA 4JIOA 4U0VA 3SZTA 4XIDA 3OIOA 4XONA 4I7HA 1SAUA 1T2KA 4G8XA 4KYWA 5EGOB 2OV7A 3K9TA 1VQ6I 5EEAA 2IS6A 1OCCH 1TKNA 3I71A 3MYFA 1A04A 3Q6NA 2GA1A 4U5GA 2L9VA 2WBMA 4KA4A 5HV9A 3OYFA 2D1HA 1LFUP 2DBBA 1OCZH 4BJTA 3KYCB 1WGWA 2VQGA 3K2ZA 3MX3A 3NARA 4PUSA 1O3UA 5JUAA 5D4RA 4HDUA 1W5TA 3H1CA 4UV8A 2DJIA 4Y3OA 2CV0A 1U5TA 3HUGB 1UHMA 4S0HB 2X6WA 4F91B 3CCMI 3WG7C 3K4NA 2ZXWH 1YE9A 3PNTA 1DDNA 4HNTA 2ETHA 2HQNA 3JRFA 5ICGA 3BZ6A 4BAYA 2ID3A 1MMGA 1O3SA 2CNWA 4RAZA 4EEFG 3C2HA 4CHUA 4GYTA 3ZSUA 4AL1A 4C2TA 1O57A 4I98B 3A02A 4X0RA 2HR3A 1USTA 3RKWA 3WHNA 4A4AA 4BQOA 4F7ZA 3W2WA 4NQWB 3AFHA 1ULYA 4C3DA 2EINH 4PGHA 3C8ZA 1XB4A 4A0ZA 1MBJA 2Y0SN 1S8NA 4EMSA 5J8CA 1IRZA 1QVUA 1HE9A 4YWQA 1WHUA 4XPYA 1LFBA 3QVYA 3F46A 4B3XA 2LLKA 2J46A 3EETA 1C03A 3M15A 1NHAA 3GLXA 2XPWA 3L1PA 5EJCA 3NMJA 3Q7GA 3UR3C 2PLYA 3ECHA 2BY3A 4BQAA 1QNTA 1QZZA 4AWXB 2YLGA 3WU2C 2Y9YA 3CCYA 3DWLE 1FX7A 1TT0A 4W8PA 2OU2A 3BJOA 2ME6A 4HYEA 2MFZA 2XVCA 3BP8A 4P5OA 3ROUA 3Q6MA 2BW3A 4KIFA 2EQRA 3FWEA 4XN0A 2OJQA 1T6QA 1OR3A 1VQMI 5L3QA 1IXSB 5LGTA 3M1CB 2Y39A 3QPLA 1U9NA 2V3CC 3OYGA 1DGRM 2CW8A 4MS2A 3TKYA 4EM1A 2TCTA 3CP2A 2VKHA 2ZXIA 3VYSB 2F5VA 1WH5A 1Z3YA 1K05A 4DJ9A 5J6XA 2M7BA 1A7EA 1ZVZA 3S1QJ 2GWWA 1WI3A 4HG2A 2H8WA 2FEZA 1JJ6C 2VC1A 3IHUA 5E8IA 3EFOA 1X3ZB 2OEXA 3MFNA 2KL4A 1BC8C 1MBFA 4JX6A 4U0WA 1ETVA 3LSRA 1YI2I 2AWYA 2IYLD 2PMZA 3HGYA 3PO2J 1WPKA 2M30A 2ISZA 4O79A 5ICCA 1P4AA 3NKDA 3SDBA 4L0YB 1Z0XA 5HS8A 1QRYA 2MWQA 3VFZA 1TP4A 3GORA 3E5XA 1WWXA 2J5PA 5IYCJ 5KYYB 2ZNYA 1Z23A 3SYNA 1VQ5I 1GS9A 1B9NA 3ZN0A 4BJ6C 1GLNA 1YIJI 5GTHC 4MVRA 5HLGA 5H20A 3BLYA 4XLEA 3FDQA 3TQOA 3KE2A 4I76A 2XRHA 2VC0A 4E7IA 4AE4B 4E6KG 2WVQA 3K70C 2AO9A 3RYLA 4KMFA 4WGZA 1FFHA 2M8EA 1FBSA 3IAS2 4E7ZA 1AWCA 5EG0A 3ABLC 2EV0A 3U9GA 5DD8A 1UFBA 2W4MA 1ZREA 2IP2A 5E2QA 3OYHA 2YEVA 3IQ5A 2VBXA 4CSAC 3DBHB 3V4GA 3HOSA 4R8HA 4DYQA 2WY7Q 1R4MB 3FXMA 4GGGA 5HLHA 2Z99A 2JQ7A 4A0YA 4BXFA 4M73A 1GT0C 1SC7A 4HRIA 3DI5A 5HNHA 3R4KA 4BDZA 3DEEA 1BZ4A 1ZG5A 3OL3A 3H3VK 2P0NA 5JI6A 5B3SC 3AG4H 1FTTA 3GFLA 1V74B 1AEPA 2HXIA 1JGSA 3BEHA 3K4LA 1QPMA 5D4SA 5J1YA 3PHF2 4XLHA 3GM2A 3S9OA 3PUFA 3KIOA 1MNMC 3RZDJ 2NPUA 3K4KA 2DK8A 3GTJJ 3U5SA 2DTRA 4N0BA 3FIWA 2X0CA 4N4OB 4BNCA 1RCPA 1ETWA 3BR3A 2G0EA 2HQAA 3S2WA 4I0BA 1F36A 1ERDA 1L3LA 3FM5A 4CYCA 3ZQLA 2FMLA 2XPUA 2RKHA 2Y69H 3K69A 1UMQA 4KT6A 3T8RA 3ASOH 4H0EA 3GTPJ 2VCAA 3DU5A 4G94A 2P5KA 4J01A 1Y0NA 3SEOA 1FSEA 2XASA 2A61A 3CCLI 5DQTA 2MD0A 4IHTA 2QQAA 3BTJA 1BR1A 4HOBA 4N6HA 2OA4A 3E7LA 4LG3A 3W6JB 1OW8A 2HYFA 2M2EA 2Q0OA 3O8HA 2OF7A 2LK4A 1JE8A 4E17A 4F92B 4QWQA 3BDDA 5F1RA 2IGMA 5K5RA 1RXQA 4MQ9F 3K66A 5LHHA 4IJAA 1OQCA 4IEJA 5CQGA 3T5XA 4RDUA 2J7PA 3JYHA 2HTJA 5DS6A 5JRAA 3S1MJ 4ZTFA 4PZJA 1O3TA 1J8MF 2LMDA 2E1CA 2JUGA 3VEPA 3AGTA 4AUXA 3M07A 5DCMA 3AG2C 1M1EB 1I4ZA 1VZ0A 3NRHA 1G3WA 3AG3C 1BW6A 5JP7A 4PJJA 1HSTA 3I59B 3OWTA 2UXXA 2XGEA 1YYJA 2GWRA 4KI2A 1EA3A 3IH3A 5FZTA 4KITB 2DT7B 1DGWY 5F64A 1QZXA 1LNWA 3H65A 5CIVA 4YRVA 4L0ZB 4DW6A 2V6CA 3EYYA 3JSZA 2ZXHA 2RC4A 4UY8I 2KZVA 2KSFA 3ZP5A 3R0JA 3F6VA 3K10A 2J9VA 5EZGA 5EGYA 5DLJA 3LFUA 2X85A 2EPFA 2C6YA 2QA4I 3I58A 1R6RA 4EHPA 1PP8F 3WHCA 1NU7D 4RMNA 4CJOA 3CCVI 2BY1A 3S27A 1Z7UA 2Q4FA 1ORJA 2QBYB 2CU7A 4LG0B 3HDDA 1V55C 3IQCA 1OCPA 4IZZA 2EK5A 3CESA 4BXXJ 2Q9CA 2BEOA 4CS9A 3DPTA 4M72A 1GQAA 4M63A 3F8BA 3PFYA 3G73A 4IX7A 1FAPB 3SXMA 3EUAA 4OMYA 1P7IA 2V26A 2O9XA 1VQ8I 4BY1J 1XC5A 1YTYA 3CMYA 5DV5A 1APLC 2KDZA 2L9JA 3KEQA 4IL6C 5K1YA 1XMAA 2YPRA 2YU9J 1E3OC 1J8YF 1OKKA 1EI7A 3SP1A 4ZYHA 1SYQA 4CDVA 4U87A 1U2WA 3GTGJ 2YSRA 2Z15A 1T6UA 2DYSC 2ZXJA 3K1HA 3RFYA 3DLAA 5J47A 1BI0A 3GZ6A 3WTZA 1VMAA 2H7OA 2R02A 1HW1A 3R2PA 2QQ8A 2OAZA 2XAQA 4LLLA 3TL4X 1HCRA 1CGOA 3DTIA 5HODA 3HNLA 3RF3A 2M1BA 4BEMJ 3JTHA 4B09A 2IXSA 3E97A 4RM3A 3FXHA 4LLEA 3GEZA 1EH7A 1LUJB 2E71A 1YRNB 3JT1A 2MD5A 5FKOA 2ICWG 3I53A 2AVKA 3P7NA 4Q7CA 1JJ8C 3ATPA 2Y3HA 1FY7A 1TLHB 2OZUA 1BM9A 2A3SA 4GDFA 2E2IJ 3WGGA 4B4CA 4E7SA 4CCJA 1MBGA 3BCAA 3K7DA 2Y48A 1DOVA 1W1WE 1WATA 2XLMA 2XXAB 4FE7A 3KCCA 3WG7H 4RB2C 4I01A 5L3VA 3GANA 3GZ5A 1G59A 3ZMUA 3LSMA 1J7KA 4C3BA 5DS9A 5C3EJ 2AQEA 3F0CA 3I3LA 4MVOA 1BI1A 1XMKA 3OYIA 5KYXA 4CS8A 2QYOA 1UAAA 2K86A 1IN4A 5HLIA 4C3JJ 5GPCA 1XPXA 3ABKC 1T08B 2W57A 4B1RA 4PK4A 2XSEA 2L6HA 3DTEA 2LP0A 2YKZA 3HKZA 4XKCA 5KHDA 1W5CC 2EPMX 4MW3A 2DMPA 1QHHD 4ZDPA 4XSXF 1LKXA 3I0TA 3K4JA 3V7CA 2JTVA 3KLOA 5JLXA 4A3EJ 3V7RA 2IS2A 1M2VA 3DKWA 4RBNA 1I27A 1R5GA 1LIHA 2BGCA 2NNYA 2LR8A 2ZC2A 1X19A 2C03A 2OD5A 4G78A 4ER9A 4C9YA 2PX0A 1NU9C 1MBEA 3PCVA 3HIFA 3UKGA 3T8TA 1A31A 1QKRA 2QZ8A 3LWFA 4D5CA 2W9YA 3DWWA 5F5FA 3RTRA 2QKLB 2JSPA 3HOVJ 1G3SA 2HPIA 3PQKA 1FNTc 1VTMP 4JP0A 2B0LA 3FX3A 1BN5A 1RKEB 4UUVA 5LLQA 2GDCA 4JURI 5GPGB 3LOCA 1YA7O 1ZG3A 1V3FA 2CNWD 1NTCA 2M4GA 4PJNA 4PJLA 2NXNB 4LMYA 3KFWX 3PO3J 2EPNA 2QSFX 3WE2A 3JTGA 1X58A 3L2QA 3OY9A 2QEXI 2L5QA 2OOCA 2XROA 2ZBKA 3HRSA 2ETSA 1U0BB 2VCBA 1FNNA 2IVMA 3DE9A 4Z9JA 2IA1A 1R9TJ 4A3KJ 2VI6A 4MNDA 1BDJB 1FFTC 3VAYA 4M74A 2IW5A 3EG9B 5JFRA 1T0FC 2E35A 3MYIA 2D5VA 4JEAA 1VQ9I 4GYIA 4ZZLA 1Q0FA 1IV8A 3HOZJ 2FQ4A 5F28E 2PNOA 2H8AA 1FMVA 1FIAA 1Q0KA 2K9SA 1A5JA 3VB2A 2HDWA 2EFQA 2LDUA 5FFZA 4RB1A 3D1NI 1OCOC 2M87A 2FA5A 1V54C 3S16J 1X3WB 2MG4A 1ETXA 3OYBA 3A11A 3G50A 2WA0A 4JTDB 5F0FA 4KNWA 3PIOF 3HNIA 2BXYA 4A69C 3J7ZI 2OTLI 4XBFA 1ZKGA 5JS5A 3K2AA 3M4CA 4II3A 1S29A 2L7KA 1S9HA 1X1CA 3JTLO 1BR4A 4BY7J 3BY6A 2RREA 2E19A 1RJ9A 5JVGF 2CDQA 3H36A 1IW7F 5L0IA 4FTHA 3J80K 2LOOA 2H7BA 4PGGA 4EWCA 1OFCX 1N78A 4WXHA 2K27A 2VCCA 2XLOA 5L0HA 1FOYA 1R00A 3FBNB 4GRIA 5E1XA 4IKFA 3BWGA 2I10A 3V42A 4XLFA 1SD4A 3K1IA 4NUBA 1T33A 1U5TB 5M5WJ 1BIAA 3MVPA 4EGYA 1WJAA 2Y3BA 2O03A 2ASRA 4L6RA 3I55I 3C62A 3US6A 2BV6A 1B9MA 3MEXA 1STZA 4NTBA 4LK0F 5B3SH 1QSPA 4DRJB 1Q1HA 4ENNA 1IV6A 4ESJA 4HX8A 5DEQA 2FJ1A 5BUOA 2BHYA 2QVOA 2M5WA 2E1MB 3S1RJ 4LIVA 4L5IA 2JN6A 3RVZA 2OCCC 1BJAA 2XV4S 4IO9F 5D8LB 5TGTA 2PBEA 1UG0A 3HOUJ 2VJJA 5K7FA 4Y17A 2VXZA 4CH7A 3GM1A 5HNFA 2NVXJ 2R5YA 3TQNA 2DB4A 3TMOA 3AQCA 1RR7A 3LESA 5EK0A 4BHPA 3L2VA 2B63J 5IT9K 3I56I 3IWFA 1SMYF 2O6GE 4EM0B 2LBFA 3MN2A 4G7OF 4GEHA 5DYMA 1A41A 3IRRA 1X4PA 1I39A 3I4MJ 3TULA 3KP5A 1X4OA 2XF5A 4M3GA 3ZXSA 1ETQA 2BW3B 3IL2A 2IAIA 2JMWA 2YLDA 1NLXA 1ETOA 2X0LA 1KNYA 1K6YA 2XM0A 3G3ZA 5BPDA 2D45A 4A93J 1XDUA 3S0XA 2HTSA 4NC8A 2Z9OA 4C7OA 1BI3A 2JJ7A 3JW4A 3B0UX 3KH2A 1SFXA 2Y75A 3AL0B 1YAUO 3ECOA 5B66C 3TJ5A 2EV6A 3A4CA 1NZEA 1HDDC 2DA2A 2HU9A 1SFOJ 4Z9HA 2STWA 4WF2A 3LNQA 3VF0A 2V7FA 2G9WA 5T3WA 3R7CA 5DD4A 4D7NA 1OISA 2EB7A 3AG3H 3LSHA 3HC7A 5F08A 4B47A 3JRDA 1K79A 4LLGF 2HKVA 4LDRA 3S3OA 1KQ8A 3GFJA 4M9ZA 2FNAA 3ZQHA 1RRJA 1IJWC 3ZTMA 4HF1A 5AGFA 2IGOA 3EFOB 4F4BA 1TZLA 3DJUB 3O6XA 2IJLA 1QVXA 1R49A 3HNKA 3M1EA 2VONA 4N06A 2KIMA 3QU6A 1P9QC 1CF7A 2K9QA 1IN7A 3WTUC 2DYRC 4I09A 2X48A 3K33A 2UUHA 3B0PA 1RKTA 3MZHA 1KONA 4GQHA 3ZDLA 5KAFC 3N4MA 1L7CA 3T0YA 4A6EA 1XSDA 2BXZA 3DAGA 1FOWA 4B44A 4B6IA 3R61A 1VNDA 3J7AY 4UVAA 4XEFA 4XPXA 3K7AJ 1F43A 3DAFA 2J7PD 5KAIC 3HNJA 4UXNA 1X1BA 1Y39A 1V55H 2KGOA 1ZHYA 2K9LA 2K02A 3BR2A 2Z33A 1FOXA 3LA3A 1FJLA 5IY5C 2H8RA 1D3YA 3ZGKA 3TO6A 4CICA 5EG0B 1HW2A 1WTYA 3U2MA 3BTLA 2NOJB 2FF4A 2Y31A 3GMEA 3KZIC 4Z9IA 5DVWA 1N75A 3IH4A 3HRMA 5C4JJ 2QWWA 4N9IA 3BPXA 2OTJI 4ZZDA 2DOAA 4EJWA 3ABMC 2VT2A 4QDLA 5B1BC 3I5PA 1A6QA 2WV0A 4Y15A 1J09A 2XGXA 3LQRA 4PJ0C 1A7VA 3GVAA 3G1MA 2RNGA 4EBJA 2B7EA 2DYSH 3AAFA 4WXCA 4LIUA 4EQQA 2QE9A 3B02A 2M7AA 1X2MA 2GIZA 1K4TA 5L0JA 5DS5A 1Z9CA 3NRVA 3JSEO 5J4VA 4ZDOA 1QPUA 3S93A 4RGUA 2XSJC 3BOQA 2LQGA 1M2OA 2JK3A 5LFAA 2ZSHB 1MMAA 3JAMK 1ACIA 5JVEA 5M3FJ 3J81K 1T5OA 1WFXA 4CJGA 2EBIA 2JPBA 4E18A 4AM3A 3CCEI 2W45A 3KZYA 3KP2A 3ZMSA 4YJWA 2ZB9A 4OAZA 3FXUA 1RI7A 2FBIA 2NVUB 2XL4A 3W2AA 3TW7A 1VQNI 2M4KA 3DM9B 2NVYJ 2DMNA 1LE4A 4BGDA 4CYCB 2CGPA 3H0DA 2W00A 3CCUI 1NG7A 1SFUA 3F9KA 1FEXA 3F21A 5D92A 2M34A 1BJZA 3UMKA 4UVCA 3HTUA 3FKJA 2ADUA 3U3BA 2D1VA 3M7GA 1OKKD 1USSA 3JRTA 3PM1A 3GFMA 3H9QA 1G3YA 1ORKA 4W1UA 2DW4A 3VYRB 5FLVA 4LDKA 3POVA 2ZJRF 4G7HF 2KYHA 1OCTC 2AU5A 4JE9A 3ABKH 4RGXA 1TL8A 4EBKA 2A07F 2QTVA 4A0XA 1MD0A 2PMUA 3G2BA 4PSXA 5L3FA 1YYVA 3G4ZA 1TNTA 2VC9A 3L9FA 2XB0X 1X1AA 3I54A 1U5TC 2FXAA 2PJPA 3ZOBA 3BZCA 3FXKA 2KHMA 1JKOC 4I44A 4E7JA 2I8DA 2I5UA 3FMSA 5DCMB 1I6HJ 1KU7A 1ZHFA 5COFA 2F5EA 2KT0A 4I02A 2PQ8A 2WAEA 3S90A 3CJRB 3FMRA 2ZXOA 4Y7NJ 2R7WA 4II2A 5FLXK 1OQYA 1ZGJA 2H1LA 2E1MC 2O0YA 1Z6AA 3IQTA 1QQ3A 2A6HF 3TO9A 1Z5ZA 1PD1A 2G62A 5D5VB 2EZIA 1CGPA 2CH0A 2QSGX 4O6YA 4CZCA 3F72A 1DOWA 4NTAA 2QKMB 3IRQA 3RZOJ 3LMMA 2HVSA 4KNVA 3G4SI 5AC4A 1IZMA 1HF0A 4ON0A 3IEEA 1GVDA 3HLZA 3ZIBA 5BQHA 5L0DA 1FC3A 1ZN2A 2PFBA 3KPHA 1MKMA 4Y33A 1QQIA 2CQXA 2K4BA 3H9JA 4OMZA 2DO7A 4WK8F 2P6SA 3E6BA 4HSTA 2FBKA 3H3UA 3ERED 1GV2A 4CGZA 4QTRA 2XKOA 3M8EA 3OR1C 4HEAJ 2EFOA 2L01A 3CTAA 2M0CA 3LQQA 1G8XA 2EIKC 2OQGA 2R25A 4HSRA 4RGSA 3EHNA 3GTKJ 2CW7A 1FTSA 1XZQA 2BYVE 2L54A 1IC8A 2A0UA 3CUQA 4P9FA 3WGHA 5HVQC 2GOXB 1OCRC 5FKKA 3AL0C 3MLGA 3N97A 6PAXA 1SD5A 5D5XB 2HKOA 4A5NA 1W5SA 2CJJA 2Q3TA 1LE8A 1OCOH 3P5JA 5DM6F 1V54H 2WAQN 2FX0A 3PNVA 4BH9A 1ZRCA 2KLOA 5J1UA 2IS4A 3M8FA 4RD9A 2PBIA 5E17F 2VKEA 5BPIA 4CUGA 5D6EA 3GM3A 4XICA 4ITVA 4I99C 1UHSA 3RKXA 4FE4A 4PSWA 4Y4RA 5LGUA 4BL0B 3S3NA 2Y30A 1X1DA 1KYWA 4HNVA 4CDAA 4FCYA 1J0RA 3HM5A 4CIPA 1K83J 2R7OA 5TISC 2VL8A 4YIIA 3JRGA 4JTAB 4D0PA 3NMKA 1TQMA 3B6AA 1QA6A 5J4YA 1ORSC 1R7JA 3GO5A 2IPQX 4XWJA 2CQKA 4OD4A 2HV7A 2A5YB 2NUTA 2FSWA 3NYJA 3KP7A 1VQ7I 4CO8A 1JUSA 3HOTA 3GX4X 1B4AA 2OU6A 1EJ9A 4AYBN 1CGNA 1AVOB 1TQPA 3ZQGA 4B48A 2LSOA 2QLZA 3WGIA 2EA2A 3SZGA 4PDKA 3K1PA 1ZZPA 2IGNA 2F5FA 3K4BA 4KICA 4NC3A 2P4WA 4PFPA 5IP9J 4F93B 3RKQA 5KYXB 9ANTA 1R5HA 1UB9A 1FIPA 2EJRA 3SEQA 2HSBA 4P55A 1YA9A 5JHFA 2B9SA 5TRDA 5KYWA 3MWMA 1K78A 3CDIA 1B68A 3RH3A 1S7AA 4NC6A 4B8XA 2Q00A 2L9NA 3BG7A 5L3DA 4BS9A 5ED4A 1E86A 2VPLA 4HFFB 1R1VA 3M4OJ 1M2VB 4WJ0A 3QQAA 1IF1A 3TOMA 2P5LC 4E4HA 2YL7A 5EHHA 4FX5A 3CJTB 3LSGA 3DLLF 1SVMA 4YEJA 1S72I 5JLWA 4DGWB 4RB0A 2ME0A 3QOPA 1XGSA 1K04A 2ZSIB 4DRIB 3LLIA 3JRMO 3VRCA 2P1AA 2OPTA 3KKBA 1PUFA 1P7JA 2TDXA 3ESWB 4HBLA 4OD5A 2R7UA 4K7BA 5CVRA 2VQCA 1KA8A 2WZGA 2P5VA 4XQFA 1GXPA 3B29A 4J7YA 2NYXA 2DPUA 5DM7F 4I6ZA 2L7MP 3BTCA 5A6KA 4YT8A 2DXIA 3S2DJ 1FYKA 2DLLA 4Q5SF 3OIQA 2KJGA 1HKSA 3DZAA 1A0BA 3I5UA 1A36A 1ZQ3P 1U89A 2YZSA 3FXOA 4I2OA 3OL4A 3E9VA 4DRHB 4JQFA 2ZFWA 4AD9A 5KK1A 1C17M 1X3UA 1H89C 3GZNB 1BBYA 2OQMA 3TBIA 1MIJA 2E7WA 4X6AJ 2G7HA 4R79A 4JOMA 1IAWA 1JT6A 3IKTA 1VTNC 5M5YJ 1ZG1A 4I1OB 3PDMP 3B0VC 2W85A 1N25A 1ETKA 1FSHA 1HW5A 1WJDA 1EKEA 1XN7A 1B59A 2HUJA 2XKPA 4U9DA 3IC7A 2JWTA 1J75A 1AU7A 3TK0A 1ZW3A 3OYEA 3DMDA 2OC6A 1JKPC 3GFIA 5H2FC 5AIQA 2G7UA 3PFIA 4QLCU 2DYRH 2J9WA 3FOOA 1V4RA 1Z6TA 4MTEA 1G4DA 4L9NA 2Y2ZA 1SD7A 1M6TA 1TFOB 4G6DA 2IXOA 5EYRA 3TOLA 3RYPA 4JVSA 1MJBA 2DMQA 5E3OA 3NYLA 4JW1A 4ZYAA 4A5MA 4A3FJ 2DA5A 1YLMA 4MHGA 1E85A 3Q0VA 3L7WA 4D7MA 3H0GJ 3SZPA 2E5NA 4ESFA 1RJ9B 3B9QA 2FNPA 5A2QK 4I3MA 3CC4I 2X1EA 2O5RA 3OYJA 5E33A 1ZARA 5IY5H 5KNLA 1Z63A 4LB6B 4AIHA 3DU6A 4YT2A 3BR0A 2OKUA 2J9BA 1HSJA 2Y9ZA 1TWCJ 1D0ZA 3U3FA 1D0XA 1HY5A 4C2UA 2E60A 2F22A 2HQRA 3BG5A 2A0BA 3GEHA 3IUOA 1UG2A 2HYJA 2VE9A 2HDDA 5B1BH 2V9PA 5IYDJ 5CVUA 2LD5A 3L34A 4BJ5A 3WTVC 2MLKA 4GCVA 4CS9C 3CDHA 1X2NA 3UNGC 3HB9A 1EKYA 4RB3C 2Q8KA 4RDAA 3QRFF 2LKXA 4RM2A 3PJRA 4YIFA 1TW3A 2XF7A 2ZJQF 3KEYA 2AP3A 2COMA 1XX5A 4IVNA 2CQQA 3JRCA 1IUYA 3AJMA 1P92A 2DJNA 2K5CA 1JKQC 2DDAA 1E2XA 2BVMA 4XEKA 1HQCA 2LIGA 2DQLA 4O3MA 5CI8A 2XPVA 4C2MJ 4CXFA 2XL8A 3HJEA 1NG6A 4C30A 3RPUD 1ODDA 3W8IA 4G9YA 4E70A 2R5YB 3EUHA 1ORYA 1IRXA 4HNUA 4B43A 2NRAC 2IXMA 3ZQ7A 3KLNA 1PD0A 3DEUA 4PJMA 2ZNZA 4YG2F 3FHDA 1QHGA 2LBFB 3L2WA 2UUIA 2P6VA 2R7RA 5D5WB 3TD7A 4WWCA 4CSWA 4DZJA 2OG2A 1IN5A 2Y0SA 3QPTA 3NWSA 4S05A 4AL0A 3TO7A 3VM6A 3ZQIA 2YLIA 2HKXA 1JPNA 5FO5A 1B6AA 2DMTA 1NK2P 3EGDA 1KGSA 2H09A 1OYYA 1WJBA 1O3QA 3K4CA 1W2WA 3RQGA 2M64A 3FHNA 4C7OB 3HGGA 3SFIA 3S17J 3FKIJ 3N2ZB 4Y52J 4EJTA 5JR3A 3KETA 4DNCA 4XR6A 3VDXA 4HEA2 5GP9A 5KYUA 4OIQF 2WB1N 2EFPA 2XIGA 5ILSA 2UWMA 1T01A 4DBQA 4A3DJ 3EH1A 1WJ5A 4AU7A 2KDOA 2LSEA 2Z16A 5GAHJ 3RVYA 3AG1C 3T6GB 3BJAA 4L9TA 4CS8C 3AKZA 3CCQI 2YWAA 2WADA 3SFZA 3ZRGA 1VQ4I 3OS2A 3QOEA 2I15A 3H92A 2PJRA 1JTYA 3G1OA 4MW8A 3QP6A 4ABZA 3E6MA 2WWYA 1CF7B 5L3GA 3GEIA 3I9V2 4XRFA 4XOPA 4LDQA 4PFOA 3CO7C 1BI2A 2L2OA 3ABTA 3E6DA 1DP7P 1ETYA 2DFFA 5FGMA 1LPEA 3TW6A 4NCQA 4XLPF 2F6CA 4L9VA 2FGYA 1WJEA 1IG7A 1LS1A 3BQZA 4XRSA 3AGUA 3FAPB 1F9NA 1QZYA 3A2KA 4BG0A 2DT6A 2DOFA 3HBLA 2N8GA 1LPQA 3C3WA 4FWVA 3WAQA 4WGYA 2ESHA 3QP5A 4HA8A 5D6FA 2XGCA 3NEUA 4P1WA 5IT3A 1SVOA 1MGTA 4AC0A 3VYWA 4DYCA 2EIKH 3E6CC 4UUTA 2ID6A 4KJZA 5GAGJ 4A3JJ 4N9HA 3ZTZA 5J8FA 4ZYEA 3S8PA 5FFXA 4J00A 4LITA 1YW7A 2LY2A 2LK2A 1OCRH 3S84A 1UELB 2LY9A 5FRNA 5E3AA 2ECBA 3O2PE 5IT9Z 3DPLC 3QAHA 2VJ5A 1Z3XA 1YHQI 2EIMC 2P7VA 1V5EA 4DYRA 4CCMA 3ZQCA 4CA0A 1FT9A 3D0SA 4W97A 1LI7A 2ZMEA 4RA2A 2XLDA 3HOXJ 1ST6A 4MFDA 1TWCA 2GA2A 2AXTC 1ZW2A 2ISYA 1J5YA 3J06A 1MBKA 2CSOA 3GW2A 1KZHA 1ZRDA 1BC7C 2YL1A 3HSRA 1ZGAA 3GTMJ 4ETSA 4M9SA 1UHWA 3O55A 1FPQA 4HPQA 2GM4A 5IP6A 4XM3A 3NKEA 2JSCA 1OR7C 3PNYA 1GV5A 1YFHA 1IZ1A 1O5HA 5ICEA 1E17A 5A6JA 1T6SA 1YJWI 4H4KC 3EJNA 3OIPA 4XSZF 1LVAA 3ELKA 1QO0D 3MKWB 1T8IA 1EA8A 2H6CA 1B1BA 1P4XA 5KCMA 4Y13A 1YZAA 3HKKA 5T1DB 2L0KA 4BJ1A 1HBXG 4IHXA 4BUPA 3LAYA 1KU9A 3ZQYA 3Q9VA 2PX3A 1RMVA 3UGPA 1XMXA 2FFHA 1OCZC 3U21A 1FZPB 3K1IC 1W4MA 5FKLA 4ULWA 3LSTA 2HDCA 2DPDA 1FBQA 1OJLA 1JUPA 1Z7LA 4L18B 3VODA 1E84A 2WVOA 2V1NA 5IPAA 5KYNA 1I1GA 3H9GA 2ZXWC 2O3FA 4Z2YA 4F52A 2BE5F 1H6GA 2PP4A 5DTDA 1VQPI 5F27A 2A68F 2M0MA 4DIQA 1U6HA 1TW2A 2PN6A 2DT5A 3F8CA 4I0AA 2A69F 1IGNA 4A12A 3FZVA 5A69A 1D8KA 4ZYDA 5HOOA 2HOTA 1KTMA 1D1BA 1O7FA 1D1AA 4IOCF 1G5ZA 2J9UA 3BCBA 4WABA 2NUPA 4NQFA 1TT5B 3IAM2 1WJFA 3B71A 1VQLI 2EILC 4HE8D 1BL0A 3ABLH 2YL0A 1R22A 2ZFUA 1ZU4A 5CQEA 5LGNA 3CEXA 4YL1A 1WJCA 3CZ6A 2NNNA 3UGOA 4M6VA 3RQEA 3T4RA 2R7QA 3IWZA 3FAJA 3ONQA 1C0WA 4ZC3A 1Z77A 1R4TA 3SXKA 4IWBA 1RESA 2CGEA 1U8RA 1P6RA 2DA6A 2RD9A 2XLVA 3HTKC 5LRSA 3JAMZ 5LHIA 3CUQB 1ZR2A 2KFDA 2W82A 3GWNA 4A2NB 2KJCA 3J81Z 2ESNA 2JPUA 3OS1A 2YHSA 3EGXA 2FU4A 2V9KA 4G6TB 2FOKA 2YRFA 3LA7A 3PMRA 4LACB 1R36A 1PV3A 1Y8RB 2PFDA 1D5VA 1REPC 2P81A 3CC7I 1LE8B 1JAFA 3T6BA 1JTXA 4OIRF 1POGA 4U0YA 3C2GA 1MMSA 2JVHA 4ENJA 1OKRA 2CFXA 2GLOA 1FWZA 1A7DA 4LFUA 3CAXA 4P6IC 2PG4A 5AONA 1HKTA 3MBGA 2V79A 2LY1A 4YIRX 4ZDLA 3JRIA 2Q7RA 1I3QJ 5JT4A 3RW0A 3DM5A 4O7GA 2H6BA 1J2XA 3BR5A 3PUBA 3LSPA 2ZJPF 4ESBA 4JC7A 3WTTC 4G12A 1QU3A 2XRNA 5EF6A 3WE3A 1YITI 4D4XA 5HSWA 2EWNA 2HZTA 3LLKA 3O10A 4NTFA 1IUFA 3ZWIA 2X1CA 2CUJA 3OOUA 2GBYA 2J8WA 5CKTA 1FMWA 1MBHA 1TTYA 1P2FA 3H5AA 1S7ZA 2HMQA 2NUTB 2LP4A 2WL8A 4XN3A 2L9RA 4MIMA 3ZPLA 3B6CA 1VI0A 5FLXZ 1YVIA 4ULVA 4MTFA 1IRFA 3BG6A 4GXOA 4RBOA 3OYNA 5K7ZA 2KW3C 4AVZA 1E0EA 5BQGA 3TOAA 1BR2A 3AG2H 4FASD 1Q0GA 1RUOA 1MW7A 3C2BA 3ABUA 4YFXF 2LH9A 2AWCA 4IHWA 2DFIA 5KYWB 1K78B 1S5LC 2VOOA 4OIOF 1VLSA 1EV7A 2EPKX 2UV1A 4PCQA 1HDPA 2JT1A 2KZGA 4OU0A 2XAFA 4IARA 3W8HA 1SANA 2HQ5A 2DI3A 4XL9A 4B3AA 2R0QC 3KP6A 4MVMA 3DP7A 3KP4A 4KT5C 3CJQB 4UB6C 5ICFA 3SXZA 2HJ3A 3F3XA 2XLEA 3I5QA 4V19K 4XLAA 5EEGA 4NBQA 1DQUA 2HNHA 5J3LA 1TWHJ 2WC2A 5E8GA 1YX5A 1K40A 1PUFB 4E0HA 4HQEA 1EH8A 2KMUA 1LE2A 3OR2C 2BVLA 2K9NA 2IBDA 1E83A 3OYAA 5LD2C 1YQAA 1WQ2A 3W6KB 3BG9A 2JVGA 3OYMA 3RPUA 2CQ7A 2R7TA 3CMAI 4O6MA 3V5ZA 2XRLA 2OQRA 4ENKA 1LB2A 3MKYB 4M3FA 3FXLA 2R05A 5FB2A 1QBJA 2EA4A 1FBUA 5L0CA 1RNLA 1K6OA 4EKWA 2CO5A 2CRGA 2EPOA 5B5EC 4QIWN 3I4PA 1AKHA 3L00A 2X6XA 4PACA 3DCFA 5GTIC 2F2EA 3S1NJ 1EF4A 3GBGA 2VPRA 2NSFA 2CG4A 3VPRA 3OA1A 2P61A 2HMZA 3X2QC 1CGME 1G6NA 2GAUA 1E3HA 4UVBA 3RPQA 1SEUA 1Z67A 3VYUB 4EJUA 2HS5A 2FAPB 5JHUA 1T98A 4AVPA 2JZYA 3K1NA 3AG1H 1HA8A 2HI3A 1XWJA 3L2RA 1NK3P 3A9CA 3E70C 2PMZN 3LEOA 5BNGA 2DQRA 1HKQA 2EV5A 1H8AC 3LS1A 3HXLA 4NDLA 4BE2A 2IA0A 3HYIA 3CJNA 2JD3A 3LEVA 2HGCA 3TDUC 3WG9A 3MZ8A 1WCMJ 4YK5A 5DCFA 3EPZA 5J1RA 1EH6A 2VKDA 4TV7A 1O7LA 1JRAA 2XAJA 2KRFA 4R1HA 1S6LA 1TNSA 1A6IA 1MMNA 3LS0A 1U0JA 4M3EA 1RZ4A 1FP1D 4A2UA 4LGWA 4BHCA 5CI9A 3HPHA 5FD6A 2CYDA 2XHKA 5FRMA 1SMTA 4IRGA 3S15J 4HF2A 3QW1A 3SHFA 1YW8A 5L3EA 2HSQA 2L81A 2L3DA 2VLAA 1JT0A 1TQGA 4G0HA 1KYZA 4XTKA 1ZK8A 4UV9A 3KYDB 5E3MA 2R5ZA 4A3BJ 4CCLA 1XTAA 1OMIA 2OCEA 1YS6A 2QLAA 2RNJA 2M4EA 3CUOA 3A01A 3TOBA 2L4MA 3S32A 1ONVA 2R03A 2HVQA 2YX7A 4IF4A 1SF8A 1ZGWA 4DVZA 4BEHA 2EIMH 1ZLKA 4PR9A 2WZFA 5GPAA 1YG2A 2DDBA 1GUUA 4YELA 1OXBA 4XEVA 2CYYA 4GO1A 4EM2A 4P9TA 2ECCA 2PF4E 5HDKA 3SXYA 3HPGA 3IP4B 5M3MJ 2E2HJ 3MMYB 3CUQC 1M57C 3OYLA 2HFHA 4QI2A 3CLOA 4RLFA 1AA7A 3CP8A 4MVQA 5CLSA 1MJAA 3QU3A 4NC7A 4HFKB 3F8MA 3OV8A 1HC8A 3C8GA 5FROA 1WI9A 1IRGA 3U9MA 2L4AA 4BDYA 1ZYRF 2OUMA 1UFMA 1LM3B 2OEVA 256BA 3ZQQA 2Q9AA 1VQOI 5F0HA 3H2UA 3F8NA 2IXNA 1Y4CA 4BEJA 2MC3A 4D5FA 2MC4A 2RAEA 1OYIA 3M3YJ 3C18A 3ZMDA 5HLTA 3NQOA 4BACA 2FD5A 4LB5A 2VIXA 3ECSA 1H9GA 2CS3A 1TBXA 4HX4A 1U6GA 4ZH4F 3RQ4A 2NSGA 3VSKA 3WHBA 3FVYA 3JREA 2OZ6A 1KQ0A 3KZZA 3L2CA 2JA2A 3D5RC 1AHDP 4FETA 2L6GA 1V5GA 5EDNA 4IOAF 3KYIA 4N4WA 2VE8A 1WKMA 2E36A 3QWLA 1FYLA 1BA5A 2VT3A 1PYVA 3EGDB 4M3DA 1TWHA 2I8BA 1XDSA 4HZFA 4XPWA 2RGVA 5K5OA 2NS8A 3JYYA 4BKXA 3ISPA 4XORA 2FE3A 4YFNF 1HXDA 1SVLA 3L2UA 3KX2A 3BZKA 4A6DA 2EFNA 4F3QA 1GGQA 2O61A 2JUCA 5KYUB 5F04A 3EQLF 3SEZA 4P9UA 5L3CA 1LJ9A 5AC5A 2QGUA 3FK6A 3QYBA 3B73A 1S05A 4JTCB 3F23A 4OWRB 3OSFA 4HAMA 1A35A 4K2EA 3ZMZA 1YYXA 5A6AA 5A2QZ 4RLQA 3HEFA 1ON2A 2IXPA 4U5HA 3ZG1A 4ANJA 2GXAA 2CWEA 3GLLA 1BOAA 4RAGA 4EVIA 2JA6J 1CPQA 1B8IA 5HS9A 2PJRB 2AHQA 1DU6A 2QY9A 1YLFA 4RGRA 1VYKA 2WB7A 4DOZA 1MNEA 3QMKA 2QQ9A 2KIUA 3MAJA 3WU0A 1Y8QB 1RETA 1DUXC 1Y56A 1K7AA 1BW5A 3UMHA 1LDDA 2VBZA 3KEOA 1S7OA 1J9IA 2ZXRA 3ULQB 2RQQA 5FLMJ 2EILH 4FESA 5LBQA 3BTIA 2DAOA 2EH3A 4CBEA 4Q4ZF 1UZCA 3DXJF 3QTHA 3LNMB 1HMDA 2CFOA 2QUFA 3FXJA 1V5FA 5DQZA 2A1DD 5IOZA 4JBAA 1T6IA 3KYJA 2COBA 3N0TA 3W3CA 5B1AC 2PX9A 4ENMA 3A0BC 3V5XA 4UUSA 1I1SA 1DPRA 2LTPA 2DA4A 3WU1B 4J7TA 2HPMA 2YVKA 4KIGA 2F4IA 2KRCA 3MD2A 1MDMA 4G7ZF 5BQTA 2IT0A 3GTOJ 1T9KA 1W36D 1YARO 2JX0A 3JR9A 4MVSA 3QZCA 4MQVA 2NVQJ 3RQFA 1D8JA 2Q2EA 4MO7A 5D8KB 3F47A 3DKYA 3HHHA 1SAXA 3NYMA 5GADJ 1G2HA 3GUDA 1T56A 2MA3A 2AQFA 2O8XA 5EZHA 1YDIA 2KQRA 2L9SA 2OCCH 5FCLA 3QPSA 4DXWA 2P7VB 2VJ4A 2R92J 3GCMA 5A6BA 2OJED 3SQNA 2ELJA 4BE1A 3G71I 1B72A 1TR2A 3K6BA 3L8IA 2DN0A 1H0MA 1S7EA 3OYDA 2VXDA 1R5ID 1YOVB 4O6JA 1MNDA 2W4SA 3DBRB 2ZMEB 1YZCA 3T6JA 3CLQA 3DKAA 3LNRA 4BYYA 1D1CA 4MEYF 1Z3IX 3WTYC 4MLOA 5ILVA 2XL6A 3V7OA 2DFHA 2IBFA 4CX9A 4ZYGA 2W48A 3DKXA 3BC8A 3PL8A 2YR2A 1YX3A 4U88A 4JX5A 4EJVA 3IPMO 4J30B 3DJNB 3BROA 4IHSA 3A1YA 3P9CA 3U8PA 3DEWA 2KQ9A 4NB5A 4KDPA 3TP3A 5HDNA 3KYLA 3FISA 3FHZA 1VYIA 1ZU5A 5B3IA 1XGNA 5ERIA 4JX4A 1G4US 2VQHA 3HL2A 3RI4A 2KK1A 3OYCA 5E1ZB 4NHJA 3KL4A 3FXQA 3COAC 5LEJA 1J59A 3CQZJ 4JJFA 3H5RA 2EPLX 2MSYA 2XAUA 2CUZA 3E3VA 2XDVA 4N4NB 4DZPA 2W1OA 1JHHA 3V8KA 1YIOA 2ZCWA 3QYEA 2FOWA 5F6FA 3QODA 3OSGA 3S14J 2MLGA 3SNHA 3GYHX 2H27A 3VOEA 4D1QA 3HKZN 4EV0A 2H1KA 1WGXA 2BHZA 3SYTA 2BBYA 3FXRA 3U2RA 4JCHA 3E1SA 2Z1DA 2QCOA 3I4UA 4AX2A 3E5QA 1MJ9A 2GQQA 2A6TA 3WTWC 3A0HC 2WTEA 2X51A 1TWGJ 3HRTA 2IOQA 3U2LA 3IKVA 2VQLA 1VF9A 2NG1A 4M6YA 4HLYA 2J0WA 4BJ5C 5K7HA 3M9AA 1TC3C 2K9MA 3EDPA 1IXRC 1W0TA 1MH3A 3G1LA 2CV1A 5LHGA 4WCGA 4J19A 1VOMA 4ZTJA 1RKCA 3JZ0A 5F1JA 1QGPA 4XKVA 2JPCA 1OW6A 4U5FE 5KVRA 3T9OA 4FT8A 1APCA 1OYWA 4R32A 1Z91A 4LOCA 4IAOA 2BZTA 3O6BB 2QM3A 3LSJA 2ZJ2A 4BJ6A 3HG9A 2NUPB 2M3AA 4NY3A 3EUHC 2R7SA 5D5UB 2V1XA 1RUNA 2WVNA 3SZRA 4IQ4A 2GFHA 3J7AO 2EIJC 1C02A 3GF2A 4A3CJ 4D4NA 1BOBA 2VJIA 2R9RB 2H7VC 2BC5A 3SDGA 2R7XA 2E1NA 1GVJA 4HLXA 2CCYA 2VBYA 4S04A 5FJ8J 3X2QH 1D5YA 3M4BA 4IQJA 5E3CA 3ABMH 3NG1A 4CSAA 2LRDA 2ELKA 4ASNA 2O9LA 3L8JA 2V1UA 4HW0A 4JCZA 2RSEB 3LUTB 1U9OA 5FKMA 1MSEC 1SZIA 1W7PA 4HQMA 3WODF 2L7FP 4QPOA 1OPCA 4KUMA 2Q1ZB 1M56C 3EGXB 2XAHA 4MVZA 4IRHA 1DU0A 1EQ1A 1XS9A 2YX4A 2Y3DA 2DGJA 2M45A 2WV1A 1Z05A 1IN8A 4CZZA 1F1MA 2LF8A 5E18F 4KN7X 1LEBA 1F1ZA 2L7AA 4CIHA 4MTGA 3CF5F 2UUZA 2E34A 3I4NJ 2VUMJ 1HOMA 3U8VA 3PSIA 3C63A 2DA3A 2KIQA 3RIRA 5K5QA 1BIBA 3ZMTA 4O6NA 2CW0F 2LFDA 2VKVA 3EH2A 3ZR8X 1LS4A 2F5CA 3AQBA 2DFEA 3IQ6A 3OEOA 2NS7A 2WAQA 2BL2A 3F6OA 2YUSA 1N77A 4BE0A 2P0WA 2J5OA 2R93J 2IEKA 1QPIA 4A3GJ 5EGOA 5T3TA 1H7IA 5JSLA 3LSKA 4HX7A 3HTSB 1MSFC 1RKWA 2CUEA 3D5SC 4HF0A 3O3KA 4OINF 1SFEA 5JLIA 4MGRA 3R6SA 1H88C 1ZHWA 1LEAA 4QPQA 1LDJA 2ZXPA 4HV5A 4DVYP 3MFKA 2P7CB 3VSLA 1ZAOA 4F55A 4XKBA 3RCOA 2OBPA 2V4JC 2NVTJ 2XLWA 3HUGA 4UNOA 1JKRC 2BOLA 5E3LA 3QVZA 3K1MA 3CCJI 3DF8A 1VFCA 3HOYJ 1QLEC 3HSEA 1KQ9A 4C3HJ 3G6EI 1ZHTA 3CQZA 4CDGA 4J32B 3J80Z 2DMUA 3UMIA 4AYBA 4OIPF 2EZHA 3DTKA 4CCKA 3J7YJ 3GTLJ 1Q0MA 3N05A 4U7BA 2KNHA 1VLTA 3U1KA 1MH4A 1WVRA 2G3KA 2GA0A 3R60A 5IOYA 1YS7A 1FP2A 2CV2A 2YQYA 3BPVA 3LA2A 3CF2A 1R71A 2O7OA 3NAUA 4BBSJ 4NQWA 4V2FA 4RAYA 1FLIA 2ZMEC
chains in the Genus database with same CATH topology
4EATA 3PMRA 4LACB 1OKKD 3JRTA 4BJ6C 1GLNA 2PFDA 4W8KA 3H9QA 3VYRB 3POVA 3BLYA 4XLEA 3FDQA 1LDKB 1TWGA 3T6BA 4G7HF 4OIRF 2XRHA 3C2GA 4E7IA 2QTVA 2W4BA 2JVHA 3G2BA 4PSXA 4E6KG 4AE4B 2WVQA 4ZJZA 3K70C 3RYLA 1X1AA 1FFHA 2C04A 4P6IC 4YT4A 3IAS2 4E7ZA 2KHMA 3ABLC 2LY1A 4I44A 4ZDLA 4E7JA 2I8DA 2W4MA 3FDYA 3DM5A 4O7GA 5E2QA 3OYHA 2YEVA 2WAEA 3PUBA 4CSAC 3CJRB 3HOSA 2ZXOA 4XLNF 2WY7Q 2R7WA 4II2A 2WZLA 1Z6AA 1QU3A 2E1MC 5HSWA 3M1CA 4BXFA 1Z5ZA 1PD1A 4HRIA 2A6HF 2G62A 2X1CA 3LLKA 5HNHA 4BDZA 3DEEA 2CUJA 3OL3A 3OOUA 2CH0A 5CKTA 4O6YA 1FMWA 5B3SC 1S7ZA 4CZCA 3H5AA 2NUTB 4EBBA 1ZHZA 3NWTA 2QKMB 3FBIB 2WL8A 3LMMA 2HVSA 4XN3A 4KNVA 4LERA 1IZMA 2GOMA 3K4LA 3IEEA 4X0GA 3PHF2 4XLHA 3HLZA 3ZIBA 3BG6A 3OYNA 2XC7A 2KW3C 4Y33A 4AVZA 1E0EA 3H9JA 4FASD 1BR2A 3QYFA 3K4KA 4HSTA 2LC2A 1MW7A 1SFKA 2V6EA 3OR1C 4N4OB 2HV6A 4JZAA 2LH9A 4HEAJ 2DCEA 2HQAA 1PCXA 5KYWB 1G8XA 2EIKC 4OIOF 4HSRA 1ERDA 3EHNA 2UV1A 2CW7A 1W36C 1FTSA 4G7ZF 4KT6A 2VH3A 3W8HA 4XL9A 3DU5A 5HVQC 2GOXB 3CJQB 1OCRC 3M8JA 4J01A 3SEOA 3AL0C 5KYYA 3I5QA 4XLAA 5DQTA 2MD0A 1DQUA 2HNHA 1BR1A 2X1DA 4LG3A 2Q3TA 5F5FA 1YX5A 4F92B 4DJAA 3K66A 2IGMA 2KMUA 4MQ9F 3OR2C 3PNVA 2BVLA 2IS4A 1JPJA 2KLOA 1OCCC 3OYAA 5CQGA 5LD2C 4RD9A 2J7PA 3JYHA 3OYMA 5DS6A 2JVGA 4QI0A 2R7TA 4CUGA 4ZTFA 4O6MA 1J8MF 4ITVA 3MKYB 4PSWA 4Y4RA 3S3NA 2JUGA 4BL0B 3AG2C 4BEHB 1X1DA 5CPRB 3OS0A 1VZ0A 3N24A 2HZDA 2R7OA 3NRHA 2VL8A 3AG3C 4F4BA 2X6XA 3OYKA 4PJJA 3GBGA 3OWTA 4K0DA 5F5HA 4KI2A 4XWJA 3OA1A 3Q7LA 1EA3A 4OD4A 4XLCA 2HV7A 3X2QC 3DPUA 4KITB 4ZLCA 2DT7B 2NUTA 1DGWY 3E0JB 4U5BE 1QZXA 3H65A 4XNFA 4YRVA 3NYJA 3VYUB 4AE4A 1HA8A 3JSZA 3HOTA 4U5EE 2ZXHA 2LG4A 2J0XA 3L2RA 2KZVA 4E7LA 3E70C 3K10A 2J9VA 3CSKA 5EGYA 4B48A 5DLJA 3LS1A 3LFUA 3HXLA 2X85A 4BE2A 4CS7A 2EINC 3SZGA 2IGNA 3K4BA 1R6RA 2JD3A 3LEVA 3RIPA 4PFPA 4RMNA 1NU7D 4F93B 5KYYB 3S27A 4BQQA 5KYXB 3EPZA 3SEQA 1V55C 5DS4A 2VKDA 5JHFA 4IZZA 5KYWA 3RH3A 3CESA 2W7NA 2Q9CA 2G3VA 2L9NA 3BG7A 1MMNA 3DPTA 1U0JA 4BS9A 3PFYA 4D9JA 4IX7A 3LS0A 4M63A 5CI9A 2VPLA 3EUAA 3HPHA 4HFFB 2V26A 2O9XA 1M2VB 3W2VA 5FRMA 4WJ0A 4E4HA 5EHHA 4FX5A 3LSGA 4YEJA 2L81A 4KBLA 2VLAA 4DGWB 3ITFA 2ZSIB 4G0HA 2L9JA 3LLIA 1Z21A 4XTKA 3KKBA 3K6GA 1JI8A 1J8YF 1O87A 1OKKA 4CCLA 4OD5A 2R7UA 3SP1A 4K7BA 4LLCA 2VQCA 4U87A 4BU2A 2M4EA 4XQFA 2WZGA 2Z15A 3KMIA 2DYSC 1MMDA 1Y6IA 3K1HA 3DLAA 3RFYA 3S32A 1VMAA 4E7HA 2H7OA 2HVQA 4YT8A 3TL4X 2DXIA 1SF8A 4DVZA 3DTIA 4BEHA 4Q5SF 3OIQA 2KJGA 3DZAA 2KP6A 4OAYA 2WZFA 4YELA 2YZSA 2WB1A 2IXSA 3OL4A 4RM3A 2PF4E 4JQFA 2ZPAA 3E9VA 2CMPA 4LLEA 2WAFA 4AK9A 3HPGA 3IP4B 3JT1A 4OIPF 3MMYB 2IS1A 4C3EA 3TBIA 1M57C 3OYLA 4U5DE 4RLFA 1N1CA 1AA7A 3CP8A 4R79A 4Q7CA 2Y3HA 4JOMA 3B0VC 4NC7A 4I1OB 2IGKA 4HFKB 5FROA 1WJDA 4CCJA 3BCAA 4E7SA 3K7DA 2WY8Q 3EZHA 4U5CE 4BDYA 4NNJA 1ZYRF 2OUMA 2XXAB 2Q9AA 3ZC4A 3ZQQA 3VWBA 5L3VA 3GANA 1G59A 2IXNA 3LSMA 3OYEA 2A5WA 2OC6A 3DMDA 4BEJA 2MC4A 4C3BA 5HLTA 2AQEA 3I3LA 2J9WA 4BACA 5KYXA 2VIXA 3OYIA 2HVRA 3ECSA 1UAAA 2CS3A 5D91A 4BQNA 4CS8A 3RQ4A 2IXOA 3ABKC 3WG7C 2XSEA 3VSKA 4PK4A 3FVYA 4JVSA 2KRHA 3DTEA 3HKZA 1LFPA 2JA2A 3D5RC 4XKCA 5KHDA 3NYLA 4FETA 4JW1A 1QHHD 1V5GA 2Q2EB 3S3MA 4ZYAA 4ZDPA 1LKXA 2IS2A 3K4JA 3DD7A 1M2VA 1PYVA 3EGDB 4DBRA 1TWHA 2I8BA 4ZLDA 4RBNA 4E7KA 4G6TB 2VASA 3L0IA 3H35A 2E5NA 4XORA 3ZVRA 1X19A 2C03A 3L2UA 1RJ9B 3B9QA 4I3MA 2X1EA 2O5RA 4C9YA 2LYCA 3KX2A 4XMYA 3OYJA 2MABA 1NU9C 5KNLA 4F3QA 2PX0A 3O39A 5E33A 5KYUB 1Z63A 3DU6A 4YT2A 3EQLF 2W9YA 3SEZA 3K70D 3RTRA 3AG4C 3LL7A 1D0ZA 2JSPA 2QKLB 3QYBA 2HPIA 4OWRB 1D0XA 4C2UA 2E60A 4JURI 4RLQA 4KC9A 2CNWD 2IXPA 4U5HA 3ZG1A 4ANJA 3IUOA 2M4GA 4PJNA 4PJLA 3L34A 4BJ5A 1D0YA 2PJRB 4CS9C 3UNGC 2QY9A 1VYKA 2WB7A 4DOZA 2R7VA 4RDAA 1MNEA 3L2QA 3OY9A 4RM2A 2L5QA 3PJRA 2XF7A 3ZCOA 3QMKA 3KEYA 2E5ZA 3S28A 3PSFA 1Y56A 3UMHA 4QI2A 3RSNA 2ZXRA 2K5CA 2RQQA 4MNDA 3EPVA 1FFTC 3VAYA 2BVMA 4FESA 3EG9B 4CCNA 3EUKL 4CBEA 5CI8A 1T0FC 2Y69C 4Q4ZF 1NG6A 4C30A 2R4GA 3RPUD 3ASOC 3DXJF 3HJCA 3W8IA 2XXAA 2CFOA 2D5RB 4I1MA 1V5FA 5DQZA 2A1DD 1IRXA 4HNUA 4B43A 2IXMA 3EZIA 3S29A 4KISA 1FMVA 3N0TA 1ZELA 1PD0A 3W3CA 5B1AC 1TWAA 4PJMA 3VYTB 3FHDA 2K3PA 2HDWA 3K4MA 1QHGA 2LBFB 3L2WA 2P6VA 1OCOC 2R7RA 1V54C 2HPMA 3TD7A 4CS9A 3OYBA 2F4IA 2KRCA 2WA0A 3MD2A 4CSWA 2OG2A 4KNWA 2Y0SA 4XOTA 3NWSA 1W36D 3NDBB 3QZCA 3LJBA 1PJRA 4JJGA 2A6EF 3H5NA 3F47A 3DKYA 4II3A 1JPNA 3NYMA 5FCLA 2L7KA 2AQFA 2XF6A 2KQRA 2L9SA 3EGDA 1S9HA 1X1CA 2VJ4A 1BR4A 1WJBA 3D5LA 3K4CA 2ELJA 2RREA 4CCOA 4BE1A 1TR2A 2VB6A 1W2WA 3K6BA 3FHNA 3OYDA 4C7OB 2VXDA 1RJ9A 1DP3A 2CDQA 1MNDA 2W4SA 3N2ZB 3X1OA 4XR6A 1IW7F 3VDXA 1VK5A 3LNRA 3T6JA 4HEA2 1D1CA 1Z3IX 2LOOA 2H7BA 5KYUA 2J45A 4MLOA 4OIQF 3V7OA 4EWCA 3DQVC 2UWMA 4DBQA 1N78A 3EH1A 1WJ5A 4AU7A 2KDOA 3DKXA 2LSEA 3BC8A 3PL8A 2Z16A 3JCUQ 3FBNB 1YX3A 4GRIA 4IKFA 4YN0B 4YT5A 3V42A 4XLFA 2LREA 4J30B 3AG1C 3DJNB 4NUBA 3A1YA 4CS8C 3AKZA 2Y3BA 1WJAA 2KQ9A 3SYNA 2WADA 3ZRGA 1OLTA 3OS2A 3KYLA 3QOEA 1VYIA 1ZU5A 2PJRA 2VQHA 3HL2A 1NG1A 3GODA 3I9V2 4XOPA 3OYCA 4PFOA 2L2OA 2KPMA 3KL4A 2MYSA 5BUOA 4XKWA 3LSIA 2E1MB 4JJFA 3H5RA 1LVKA 4XLPF 2XAUA 2CUZA 2F6CA 2FUG2 2X6YA 2XDVA 4LIVA 2W1OA 1WJEA 4N4NB 1LS1A 2FGYA 2Q9BA 3EG9A 3CMMA 2OCCC 3QYEA 3QODA 3SNHA 3A2KA 5TGTA 1T95A 2DT6A 4D1QA 3EHMA 1UG0A 4BG0A 2VJJA 4FWVA 2VXZA 4CH7A 5HNFA 3LESA 3SYTA 3TMOA 3AQCA 3L2VA 3E1SA 2Z1DA 4P1WA 3I4UA 4JCHA 3OMYA 4AX2A 1SMYF 3VYWA 2E87A 2A6TA 2B0JA 2LBFA 4KJZA 2X51A 1ZHXA 3MKZA 3RKOF 2IOQA 4G7OF 4GEHA 3S8PA 2VQLA 1X4PA 2NG1A 4J00A 4LITA 2J0WA 4BJ5C 2LY2A 4IJJA 1UELB 2K9MA 5FRNA 1KU2A 1X4OA 2XF5A 2Z2SB 2Y3GA 5E3AA 3ZXSA 2CV1A 2BW3B 1VOMA 3DPLC 2VJ5A 1Z3XA 4XONA 4ZTJA 2P7VA 1K6YA 1SAUA 4XKVA 2EIMC 4U5FE 1V5EA 2OV7A 3S0XA 4NC8A 4C7OA 4CCMA 2IS6A 1TKNA 3KH2A 3B0UX 4CA0A 3AL0B 3Q6NA 4IAOA 4U5GA 2WBMA 1TWCA 1ST6A 3OYFA 3A4CA 4BJ6A 1NZEA 2HU9A 3HG9A 4BJTA 2M3AA 2NUPB 1WGWA 2VQGA 3EUHC 2R7SA 3MX3A 2V7FA 4PUSA 4NY3A 2WVNA 3SZRA 5T3WA 4IQ4A 2GFHA 2DJIA 2EIJC 4HPQA 3LSHA 4B47A 3MLGA 3HC7A 4Y3OA 2CV0A 1BOBA 2VJIA 3HUGB 4XM3A 3S3OA 3NKEA 2X6WA 1OR7C 3PNYA 4F91B 3K4NA 2R7XA 2IGOA 1O5HA 2H7VC 1TZLA 1YE9A 3PNTA 3DJUB 4HNTA 3EFOB 3O6XA 4H4KC 4N06A 3EJNA 1P9QC 4IRUA 3OIPA 4IQJA 1MMGA 2CNWA 3NG1A 2DYRC 2LRDA 5E3CA 4CSAA 3K33A 3B0PA 3C2HA 4GYTA 3ZSUA 3MKWB 4C2TA 1KONA 4IWBA 4X0RA 1SZIA 5KCMA 4BQOA 3WODF 4QPOA 3W2WA 4NQWB 3AFHA 2Q1ZB 1M56C 3DAGA 3EGXB 5T1DB 4B44A 4B6IA 4C3DA 3J7AY 4BJ1A 4BUPA 4YWQA 2Y3DA 2DGJA 3DAFA 3LAYA 2J7PD 2PX3A 1X1BA 3F46A 3UGPA 2KGOA 1ZHYA 2K9LA 4B3XA 2FFHA 2J46A 4CIHA 1OCZC 3U21A 3Q7GA 3K1IC 3UR3C 4ULWA 5IY5C 2UUZA 3ZGKA 3PSIA 3DWLE 1TT0A 2NOJB 1Z7LA 4O6NA 2CW0F 5DVWA 1N75A 2MFZA 2V1NA 2WVOA 4P5OA 3EH2A 5KYNA 3Q6MA 2BW3A 3H9GA 4XN0A 3ZR8X 2ZXWC 3AQBA 3OEOA 2WAQA 4F52A 2BE5F 2PP4A 1N77A 4BE0A 5L3QA 2P0WA 2A68F 2DOAA 2M0MA 5T3TA 3ABMC 3LSKA 3M1CB 4DIQA 2Y39A 4QDLA 5B1BC 2V3CC 3I5PA 3OYGA 3D5SC 2A69F 1DGRM 4OINF 1J09A 2CW8A 2RNGA 1ZHWA 5HOOA 1D1BA 4QPQA 1D1AA 4LIUA 2J9UA 3BCBA 2ZXPA 2NUPA 2M7AA 3CP2A 3IAM2 1WJFA 4DVYP 2VKHA 2ZXIA 3VYSB 5DS5A 2F5VA 1Z3YA 2EILC 4ZDOA 4HE8D 3VSLA 3S93A 2M7BA 2XSJC 2ZFUA 4XKBA 2V4JC 3RCOA 4F55A 5CQEA 1M2OA 1ZU4A 4HG2A 2ZSHB 1MMAA 5LFAA 1WJCA 2BOLA 3EFOA 1WFXA 3CZ6A 3UGOA 1QLEC 2W45A 3T4RA 2KL4A 4YJWA 2R7QA 1ZHTA 3FAJA 3CQZA 3ONQA 4OAZA 4J32B 4ZC3A 3UMIA 2IYLD 2PMZA 4AYBA 3ASNC 3DTKA 4CCKA 3W2AA 2CGEA 2XL4A 2M4KA 3N05A 4U7BA 2KNHA 3DM9B 4BGDA 3HTKC 4O79A 3H0DA 2W00A 2G3KA 1NG7A 3NKDA 3F9KA 2W82A 3SDBA 2CV2A 4A2NB 5D92A 3CF2A 2MWQA 3OS1A 3UMKA 2YHSA 3EGXA 3FKJA 2V9KA 1Z23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJ5 C;  4BJ6 C;  3CZ6 A;  3K6G A;  3OWT A;  4BJT A; 
#chains in the Genus database with same CATH topology
 1P4W A;  2IA2 A;  4EAT A;  4JKV A;  1R1U A;  2QUP A;  1PP7 U;  4W8K A;  4IGG A;  1WN0 A;  4GFB A;  4V2G A;  4DQ2 A;  1LDK B;  1I4Y A;  1WRJ A;  1NFN A;  1TWG A;  3JRH A;  2QSH X;  4FIS A;  2W4B A;  4AIJ A;  1S3J A;  4MEX F;  1R4N B;  4L5E A;  4ZJZ A;  4JEB A;  2C04 A;  4YT4 A;  1YW9 A;  3MQ0 A;  2RQP A;  3BJ6 A;  3FDY A;  3TGN A;  3AOU A;  2XGD A;  2HJM A;  1JOG A;  2W24 A;  3H2V A;  3RQI A;  2O8K A;  1AKH B;  2Z3Y A;  2LFF A;  4XLN F;  1VB5 A;  2WZL A;  2AS5 F;  2HOE A;  4Z6Y A;  2E1O A;  1NBB A;  2P8T A;  3M1C A;  4LK1 F;  3C8G D;  1XGO A;  4IHV A;  2GXG A;  2VN2 A;  2F5D A;  1K4S A;  4EBB A;  3G4X A;  1ZHZ A;  3NWT A;  1UJ8 A;  3PQJ A;  4LLN A;  3FBI B;  2TMV P;  4LER A;  1T39 A;  2GOM A;  4X0G A;  4YL3 A;  2F48 A;  2XC7 A;  2A05 A;  1F4K A;  2MH9 A;  4KNY A;  3QYF A;  3ZQV A;  2LC2 A;  3ZN1 A;  1SFK A;  2V6E A;  1R23 A;  3HOW J;  2JRT A;  4YFK F;  2HV6 A;  4JZA A;  2DCE A;  2UXN A;  4QSH A;  3ASN C;  1PCX A;  3BR1 A;  4IPA A;  3REO A;  4MVU A;  2IM8 A;  2LCH A;  5CVV A;  4Q48 A;  1W36 C;  2BY2 A;  2HEO A;  1V4A A;  4JK1 X;  2VH3 A;  1AUE A;  3JRB A;  3HZJ A;  2VOD A;  3TP0 A;  3M8J A;  4OOI A;  1JUM A;  5KYY A;  1O4X A;  2MH2 A;  3RDI A;  3TDZ C;  5B1A H;  2K40 A;  5TJJ A;  2X1D A;  3LAJ A;  5CVI A;  5E3N A;  1ZTR A;  3ZQF A;  4A3I J;  2ELH A;  4DJA A;  2R5Z B;  2X6O A;  1I3A A;  1JPJ A;  1OCC C;  4AE4 A;  1XCV A;  4FX4 A;  3I64 A;  2KIS A;  2ZO4 A;  3Q3S A;  3Q9S A;  3CO6 C;  4QI0 A;  3A01 B;  4IAQ A;  2D4U A;  3FF5 A;  1ON1 A;  3Q0W A;  3CME I;  5C4X J;  4M3B A;  1T38 A;  1GDT A;  4BEH B;  3ZMV A;  5CPR B;  3OS0 A;  2Y0M A;  3Q5F A;  5COG A;  1R58 A;  3N24 A;  2HZD A;  3OYK A;  1YJG A;  3V5Y A;  3K0L A;  4IRI A;  4XQ1 A;  2DA1 A;  2PI0 A;  3BQY A;  1X1P A;  2FRH A;  3M79 A;  1GXQ A;  2K4J A;  2E2J J;  4K0D A;  5F5H A;  5BMZ A;  1JXS A;  2V1D A;  3Q7L A;  3RJP A;  4XLC A;  1OR2 A;  4ZLC A;  3DPU A;  3MKL A;  2LKS A;  3E0J B;  4U5B E;  1XGM A;  4XNF A;  2GIV A;  1QZE A;  3C8G B;  3P9I A;  5AIP A;  2GZW A;  4U5E E;  2JRM A;  2LG4 A;  2R7D A;  5DDG A;  4E7L A;  2J0X A;  2KC3 A;  3CSK A;  5CJ9 A;  2HOS A;  1OW7 A;  4RS8 A;  4CS7 A;  2EIN C;  3MCZ A;  1I6X A;  3P9K A;  1NSG B;  1OR7 A;  3Q0U A;  3DBL B;  3RIP A;  3FM3 A;  4MFE A;  4BQQ A;  1LQ1 A;  5HDG A;  5ILU A;  2RV8 A;  5E20 A;  2NOG A;  3CD6 I;  1YO5 C;  5DS4 A;  1TWA J;  2EZK A;  4JYK A;  2W7N A;  2G3V A;  4N6C A;  2DOE A;  5FD5 A;  5A6B D;  4D9J A;  1FTZ A;  3L09 A;  1JR8 A;  2BY0 A;  2NAZ A;  3JSP A;  3GWL A;  1WH7 A;  1QVT A;  1IDZ A;  3W2V A;  3IV5 A;  5K0I A;  1LI5 A;  4JRZ A;  2UZK A;  2LD6 A;  3NMI A;  2HXO A;  2K85 A;  1RC9 A;  4KBL A;  2D2W A;  4CYD A;  3U9J A;  1CQT A;  1ZLJ A;  4FQG A;  3ITF A;  1CPR A;  1T0F A;  1Z21 A;  4CDY A;  2MW8 A;  4IXA A;  3K6G A;  1JI8 A;  1O87 A;  1H9T A;  1U8B A;  4XRS G;  4LLC A;  3KMI A;  5CVJ A;  4BU2 A;  2CUF A;  2TRT A;  1MMD A;  1Y6I A;  2QQB A;  4BBR J;  4E7H A;  2B0H A;  2W25 A;  2K3F A;  2RN7 A;  2HZ8 A;  2AXL A;  2F4M B;  4L9J A;  2KP6 A;  4OAY A;  1WAS A;  3SJM A;  4H54 A;  2WB1 A;  2MHR A;  5TJ5 E;  5DUK A;  5J40 A;  1B8I B;  2CMP A;  1ENH A;  5CYV A;  2WAF A;  1Z1D A;  2XSD C;  3I59 A;  2ZPA A;  4AK9 A;  3W4Y A;  2IS1 A;  3DE8 A;  4C3E A;  3V7S A;  4U5D E;  1N1C A;  2XB5 A;  3A03 A;  3HRU A;  2YU3 A;  2LF7 A;  4XRM A;  2IGK A;  2DA7 A;  3CCR I;  2EIJ H;  2NS0 A;  1O3R A;  2WY8 Q;  3EZH A;  2EFW A;  4U5C E;  4NNJ A;  3JCU C;  4AID A;  4MTO A;  2LKP A;  3ZC4 A;  3VWB A;  2VOP A;  3LAP A;  4IB4 A;  4UDV A;  1ZR4 A;  2A5W A;  1Y1V J;  2HFI A;  3V8J A;  1XSX A;  2EZL A;  4UUS B;  2HVR A;  2QBY A;  4LG0 A;  5D91 A;  4BQN A;  2RVC A;  5DUI A;  1YJN I;  4K1O A;  3GWZ A;  1G3T A;  3T1B A;  2KRH A;  1MDM B;  2IRF G;  4KN4 X;  2M8G X;  2GAQ A;  1LFP A;  5H6R A;  1XZP A;  2L6F A;  2HOA A;  4A3M J;  2Q2E B;  1XCB A;  3S3M A;  3LFK A;  2L7Z A;  1WZ2 A;  1HE1 A;  3DD7 A;  1TWF J;  5BQI A;  5GAE J;  1SD6 A;  2MGQ A;  1TFK B;  4DBR A;  4M9X A;  3S2H J;  2V9V A;  4ZLD A;  2P6T A;  1XD7 A;  4E7K A;  2DU9 A;  2KKO A;  1W0U A;  1B72 B;  4E0I A;  2VAS A;  3L0I A;  4ONS A;  3H35 A;  3ZVR A;  3C7J A;  4WXD A;  1WSU A;  4LJZ F;  3C1D A;  2A6E F;  2LYC A;  4XMY A;  1L3P A;  3O39 A;  2MAB A;  3RYR A;  2RDP A;  1RIO H;  2QNL A;  1IN6 A;  3K70 D;  2DOD A;  1E3P A;  2DK5 A;  3AG4 C;  3LL7 A;  3ML6 A;  3ERM A;  5F0C A;  4C3I J;  5E79 C;  1GHC A;  3CC2 I;  1Q1V A;  4HV6 A;  2XS1 A;  5BS6 A;  4XK4 A;  4KC9 A;  2DTZ A;  2QEN A;  2FQ3 A;  2W84 A;  5BOX A;  3W6V A;  2XLH A;  1XSV A;  4MNU A;  1NH3 A;  1D0Y A;  2JA7 J;  5LEK A;  2M9H A;  2GXB A;  1RPW A;  2ZD9 A;  2PEX A;  1YRN A;  2MBF A;  2R7V A;  5IYB J;  4AIK A;  1R1T A;  4KIB A;  3EYI A;  3ZCO A;  3S28 A;  1W7P D;  2E5Z A;  1HLV A;  2CQN A;  3PSF A;  1UCR A;  2LVS A;  4GYG A;  3RSN A;  2L02 A;  3DV8 A;  1FOK A;  1I5N A;  2XM4 A;  2STT A;  3RKY A;  3EPV A;  1I50 J;  2FBH A;  2PMH A;  4CCN A;  3EUK L;  5C44 J;  2Y69 C;  1Y6D A;  1IO2 A;  2K7L A;  3E5U A;  2R4G A;  2XAG A;  3F22 A;  3ASO C;  3CCS I;  3HJC A;  3GEE A;  2XXA A;  2D5R B;  3BRJ A;  4I1M A;  1OXK A;  3S29 A;  4U7D A;  3EZI A;  1FR0 A;  4KIS A;  3U0C A;  1ZEL A;  4YL0 A;  2YL3 A;  1TWA A;  1U78 A;  4P96 A;  1IDY A;  3VYT B;  3ASN H;  1I5Z A;  2K3P A;  3K4M A;  1PVE A;  3HSF A;  4BHB A;  1YJ9 I;  1FYM A;  2LFB A;  4M6X A;  1F5T A;  1PUE E;  3DFG A;  2QF7 A;  4KMU X;  3HHG A;  4XOT A;  5E1W A;  4G6Q A;  3V8L A;  3LJB A;  3NDB B;  1PJR A;  1XG1 A;  4JJG A;  5LRR A;  1ZH5 A;  3H5N A;  1SR2 A;  2FMY A;  2R7Z J;  5M5X J;  3R0A A;  4UHT A;  2XUB A;  2XF6 A;  3WTS C;  2HYG D;  3FK7 A;  4FHT A;  3D5L A;  4CCO A;  1WWP A;  2E7X A;  1Z6R A;  2VB6 A;  3CDL A;  1Y0U A;  2YS9 A;  1L0O C;  3KP3 A;  1Z7Q c;  3QW0 A;  1VQK I;  1DP3 A;  3X1O A;  1K61 A;  4IHY A;  3TJ6 A;  3JRA A;  1VK5 A;  2JA5 J;  2VBW A;  1BBH A;  3FMQ A;  2XS8 A;  2X4H A;  4L5J A;  2J45 A;  3JSO A;  4BXU A;  3DQV C;  1ITY A;  5COM A;  3F8F A;  3H3Z A;  3L1M A;  1JHF A;  2KJB A;  4M71 A;  1IXC A;  4Q47 A;  1AOY A;  3JCU Q;  4YN0 B;  4YT5 A;  2LRE A;  1RKE A;  1MQV A;  3WTX C;  5L3B A;  5H6Q A;  1OLT A;  4A3L J;  5L0F A;  2ACJ A;  1RR8 C;  1JMW A;  4FX0 A;  2JA8 J;  1JGG A;  1NG1 A;  3GOD A;  2KIF A;  2X9D A;  2R3S A;  4UB8 C;  1UG7 A;  1DPU A;  2KPM A;  2F4O B;  2H94 A;  2MYS A;  4XKW A;  1NFO A;  3LSI A;  1WOL A;  1LVK A;  2X6Y A;  2FUG 2;  4EUK B;  4IRU A;  2Q9B A;  4FAP B;  3TED A;  4KFC A;  4BPM A;  3EG9 A;  1W7P B;  3CMM A;  4WX9 A;  1TQI A;  4EGZ A;  2Z5U A;  2ZKZ A;  1MZB A;  4LD5 A;  3EHM A;  4EIY A;  1T95 A;  3BT9 A;  3GXO A;  3U1D A;  1G4W R;  4U9E A;  3IH2 A;  5FKN A;  3MZY A;  3O8G A;  3OMY A;  4MTD A;  3OOP A;  1Y1W J;  3PIP F;  2E87 A;  2LNB A;  2B0J A;  4X1E A;  5JVT A;  4O5V A;  4RAF A;  5IP7 J;  5HS7 A;  2R7F A;  3MKZ A;  1ZRF A;  1ZHX A;  3RKO F;  1GM5 A;  1Q0D A;  5L0G A;  4EJO A;  3BR6 A;  1HMO A;  1PDN C;  2HWV A;  3QPH A;  4IJJ A;  1KU2 A;  5EEH A;  4HDV A;  2Z2S B;  2Y3G A;  1U3E M;  3GTQ J;  1KU3 A;  3BG3 A;  3FOP A;  4JIO A;  4U0V A;  3SZT A;  4XID A;  3OIO A;  4XON A;  4I7H A;  1SAU A;  1T2K A;  4G8X A;  4KYW A;  5EGO B;  2OV7 A;  3K9T A;  1VQ6 I;  5EEA A;  2IS6 A;  1OCC H;  1TKN A;  3I71 A;  3MYF A;  1A04 A;  3Q6N A;  2GA1 A;  4U5G A;  2L9V A;  2WBM A;  4KA4 A;  5HV9 A;  3OYF A;  2D1H A;  1LFU P;  2DBB A;  1OCZ H;  4BJT A;  3KYC B;  1WGW A;  2VQG A;  3K2Z A;  3MX3 A;  3NAR A;  4PUS A;  1O3U A;  5JUA A;  5D4R A;  4HDU A;  1W5T A;  3H1C A;  4UV8 A;  2DJI A;  4Y3O A;  2CV0 A;  1U5T A;  3HUG B;  1UHM A;  4S0H B;  2X6W A;  4F91 B;  3CCM I;  3WG7 C;  3K4N A;  2ZXW H;  1YE9 A;  3PNT A;  1DDN A;  4HNT A;  2ETH A;  2HQN A;  3JRF A;  5ICG A;  3BZ6 A;  4BAY A;  2ID3 A;  1MMG A;  1O3S A;  2CNW A;  4RAZ A;  4EEF G;  3C2H A;  4CHU A;  4GYT A;  3ZSU A;  4AL1 A;  4C2T A;  1O57 A;  4I98 B;  3A02 A;  4X0R A;  2HR3 A;  1UST A;  3RKW A;  3WHN A;  4A4A A;  4BQO A;  4F7Z A;  3W2W A;  4NQW B;  3AFH A;  1ULY A;  4C3D A;  2EIN H;  4PGH A;  3C8Z A;  1XB4 A;  4A0Z A;  1MBJ A;  2Y0S N;  1S8N A;  4EMS A;  5J8C A;  1IRZ A;  1QVU A;  1HE9 A;  4YWQ A;  1WHU A;  4XPY A;  1LFB A;  3QVY A;  3F46 A;  4B3X A;  2LLK A;  2J46 A;  3EET A;  1C03 A;  3M15 A;  1NHA A;  3GLX A;  2XPW A;  3L1P A;  5EJC A;  3NMJ A;  3Q7G A;  3UR3 C;  2PLY A;  3ECH A;  2BY3 A;  4BQA A;  1QNT A;  1QZZ A;  4AWX B;  2YLG A;  3WU2 C;  2Y9Y A;  3CCY A;  3DWL E;  1FX7 A;  1TT0 A;  4W8P A;  2OU2 A;  3BJO A;  2ME6 A;  4HYE A;  2MFZ A;  2XVC A;  3BP8 A;  4P5O A;  3ROU A;  3Q6M A;  2BW3 A;  4KIF A;  2EQR A;  3FWE A;  4XN0 A;  2OJQ A;  1T6Q A;  1OR3 A;  1VQM I;  5L3Q A;  1IXS B;  5LGT A;  3M1C B;  2Y39 A;  3QPL A;  1U9N A;  2V3C C;  3OYG A;  1DGR M;  2CW8 A;  4MS2 A;  3TKY A;  4EM1 A;  2TCT A;  3CP2 A;  2VKH A;  2ZXI A;  3VYS B;  2F5V A;  1WH5 A;  1Z3Y A;  1K05 A;  4DJ9 A;  5J6X A;  2M7B A;  1A7E A;  1ZVZ A;  3S1Q J;  2GWW A;  1WI3 A;  4HG2 A;  2H8W A;  2FEZ A;  1JJ6 C;  2VC1 A;  3IHU A;  5E8I A;  3EFO A;  1X3Z B;  2OEX A;  3MFN A;  2KL4 A;  1BC8 C;  1MBF A;  4JX6 A;  4U0W A;  1ETV A;  3LSR A;  1YI2 I;  2AWY A;  2IYL D;  2PMZ A;  3HGY A;  3PO2 J;  1WPK A;  2M30 A;  2ISZ A;  4O79 A;  5ICC A;  1P4A A;  3NKD A;  3SDB A;  4L0Y B;  1Z0X A;  5HS8 A;  1QRY A;  2MWQ A;  3VFZ A;  1TP4 A;  3GOR A;  3E5X A;  1WWX A;  2J5P A;  5IYC J;  5KYY B;  2ZNY A;  1Z23 A;  3SYN A;  1VQ5 I;  1GS9 A;  1B9N A;  3ZN0 A;  4BJ6 C;  1GLN A;  1YIJ I;  5GTH C;  4MVR A;  5HLG A;  5H20 A;  3BLY A;  4XLE A;  3FDQ A;  3TQO A;  3KE2 A;  4I76 A;  2XRH A;  2VC0 A;  4E7I A;  4AE4 B;  4E6K G;  2WVQ A;  3K70 C;  2AO9 A;  3RYL A;  4KMF A;  4WGZ A;  1FFH A;  2M8E A;  1FBS A;  3IAS 2;  4E7Z A;  1AWC A;  5EG0 A;  3ABL C;  2EV0 A;  3U9G A;  5DD8 A;  1UFB A;  2W4M A;  1ZRE A;  2IP2 A;  5E2Q A;  3OYH A;  2YEV A;  3IQ5 A;  2VBX A;  4CSA C;  3DBH B;  3V4G A;  3HOS A;  4R8H A;  4DYQ A;  2WY7 Q;  1R4M B;  3FXM A;  4GGG A;  5HLH A;  2Z99 A;  2JQ7 A;  4A0Y A;  4BXF A;  4M73 A;  1GT0 C;  1SC7 A;  4HRI A;  3DI5 A;  5HNH A;  3R4K A;  4BDZ A;  3DEE A;  1BZ4 A;  1ZG5 A;  3OL3 A;  3H3V K;  2P0N A;  5JI6 A;  5B3S C;  3AG4 H;  1FTT A;  3GFL A;  1V74 B;  1AEP A;  2HXI A;  1JGS A;  3BEH A;  3K4L A;  1QPM A;  5D4S A;  5J1Y A;  3PHF 2;  4XLH A;  3GM2 A;  3S9O A;  3PUF A;  3KIO A;  1MNM C;  3RZD J;  2NPU A;  3K4K A;  2DK8 A;  3GTJ J;  3U5S A;  2DTR A;  4N0B A;  3FIW A;  2X0C A;  4N4O B;  4BNC A;  1RCP A;  1ETW A;  3BR3 A;  2G0E A;  2HQA A;  3S2W A;  4I0B A;  1F36 A;  1ERD A;  1L3L A;  3FM5 A;  4CYC A;  3ZQL A;  2FML A;  2XPU A;  2RKH A;  2Y69 H;  3K69 A;  1UMQ A;  4KT6 A;  3T8R A;  3ASO H;  4H0E A;  3GTP J;  2VCA A;  3DU5 A;  4G94 A;  2P5K A;  4J01 A;  1Y0N A;  3SEO A;  1FSE A;  2XAS A;  2A61 A;  3CCL I;  5DQT A;  2MD0 A;  4IHT A;  2QQA A;  3BTJ A;  1BR1 A;  4HOB A;  4N6H A;  2OA4 A;  3E7L A;  4LG3 A;  3W6J B;  1OW8 A;  2HYF A;  2M2E A;  2Q0O A;  3O8H A;  2OF7 A;  2LK4 A;  1JE8 A;  4E17 A;  4F92 B;  4QWQ A;  3BDD A;  5F1R A;  2IGM A;  5K5R A;  1RXQ A;  4MQ9 F;  3K66 A;  5LHH A;  4IJA A;  1OQC A;  4IEJ A;  5CQG A;  3T5X A;  4RDU A;  2J7P A;  3JYH A;  2HTJ A;  5DS6 A;  5JRA A;  3S1M J;  4ZTF A;  4PZJ A;  1O3T A;  1J8M F;  2LMD A;  2E1C A;  2JUG A;  3VEP A;  3AGT A;  4AUX A;  3M07 A;  5DCM A;  3AG2 C;  1M1E B;  1I4Z A;  1VZ0 A;  3NRH A;  1G3W A;  3AG3 C;  1BW6 A;  5JP7 A;  4PJJ A;  1HST A;  3I59 B;  3OWT A;  2UXX A;  2XGE A;  1YYJ A;  2GWR A;  4KI2 A;  1EA3 A;  3IH3 A;  5FZT A;  4KIT B;  2DT7 B;  1DGW Y;  5F64 A;  1QZX A;  1LNW A;  3H65 A;  5CIV A;  4YRV A;  4L0Z B;  4DW6 A;  2V6C A;  3EYY A;  3JSZ A;  2ZXH A;  2RC4 A;  4UY8 I;  2KZV A;  2KSF A;  3ZP5 A;  3R0J A;  3F6V A;  3K10 A;  2J9V A;  5EZG A;  5EGY A;  5DLJ A;  3LFU A;  2X85 A;  2EPF A;  2C6Y A;  2QA4 I;  3I58 A;  1R6R A;  4EHP A;  1PP8 F;  3WHC A;  1NU7 D;  4RMN A;  4CJO A;  3CCV I;  2BY1 A;  3S27 A;  1Z7U A;  2Q4F A;  1ORJ A;  2QBY B;  2CU7 A;  4LG0 B;  3HDD A;  1V55 C;  3IQC A;  1OCP A;  4IZZ A;  2EK5 A;  3CES A;  4BXX J;  2Q9C A;  2BEO A;  4CS9 A;  3DPT A;  4M72 A;  1GQA A;  4M63 A;  3F8B A;  3PFY A;  3G73 A;  4IX7 A;  1FAP B;  3SXM A;  3EUA A;  4OMY A;  1P7I A;  2V26 A;  2O9X A;  1VQ8 I;  4BY1 J;  1XC5 A;  1YTY A;  3CMY A;  5DV5 A;  1APL C;  2KDZ A;  2L9J A;  3KEQ A;  4IL6 C;  5K1Y A;  1XMA A;  2YPR A;  2YU9 J;  1E3O C;  1J8Y F;  1OKK A;  1EI7 A;  3SP1 A;  4ZYH A;  1SYQ A;  4CDV A;  4U87 A;  1U2W A;  3GTG J;  2YSR A;  2Z15 A;  1T6U A;  2DYS C;  2ZXJ A;  3K1H A;  3RFY A;  3DLA A;  5J47 A;  1BI0 A;  3GZ6 A;  3WTZ A;  1VMA A;  2H7O A;  2R02 A;  1HW1 A;  3R2P A;  2QQ8 A;  2OAZ A;  2XAQ A;  4LLL A;  3TL4 X;  1HCR A;  1CGO A;  3DTI A;  5HOD A;  3HNL A;  3RF3 A;  2M1B A;  4BEM J;  3JTH A;  4B09 A;  2IXS A;  3E97 A;  4RM3 A;  3FXH A;  4LLE A;  3GEZ A;  1EH7 A;  1LUJ B;  2E71 A;  1YRN B;  3JT1 A;  2MD5 A;  5FKO A;  2ICW G;  3I53 A;  2AVK A;  3P7N A;  4Q7C A;  1JJ8 C;  3ATP A;  2Y3H A;  1FY7 A;  1TLH B;  2OZU A;  1BM9 A;  2A3S A;  4GDF A;  2E2I J;  3WGG A;  4B4C A;  4E7S A;  4CCJ A;  1MBG A;  3BCA A;  3K7D A;  2Y48 A;  1DOV A;  1W1W E;  1WAT A;  2XLM A;  2XXA B;  4FE7 A;  3KCC A;  3WG7 H;  4RB2 C;  4I01 A;  5L3V A;  3GAN A;  3GZ5 A;  1G59 A;  3ZMU A;  3LSM A;  1J7K A;  4C3B A;  5DS9 A;  5C3E J;  2AQE A;  3F0C A;  3I3L A;  4MVO A;  1BI1 A;  1XMK A;  3OYI A;  5KYX A;  4CS8 A;  2QYO A;  1UAA A;  2K86 A;  1IN4 A;  5HLI A;  4C3J J;  5GPC A;  1XPX A;  3ABK C;  1T08 B;  2W57 A;  4B1R A;  4PK4 A;  2XSE A;  2L6H A;  3DTE A;  2LP0 A;  2YKZ A;  3HKZ A;  4XKC A;  5KHD A;  1W5C C;  2EPM X;  4MW3 A;  2DMP A;  1QHH D;  4ZDP A;  4XSX F;  1LKX A;  3I0T A;  3K4J A;  3V7C A;  2JTV A;  3KLO A;  5JLX A;  4A3E J;  3V7R A;  2IS2 A;  1M2V A;  3DKW A;  4RBN A;  1I27 A;  1R5G A;  1LIH A;  2BGC A;  2NNY A;  2LR8 A;  2ZC2 A;  1X19 A;  2C03 A;  2OD5 A;  4G78 A;  4ER9 A;  4C9Y A;  2PX0 A;  1NU9 C;  1MBE A;  3PCV A;  3HIF A;  3UKG A;  3T8T A;  1A31 A;  1QKR A;  2QZ8 A;  3LWF A;  4D5C A;  2W9Y A;  3DWW A;  5F5F A;  3RTR A;  2QKL B;  2JSP A;  3HOV J;  1G3S A;  2HPI A;  3PQK A;  1FNT c;  1VTM P;  4JP0 A;  2B0L A;  3FX3 A;  1BN5 A;  1RKE B;  4UUV A;  5LLQ A;  2GDC A;  4JUR I;  5GPG B;  3LOC A;  1YA7 O;  1ZG3 A;  1V3F A;  2CNW D;  1NTC A;  2M4G A;  4PJN A;  4PJL A;  2NXN B;  4LMY A;  3KFW X;  3PO3 J;  2EPN A;  2QSF X;  3WE2 A;  3JTG A;  1X58 A;  3L2Q A;  3OY9 A;  2QEX I;  2L5Q A;  2OOC A;  2XRO A;  2ZBK A;  3HRS A;  2ETS A;  1U0B B;  2VCB A;  1FNN A;  2IVM A;  3DE9 A;  4Z9J A;  2IA1 A;  1R9T J;  4A3K J;  2VI6 A;  4MND A;  1BDJ B;  1FFT C;  3VAY A;  4M74 A;  2IW5 A;  3EG9 B;  5JFR A;  1T0F C;  2E35 A;  3MYI A;  2D5V A;  4JEA A;  1VQ9 I;  4GYI A;  4ZZL A;  1Q0F A;  1IV8 A;  3HOZ J;  2FQ4 A;  5F28 E;  2PNO A;  2H8A A;  1FMV A;  1FIA A;  1Q0K A;  2K9S A;  1A5J A;  3VB2 A;  2HDW A;  2EFQ A;  2LDU A;  5FFZ A;  4RB1 A;  3D1N I;  1OCO C;  2M87 A;  2FA5 A;  1V54 C;  3S16 J;  1X3W B;  2MG4 A;  1ETX A;  3OYB A;  3A11 A;  3G50 A;  2WA0 A;  4JTD B;  5F0F A;  4KNW A;  3PIO F;  3HNI A;  2BXY A;  4A69 C;  3J7Z I;  2OTL I;  4XBF A;  1ZKG A;  5JS5 A;  3K2A A;  3M4C A;  4II3 A;  1S29 A;  2L7K A;  1S9H A;  1X1C A;  3JTL O;  1BR4 A;  4BY7 J;  3BY6 A;  2RRE A;  2E19 A;  1RJ9 A;  5JVG F;  2CDQ A;  3H36 A;  1IW7 F;  5L0I A;  4FTH A;  3J80 K;  2LOO A;  2H7B A;  4PGG A;  4EWC A;  1OFC X;  1N78 A;  4WXH A;  2K27 A;  2VCC A;  2XLO A;  5L0H A;  1FOY A;  1R00 A;  3FBN B;  4GRI A;  5E1X A;  4IKF A;  3BWG A;  2I10 A;  3V42 A;  4XLF A;  1SD4 A;  3K1I A;  4NUB A;  1T33 A;  1U5T B;  5M5W J;  1BIA A;  3MVP A;  4EGY A;  1WJA A;  2Y3B A;  2O03 A;  2ASR A;  4L6R A;  3I55 I;  3C62 A;  3US6 A;  2BV6 A;  1B9M A;  3MEX A;  1STZ A;  4NTB A;  4LK0 F;  5B3S H;  1QSP A;  4DRJ B;  1Q1H A;  4ENN A;  1IV6 A;  4ESJ A;  4HX8 A;  5DEQ A;  2FJ1 A;  5BUO A;  2BHY A;  2QVO A;  2M5W A;  2E1M B;  3S1R J;  4LIV A;  4L5I A;  2JN6 A;  3RVZ A;  2OCC C;  1BJA A;  2XV4 S;  4IO9 F;  5D8L B;  5TGT A;  2PBE A;  1UG0 A;  3HOU J;  2VJJ A;  5K7F A;  4Y17 A;  2VXZ A;  4CH7 A;  3GM1 A;  5HNF A;  2NVX J;  2R5Y A;  3TQN A;  2DB4 A;  3TMO A;  3AQC A;  1RR7 A;  3LES A;  5EK0 A;  4BHP A;  3L2V A;  2B63 J;  5IT9 K;  3I56 I;  3IWF A;  1SMY F;  2O6G E;  4EM0 B;  2LBF A;  3MN2 A;  4G7O F;  4GEH A;  5DYM A;  1A41 A;  3IRR A;  1X4P A;  1I39 A;  3I4M J;  3TUL A;  3KP5 A;  1X4O A;  2XF5 A;  4M3G A;  3ZXS A;  1ETQ A;  2BW3 B;  3IL2 A;  2IAI A;  2JMW A;  2YLD A;  1NLX A;  1ETO A;  2X0L A;  1KNY A;  1K6Y A;  2XM0 A;  3G3Z A;  5BPD A;  2D45 A;  4A93 J;  1XDU A;  3S0X A;  2HTS A;  4NC8 A;  2Z9O A;  4C7O A;  1BI3 A;  2JJ7 A;  3JW4 A;  3B0U X;  3KH2 A;  1SFX A;  2Y75 A;  3AL0 B;  1YAU O;  3ECO A;  5B66 C;  3TJ5 A;  2EV6 A;  3A4C A;  1NZE A;  1HDD C;  2DA2 A;  2HU9 A;  1SFO J;  4Z9H A;  2STW A;  4WF2 A;  3LNQ A;  3VF0 A;  2V7F A;  2G9W A;  5T3W A;  3R7C A;  5DD4 A;  4D7N A;  1OIS A;  2EB7 A;  3AG3 H;  3LSH A;  3HC7 A;  5F08 A;  4B47 A;  3JRD A;  1K79 A;  4LLG F;  2HKV A;  4LDR A;  3S3O A;  1KQ8 A;  3GFJ A;  4M9Z A;  2FNA A;  3ZQH A;  1RRJ A;  1IJW C;  3ZTM A;  4HF1 A;  5AGF A;  2IGO A;  3EFO B;  4F4B A;  1TZL A;  3DJU B;  3O6X A;  2IJL A;  1QVX A;  1R49 A;  3HNK A;  3M1E A;  2VON A;  4N06 A;  2KIM A;  3QU6 A;  1P9Q C;  1CF7 A;  2K9Q A;  1IN7 A;  3WTU C;  2DYR C;  4I09 A;  2X48 A;  3K33 A;  2UUH A;  3B0P A;  1RKT A;  3MZH A;  1KON A;  4GQH A;  3ZDL A;  5KAF C;  3N4M A;  1L7C A;  3T0Y A;  4A6E A;  1XSD A;  2BXZ A;  3DAG A;  1FOW A;  4B44 A;  4B6I A;  3R61 A;  1VND A;  3J7A Y;  4UVA A;  4XEF A;  4XPX A;  3K7A J;  1F43 A;  3DAF A;  2J7P D;  5KAI C;  3HNJ A;  4UXN A;  1X1B A;  1Y39 A;  1V55 H;  2KGO A;  1ZHY A;  2K9L A;  2K02 A;  3BR2 A;  2Z33 A;  1FOX A;  3LA3 A;  1FJL A;  5IY5 C;  2H8R A;  1D3Y A;  3ZGK A;  3TO6 A;  4CIC A;  5EG0 B;  1HW2 A;  1WTY A;  3U2M A;  3BTL A;  2NOJ B;  2FF4 A;  2Y31 A;  3GME A;  3KZI C;  4Z9I A;  5DVW A;  1N75 A;  3IH4 A;  3HRM A;  5C4J J;  2QWW A;  4N9I A;  3BPX A;  2OTJ I;  4ZZD A;  2DOA A;  4EJW A;  3ABM C;  2VT2 A;  4QDL A;  5B1B C;  3I5P A;  1A6Q A;  2WV0 A;  4Y15 A;  1J09 A;  2XGX A;  3LQR A;  4PJ0 C;  1A7V A;  3GVA A;  3G1M A;  2RNG A;  4EBJ A;  2B7E A;  2DYS H;  3AAF A;  4WXC A;  4LIU A;  4EQQ A;  2QE9 A;  3B02 A;  2M7A A;  1X2M A;  2GIZ A;  1K4T A;  5L0J A;  5DS5 A;  1Z9C A;  3NRV A;  3JSE O;  5J4V A;  4ZDO A;  1QPU A;  3S93 A;  4RGU A;  2XSJ C;  3BOQ A;  2LQG A;  1M2O A;  2JK3 A;  5LFA A;  2ZSH B;  1MMA A;  3JAM K;  1ACI A;  5JVE A;  5M3F J;  3J81 K;  1T5O A;  1WFX A;  4CJG A;  2EBI A;  2JPB A;  4E18 A;  4AM3 A;  3CCE I;  2W45 A;  3KZY A;  3KP2 A;  3ZMS A;  4YJW A;  2ZB9 A;  4OAZ A;  3FXU A;  1RI7 A;  2FBI A;  2NVU B;  2XL4 A;  3W2A A;  3TW7 A;  1VQN I;  2M4K A;  3DM9 B;  2NVY J;  2DMN A;  1LE4 A;  4BGD A;  4CYC B;  2CGP A;  3H0D A;  2W00 A;  3CCU I;  1NG7 A;  1SFU A;  3F9K A;  1FEX A;  3F21 A;  5D92 A;  2M34 A;  1BJZ A;  3UMK A;  4UVC A;  3HTU A;  3FKJ A;  2ADU A;  3U3B A;  2D1V A;  3M7G A;  1OKK D;  1USS A;  3JRT A;  3PM1 A;  3GFM A;  3H9Q A;  1G3Y A;  1ORK A;  4W1U A;  2DW4 A;  3VYR B;  5FLV A;  4LDK A;  3POV A;  2ZJR F;  4G7H F;  2KYH A;  1OCT C;  2AU5 A;  4JE9 A;  3ABK H;  4RGX A;  1TL8 A;  4EBK A;  2A07 F;  2QTV A;  4A0X A;  1MD0 A;  2PMU A;  3G2B A;  4PSX A;  5L3F A;  1YYV A;  3G4Z A;  1TNT A;  2VC9 A;  3L9F A;  2XB0 X;  1X1A A;  3I54 A;  1U5T C;  2FXA A;  2PJP A;  3ZOB A;  3BZC A;  3FXK A;  2KHM A;  1JKO C;  4I44 A;  4E7J A;  2I8D A;  2I5U A;  3FMS A;  5DCM B;  1I6H J;  1KU7 A;  1ZHF A;  5COF A;  2F5E A;  2KT0 A;  4I02 A;  2PQ8 A;  2WAE A;  3S90 A;  3CJR B;  3FMR A;  2ZXO A;  4Y7N J;  2R7W A;  4II2 A;  5FLX K;  1OQY A;  1ZGJ A;  2H1L A;  2E1M C;  2O0Y A;  1Z6A A;  3IQT A;  1QQ3 A;  2A6H F;  3TO9 A;  1Z5Z A;  1PD1 A;  2G62 A;  5D5V B;  2EZI A;  1CGP A;  2CH0 A;  2QSG X;  4O6Y A;  4CZC A;  3F72 A;  1DOW A;  4NTA A;  2QKM B;  3IRQ A;  3RZO J;  3LMM A;  2HVS A;  4KNV A;  3G4S I;  5AC4 A;  1IZM A;  1HF0 A;  4ON0 A;  3IEE A;  1GVD A;  3HLZ A;  3ZIB A;  5BQH A;  5L0D A;  1FC3 A;  1ZN2 A;  2PFB A;  3KPH A;  1MKM A;  4Y33 A;  1QQI A;  2CQX A;  2K4B A;  3H9J A;  4OMZ A;  2DO7 A;  4WK8 F;  2P6S A;  3E6B A;  4HST A;  2FBK A;  3H3U A;  3ERE D;  1GV2 A;  4CGZ A;  4QTR A;  2XKO A;  3M8E A;  3OR1 C;  4HEA J;  2EFO A;  2L01 A;  3CTA A;  2M0C A;  3LQQ A;  1G8X A;  2EIK C;  2OQG A;  2R25 A;  4HSR A;  4RGS A;  3EHN A;  3GTK J;  2CW7 A;  1FTS A;  1XZQ A;  2BYV E;  2L54 A;  1IC8 A;  2A0U A;  3CUQ A;  4P9F A;  3WGH A;  5HVQ C;  2GOX B;  1OCR C;  5FKK A;  3AL0 C;  3MLG A;  3N97 A;  6PAX A;  1SD5 A;  5D5X B;  2HKO A;  4A5N A;  1W5S A;  2CJJ A;  2Q3T A;  1LE8 A;  1OCO H;  3P5J A;  5DM6 F;  1V54 H;  2WAQ N;  2FX0 A;  3PNV A;  4BH9 A;  1ZRC A;  2KLO A;  5J1U A;  2IS4 A;  3M8F A;  4RD9 A;  2PBI A;  5E17 F;  2VKE A;  5BPI A;  4CUG A;  5D6E A;  3GM3 A;  4XIC A;  4ITV A;  4I99 C;  1UHS A;  3RKX A;  4FE4 A;  4PSW A;  4Y4R A;  5LGU A;  4BL0 B;  3S3N A;  2Y30 A;  1X1D A;  1KYW A;  4HNV A;  4CDA A;  4FCY A;  1J0R A;  3HM5 A;  4CIP A;  1K83 J;  2R7O A;  5TIS C;  2VL8 A;  4YII A;  3JRG A;  4JTA B;  4D0P A;  3NMK A;  1TQM A;  3B6A A;  1QA6 A;  5J4Y A;  1ORS C;  1R7J A;  3GO5 A;  2IPQ X;  4XWJ A;  2CQK A;  4OD4 A;  2HV7 A;  2A5Y B;  2NUT A;  2FSW A;  3NYJ A;  3KP7 A;  1VQ7 I;  4CO8 A;  1JUS A;  3HOT A;  3GX4 X;  1B4A A;  2OU6 A;  1EJ9 A;  4AYB N;  1CGN A;  1AVO B;  1TQP A;  3ZQG A;  4B48 A;  2LSO A;  2QLZ A;  3WGI A;  2EA2 A;  3SZG A;  4PDK A;  3K1P A;  1ZZP A;  2IGN A;  2F5F A;  3K4B A;  4KIC A;  4NC3 A;  2P4W A;  4PFP A;  5IP9 J;  4F93 B;  3RKQ A;  5KYX B;  9ANT A;  1R5H A;  1UB9 A;  1FIP A;  2EJR A;  3SEQ A;  2HSB A;  4P55 A;  1YA9 A;  5JHF A;  2B9S A;  5TRD A;  5KYW A;  3MWM A;  1K78 A;  3CDI A;  1B68 A;  3RH3 A;  1S7A A;  4NC6 A;  4B8X A;  2Q00 A;  2L9N A;  3BG7 A;  5L3D A;  4BS9 A;  5ED4 A;  1E86 A;  2VPL A;  4HFF B;  1R1V A;  3M4O J;  1M2V B;  4WJ0 A;  3QQA A;  1IF1 A;  3TOM A;  2P5L C;  4E4H A;  2YL7 A;  5EHH A;  4FX5 A;  3CJT B;  3LSG A;  3DLL F;  1SVM A;  4YEJ A;  1S72 I;  5JLW A;  4DGW B;  4RB0 A;  2ME0 A;  3QOP A;  1XGS A;  1K04 A;  2ZSI B;  4DRI B;  3LLI A;  3JRM O;  3VRC A;  2P1A A;  2OPT A;  3KKB A;  1PUF A;  1P7J A;  2TDX A;  3ESW B;  4HBL A;  4OD5 A;  2R7U A;  4K7B A;  5CVR A;  2VQC A;  1KA8 A;  2WZG A;  2P5V A;  4XQF A;  1GXP A;  3B29 A;  4J7Y A;  2NYX A;  2DPU A;  5DM7 F;  4I6Z A;  2L7M P;  3BTC A;  5A6K A;  4YT8 A;  2DXI A;  3S2D J;  1FYK A;  2DLL A;  4Q5S F;  3OIQ A;  2KJG A;  1HKS A;  3DZA A;  1A0B A;  3I5U A;  1A36 A;  1ZQ3 P;  1U89 A;  2YZS A;  3FXO A;  4I2O A;  3OL4 A;  3E9V A;  4DRH B;  4JQF A;  2ZFW A;  4AD9 A;  5KK1 A;  1C17 M;  1X3U A;  1H89 C;  3GZN B;  1BBY A;  2OQM A;  3TBI A;  1MIJ A;  2E7W A;  4X6A J;  2G7H A;  4R79 A;  4JOM A;  1IAW A;  1JT6 A;  3IKT A;  1VTN C;  5M5Y J;  1ZG1 A;  4I1O B;  3PDM P;  3B0V C;  2W85 A;  1N25 A;  1ETK A;  1FSH A;  1HW5 A;  1WJD A;  1EKE A;  1XN7 A;  1B59 A;  2HUJ A;  2XKP A;  4U9D A;  3IC7 A;  2JWT A;  1J75 A;  1AU7 A;  3TK0 A;  1ZW3 A;  3OYE A;  3DMD A;  2OC6 A;  1JKP C;  3GFI A;  5H2F C;  5AIQ A;  2G7U A;  3PFI A;  4QLC U;  2DYR H;  2J9W A;  3FOO A;  1V4R A;  1Z6T A;  4MTE A;  1G4D A;  4L9N A;  2Y2Z A;  1SD7 A;  1M6T A;  1TFO B;  4G6D A;  2IXO A;  5EYR A;  3TOL A;  3RYP A;  4JVS A;  1MJB A;  2DMQ A;  5E3O A;  3NYL A;  4JW1 A;  4ZYA A;  4A5M A;  4A3F J;  2DA5 A;  1YLM A;  4MHG A;  1E85 A;  3Q0V A;  3L7W A;  4D7M A;  3H0G J;  3SZP A;  2E5N A;  4ESF A;  1RJ9 B;  3B9Q A;  2FNP A;  5A2Q K;  4I3M A;  3CC4 I;  2X1E A;  2O5R A;  3OYJ A;  5E33 A;  1ZAR A;  5IY5 H;  5KNL A;  1Z63 A;  4LB6 B;  4AIH A;  3DU6 A;  4YT2 A;  3BR0 A;  2OKU A;  2J9B A;  1HSJ A;  2Y9Z A;  1TWC J;  1D0Z A;  3U3F A;  1D0X A;  1HY5 A;  4C2U A;  2E60 A;  2F22 A;  2HQR A;  3BG5 A;  2A0B A;  3GEH A;  3IUO A;  1UG2 A;  2HYJ A;  2VE9 A;  2HDD A;  5B1B H;  2V9P A;  5IYD J;  5CVU A;  2LD5 A;  3L34 A;  4BJ5 A;  3WTV C;  2MLK A;  4GCV A;  4CS9 C;  3CDH A;  1X2N A;  3UNG C;  3HB9 A;  1EKY A;  4RB3 C;  2Q8K A;  4RDA A;  3QRF F;  2LKX A;  4RM2 A;  3PJR A;  4YIF A;  1TW3 A;  2XF7 A;  2ZJQ F;  3KEY A;  2AP3 A;  2COM A;  1XX5 A;  4IVN A;  2CQQ A;  3JRC A;  1IUY A;  3AJM A;  1P92 A;  2DJN A;  2K5C A;  1JKQ C;  2DDA A;  1E2X A;  2BVM A;  4XEK A;  1HQC A;  2LIG A;  2DQL A;  4O3M A;  5CI8 A;  2XPV A;  4C2M J;  4CXF A;  2XL8 A;  3HJE A;  1NG6 A;  4C30 A;  3RPU D;  1ODD A;  3W8I A;  4G9Y A;  4E70 A;  2R5Y B;  3EUH A;  1ORY A;  1IRX A;  4HNU A;  4B43 A;  2NRA C;  2IXM A;  3ZQ7 A;  3KLN A;  1PD0 A;  3DEU A;  4PJM A;  2ZNZ A;  4YG2 F;  3FHD A;  1QHG A;  2LBF B;  3L2W A;  2UUI A;  2P6V A;  2R7R A;  5D5W B;  3TD7 A;  4WWC A;  4CSW A;  4DZJ A;  2OG2 A;  1IN5 A;  2Y0S A;  3QPT A;  3NWS A;  4S05 A;  4AL0 A;  3TO7 A;  3VM6 A;  3ZQI A;  2YLI A;  2HKX A;  1JPN A;  5FO5 A;  1B6A A;  2DMT A;  1NK2 P;  3EGD A;  1KGS A;  2H09 A;  1OYY A;  1WJB A;  1O3Q A;  3K4C A;  1W2W A;  3RQG A;  2M64 A;  3FHN A;  4C7O B;  3HGG A;  3SFI A;  3S17 J;  3FKI J;  3N2Z B;  4Y52 J;  4EJT A;  5JR3 A;  3KET A;  4DNC A;  4XR6 A;  3VDX A;  4HEA 2;  5GP9 A;  5KYU A;  4OIQ F;  2WB1 N;  2EFP A;  2XIG A;  5ILS A;  2UWM A;  1T01 A;  4DBQ A;  4A3D J;  3EH1 A;  1WJ5 A;  4AU7 A;  2KDO A;  2LSE A;  2Z16 A;  5GAH J;  3RVY A;  3AG1 C;  3T6G B;  3BJA A;  4L9T A;  4CS8 C;  3AKZ A;  3CCQ I;  2YWA A;  2WAD A;  3SFZ A;  3ZRG A;  1VQ4 I;  3OS2 A;  3QOE A;  2I15 A;  3H92 A;  2PJR A;  1JTY A;  3G1O A;  4MW8 A;  3QP6 A;  4ABZ A;  3E6M A;  2WWY A;  1CF7 B;  5L3G A;  3GEI A;  3I9V 2;  4XRF A;  4XOP A;  4LDQ A;  4PFO A;  3CO7 C;  1BI2 A;  2L2O A;  3ABT A;  3E6D A;  1DP7 P;  1ETY A;  2DFF A;  5FGM A;  1LPE A;  3TW6 A;  4NCQ A;  4XLP F;  2F6C A;  4L9V A;  2FGY A;  1WJE A;  1IG7 A;  1LS1 A;  3BQZ A;  4XRS A;  3AGU A;  3FAP B;  1F9N A;  1QZY A;  3A2K A;  4BG0 A;  2DT6 A;  2DOF A;  3HBL A;  2N8G A;  1LPQ A;  3C3W A;  4FWV A;  3WAQ A;  4WGY A;  2ESH A;  3QP5 A;  4HA8 A;  5D6F A;  2XGC A;  3NEU A;  4P1W A;  5IT3 A;  1SVO A;  1MGT A;  4AC0 A;  3VYW A;  4DYC A;  2EIK H;  3E6C C;  4UUT A;  2ID6 A;  4KJZ A;  5GAG J;  4A3J J;  4N9H A;  3ZTZ A;  5J8F A;  4ZYE A;  3S8P A;  5FFX A;  4J00 A;  4LIT A;  1YW7 A;  2LY2 A;  2LK2 A;  1OCR H;  3S84 A;  1UEL B;  2LY9 A;  5FRN A;  5E3A A;  2ECB A;  3O2P E;  5IT9 Z;  3DPL C;  3QAH A;  2VJ5 A;  1Z3X A;  1YHQ I;  2EIM C;  2P7V A;  1V5E A;  4DYR A;  4CCM A;  3ZQC A;  4CA0 A;  1FT9 A;  3D0S A;  4W97 A;  1LI7 A;  2ZME A;  4RA2 A;  2XLD A;  3HOX J;  1ST6 A;  4MFD A;  1TWC A;  2GA2 A;  2AXT C;  1ZW2 A;  2ISY A;  1J5Y A;  3J06 A;  1MBK A;  2CSO A;  3GW2 A;  1KZH A;  1ZRD A;  1BC7 C;  2YL1 A;  3HSR A;  1ZGA A;  3GTM J;  4ETS A;  4M9S A;  1UHW A;  3O55 A;  1FPQ A;  4HPQ A;  2GM4 A;  5IP6 A;  4XM3 A;  3NKE A;  2JSC A;  1OR7 C;  3PNY A;  1GV5 A;  1YFH A;  1IZ1 A;  1O5H A;  5ICE A;  1E17 A;  5A6J A;  1T6S A;  1YJW I;  4H4K C;  3EJN A;  3OIP A;  4XSZ F;  1LVA A;  3ELK A;  1QO0 D;  3MKW B;  1T8I A;  1EA8 A;  2H6C A;  1B1B A;  1P4X A;  5KCM A;  4Y13 A;  1YZA A;  3HKK A;  5T1D B;  2L0K A;  4BJ1 A;  1HBX G;  4IHX A;  4BUP A;  3LAY A;  1KU9 A;  3ZQY A;  3Q9V A;  2PX3 A;  1RMV A;  3UGP A;  1XMX A;  2FFH A;  1OCZ C;  3U21 A;  1FZP B;  3K1I C;  1W4M A;  5FKL A;  4ULW A;  3LST A;  2HDC A;  2DPD A;  1FBQ A;  1OJL A;  1JUP A;  1Z7L A;  4L18 B;  3VOD A;  1E84 A;  2WVO A;  2V1N A;  5IPA A;  5KYN A;  1I1G A;  3H9G A;  2ZXW C;  2O3F A;  4Z2Y A;  4F52 A;  2BE5 F;  1H6G A;  2PP4 A;  5DTD A;  1VQP I;  5F27 A;  2A68 F;  2M0M A;  4DIQ A;  1U6H A;  1TW2 A;  2PN6 A;  2DT5 A;  3F8C A;  4I0A A;  2A69 F;  1IGN A;  4A12 A;  3FZV A;  5A69 A;  1D8K A;  4ZYD A;  5HOO A;  2HOT A;  1KTM A;  1D1B A;  1O7F A;  1D1A A;  4IOC F;  1G5Z A;  2J9U A;  3BCB A;  4WAB A;  2NUP A;  4NQF A;  1TT5 B;  3IAM 2;  1WJF A;  3B71 A;  1VQL I;  2EIL C;  4HE8 D;  1BL0 A;  3ABL H;  2YL0 A;  1R22 A;  2ZFU A;  1ZU4 A;  5CQE A;  5LGN A;  3CEX A;  4YL1 A;  1WJC A;  3CZ6 A;  2NNN A;  3UGO A;  4M6V A;  3RQE A;  3T4R A;  2R7Q A;  3IWZ A;  3FAJ A;  3ONQ A;  1C0W A;  4ZC3 A;  1Z77 A;  1R4T A;  3SXK A;  4IWB A;  1RES A;  2CGE A;  1U8R A;  1P6R A;  2DA6 A;  2RD9 A;  2XLV A;  3HTK C;  5LRS A;  3JAM Z;  5LHI A;  3CUQ B;  1ZR2 A;  2KFD A;  2W82 A;  3GWN A;  4A2N B;  2KJC A;  3J81 Z;  2ESN A;  2JPU A;  3OS1 A;  2YHS A;  3EGX A;  2FU4 A;  2V9K A;  4G6T B;  2FOK A;  2YRF A;  3LA7 A;  3PMR A;  4LAC B;  1R36 A;  1PV3 A;  1Y8R B;  2PFD A;  1D5V A;  1REP C;  2P81 A;  3CC7 I;  1LE8 B;  1JAF A;  3T6B A;  1JTX A;  4OIR F;  1POG A;  4U0Y A;  3C2G A;  1MMS A;  2JVH A;  4ENJ A;  1OKR A;  2CFX A;  2GLO A;  1FWZ A;  1A7D A;  4LFU A;  3CAX A;  4P6I C;  2PG4 A;  5AON A;  1HKT A;  3MBG A;  2V79 A;  2LY1 A;  4YIR X;  4ZDL A;  3JRI A;  2Q7R A;  1I3Q J;  5JT4 A;  3RW0 A;  3DM5 A;  4O7G A;  2H6B A;  1J2X A;  3BR5 A;  3PUB A;  3LSP A;  2ZJP F;  4ESB A;  4JC7 A;  3WTT C;  4G12 A;  1QU3 A;  2XRN A;  5EF6 A;  3WE3 A;  1YIT I;  4D4X A;  5HSW A;  2EWN A;  2HZT A;  3LLK A;  3O10 A;  4NTF A;  1IUF A;  3ZWI A;  2X1C A;  2CUJ A;  3OOU A;  2GBY A;  2J8W A;  5CKT A;  1FMW A;  1MBH A;  1TTY A;  1P2F A;  3H5A A;  1S7Z A;  2HMQ A;  2NUT B;  2LP4 A;  2WL8 A;  4XN3 A;  2L9R A;  4MIM A;  3ZPL A;  3B6C A;  1VI0 A;  5FLX Z;  1YVI A;  4ULV A;  4MTF A;  1IRF A;  3BG6 A;  4GXO A;  4RBO A;  3OYN A;  5K7Z A;  2KW3 C;  4AVZ A;  1E0E A;  5BQG A;  3TOA A;  1BR2 A;  3AG2 H;  4FAS D;  1Q0G A;  1RUO A;  1MW7 A;  3C2B A;  3ABU A;  4YFX F;  2LH9 A;  2AWC A;  4IHW A;  2DFI A;  5KYW B;  1K78 B;  1S5L C;  2VOO A;  4OIO F;  1VLS A;  1EV7 A;  2EPK X;  2UV1 A;  4PCQ A;  1HDP A;  2JT1 A;  2KZG A;  4OU0 A;  2XAF A;  4IAR A;  3W8H A;  1SAN A;  2HQ5 A;  2DI3 A;  4XL9 A;  4B3A A;  2R0Q C;  3KP6 A;  4MVM A;  3DP7 A;  3KP4 A;  4KT5 C;  3CJQ B;  4UB6 C;  5ICF A;  3SXZ A;  2HJ3 A;  3F3X A;  2XLE A;  3I5Q A;  4V19 K;  4XLA A;  5EEG A;  4NBQ A;  1DQU A;  2HNH A;  5J3L A;  1TWH J;  2WC2 A;  5E8G A;  1YX5 A;  1K40 A;  1PUF B;  4E0H A;  4HQE A;  1EH8 A;  2KMU A;  1LE2 A;  3OR2 C;  2BVL A;  2K9N A;  2IBD A;  1E83 A;  3OYA A;  5LD2 C;  1YQA A;  1WQ2 A;  3W6K B;  3BG9 A;  2JVG A;  3OYM A;  3RPU A;  2CQ7 A;  2R7T A;  3CMA I;  4O6M A;  3V5Z A;  2XRL A;  2OQR A;  4ENK A;  1LB2 A;  3MKY B;  4M3F A;  3FXL A;  2R05 A;  5FB2 A;  1QBJ A;  2EA4 A;  1FBU A;  5L0C A;  1RNL A;  1K6O A;  4EKW A;  2CO5 A;  2CRG A;  2EPO A;  5B5E C;  4QIW N;  3I4P A;  1AKH A;  3L00 A;  2X6X A;  4PAC A;  3DCF A;  5GTI C;  2F2E A;  3S1N J;  1EF4 A;  3GBG A;  2VPR A;  2NSF A;  2CG4 A;  3VPR A;  3OA1 A;  2P61 A;  2HMZ A;  3X2Q C;  1CGM E;  1G6N A;  2GAU A;  1E3H A;  4UVB A;  3RPQ A;  1SEU A;  1Z67 A;  3VYU B;  4EJU A;  2HS5 A;  2FAP B;  5JHU A;  1T98 A;  4AVP A;  2JZY A;  3K1N A;  3AG1 H;  1HA8 A;  2HI3 A;  1XWJ A;  3L2R A;  1NK3 P;  3A9C A;  3E70 C;  2PMZ N;  3LEO A;  5BNG A;  2DQR A;  1HKQ A;  2EV5 A;  1H8A C;  3LS1 A;  3HXL A;  4NDL A;  4BE2 A;  2IA0 A;  3HYI A;  3CJN A;  2JD3 A;  3LEV A;  2HGC A;  3TDU C;  3WG9 A;  3MZ8 A;  1WCM J;  4YK5 A;  5DCF A;  3EPZ A;  5J1R A;  1EH6 A;  2VKD A;  4TV7 A;  1O7L A;  1JRA A;  2XAJ A;  2KRF A;  4R1H A;  1S6L A;  1TNS A;  1A6I A;  1MMN A;  3LS0 A;  1U0J A;  4M3E A;  1RZ4 A;  1FP1 D;  4A2U A;  4LGW A;  4BHC A;  5CI9 A;  3HPH A;  5FD6 A;  2CYD A;  2XHK A;  5FRM A;  1SMT A;  4IRG A;  3S15 J;  4HF2 A;  3QW1 A;  3SHF A;  1YW8 A;  5L3E A;  2HSQ A;  2L81 A;  2L3D A;  2VLA A;  1JT0 A;  1TQG A;  4G0H A;  1KYZ A;  4XTK A;  1ZK8 A;  4UV9 A;  3KYD B;  5E3M A;  2R5Z A;  4A3B J;  4CCL A;  1XTA A;  1OMI A;  2OCE A;  1YS6 A;  2QLA A;  2RNJ A;  2M4E A;  3CUO A;  3A01 A;  3TOB A;  2L4M A;  3S32 A;  1ONV A;  2R03 A;  2HVQ A;  2YX7 A;  4IF4 A;  1SF8 A;  1ZGW A;  4DVZ A;  4BEH A;  2EIM H;  1ZLK A;  4PR9 A;  2WZF A;  5GPA A;  1YG2 A;  2DDB A;  1GUU A;  4YEL A;  1OXB A;  4XEV A;  2CYY A;  4GO1 A;  4EM2 A;  4P9T A;  2ECC A;  2PF4 E;  5HDK A;  3SXY A;  3HPG A;  3IP4 B;  5M3M J;  2E2H J;  3MMY B;  3CUQ C;  1M57 C;  3OYL A;  2HFH A;  4QI2 A;  3CLO A;  4RLF A;  1AA7 A;  3CP8 A;  4MVQ A;  5CLS A;  1MJA A;  3QU3 A;  4NC7 A;  4HFK B;  3F8M A;  3OV8 A;  1HC8 A;  3C8G A;  5FRO A;  1WI9 A;  1IRG A;  3U9M A;  2L4A A;  4BDY A;  1ZYR F;  2OUM A;  1UFM A;  1LM3 B;  2OEV A;  256B A;  3ZQQ A;  2Q9A A;  1VQO I;  5F0H A;  3H2U A;  3F8N A;  2IXN A;  1Y4C A;  4BEJ A;  2MC3 A;  4D5F A;  2MC4 A;  2RAE A;  1OYI A;  3M3Y J;  3C18 A;  3ZMD A;  5HLT A;  3NQO A;  4BAC A;  2FD5 A;  4LB5 A;  2VIX A;  3ECS A;  1H9G A;  2CS3 A;  1TBX A;  4HX4 A;  1U6G A;  4ZH4 F;  3RQ4 A;  2NSG A;  3VSK A;  3WHB A;  3FVY A;  3JRE A;  2OZ6 A;  1KQ0 A;  3KZZ A;  3L2C A;  2JA2 A;  3D5R C;  1AHD P;  4FET A;  2L6G A;  1V5G A;  5EDN A;  4IOA F;  3KYI A;  4N4W A;  2VE8 A;  1WKM A;  2E36 A;  3QWL A;  1FYL A;  1BA5 A;  2VT3 A;  1PYV A;  3EGD B;  4M3D A;  1TWH A;  2I8B A;  1XDS A;  4HZF A;  4XPW A;  2RGV A;  5K5O A;  2NS8 A;  3JYY A;  4BKX A;  3ISP A;  4XOR A;  2FE3 A;  4YFN F;  1HXD A;  1SVL A;  3L2U A;  3KX2 A;  3BZK A;  4A6D A;  2EFN A;  4F3Q A;  1GGQ A;  2O61 A;  2JUC A;  5KYU B;  5F04 A;  3EQL F;  3SEZ A;  4P9U A;  5L3C A;  1LJ9 A;  5AC5 A;  2QGU A;  3FK6 A;  3QYB A;  3B73 A;  1S05 A;  4JTC B;  3F23 A;  4OWR B;  3OSF A;  4HAM A;  1A35 A;  4K2E A;  3ZMZ A;  1YYX A;  5A6A A;  5A2Q Z;  4RLQ A;  3HEF A;  1ON2 A;  2IXP A;  4U5H A;  3ZG1 A;  4ANJ A;  2GXA A;  2CWE A;  3GLL A;  1BOA A;  4RAG A;  4EVI A;  2JA6 J;  1CPQ A;  1B8I A;  5HS9 A;  2PJR B;  2AHQ A;  1DU6 A;  2QY9 A;  1YLF A;  4RGR A;  1VYK A;  2WB7 A;  4DOZ A;  1MNE A;  3QMK A;  2QQ9 A;  2KIU A;  3MAJ A;  3WU0 A;  1Y8Q B;  1RET A;  1DUX C;  1Y56 A;  1K7A A;  1BW5 A;  3UMH A;  1LDD A;  2VBZ A;  3KEO A;  1S7O A;  1J9I A;  2ZXR A;  3ULQ B;  2RQQ A;  5FLM J;  2EIL H;  4FES A;  5LBQ A;  3BTI A;  2DAO A;  2EH3 A;  4CBE A;  4Q4Z F;  1UZC A;  3DXJ F;  3QTH A;  3LNM B;  1HMD A;  2CFO A;  2QUF A;  3FXJ A;  1V5F A;  5DQZ A;  2A1D D;  5IOZ A;  4JBA A;  1T6I A;  3KYJ A;  2COB A;  3N0T A;  3W3C A;  5B1A C;  2PX9 A;  4ENM A;  3A0B C;  3V5X A;  4UUS A;  1I1S A;  1DPR A;  2LTP A;  2DA4 A;  3WU1 B;  4J7T A;  2HPM A;  2YVK A;  4KIG A;  2F4I A;  2KRC A;  3MD2 A;  1MDM A;  4G7Z F;  5BQT A;  2IT0 A;  3GTO J;  1T9K A;  1W36 D;  1YAR O;  2JX0 A;  3JR9 A;  4MVS A;  3QZC A;  4MQV A;  2NVQ J;  3RQF A;  1D8J A;  2Q2E A;  4MO7 A;  5D8K B;  3F47 A;  3DKY A;  3HHH A;  1SAX A;  3NYM A;  5GAD J;  1G2H A;  3GUD A;  1T56 A;  2MA3 A;  2AQF A;  2O8X A;  5EZH A;  1YDI A;  2KQR A;  2L9S A;  2OCC H;  5FCL A;  3QPS A;  4DXW A;  2P7V B;  2VJ4 A;  2R92 J;  3GCM A;  5A6B A;  2OJE D;  3SQN A;  2ELJ A;  4BE1 A;  3G71 I;  1B72 A;  1TR2 A;  3K6B A;  3L8I A;  2DN0 A;  1H0M A;  1S7E A;  3OYD A;  2VXD A;  1R5I D;  1YOV B;  4O6J A;  1MND A;  2W4S A;  3DBR B;  2ZME B;  1YZC A;  3T6J A;  3CLQ A;  3DKA A;  3LNR A;  4BYY A;  1D1C A;  4MEY F;  1Z3I X;  3WTY C;  4MLO A;  5ILV A;  2XL6 A;  3V7O A;  2DFH A;  2IBF A;  4CX9 A;  4ZYG A;  2W48 A;  3DKX A;  3BC8 A;  3PL8 A;  2YR2 A;  1YX3 A;  4U88 A;  4JX5 A;  4EJV A;  3IPM O;  4J30 B;  3DJN B;  3BRO A;  4IHS A;  3A1Y A;  3P9C A;  3U8P A;  3DEW A;  2KQ9 A;  4NB5 A;  4KDP A;  3TP3 A;  5HDN A;  3KYL A;  3FIS A;  3FHZ A;  1VYI A;  1ZU5 A;  5B3I A;  1XGN A;  5ERI A;  4JX4 A;  1G4U S;  2VQH A;  3HL2 A;  3RI4 A;  2KK1 A;  3OYC A;  5E1Z B;  4NHJ A;  3KL4 A;  3FXQ A;  3COA C;  5LEJ A;  1J59 A;  3CQZ J;  4JJF A;  3H5R A;  2EPL X;  2MSY A;  2XAU A;  2CUZ A;  3E3V A;  2XDV A;  4N4N B;  4DZP A;  2W1O A;  1JHH A;  3V8K A;  1YIO A;  2ZCW A;  3QYE A;  2FOW A;  5F6F A;  3QOD A;  3OSG A;  3S14 J;  2MLG A;  3SNH A;  3GYH X;  2H27 A;  3VOE A;  4D1Q A;  3HKZ N;  4EV0 A;  2H1K A;  1WGX A;  2BHZ A;  3SYT A;  2BBY A;  3FXR A;  3U2R A;  4JCH A;  3E1S A;  2Z1D A;  2QCO A;  3I4U A;  4AX2 A;  3E5Q A;  1MJ9 A;  2GQQ A;  2A6T A;  3WTW C;  3A0H C;  2WTE A;  2X51 A;  1TWG J;  3HRT A;  2IOQ A;  3U2L A;  3IKV A;  2VQL A;  1VF9 A;  2NG1 A;  4M6Y A;  4HLY A;  2J0W A;  4BJ5 C;  5K7H A;  3M9A A;  1TC3 C;  2K9M A;  3EDP A;  1IXR C;  1W0T A;  1MH3 A;  3G1L A;  2CV1 A;  5LHG A;  4WCG A;  4J19 A;  1VOM A;  4ZTJ A;  1RKC A;  3JZ0 A;  5F1J A;  1QGP A;  4XKV A;  2JPC A;  1OW6 A;  4U5F E;  5KVR A;  3T9O A;  4FT8 A;  1APC A;  1OYW A;  4R32 A;  1Z91 A;  4LOC A;  4IAO A;  2BZT A;  3O6B B;  2QM3 A;  3LSJ A;  2ZJ2 A;  4BJ6 A;  3HG9 A;  2NUP B;  2M3A A;  4NY3 A;  3EUH C;  2R7S A;  5D5U B;  2V1X A;  1RUN A;  2WVN A;  3SZR A;  4IQ4 A;  2GFH A;  3J7A O;  2EIJ C;  1C02 A;  3GF2 A;  4A3C J;  4D4N A;  1BOB A;  2VJI A;  2R9R B;  2H7V C;  2BC5 A;  3SDG A;  2R7X A;  2E1N A;  1GVJ A;  4HLX A;  2CCY A;  2VBY A;  4S04 A;  5FJ8 J;  3X2Q H;  1D5Y A;  3M4B A;  4IQJ A;  5E3C A;  3ABM H;  3NG1 A;  4CSA A;  2LRD A;  2ELK A;  4ASN A;  2O9L A;  3L8J A;  2V1U A;  4HW0 A;  4JCZ A;  2RSE B;  3LUT B;  1U9O A;  5FKM A;  1MSE C;  1SZI A;  1W7P A;  4HQM A;  3WOD F;  2L7F P;  4QPO A;  1OPC A;  4KUM A;  2Q1Z B;  1M56 C;  3EGX B;  2XAH A;  4MVZ A;  4IRH A;  1DU0 A;  1EQ1 A;  1XS9 A;  2YX4 A;  2Y3D A;  2DGJ A;  2M45 A;  2WV1 A;  1Z05 A;  1IN8 A;  4CZZ A;  1F1M A;  2LF8 A;  5E18 F;  4KN7 X;  1LEB A;  1F1Z A;  2L7A A;  4CIH A;  4MTG A;  3CF5 F;  2UUZ A;  2E34 A;  3I4N J;  2VUM J;  1HOM A;  3U8V A;  3PSI A;  3C63 A;  2DA3 A;  2KIQ A;  3RIR A;  5K5Q A;  1BIB A;  3ZMT A;  4O6N A;  2CW0 F;  2LFD A;  2VKV A;  3EH2 A;  3ZR8 X;  1LS4 A;  2F5C A;  3AQB A;  2DFE A;  3IQ6 A;  3OEO A;  2NS7 A;  2WAQ A;  2BL2 A;  3F6O A;  2YUS A;  1N77 A;  4BE0 A;  2P0W A;  2J5O A;  2R93 J;  2IEK A;  1QPI A;  4A3G J;  5EGO A;  5T3T A;  1H7I A;  5JSL A;  3LSK A;  4HX7 A;  3HTS B;  1MSF C;  1RKW A;  2CUE A;  3D5S C;  4HF0 A;  3O3K A;  4OIN F;  1SFE A;  5JLI A;  4MGR A;  3R6S A;  1H88 C;  1ZHW A;  1LEA A;  4QPQ A;  1LDJ A;  2ZXP A;  4HV5 A;  4DVY P;  3MFK A;  2P7C B;  3VSL A;  1ZAO A;  4F55 A;  4XKB A;  3RCO A;  2OBP A;  2V4J C;  2NVT J;  2XLW A;  3HUG A;  4UNO A;  1JKR C;  2BOL A;  5E3L A;  3QVZ A;  3K1M A;  3CCJ I;  3DF8 A;  1VFC A;  3HOY J;  1QLE C;  3HSE A;  1KQ9 A;  4C3H J;  3G6E I;  1ZHT A;  3CQZ A;  4CDG A;  4J32 B;  3J80 Z;  2DMU A;  3UMI A;  4AYB A;  4OIP F;  2EZH A;  3DTK A;  4CCK A;  3J7Y J;  3GTL J;  1Q0M A;  3N05 A;  4U7B A;  2KNH A;  1VLT A;  3U1K A;  1MH4 A;  1WVR A;  2G3K A;  2GA0 A;  3R60 A;  5IOY A;  1YS7 A;  1FP2 A;  2CV2 A;  2YQY A;  3BPV A;  3LA2 A;  3CF2 A;  1R71 A;  2O7O A;  3NAU A;  4BBS J;  4NQW A;  4V2F A;  4RAY A;  1FLI A;  2ZME C; 
#chains in the Genus database with same CATH homology
 4EAT A;  3PMR A;  4LAC B;  1OKK D;  3JRT A;  4BJ6 C;  1GLN A;  2PFD A;  4W8K A;  3H9Q A;  3VYR B;  3POV A;  3BLY A;  4XLE A;  3FDQ A;  1LDK B;  1TWG A;  3T6B A;  4G7H F;  4OIR F;  2XRH A;  3C2G A;  4E7I A;  2QTV A;  2W4B A;  2JVH A;  3G2B A;  4PSX A;  4E6K G;  4AE4 B;  2WVQ A;  4ZJZ A;  3K70 C;  3RYL A;  1X1A A;  1FFH A;  2C04 A;  4P6I C;  4YT4 A;  3IAS 2;  4E7Z A;  2KHM A;  3ABL C;  2LY1 A;  4I44 A;  4ZDL A;  4E7J A;  2I8D A;  2W4M A;  3FDY A;  3DM5 A;  4O7G A;  5E2Q A;  3OYH A;  2YEV A;  2WAE A;  3PUB A;  4CSA C;  3CJR B;  3HOS A;  2ZXO A;  4XLN F;  2WY7 Q;  2R7W A;  4II2 A;  2WZL A;  1Z6A A;  1QU3 A;  2E1M C;  5HSW A;  3M1C A;  4BXF A;  1Z5Z A;  1PD1 A;  4HRI A;  2A6H F;  2G62 A;  2X1C A;  3LLK A;  5HNH A;  4BDZ A;  3DEE A;  2CUJ A;  3OL3 A;  3OOU A;  2CH0 A;  5CKT A;  4O6Y A;  1FMW A;  5B3S C;  1S7Z A;  4CZC A;  3H5A A;  2NUT B;  4EBB A;  1ZHZ A;  3NWT A;  2QKM B;  3FBI B;  2WL8 A;  3LMM A;  2HVS A;  4XN3 A;  4KNV A;  4LER A;  1IZM A;  2GOM A;  3K4L A;  3IEE A;  4X0G A;  3PHF 2;  4XLH A;  3HLZ A;  3ZIB A;  3BG6 A;  3OYN A;  2XC7 A;  2KW3 C;  4Y33 A;  4AVZ A;  1E0E A;  3H9J A;  4FAS D;  1BR2 A;  3QYF A;  3K4K A;  4HST A;  2LC2 A;  1MW7 A;  1SFK A;  2V6E A;  3OR1 C;  4N4O B;  2HV6 A;  4JZA A;  2LH9 A;  4HEA J;  2DCE A;  2HQA A;  1PCX A;  5KYW B;  1G8X A;  2EIK C;  4OIO F;  4HSR A;  1ERD A;  3EHN A;  2UV1 A;  2CW7 A;  1W36 C;  1FTS A;  4G7Z F;  4KT6 A;  2VH3 A;  3W8H A;  4XL9 A;  3DU5 A;  5HVQ C;  2GOX B;  3CJQ B;  1OCR C;  3M8J A;  4J01 A;  3SEO A;  3AL0 C;  5KYY A;  3I5Q A;  4XLA A;  5DQT A;  2MD0 A;  1DQU A;  2HNH A;  1BR1 A;  2X1D A;  4LG3 A;  2Q3T A;  5F5F A;  1YX5 A;  4F92 B;  4DJA A;  3K66 A;  2IGM A;  2KMU A;  4MQ9 F;  3OR2 C;  3PNV A;  2BVL A;  2IS4 A;  1JPJ A;  2KLO A;  1OCC C;  3OYA A;  5CQG A;  5LD2 C;  4RD9 A;  2J7P A;  3JYH A;  3OYM A;  5DS6 A;  2JVG A;  4QI0 A;  2R7T A;  4CUG A;  4ZTF A;  4O6M A;  1J8M F;  4ITV A;  3MKY B;  4PSW A;  4Y4R A;  3S3N A;  2JUG A;  4BL0 B;  3AG2 C;  4BEH B;  1X1D A;  5CPR B;  3OS0 A;  1VZ0 A;  3N24 A;  2HZD A;  2R7O A;  3NRH A;  2VL8 A;  3AG3 C;  4F4B A;  2X6X A;  3OYK A;  4PJJ A;  3GBG A;  3OWT A;  4K0D A;  5F5H A;  4KI2 A;  4XWJ A;  3OA1 A;  3Q7L A;  1EA3 A;  4OD4 A;  4XLC A;  2HV7 A;  3X2Q C;  3DPU A;  4KIT B;  4ZLC A;  2DT7 B;  2NUT A;  1DGW Y;  3E0J B;  4U5B E;  1QZX A;  3H65 A;  4XNF A;  4YRV A;  3NYJ A;  3VYU B;  4AE4 A;  1HA8 A;  3JSZ A;  3HOT A;  4U5E E;  2ZXH A;  2LG4 A;  2J0X A;  3L2R A;  2KZV A;  4E7L A;  3E70 C;  3K10 A;  2J9V A;  3CSK A;  5EGY A;  4B48 A;  5DLJ A;  3LS1 A;  3LFU A;  3HXL A;  2X85 A;  4BE2 A;  4CS7 A;  2EIN C;  3SZG A;  2IGN A;  3K4B A;  1R6R A;  2JD3 A;  3LEV A;  3RIP A;  4PFP A;  4RMN A;  1NU7 D;  4F93 B;  5KYY B;  3S27 A;  4BQQ A;  5KYX B;  3EPZ A;  3SEQ A;  1V55 C;  5DS4 A;  2VKD A;  5JHF A;  4IZZ A;  5KYW A;  3RH3 A;  3CES A;  2W7N A;  2Q9C A;  2G3V A;  2L9N A;  3BG7 A;  1MMN A;  3DPT A;  1U0J A;  4BS9 A;  3PFY A;  4D9J A;  4IX7 A;  3LS0 A;  4M63 A;  5CI9 A;  2VPL A;  3EUA A;  3HPH A;  4HFF B;  2V26 A;  2O9X A;  1M2V B;  3W2V A;  5FRM A;  4WJ0 A;  4E4H A;  5EHH A;  4FX5 A;  3LSG A;  4YEJ A;  2L81 A;  4KBL A;  2VLA A;  4DGW B;  3ITF A;  2ZSI B;  4G0H A;  2L9J A;  3LLI A;  1Z21 A;  4XTK A;  3KKB A;  3K6G A;  1JI8 A;  1J8Y F;  1O87 A;  1OKK A;  4CCL A;  4OD5 A;  2R7U A;  3SP1 A;  4K7B A;  4LLC A;  2VQC A;  4U87 A;  4BU2 A;  2M4E A;  4XQF A;  2WZG A;  2Z15 A;  3KMI A;  2DYS C;  1MMD A;  1Y6I A;  3K1H A;  3DLA A;  3RFY A;  3S32 A;  1VMA A;  4E7H A;  2H7O A;  2HVQ A;  4YT8 A;  3TL4 X;  2DXI A;  1SF8 A;  4DVZ A;  3DTI A;  4BEH A;  4Q5S F;  3OIQ A;  2KJG A;  3DZA A;  2KP6 A;  4OAY A;  2WZF A;  4YEL A;  2YZS A;  2WB1 A;  2IXS A;  3OL4 A;  4RM3 A;  2PF4 E;  4JQF A;  2ZPA A;  3E9V A;  2CMP A;  4LLE A;  2WAF A;  4AK9 A;  3HPG A;  3IP4 B;  3JT1 A;  4OIP F;  3MMY B;  2IS1 A;  4C3E A;  3TBI A;  1M57 C;  3OYL A;  4U5D E;  4RLF A;  1N1C A;  1AA7 A;  3CP8 A;  4R79 A;  4Q7C A;  2Y3H A;  4JOM A;  3B0V C;  4NC7 A;  4I1O B;  2IGK A;  4HFK B;  5FRO A;  1WJD A;  4CCJ A;  3BCA A;  4E7S A;  3K7D A;  2WY8 Q;  3EZH A;  4U5C E;  4BDY A;  4NNJ A;  1ZYR F;  2OUM A;  2XXA B;  2Q9A A;  3ZC4 A;  3ZQQ A;  3VWB A;  5L3V A;  3GAN A;  1G59 A;  2IXN A;  3LSM A;  3OYE A;  2A5W A;  2OC6 A;  3DMD A;  4BEJ A;  2MC4 A;  4C3B A;  5HLT A;  2AQE A;  3I3L A;  2J9W A;  4BAC A;  5KYX A;  2VIX A;  3OYI A;  2HVR A;  3ECS A;  1UAA A;  2CS3 A;  5D91 A;  4BQN A;  4CS8 A;  3RQ4 A;  2IXO A;  3ABK C;  3WG7 C;  2XSE A;  3VSK A;  4PK4 A;  3FVY A;  4JVS A;  2KRH A;  3DTE A;  3HKZ A;  1LFP A;  2JA2 A;  3D5R C;  4XKC A;  5KHD A;  3NYL A;  4FET A;  4JW1 A;  1QHH D;  1V5G A;  2Q2E B;  3S3M A;  4ZYA A;  4ZDP A;  1LKX A;  2IS2 A;  3K4J A;  3DD7 A;  1M2V A;  1PYV A;  3EGD B;  4DBR A;  1TWH A;  2I8B A;  4ZLD A;  4RBN A;  4E7K A;  4G6T B;  2VAS A;  3L0I A;  3H35 A;  2E5N A;  4XOR A;  3ZVR A;  1X19 A;  2C03 A;  3L2U A;  1RJ9 B;  3B9Q A;  4I3M A;  2X1E A;  2O5R A;  4C9Y A;  2LYC A;  3KX2 A;  4XMY A;  3OYJ A;  2MAB A;  1NU9 C;  5KNL A;  4F3Q A;  2PX0 A;  3O39 A;  5E33 A;  5KYU B;  1Z63 A;  3DU6 A;  4YT2 A;  3EQL F;  2W9Y A;  3SEZ A;  3K70 D;  3RTR A;  3AG4 C;  3LL7 A;  1D0Z A;  2JSP A;  2QKL B;  3QYB A;  2HPI A;  4OWR B;  1D0X A;  4C2U A;  2E60 A;  4JUR I;  4RLQ A;  4KC9 A;  2CNW D;  2IXP A;  4U5H A;  3ZG1 A;  4ANJ A;  3IUO A;  2M4G A;  4PJN A;  4PJL A;  3L34 A;  4BJ5 A;  1D0Y A;  2PJR B;  4CS9 C;  3UNG C;  2QY9 A;  1VYK A;  2WB7 A;  4DOZ A;  2R7V A;  4RDA A;  1MNE A;  3L2Q A;  3OY9 A;  4RM2 A;  2L5Q A;  3PJR A;  2XF7 A;  3ZCO A;  3QMK A;  3KEY A;  2E5Z A;  3S28 A;  3PSF A;  1Y56 A;  3UMH A;  4QI2 A;  3RSN A;  2ZXR A;  2K5C A;  2RQQ A;  4MND A;  3EPV A;  1FFT C;  3VAY A;  2BVM A;  4FES A;  3EG9 B;  4CCN A;  3EUK L;  4CBE A;  5CI8 A;  1T0F C;  2Y69 C;  4Q4Z F;  1NG6 A;  4C30 A;  2R4G A;  3RPU D;  3ASO C;  3DXJ F;  3HJC A;  3W8I A;  2XXA A;  2CFO A;  2D5R B;  4I1M A;  1V5F A;  5DQZ A;  2A1D D;  1IRX A;  4HNU A;  4B43 A;  2IXM A;  3EZI A;  3S29 A;  4KIS A;  1FMV A;  3N0T A;  1ZEL A;  1PD0 A;  3W3C A;  5B1A C;  1TWA A;  4PJM A;  3VYT B;  3FHD A;  2K3P A;  2HDW A;  3K4M A;  1QHG A;  2LBF B;  3L2W A;  2P6V A;  1OCO C;  2R7R A;  1V54 C;  2HPM A;  3TD7 A;  4CS9 A;  3OYB A;  2F4I A;  2KRC A;  2WA0 A;  3MD2 A;  4CSW A;  2OG2 A;  4KNW A;  2Y0S A;  4XOT A;  3NWS A;  1W36 D;  3NDB B;  3QZC A;  3LJB A;  1PJR A;  4JJG A;  2A6E F;  3H5N A;  3F47 A;  3DKY A;  4II3 A;  1JPN A;  3NYM A;  5FCL A;  2L7K A;  2AQF A;  2XF6 A;  2KQR A;  2L9S A;  3EGD A;  1S9H A;  1X1C A;  2VJ4 A;  1BR4 A;  1WJB A;  3D5L A;  3K4C A;  2ELJ A;  2RRE A;  4CCO A;  4BE1 A;  1TR2 A;  2VB6 A;  1W2W A;  3K6B A;  3FHN A;  3OYD A;  4C7O B;  2VXD A;  1RJ9 A;  1DP3 A;  2CDQ A;  1MND A;  2W4S A;  3N2Z B;  3X1O A;  4XR6 A;  1IW7 F;  3VDX A;  1VK5 A;  3LNR A;  3T6J A;  4HEA 2;  1D1C A;  1Z3I X;  2LOO A;  2H7B A;  5KYU A;  2J45 A;  4MLO A;  4OIQ F;  3V7O A;  4EWC A;  3DQV C;  2UWM A;  4DBQ A;  1N78 A;  3EH1 A;  1WJ5 A;  4AU7 A;  2KDO A;  3DKX A;  2LSE A;  3BC8 A;  3PL8 A;  2Z16 A;  3JCU Q;  3FBN B;  1YX3 A;  4GRI A;  4IKF A;  4YN0 B;  4YT5 A;  3V42 A;  4XLF A;  2LRE A;  4J30 B;  3AG1 C;  3DJN B;  4NUB A;  3A1Y A;  4CS8 C;  3AKZ A;  2Y3B A;  1WJA A;  2KQ9 A;  3SYN A;  2WAD A;  3ZRG A;  1OLT A;  3OS2 A;  3KYL A;  3QOE A;  1VYI A;  1ZU5 A;  2PJR A;  2VQH A;  3HL2 A;  1NG1 A;  3GOD A;  3I9V 2;  4XOP A;  3OYC A;  4PFO A;  2L2O A;  2KPM A;  3KL4 A;  2MYS A;  5BUO A;  4XKW A;  3LSI A;  2E1M B;  4JJF A;  3H5R A;  1LVK A;  4XLP F;  2XAU A;  2CUZ A;  2F6C A;  2FUG 2;  2X6Y A;  2XDV A;  4LIV A;  2W1O A;  1WJE A;  4N4N B;  1LS1 A;  2FGY A;  2Q9B A;  3EG9 A;  3CMM A;  2OCC C;  3QYE A;  3QOD A;  3SNH A;  3A2K A;  5TGT A;  1T95 A;  2DT6 A;  4D1Q A;  3EHM A;  1UG0 A;  4BG0 A;  2VJJ A;  4FWV A;  2VXZ A;  4CH7 A;  5HNF A;  3LES A;  3SYT A;  3TMO A;  3AQC A;  3L2V A;  3E1S A;  2Z1D A;  4P1W A;  3I4U A;  4JCH A;  3OMY A;  4AX2 A;  1SMY F;  3VYW A;  2E87 A;  2A6T A;  2B0J A;  2LBF A;  4KJZ A;  2X51 A;  1ZHX A;  3MKZ A;  3RKO F;  2IOQ A;  4G7O F;  4GEH A;  3S8P A;  2VQL A;  1X4P A;  2NG1 A;  4J00 A;  4LIT A;  2J0W A;  4BJ5 C;  2LY2 A;  4IJJ A;  1UEL B;  2K9M A;  5FRN A;  1KU2 A;  1X4O A;  2XF5 A;  2Z2S B;  2Y3G A;  5E3A A;  3ZXS A;  2CV1 A;  2BW3 B;  1VOM A;  3DPL C;  2VJ5 A;  1Z3X A;  4XON A;  4ZTJ A;  2P7V A;  1K6Y A;  1SAU A;  4XKV A;  2EIM C;  4U5F E;  1V5E A;  2OV7 A;  3S0X A;  4NC8 A;  4C7O A;  4CCM A;  2IS6 A;  1TKN A;  3KH2 A;  3B0U X;  4CA0 A;  3AL0 B;  3Q6N A;  4IAO A;  4U5G A;  2WBM A;  1TWC A;  1ST6 A;  3OYF A;  3A4C A;  4BJ6 A;  1NZE A;  2HU9 A;  3HG9 A;  4BJT A;  2M3A A;  2NUP B;  1WGW A;  2VQG A;  3EUH C;  2R7S A;  3MX3 A;  2V7F A;  4PUS A;  4NY3 A;  2WVN A;  3SZR A;  5T3W A;  4IQ4 A;  2GFH A;  2DJI A;  2EIJ C;  4HPQ A;  3LSH A;  4B47 A;  3MLG A;  3HC7 A;  4Y3O A;  2CV0 A;  1BOB A;  2VJI A;  3HUG B;  4XM3 A;  3S3O A;  3NKE A;  2X6W A;  1OR7 C;  3PNY A;  4F91 B;  3K4N A;  2R7X A;  2IGO A;  1O5H A;  2H7V C;  1TZL A;  1YE9 A;  3PNT A;  3DJU B;  4HNT A;  3EFO B;  3O6X A;  4H4K C;  4N06 A;  3EJN A;  1P9Q C;  4IRU A;  3OIP A;  4IQJ A;  1MMG A;  2CNW A;  3NG1 A;  2DYR C;  2LRD A;  5E3C A;  4CSA A;  3K33 A;  3B0P A;  3C2H A;  4GYT A;  3ZSU A;  3MKW B;  4C2T A;  1KON A;  4IWB A;  4X0R A;  1SZI A;  5KCM A;  4BQO A;  3WOD F;  4QPO A;  3W2W A;  4NQW B;  3AFH A;  2Q1Z B;  1M56 C;  3DAG A;  3EGX B;  5T1D B;  4B44 A;  4B6I A;  4C3D A;  3J7A Y;  4BJ1 A;  4BUP A;  4YWQ A;  2Y3D A;  2DGJ A;  3DAF A;  3LAY A;  2J7P D;  2PX3 A;  1X1B A;  3F46 A;  3UGP A;  2KGO A;  1ZHY A;  2K9L A;  4B3X A;  2FFH A;  2J46 A;  4CIH A;  1OCZ C;  3U21 A;  3Q7G A;  3K1I C;  3UR3 C;  4ULW A;  5IY5 C;  2UUZ A;  3ZGK A;  3PSI A;  3DWL E;  1TT0 A;  2NOJ B;  1Z7L A;  4O6N A;  2CW0 F;  5DVW A;  1N75 A;  2MFZ A;  2V1N A;  2WVO A;  4P5O A;  3EH2 A;  5KYN A;  3Q6M A;  2BW3 A;  3H9G A;  4XN0 A;  3ZR8 X;  2ZXW C;  3AQB A;  3OEO A;  2WAQ A;  4F52 A;  2BE5 F;  2PP4 A;  1N77 A;  4BE0 A;  5L3Q A;  2P0W A;  2A68 F;  2DOA A;  2M0M A;  5T3T A;  3ABM C;  3LSK A;  3M1C B;  4DIQ A;  2Y39 A;  4QDL A;  5B1B C;  2V3C C;  3I5P A;  3OYG A;  3D5S C;  2A69 F;  1DGR M;  4OIN F;  1J09 A;  2CW8 A;  2RNG A;  1ZHW A;  5HOO A;  1D1B A;  4QPQ A;  1D1A A;  4LIU A;  2J9U A;  3BCB A;  2ZXP A;  2NUP A;  2M7A A;  3CP2 A;  3IAM 2;  1WJF A;  4DVY P;  2VKH A;  2ZXI A;  3VYS B;  5DS5 A;  2F5V A;  1Z3Y A;  2EIL C;  4ZDO A;  4HE8 D;  3VSL A;  3S93 A;  2M7B A;  2XSJ C;  2ZFU A;  4XKB A;  2V4J C;  3RCO A;  4F55 A;  5CQE A;  1M2O A;  1ZU4 A;  4HG2 A;  2ZSH B;  1MMA A;  5LFA A;  1WJC A;  2BOL A;  3EFO A;  1WFX A;  3CZ6 A;  3UGO A;  1QLE C;  2W45 A;  3T4R A;  2KL4 A;  4YJW A;  2R7Q A;  1ZHT A;  3FAJ A;  3CQZ A;  3ONQ A;  4OAZ A;  4J32 B;  4ZC3 A;  3UMI A;  2IYL D;  2PMZ A;  4AYB A;  3ASN C;  3DTK A;  4CCK A;  3W2A A;  2CGE A;  2XL4 A;  2M4K A;  3N05 A;  4U7B A;  2KNH A;  3DM9 B;  4BGD A;  3HTK C;  4O79 A;  3H0D A;  2W00 A;  2G3K A;  1NG7 A;  3NKD A;  3F9K A;  2W82 A;  3SDB A;  2CV2 A;  4A2N B;  5D92 A;  3CF2 A;  2MWQ A;  3OS1 A;  3UMK A;  2YHS A;  3EGX A;  3FKJ A;  2V9K A;  1Z23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...