4BJTA

Crystal structure of the rap1 c-terminal domain (rap1-rct) in complex with the rap1 binding module of rif1 (rif1-rbm)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
152
Chain Sequence
b'DFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-BINDING PROTEIN RAP1
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription
total genus 52
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bjtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bjtA01
4BJ5C 3CZ6A 3K6GA 3OWTA 4BJ6C 4BJTA
chains in the Genus database with same CATH superfamily
3ZMDA 3H0DA 3TP3A 2XLVA 1T8IA 3QU3A 3GTPJ 3ABKH 2VCCA 2QSGX 2XRHA 3L8JA 3M8FA 1R49A 5IYBJ 1Z63A 4NC6A 3C2HA 2AS5F 2EFPA 3QU6A 2X51A 3VYRB 1T56A 2ZCWA 3DKWA 5DYMA 2ZKZA 3NRHA 1D1BA 1DQUA 5A2QZ 4BHPA 1ORKA 3NRVA 1O3RA 3R60A 5C4XJ 2XRNA 3IRRA 2JQ7A 1NG1A 2R93J 1MNDA 1R00A 3HOXJ 3PCVA 1A7EA 1X1AA 3LLKA 3M4CA 4G7HF 4F7ZA 2EWNA 2E1MB 2F6CA 2Q2EB 3W4YA 3TO9A 3BQYA 3ZQCA 4B43A 3IQ5A 2GLOA 3WE3A 2EV5A 3Q7LA 2E2IJ 1QHHD 5D6EA 4E7JA 3C18A 1YLFA 1Z6TA 2OJQA 1OYYA 4XRSA 2ZXIA 3OYNA 4G78A 4Q5SF 3R61A 3FAPB 3CF5F 2G3KA 3P9CA 3QVYA 3W8HA 3K0LA 4Q47A 1RETA 3E5UA 3KMIA 5B1BH 2HWVA 4KMFA 2W45A 1R9TJ 3ASOC 2JA2A 1G3YA 1BC8C 4U5FE 1B72B 3UMIA 1YS6A 2LSOA 5HDKA 2PEXA 1ETOA 4XKBA 3WHBA 5E20A 3VDXA 4EEFG 1PVEA 1MSFC 1OISA 2YZSA 2VQHA 1W7PB 5L0HA 2L7MP 2ZJ2A 5AIQA 2E2JJ 2X6XA 2PLYA 4M9SA 1S29A 1SF8A 2G0EA 3K4NA 2HI3A 4M9XA 3H2VA 4LLEA 4FX0A 4MIMA 1VFCA 3LAYA 3F0CA 4QI0A 1FTTA 1ZLJA 3J80K 3R7CA 3LSRA 1I5NA 3HYIA 3LEVA 3DBHB 2IS6A 1S7AA 2Z9OA 2MH9A 1A31A 4KIGA 4AD9A 3FOPA 3RQFA 1VYKA 3J80Z 4C30A 2R02A 3TQOA 3POVA 1E0EA 5B3IA 4CCJA 2MLKA 5IP6A 5L3VA 4I01A 3CCSI 1YIJI 4IZZA 4FE7A 3SDGA 3HRMA 3WTZA 2XROA 1VQ8I 4HF1A 1GLNA 3ZMSA 1KQ8A 1HKQA 3AAFA 1YYVA 3PHF2 3FXUA 1AUEA 3DKXA 2JT1A 2DT7B 3FKIJ 4NHJA 2LH9A 3WAQA 3ZVRA 3CDLA 2ACJA 4HOBA 5D91A 2G3VA 4RB3C 5E3OA 2VXDA 4PGHA 4D0PA 3H65A 2LDUA 3SZGA 2FSWA 4WCGA 2H8RA 3NEUA 5FKKA 1B59A 4RAYA 2K4JA 2PFDA 3M4OJ 1VQPI 5KYXA 2K9LA 4II2A 2CG4A 4HZFA 3WGGA 1A36A 1JE8A 4B6IA 3CCYA 1Z05A 2Y39A 3DEEA 3TO7A 1A0BA 2FF4A 1XZQA 4A69C 1TR2A 3ERMA 2BL2A 5M5WJ 2O5RA 3SEOA 2A5YB 3KZZA 4AM3A 3EG9B 2L4AA 4E17A 3MFNA 4CH7A 1ENHA 3ZMTA 3IQ6A 3LSHA 4HNTA 2CV0A 4EJWA 4IO9F 1D5YA 2WV0A 2AWYA 2LNBA 3GORA 3HPGA 3HBLA 4CDGA 1N77A 1UFMA 1W5SA 4D7NA 1M6TA 2FFHA 2LKPA 4GRIA 1RR7A 2YL3A 1XSVA 1FTZA 2QUFA 2LBFB 2A1DD 1IN7A 4IB4A 5CVIA 4HSRA 3OY9A 3TOBA 2R7OA 2KHMA 4A3FJ 3K4BA 1ETWA 2D45A 4JQFA 4M63A 1U6HA 3FHNA 2XKOA 1VQ7I 3DM9B 4XKVA 3DE9A 4PK4A 1MBFA 4IHVA 1ST6A 3A03A 5HDNA 3EZHA 4B3AA 5KNLA 2FX0A 5GPGB 2A68F 1TQIA 2Y9ZA 2Q8KA 2JA8J 2VC9A 3AQCA 2IA1A 3KEYA 5CI8A 2HQAA 1CGME 4DIQA 1K78B 2G7HA 2QBYB 3K9TA 4BKXA 5GTIC 2ZFWA 2DAOA 1SFXA 2P7VB 1U0JA 1R4NB 2M9HA 3T1BA 4YRVA 3QRFF 1KU2A 1WJBA 4NDLA 1XGNA 5EGOA 3CDHA 2WAQN 3EUHC 3FIWA 5ERIA 5H20A 2W7NA 3HNLA 4OIQF 4XSZF 2IGMA 3RCOA 2JPUA 1O3QA 4LDKA 1NZEA 2MC3A 3JTGA 1STZA 4UV8A 5HVQC 3QTHA 4MEXF 1IG7A 2P7CB 4ZTFA 4CS7A 1E3OC 3AL0C 1R4MB 4MTDA 4CA0A 2YR2A 2BC5A 2HSQA 2ELJA 1TWCJ 4EWCA 1VQ6I 4C3DA 1MJ9A 1WSUA 4ENNA 2FQ4A 1U89A 2DA4A 3NYJA 4M71A 1GVDA 1O3SA 3CCVI 5IYDJ 2Y69C 2ELKA 3AQBA 2CW7A 4RGXA 2ADUA 1K4TA 4KC9A 1A6IA 4C3JJ 2ZJPF 4EHPA 2W48A 1UHSA 2PBIA 4LG3A 2E71A 4CJGA 1W0UA 1HW2A 3A02A 2DT5A 4Y15A 3TJ5A 2WY8Q 4MW8A 2ME0A 4AE4A 2AXLA 4FETA 5A69A 1U8BA 1V4RA 1XDSA 2HOAA 2IBDA 2ECBA 4B1RA 3ZSUA 3LSMA 5DD4A 5D5VB 1E2XA 5J4YA 1DU0A 1TKNA 3F47A 2V79A 2H27A 3SYNA 2IPQX 1ETXA 2Z5UA 2KIFA 4IHWA 3WG9A 2M8GX 2R7WA 2RD9A 4P9TA 4ZDPA 9ANTA 3WODF 4JOMA 2M2EA 1IAWA 1S3JA 3K4LA 2C6YA 1WJEA 5JUAA 2Y69H 2ME6A 4OU0A 1LPEA 4DRJB 2F5EA 4G6QA 4IEJA 2L7ZA 2C04A 4W97A 1UB9A 3HRTA 1VI0A 2DW4A 2H09A 2XGEA 2H1KA 3I58A 1FTSA 1G3SA 3ABLH 1H88C 3C8GA 2FNAA 1LNWA 5JHUA 2L3DA 1I4ZA 1VQMI 4A93J 1MSEC 4P9FA 4V2GA 2GM4A 4QTRA 4RB2C 1Z3YA 3JRAA 4CYDA 1LVKA 3RKQA 3ISPA 4WJ0A 2L7AA 3WHCA 3HLZA 1S9HA 4B09A 3IWZA 3J7ZI 2KPMA 5COFA 2Z3YA 1ETQA 1E83A 2O7OA 4LIVA 1S72I 3TKYA 1X2MA 3HOYJ 2O61A 2XSJC 1RXQA 5B1AC 2KKOA 1PP7U 2XLDA 2AQFA 3HJEA 3CZ6A 3K6GA 3LOCA 3CCMI 3N97A 1K79A 4XLEA 1ZG1A 2V6EA 5DEQA 5E8IA 4DGWB 2ID3A 3FK6A 4BEHB 4ITVA 3LL7A 5D5UB 1YJNI 3LSIA 2XGXA 3OYDA 2HSBA 4YT2A 2ETHA 5K5RA 4RS8A 1BDJB 3B73A 4ZYHA 1VOMA 3FKJA 2HDCA 1EKEA 1Y6IA 3HOUJ 2KMUA 3V5YA 2EINC 2VJ4A 4DJ9A 1RJ9B 3RYRA 1Z3IX 3PUFA 1ERDA 1ZHTA 2EPOA 5J1RA 3WU2C 5FCLA 4WXHA 5B1AH 5F5HA 2I15A 4NBQA 3LNRA 2GA1A 4MTGA 3KP5A 1VNDA 1FNTc 2VCAA 1H7IA 4XM3A 2FOWA 4F3QA 4NC8A 3GF2A 4OIRF 2V7FA 1MMNA 3Q7GA 4WGZA 3DEUA 1RKTA 3HC7A 3TOLA 2PI0A 1ZVZA 2I8BA 2ZB9A 1BI0A 4XBFA 1PUEE 5EK0A 3NMIA 2QA4I 5CYVA 1YW9A 3ZQGA 2WBMA 5JVEA 1R58A 1AWCA 4AWXB 2XUBA 1P4AA 2Y9YA 5IT3A 2LY9A 5J1YA 2V1UA 4XLHA 4Y4RA 3JRDA 3RKXA 1YI2I 2EINH 3IUOA 2XVCA 3CCUI 4EBJA 2Z99A 3BPXA 1NBBA 3GVAA 4BE2A 1YRNB 3MKLA 3L34A 1T39A 1RUOA 4J30B 3X2QH 2QQAA 3LWFA 3GZ5A 5CPRB 3TDUC 1OCZH 4NTFA 2ZFUA 3KETA 4G7OF 2IA2A 3ZTZA 1MDMA 3DJUB 4CGZA 1C0WA 4OAYA 2YHSA 4HLXA 3KYDB 1P92A 3LNMB 4H0EA 3OR1C 4L5EA 3IEEA 1DP3A 1FOYA 3QP6A 2EA4A 3S14J 1MZBA 2XL8A 3PSFA 2EIJC 2Y3BA 2YL0A 3S9OA 2MHRA 3JRCA 1OR7A 3TGNA 5A6BD 4HAMA 2DMTA 2BGCA 1F5TA 2BY0A 3ZXSA 4X0GA 3AL0B 3GZ6A 3ASNC 4OIPF 1MD0A 3HTUA 3WTUC 2NOGA 3ZQQA 5ILUA 2XAJA 2DDBA 1AOYA 3RH3A 4WXCA 1W36C 3I5QA 1J59A 1U6GA 3DAGA 4LJZF 1SD6A 5EEAA 3EH1A 4X0RA 5D4SA 2NUTB 2MWQA 1ZR2A 4JRZA 5HSWA 1MH4A 3VOEA 3BR1A 1JKPC 3K69A 2HKVA 1QRYA 3PIPF 2PF4E 2F5FA 3MZYA 4L9TA 2EIJH 3I5UA 1JXSA 3AOUA 2P8TA 3EUAA 4XKCA 2CGEA 3S3OA 4M3FA 3DBRB 1J9IA 2Q9AA 3NKEA 1Z0XA 3ASNH 3EPVA 2HFIA 2L5QA 1S6LA 2OZUA 3CP8A 2JVHA 3I4PA 4ZH4F 3WTXC 3L2WA 1IZMA 4FX5A 1N75A 2CV1A 2XIGA 3OYIA 3QPTA 3KL4A 3L09A 2NYXA 4MVMA 4XORA 3NYLA 1KTMA 2J46A 1QQIA 2XL4A 4F93B 3EQLF 3LSGA 5D4RA 2JTVA 1ZLKA 3S29A 2M4GA 3DPLC 2W85A 1AU7A 1D1AA 3LSJA 3PQKA 4E7ZA 2DGJA 5EG0A 4OIOF 3U8VA 2CGPA 1PCXA 5JP7A 1KZHA 4EATA 5E79C 2HVRA 4YT4A 4R8HA 3NMKA 3EG9A 5E2QA 2FMYA 3ONQA 1UG0A 1NU9C 3GTKJ 1FPQA 4XLAA 3AGTA 3GWNA 4NTAA 4U5EE 3LSKA 3EJNA 3RIPA 5FKMA 1WH5A 2IBFA 3RQGA 2M45A 1ZZPA 1MMAA 5L0FA 1QGPA 3K1MA 1NK2P 3CDIA 1K6YA 2ICWG 1HW5A 1G4US 3GM3A 3ATPA 3L0IA 4MLOA 5L3QA 5KYYB 2DYSC 4MHGA 2DFHA 3AG4C 4YL1A 5BOXA 1EF4A 3JSPA 2Q00A 1ZG3A 1LE8B 1V55C 2GA2A 1WKMA 2V26A 1UHWA 3WTYC 3ZDLA 4EGZA 1E17A 1ZQ3P 1T98A 1NH3A 1E85A 3G6EI 2EPNA 5F64A 5KYUA 1WGXA 2WL8A 4B44A 3HTKC 2OEVA 4U5HA 5M5YJ 1NTCA 3HSFA 3WE2A 5FZTA 4GO1A 3HB9A 5T3TA 4CSAA 3NYMA 5LRSA 4CS9A 2FU4A 2R3SA 4HPQA 1T38A 1QU3A 2JX0A 2CQ7A 4JX5A 1Z7LA 1E3HA 2QSFX 2F22A 2MD0A 2DYSH 3FK7A 4CZZA 3H5NA 3LA7A 2EZKA 1W5TA 1G4WR 1MIJA 3CUQC 1PYVA 2PBEA 4YT8A 3LQQA 3IH2A 4I98B 2KQRA 2TRTA 1DOWA 2LVSA 3S1QJ 5GPCA 1TWAJ 5COMA 2HPMA 4I76A 4NCQA 1TTYA 3F22A 4N4NB 5FLVA 3FAJA 1FP1D 4BQAA 2JN6A 4D4XA 4ONSA 3EPZA 1OCRC 3QPSA 4C3EA 2ZXOA 3HSRA 3K2AA 2NG1A 2IP2A 1B9MA 1SAUA 3WTVC 1Y39A 2E5ZA 1CQTA 1PD1A 1EA8A 1QZXA 1Z91A 5GAEJ 1LFPA 2KRFA 5HS8A 2VQGA 3ZC4A 2O8KA 3H0GJ 2V3CC 2J7PA 3PNTA 1JHHA 4S0HB 4MTOA 2V9VA 3Q6NA 3O3KA 3SYTA 1ZR4A 1JGSA 3WG7C 4JJFA 4AIHA 3QOEA 5FKLA 1APLC 5K7HA 4LD5A 3LQRA 2QZ8A 1E86A 3ZMZA 4I7HA 2IXSA 5KAIC 3HOVJ 2L54A 4LOCA 1XCBA 1S5LC 1MNMC 1VZ0A 5HS7A 3SEQA 3V8KA 2OKUA 4WGYA 3BRJA 4OD4A 3A0BC 3F46A 1Z77A 2ISYA 5ILSA 2IYLD 1JAFA 2WB1A 2JA5J 2VPLA 1D8KA 3KH2A 2E1NA 2ZSHB 4A3DJ 2VBWA 2M7AA 1TWGA 3AG1H 4PFOA 2UXNA 3T9OA 3JR9A 3FZVA 2K9MA 1GXQA 2JPCA 1TT5B 4L0ZB 1D0ZA 1USSA 1IRGA 2ZD9A 3OS1A 4BBRJ 1A41A 2XSEA 2HVQA 2FD5A 3GFJA 1X58A 2QQBA 3EYYA 1FWZA 2CQKA 4N9HA 2FJ1A 2X6OA 4DZJA 2XV4S 2XPUA 3ECSA 3H1CA 3UKGA 2HR3A 2H1LA 2PFBA 3TBIA 2OF7A 2Z33A 3S15J 1YIOA 4ANJA 1JGGA 4BH9A 3M8EA 2HOTA 4O6YA 1R71A 3L8IA 3OS2A 1ZRFA 3TO6A 2XLWA 4DVYP 5DCMA 4U7BA 4J7YA 3RZDJ 2Z2SB 2HEOA 3OOUA 4UDVA 2V6CA 2KJCA 3TW7A 2DA6A 1ZGAA 4IWBA 4M72A 1S05A 3GZNB 1VQNI 5H2FC 1B68A 2J5OA 1YJWI 3BOQA 1XS9A 3EGXB 2RGVA 4JJGA 1OQCA 2A3SA 5F27A 3AG2C 4HQMA 2XLEA 1WH7A 4C2MJ 5J8FA 2R7TA 3A01B 1TQPA 3DZAA 4M73A 1RNLA 4MTEA 1A6QA 4A5MA 2Q7RA 3KYCB 4MVUA 3FMSA 3HG9A 5FD5A 4A3LJ 2PX3A 2F5CA 2Y48A 3AKZA 5COGA 2KIUA 3G1MA 2P61A 5LHGA 4YL0A 3OMYA 4FASD 3MKYB 4U88A 4ULWA 5ICGA 1LDKB 1I6XA 4K1OA 1M56C 1FAPB 3E6DA 2DTZA 4BGDA 1RJ9A 2O3FA 4BDYA 2KZVA 5B5EC 4NQFA 2PMUA 4XSXF 3CJQB 3TP0A 3MLGA 4LMYA 4HRIA 3L2VA 2R92J 5CKTA 4LGWA 1P2FA 2TMVP 4ASNA 4XRMA 3RKOF 2MABA 5DUIA 3AG2H 1V5FA 1Z21A 1MW7A 1BW5A 4RA2A 3VB2A 3HL2A 1FOWA 4ZYGA 3ZQIA 2H7VC 2ZXWC 1WASA 2VCBA 1JKOC 2W82A 2X1DA 1YX3A 2V4JC 1BJZA 4FE4A 4RLFA 3UNGC 3VRCA 2ZO4A 2NS8A 3FHZA 2W00A 2IGNA 2F5DA 2Z1DA 2QTVA 3HOTA 3T0YA 2EPMX 2BY2A 4YFKF 4IRHA 5JI6A 2NXNB 1X1DA 4KITB 5B3SC 5KYWB 2HTSA 2RV8A 1MBEA 1U9NA 2BBYA 1B6AA 2NVYJ 3TQNA 3G71I 1XGMA 1ZRCA 1GQAA 2EIMC 3I5PA 3RW0A 4OOIA 2WZFA 4L0YB 2QENA 3CUQB 1G4DA 3EFOA 4KA4A 3K1IC 1ETVA 3EUHA 3WU0A 2BVMA 2KLOA 3ABKC 2YL1A 2HQ5A 1W0TA 2VUMJ 2VC1A 2A6TA 5DDGA 1IJWC 5ILVA 1R36A 4UB8C 3I64A 2QEXI 3L00A 1G5ZA 1N1CA 1O5HA 2HGCA 2BHZA 5JLIA 2CYDA 3S84A 3JT1A 3DTKA 4WXDA 1E84A 4NNJA 3HJCA 1JKRC 2R9RB 3VSKA 1OCPA 2KIQA 3PIOF 3QYEA 3KEOA 4MQ9F 2HZ8A 3K6BA 3PO2J 3FXKA 3K4JA 2JZYA 5B3SH 5TISC 4HX8A 5FKOA 4E4HA 4JW1A 1TWFJ 4XNFA 1X1BA 3PO3J 5A6KA 3OYBA 4IPAA 2D5VA 2VIXA 1X3WB 2GZWA 2X4HA 5B66C 2VKHA 2KYHA 2VKEA 1N78A 1HQCA 3M8JA 2NUTA 4YFXF 3GANA 1UFBA 4CYCB 3PL8A 1HDPA 3H3ZA 3PUBA 4X1EA 3DKYA 3ZMUA 3AFHA 2VASA 2QKMB 2O6GE 3ZIBA 2RVCA 4IOAF 1QZEA 3E9VA 2YLIA 5A2QK 4A3MJ 2CUEA 4MVZA 4CIHA 1OJLA 1OW6A 3M1CB 4JCHA 3F3XA 3ZQ7A 3I4NJ 2TDXA 4LG0B 1LE4A 5B1BC 2V9PA 2DN0A 1H0MA 1I1SA 4J7TA 4U9EA 5AGFA 3MZ8A 2IW5A 3Q0WA 2ZMEA 3C2BA 3ZCOA 2FGYA 1PUFA 3RVYA 2DOFA 3ECOA 3SJMA 1P9QC 3E70C 1L0OC 5FLMJ 2XLMA 4R32A 3SP1A 3ZPLA 4LB6B 3N4MA 3J7YJ 2NUPB 3MYFA 3DV8A 1UG2A 4KISA 1LDJA 3HGYA 4HE8D 2L9JA 3I9V2 1FNNA 2WB1N 2LF8A 3I53A 3O6BB 4BJ5A 4DOZA 4ETSA 3CO7C 3LUTB 2P6VA 2W57A 2E87A 4XEFA 3CF2A 2CFXA 4ZJZA 1FBSA 3K1PA 3H9QA 4E7SA 1RUNA 2QVOA 2OOCA 5HNFA 3F6VA 4ENKA 3FXLA 3T6JA 2HMZA 3EETA 2OV7A 3GX4X 3K66A 2HZDA 3DTIA 4KDPA 2VH3A 3H9GA 1P6RA 4BDZA 2OEXA 1RIOH 5KYYA 1J09A 1J8YF 4LFUA 2XB0X 2DB4A 4DVZA 3PDMP 4IARA 1FEXA 4KIBA 3R0JA 2KJGA 5IPAA 2X0LA 2ZSIB 3G3ZA 1T08B 4OWRB 2OU6A 3ZGKA 4E6KG 5L0JA 3BTIA 1R23A 3KE2A 1JPJA 3CCLI 3CO6C 3RQ4A 4E7KA 3U2MA 3RZOJ 2QM3A 4A3EJ 1OW8A 1IZ1A 1R1VA 3HHGA 3LA3A 2QLZA 3EHMA 4RAZA 2VBXA 5GPAA 3RPQA 2KW3C 1B9NA 2CFOA 5IT9K 2W4BA 5AC4A 1FFHA 1O57A 4V2FA 2YUSA 2YLGA 2XAGA 1M2OA 3IHUA 4HNVA 3FXQA 4JBAA 2JVGA 2ETSA 5E1ZB 4KNYA 5IT9Z 4W1UA 1X19A 4BXXJ 1J5YA 2CNWA 2RKHA 4YN0B 4UNOA 3HM5A 2IOQA 5CVJA 4JKVA 4A6DA 4LACB 1IRFA 3HRSA 3H35A 3CC2I 1H89C 3OYMA 2R0QC 3IAS2 1VQLI 2JD3A 4HEAJ 4DW6A 2Q3TA 2OD5A 1Y1VJ 3CLOA 5E18F 2E1CA 2L81A 1BBHA 4R1HA 1PDNC 3SXZA 2UUIA 2DA3A 1OMIA 2E36A 3FVYA 4XQ1A 4MVRA 3HUGA 1F36A 3CQZJ 1USTA 3HPHA 1R5GA 2M0CA 4XEVA 2OC6A 2DMPA 3GFIA 3L2CA 1SANA 1UELB 4YWQA 3J7AO 1FIPA 4QPQA 4HYEA 4XN3A 3UMHA 3IKTA 2K86A 4HFKB 2JPBA 1QQ3A 5KVRA 2DPUA 3NDBB 1VQ5I 1F4KA 2YU9J 4A3GJ 1B8IA 4CBEA 4EBBA 1WCMJ 2HYJA 3MKZA 2LF7A 2DU9A 2CQXA 1JPNA 4GDFA 5FRNA 2NSFA 3D5RC 4IHTA 3BJAA 3K70D 2A0UA 1IGNA 4Y3OA 3QW0A 4Y33A 1IN5A 4U0WA 1Y0UA 1ZW2A 1IN4A 3M1EA 3BCAA 2ZJQF 1LFBA 4M6VA 4DRIB 4MVOA 3RIRA 2QY9A 1BA5A 3HGGA 4DYRA 3R2PA 2R5YA 3S27A 1XPXA 2ZC2A 4Z9JA 2X85A 4P5OA 3AJMA 3S1RJ 2CO5A 3HIFA 2JUGA 2YPRA 3L2QA 5F5FA 3CTAA 2GIVA 4JX4A 4XONA 1C17M 4ER9A 3S2WA 1Q1HA 1MMDA 2IGKA 3LAPA 3F9KA 1XGSA 2LG4A 2EZHA 1UAAA 4O6NA 4CDVA 1TL8A 1Y1WJ 4N4WA 3DEWA 5M3MJ 3TOAA 3O8GA 1JTYA 5F0CA 2PG4A 5D92A 2X0CA 3RTRA 4ENJA 1MBJA 2X48A 1IXSB 4OINF 3V8LA 1AKHA 1QKRA 1ETKA 5K7FA 4L9VA 1RKEB 3EGXA 4GYTA 1XN7A 3P9IA 3HNIA 1JR8A 2XXAB 4NQWB 2Q1ZB 4ZZLA 3DD7A 3FHDA 4QLCU 5A6AA 1WGWA 2LMDA 2FXAA 3B29A 3E7LA 1RC9A 3A01A 2KISA 4K2EA 3N0TA 3M07A 4QDLA 2ZXRA 1P7JA 4XEKA 5EHHA 4LIUA 3GXOA 2B0HA 2LRDA 1SMYF 1RI7A 1YA9A 3C7JA 2GBYA 1AHDP 1KU9A 1WTYA 2P6SA 3V7CA 3VEPA 1ACIA 3RVZA 4M9ZA 5D8KB 3DM5A 3IWFA 3IQCA 3ABLC 1MBKA 2VI6A 5J1UA 1SD5A 2IEKA 5M5XJ 1U5TC 1IXCA 4CDAA 5C44J 4QI2A 5IOZA 3CJNA 2V1DA 4LK1F 5JSLA 4RMNA 3ZQVA 2L7FP 4XPXA 2I10A 2I8DA 4P96A 5HOOA 4NTBA 4G7ZF 2PX0A 1SFOJ 1Q0KA 1YLMA 4G94A 5E3LA 3GTGJ 2WZLA 3BR6A 3QMKA 5CQEA 2ZJRF 3DMDA 3BC8A 1R4TA 3DWWA 1JOGA 4HLYA 2E7XA 2XB5A 4I1OB 1VMAA 4YL3A 3VF0A 1QNTA 3I4UA 2XGCA 3FWEA 2HTJA 4DBRA 2BW3B 2EH3A 1JKQC 1T5OA 3U2RA 4X6AJ 2KK1A 5L0CA 3V42A 2QE9A 1M2VA 2DA1A 3NWTA 3P5JA 256BA 2ECCA 1SVLA 2KFDA 2DODA 1K61A 1CGPA 3CUQA 5L3DA 2XKPA 1W2WA 3JTLO 3VYTB 2LD5A 5J40A 3OYLA 2NSGA 1XG1A 2FRHA 2OU2A 1GXPA 3S17J 3FM3A 4XIDA 1SYQA 3I55I 3OSGA 2NVXJ 2CUFA 4N9IA 4FISA 2Y3GA 2JRMA 1S7EA 2OG2A 2M87A 1L7CA 2LOOA 4HBLA 3JRGA 4C7OA 3BZCA 4CJOA 4U0VA 1HKSA 4FX4A 1S7OA 3JSOA 1L3LA 3H92A 2L6FA 1HXDA 3E6BA 2NPUA 1BI3A 3N05A 4G9YA 3JRMO 3UGPA 3F8MA 4HG2A 3LSPA 2HVSA 3KIOA 2Y2ZA 2CV2A 3FXOA 1IUYA 2CQQA 2H8AA 4F92B 5FFXA 2W4SA 3A9CA 2LY2A 4KN7X 4OMYA 3R4KA 4A0ZA 2VQLA 2VL8A 3S2HJ 3BJ6A 1BI1A 4LLGF 4YELA 3HEFA 4CYCA 4BQNA 5EZHA 4C2UA 4GEHA 3MD2A 3CMMA 2B63J 1ZN2A 1BZ4A 3RI4A 4BXFA 2J9BA 2F4OB 1ZU4A 4RB0A 2EBIA 3LLIA 4MVQA 4M74A 2M30A 3DKAA 2UUHA 3G4SI 5A6BA 3X2QC 3K70C 3I59B 1HLVA 1OCZC 2AWCA 1SAXA 3W6JB 4LG0A 2GIZA 1U8RA 3HRUA 3ZQFA 2HUJA 1BW6A 1ON1A 1HBXG 2ZXPA 2VJJA 2EJRA 1LEBA 2H6CA 3Q0UA 2VOOA 2E7WA 4M3GA 1A35A 2Q2EA 2NUPA 2RSEB 3ULQB 4EJOA 2HYGD 1LIHA 5CI9A 4BJ6C 3KCCA 5J4VA 1RCPA 2RAEA 3NQOA 3C8GD 4I44A 1TT0A 1YARO 4XLNF 3AG3H 4W8PA 5K7ZA 1F1MA 1HY5A 3T8TA 2R05A 5D8LB 1ZAOA 4IXAA 5BQIA 1LS4A 1FOXA 1PP8F 1I4YA 1RKCA 2LR8A 4FT8A 4PDKA 1TW3A 1XB4A 2ZXJA 2J9VA 3HNJA 1B72A 3T5XA 1JUPA 5DTDA 3VYSB 5DV5A 2QCOA 3ABMC 4EM1A 4MQVA 1HMDA 4A2NB 4EKWA 3ZN1A 3W6VA 3U9JA 4DXWA 1W7PA 4YJWA 2HZTA 4YIIA 4PR9A 4J19A 2H7BA 5E3AA 3CC4I 2VJ5A 4HV5A 2GQQA 5A6JA 3ZQHA 1IDYA 2DA2A 1EI7A 3SNHA 2NRAC 4PJ0C 1BN5A 1ODDA 3CJRB 3GM1A 3K1HA 3W6KB 1JI8A 3GEEA 5HNHA 3IQTA 5KYNA 3JYHA 2IRFG 2FMLA 4E70A 3V5ZA 4U5GA 3C63A 5LRRA 3ABMH 2L02A 2R7QA 3BCBA 1I3QJ 1RPWA 4XR6A 2IS1A 5LHIA 2QLAA 2L7KA 5DUKA 2CH0A 1JJ8C 2O9XA 4AVPA 1U5TB 4EIYA 2KL4A 4BHCA 4Y13A 2W4MA 3GYHX 3TK0A 1Z6RA 4AIKA 1GUUA 4HA8A 1HE9A 3O39A 5L0DA 3DPUA 2VC0A 5F6FA 2O8XA 1TWHA 2IM8A 2M4EA 1T6QA 4O79A 4U9DA 4BL0B 4KICA 5L3GA 3HSEA 3BPVA 4F52A 2NNYA 3UMKA 3F8CA 3FBIB 2K7LA 2M0MA 2R25A 3F8BA 4L5IA 2EA2A 3MAJA 1SZIA 3JSZA 3F6OA 3H3VK 2WZGA 3QYBA 3LEOA 2O0YA 3ZOBA 2IGOA 2Q4FA 3EGDB 2AQEA 4P1WA 2B0JA 2STWA 1C02A 1LKXA 3A1YA 3LS1A 2GAQA 5LBQA 4HW0A 1YYXA 2IT0A 3D0SA 2E2HJ 3ZWIA 5LGUA 3F72A 2KIMA 2DCEA 3DFGA 4CXFA 1WWXA 4I6ZA 1APCA 4EUKB 5K1YA 2BY3A 1OKKD 4I2OA 1XCVA 1LI7A 4BEJA 2PNOA 3E3VA 1I39A 3FF5A 1LS1A 4IKFA 2WWYA 5TJJA 4O6JA 4B48A 4F55A 5HLHA 1WWPA 1LDDA 2DK5A 2VB6A 5IY5H 3JRFA 3ABTA 2LBFA 2CYYA 1XDUA 1MBGA 3EZIA 2DK8A 3IAM2 5JHFA 4WX9A 3S8PA 4BJ1A 3JAMK 4E0IA 1PD0A 5DQTA 1ZKGA 2R7RA 4JP0A 2LFBA 1FYMA 2CU7A 3ERED 1FMVA 1SFEA 2HNHA 3NAUA 2IS2A 4E7IA 5BUOA 1B1BA 1V5EA 3RPUA 2CS3A 1YHQI 4RGRA 3JAMZ 4G12A 2K40A 4JEBA 2NVUB 3A0HC 2XAUA 3KYJA 2ESNA 4V19K 3O55A 4BAYA 2IXNA 1ZHXA 1VQOI 3CESA 4MS2A 1LE2A 1IXRC 1FIAA 1MJBA 2NOJB 3IP4B 4I0BA 4U87A 4UXNA 1K78A 2QBYA 4KNVA 2W24A 3C1DA 2R7SA 3I54A 4DRHB 2YVKA 4ZDLA 2P81A 5LD2C 2P7VA 1IUFA 1L3PA 1K83J 2KDZA 2VKDA 4D4NA 2ZBKA 3TJ6A 3JREA 3CLQA 2YLDA 3OV8A 1HE1A 2PJPA 3SXYA 2D1HA 2EQRA 1DU6A 2MYSA 2R7FA 1FX7A 2BY1A 5DS4A 1LM3B 2GDCA 1A7VA 3IH4A 5C3EJ 3HKZA 4XQFA 2DFEA 3FDQA 1RKEA 1BOAA 3D1NI 4NC3A 3BTLA 4OD5A 4XLCA 6PAXA 5F04A 3S32A 4B8XA 2X9DA 3DTEA 2ISZA 2P5KA 5FD6A 4LB5A 3GW2A 3AG1C 3FM5A 3G2BA 2TCTA 3GTMJ 3KP7A 1AVOB 4OAZA 2IAIA 3MEXA 5CVVA 2LFFA 4M6YA 4D9JA 2KDOA 2UWMA 2FUG2 4RAGA 1GVJA 1Z7UA 1SVMA 1XX5A 2CWEA 2HU9A 3K10A 2LP4A 2JUCA 3CP2A 1BR1A 3WGIA 3LNQA 3M3YJ 1Y8RB 5EEHA 4IX7A 3PQJA 4GYIA 1FY7A 1LB2A 2L9NA 3MX3A 5KYXB 1HW1A 3MZHA 3T4RA 5EZGA 5LGTA 3KP2A 2QNLA 3B0UX 3BR5A 3IH3A 2YWAA 3JYYA 4IF4A 5K5OA 1UHMA 3BTCA 1W4MA 2CQNA 4EQQA 4HQEA 2EV6A 2IJLA 2OCCH 3JRHA 1V54H 4IVNA 1RZ4A 4WABA 3PM1A 4E18A 1ZTRA 1CGNA 3G1LA 3V5XA 4LERA 3OYHA 1O87A 2DLLA 4UV9A 4L9JA 1ORJA 2MG4A 1BI2A 3MVPA 4IRGA 3BR0A 4XRFA 5E1WA 5IYCJ 4XPWA 2GFHA 1Q0GA 2COMA 1YX5A 4MFDA 4CIPA 2BW3A 2VT2A 1OCOH 2RNJA 1V74B 1VK5A 3H5RA 2BZTA 1FOKA 3L2RA 4JTDB 1OQYA 1F9NA 4D7MA 4DBQA 3F21A 3IPMO 2COBA 2EILH 1YVIA 3GBGA 4EMSA 2F48A 4KIFA 3ECHA 2YS9A 4D5FA 4N4OB 1BOBA 1CF7B 2CUJA 4RD9A 2K4BA 2LP0A 3IV5A 3BZKA 1BC7C 2X6YA 3NWSA 5TGTA 1K4SA 2OBPA 2OCEA 3C62A 3E0JB 1LJ9A 2OQGA 3OS0A 1J8MF 4CS8C 2STTA 1ZGJA 1RKWA 4B4CA 3EYIA 1YDIA 2L9RA 4BEMJ 2Y75A 2PN6A 2QKLB 2J7PD 1HMOA 4XN0A 1WJCA 1UG7A 2MD5A 4U5CE 1VB5A 1J75A 4PSXA 4G8XA 4A0XA 2YX7A 4K0DA 1EH6A 4BEHA 1YITI 4GFBA 2E1OA 5EGOB 3QP5A 3UR3C 4PJJA 4BS9A 4M3DA 4E0HA 5JVTA 1TFKB 5DCFA 1QHGA 1GS9A 2LYCA 4RM2A 2KRHA 3PNYA 4UVBA 2UUZA 2QQ8A 4BUPA 4AU7A 2O03A 2WVQA 4HDVA 2LKXA 1G59A 1XMXA 3ZRGA 2D4UA 4MNDA 3SZRA 3I59A 2P1AA 2BXZA 2OPTA 3K1NA 1JT6A 4ENMA 2J45A 1H9GA 2BOLA 2K9QA 2HDDA 5JVGF 3RF3A 2QSHX 4IHSA 4HNUA 5M3FJ 1WI9A 2DYRC 2W25A 3SFZA 3BP8A 1QVTA 3H3UA 3VYWA 2HDWA 4K7BA 3NKDA 2GA0A 4GXOA 3ZP5A 4U7DA 2HKXA 2EFWA 3BZ6A 1Q0MA 2Y31A 3OIQA 3F8NA 3EHNA 4I99C 3U9GA 1BL0A 3U0CA 3WHNA 2MC4A 2PP4A 3LS0A 1LFUP 1TZLA 3JRBA 4AE4B 4PCQA 1S7ZA 1LPQA 3E97A 4MGRA 3CMEI 3QW1A 1R5HA 2DOAA 3U1DA 4A5NA 1YRNA 2DMUA 2OZ6A 1TQMA 4BYYA 2HKOA 1R1TA 5FJ8J 3SXMA 1NU7D 1WVRA 4ZDOA 1QZZA 3DJNB 1OKRA 1DGRM 1P7IA 2DYRH 3I0TA 4N0BA 1X3UA 1FYKA 2P0NA 1H8AC 2P5VA 3OSFA 2EFOA 4LLNA 3L1MA 3VAYA 4FAPB 4UY8I 2O9LA 3RFYA 2CCYA 3US6A 3KX2A 3Q9VA 2MLGA 3S0XA 4HV6A 4JURI 2IVMA 5J8CA 2YKZA 3P7NA 2HQRA 5L3FA 2XRLA 5C4JJ 3C2GA 1ZHWA 4MVSA 1WJFA 4CZCA 2HOEA 3C8GB 2CW8A 2RREA 3SQNA 5KHDA 4ZYDA 3MFKA 2C03A 5JLXA 2JJ7A 1I6HJ 4AL1A 2XGDA 1KU7A 2CRGA 1MMGA 3HHHA 1YYJA 3JW4A 3QOPA 3JZ0A 1O3TA 2J0XA 3S93A 2A6EF 5DD8A 4O6MA 2VBYA 4HEA2 3EUKL 5H6RA 1WOLA 3KP3A 3K7DA 2LK2A 3HKZN 3EDPA 1IV8A 5J47A 2PMHA 4KT5C 2FBKA 1TP4A 3LAJA 3F23A 1VLTA 1OLTA 5ICFA 5FRMA 2F5VA 3DBLB 3BR3A 3C3WA 1ON2A 3WTTC 2FQ3A 2MW8A 4KNWA 4BBSJ 3CJTB 2OQMA 1ETYA 1WHUA 1CPQA 3I56I 2ZNZA 2E34A 5T3WA 5FFZA 3QZCA 3GFMA 3KLNA 1VQ4I 1IV6A 4RGUA 1BR4A 2WA0A 5FLXK 2JK3A 5HODA 2YRFA 2R7DA 2VXZA 4I02A 3M7GA 1YO5C 2EPKX 4N6HA 1JUMA 2LD6A 1U3EM 1D0YA 5FLXZ 3KYLA 1T0FC 2GOXB 3EGDA 1ORYA 1OW7A 2XHKA 4IOCF 3FISA 2WTEA 3GUDA 4PUSA 1IDZA 5FROA 1TWGJ 1R5ID 2H6BA 4IQJA 2FA5A 4KT6A 3WTWC 1TWCA 2NVTJ 4GGGA 3M4BA 1H9TA 5LFAA 2H94A 1SFKA 4WK8F 2EFNA 2AU5A 4YG2F 3ML6A 5HDGA 1ZU5A 1QVUA 2J0WA 4YK5A 2HOSA 4M3BA 2FAPB 5CVRA 3DP7A 3DU6A 3GLXA 3H36A 2B7EA 2YEVA 4Z2YA 4BXUA 3HOZJ 5K5QA 3G4XA 3MMYB 3MKWB 3RKWA 4NB5A 1LE8A 3GWZA 1W5CC 5L0IA 3OYGA 5F1JA 4L6RA 1QO0D 4ZYAA 5L3BA 1MGTA 4UHTA 1IW7F 1SD4A 3KP6A 3RSNA 2PMZA 2BXYA 5AIPA 5FKNA 1VTMP 3X1OA 3B9QA 2A5WA 5GAGJ 1KQ0A 1TNTA 3O8HA 2DJNA 3E5QA 1KONA 1G8XA 4AYBA 4Q7CA 2K02A 3U3FA 1MDMB 4A3JJ 4N6CA 4FTHA 1KNYA 1AA7A 3A11A 3Q3SA 5DS9A 1DP7P 1O7FA 3VWBA 3QAHA 5FB2A 3LSTA 4YIFA 1R22A 4II3A 5GTHC 1Z6AA 1Z1DA 3KYIA 4QIWN 5JS5A 2E35A 2R5ZB 5K0IA 4IHYA 2RQQA 3HKKA 2V1XA 4BHBA 4B3XA 4PGGA 1QA6A 2DBBA 1OXKA 1IN6A 2D1VA 1IO2A 1XGOA 2BYVE 2GWRA 4CCOA 5E33A 3K33A 3T6BA 4ESFA 2Q0OA 4AUXA 3C8ZA 3L7WA 4GQHA 3LMMA 4DZPA 1YG2A 5D5WB 3G73A 1LVAA 4YEJA 1FFTC 1ZRDA 1Y0NA 3JCUQ 2LTPA 1ZW3A 1JTXA 3W2WA 4A0YA 3KPHA 2XSDC 1YZCA 3GTLJ 3M15A 3HOSA 3ASOH 3RQEA 4BJTA 1D8JA 4BJ6A 1YA7O 3B6CA 2DMNA 2Y3HA 5E1XA 1F1ZA 2XM4A 1ITYA 3SXKA 3CMAI 4P6IC 1RMVA 1Y56A 2M4KA 3MCZA 4E7HA 3CCJI 4JE9A 3DE8A 3G50A 2UV1A 4PJLA 4EBKA 3KZYA 1I5ZA 2E60A 3E6CC 4AX2A 2XF6A 2KC3A 2EPFA 3JRIA 4G0HA 4IGGA 2YU3A 4AVZA 4QSHA 5D6FA 3V7RA 3BQZA 1JHFA 4KBLA 4H54A 2XLHA 2W84A 1OCTC 5DVWA 3U5SA 3OIPA 3LESA 2K3PA 2YQYA 5TJ5E 1YE9A 5CJ9A 1TC3C 3S1MJ 5ED4A 5BMZA 3VYUB 1KA8A 5EG0B 3NG1A 3BJOA 2DQLA 2X1CA 1K40A 1TQGA 3TW6A 5L3EA 2HV7A 1GV5A 3FXMA 4S04A 4EVIA 2IXMA 1U78A 1EV7A 2DA5A 1GT0C 2VBZA 4CHUA 2XF7A 2L01A 2BE5F 1WATA 2PQ8A 2L6GA 3U8PA 5JT4A 1FR0A 2QGUA 1I50J 3FMRA 1WPKA 4M6XA 2HV6A 2R03A 2AO9A 3RYLA 5BQTA 3U9MA 1R1UA 2BV6A 1DPRA 2CNWD 2JSPA 4L9NA 5BPIA 1Z9CA 2ZXHA 1OYIA 2JMWA 1IRZA 1JRAA 4LDQA 3GLLA 3H9JA 3ZR8X 3HXLA 5DQZA 2LY1A 5EGYA 4CUGA 5JRAA 2LFDA 4MO7A 1QLEC 3G4ZA 3I71A 1FSEA 1F43A 4F91B 1MH3A 4Y52J 4JC7A 3IC7A 1DUXC 1BBYA 5KYUB 1CF7A 1Q1VA 3ESWB 3KLOA 3J81K 1D5VA 4IL6C 3SZTA 4BQQA 1YTYA 2B9SA 4EJVA 1ZGWA 5BS6A 2Q9CA 4L5JA 4DYQA 3ELKA 1Y4CA 2JA6J 2YX4A 3J81Z 5HLIA 4KYWA 4IJAA 2XDVA 2WB7A 3UGOA 4PACA 2MBFA 4M3EA 1VF9A 4I0AA 2WV1A 3OL3A 4HSTA 1AEPA 2WAEA 1WJ5A 3OEOA 2RN7A 3GTOJ 2J5PA 4D5CA 4UUSB 1NFOA 2E19A 2R4GA 3QPLA 1SC7A 5HLGA 4A12A 1YJGA 3SEZA 2D5RB 3MYIA 1MQVA 1FMWA 4GCVA 4JTCB 3L9FA 4FHTA 1BIAA 4DNCA 2A6HF 2KZGA 1HF0A 5CLSA 4U5DE 4LK0F 1ZHYA 2ESHA 4JEAA 1FYLA 5J3LA 4JZAA 1EH7A 2L9VA 2L2OA 2HPIA 3ABUA 1V5GA 2CJJA 3LFUA 2XS8A 3K7AJ 4N06A 3E6MA 2D2WA 2VJIA 2VLAA 1OR2A 4XK4A 4F4BA 2VE9A 3CD6I 2Y0SA 3R0AA 3TDZC 2M64A 4IRUA 5ICCA 5E8GA 3KKBA 4CSWA 1WZ2A 5J6XA 4FESA 2QWWA 1XMKA 2JWTA 3GODA 4C3BA 4EJUA 2Y3DA 3S28A 5BQHA 2M7BA 1MNEA 1W36D 1MBHA 2L9SA 4O3MA 2A61A 2HMQA 5EEGA 1HOMA 1POGA 2L0KA 1X3ZB 3V8JA 1WRJA 4RAFA 1GM5A 3JRTA 1G3WA 2DXIA 5DS5A 3DXJF 3PJRA 1C03A 3K2ZA 1X4OA 2VE8A 1YAUO 4RBNA 3M9AA 5KK1A 1NK3P 2A69F 2XPVA 3Q0VA 2NAZA 2ZPAA 1QSPA 3BG5A 2X6WA 3EH2A 5KYWA 5LLQA 4D1QA 5CIVA 1G6NA 4Z9IA 2WY7Q 1EA3A 3S16J 3BTJA 2A05A 2PMZN 3TEDA 3V4GA 4LDRA 3QQAA 1KYZA 2FEZA 2HYFA 2ZMEC 2EB7A 1Z67A 3GFLA 2N8GA 4AYBN 5LEJA 2AXTC 1WFXA 4BE0A 4XPYA 4YT5A 1FLIA 4O5VA 1VTNC 1JMWA 3LA2A 4ESBA 1OCCC 3Q9SA 1YW7A 1IRXA 4NUBA 3U3BA 1BJAA 1NFNA 2OA4A 2X1EA 4BJ5C 4NY3A 4UVAA 3E1SA 5LEKA 1OPCA 1XC5A 3TD7A 1ONVA 2DQRA 1I3AA 3TL4X 1T9KA 1NG7A 4XICA 3DLLF 2RNGA 2EZLA 5LGNA 3FBNB 3BG9A 2DOEA 4AC0A 3ZN0A 5DCMB 4DQ2A 2HQNA 2P5LC 3WU1B 5KAFC 3ZTMA 2DMQA 2WADA 1W1WE 2RDPA 5BNGA 2R7UA 2EZIA 3AG3C 4P55A 1MKMA 1OCCH 1RRJA 3V7OA 5HV9A 2YL7A 4XRSG 3H2UA 1FJLA 1NSGB 1R6RA 1XD7A 3M1CA 2UZKA 2OAZA 2K85A 3CSKA 3TOMA 3ZMVA 4W8KA 3V7SA 2NVQJ 2KSFA 1FC3A 1D0XA 3ROUA 4HF0A 5JR3A 3VODA 1BM9A 1LUJB 1T33A 2WAFA 3OIOA 3OWTA 3QWLA 4WF2A 3U21A 3VM6A 4XOPA 4CO8A 2MH2A 4A3KJ 1TWAA 1T6IA 2VT3A 1HCRA 3KP4A 1H6GA 2G9WA 2KGOA 4Q4ZF 3BG6A 2RQPA 4C3HJ 5GAHJ 3SZPA 1J0RA 2DDAA 3W3CA 1XZPA 2G62A 2XPWA 3CUOA 1VYIA 4BNCA 3CCQI 5CQGA 5E17F 4FCYA 4CCNA 5ICEA 3B0VC 3VFZA 2F4IA 1Y8QB 2K9NA 3FXJA 2CUZA 5BQGA 4KN4X 1A04A 1HSJA 4RLQA 2K27A 4BE1A 3SHFA 3I4MJ 1JJ6C 2PX9A 3BDDA 4R79A 3BROA 3NARA 2FBHA 1YFHA 3B71A 1X1CA 2XS1A 3B6AA 4PSWA 1Q0FA 1T01A 2R7XA 4C9YA 5E3NA 4A2UA 4CS8A 1SD7A 3B02A 1YW8A 1GGQA 4ZC3A 1NHAA 2B0LA 5E3CA 5L3CA 2LQGA 2G7UA 2K9SA 3JCUC 3D5SC 3I3LA 1QVXA 4EM0B 3GEZA 3QVZA 1UCRA 2OUMA 4CDYA 2NS7A 3O10A 2AHQA 4Y17A 1DDNA 3EFOB 2P6TA 3DLAA 1OKKA 2JRTA 3J7AY 2HJMA 3CCEI 4A3BJ 4C2TA 4ZTJA 3L1PA 1YS7A 2LK4A 2BVLA 3J06A 4CCMA 1GDTA 1K6OA 2K3FA 5H6QA 2DFIA 4BQOA 2PJRB 1O4XA 3OYAA 3DPTA 2R5ZA 1QPUA 1ZYRF 5EYRA 1WN0A 4AK9A 2R7ZJ 2CSOA 1DPUA 2KP6A 1K7AA 1EKYA 1VQ9I 4WWCA 1O3UA 4KJZA 3BEHA 4JK1X 1O7LA 4QWQA 1LQ1A 3JTHA 3REOA 4MFEA 4ON0A 3Q6MA 2Y0MA 3WTSC 1TLHB 1A7DA 5IY5C 5LHHA 3DWLE 2XL6A 2DA7A 1XSDA 2W1OA 3O2PE 4YFNF 1ZH5A 3E5XA 2AP3A 2A0BA 2W9YA 5CVUA 2Y0SN 2GWWA 3GEHA 3BR2A 3GMEA 4E7LA 4HX7A 1WI3A 4G6DA 2M3AA 4Z6YA 3CEXA 4XOTA 1G3TA 1Z23A 5GP9A 2XASA 4YIRX 3DCFA 3R6SA 1XMAA 3A2KA 1QBJA 4G6TB 1LI5A 4PJMA 2ZMEB 3RDIA 2KNHA 2I5UA 1PUFB 2ID6A 3QPHA 3QODA 2QF7A 3K1IA 1U0BB 4S05A 4A6EA 4BU2A 3GM2A 4PFPA 1P4WA 5KCMA 2IS4A 2BEOA 1W7PD 3OYKA 1ZHFA 2DJIA 1NLXA 1FT9A 3IL2A 1P4XA 4IQ4A 1XTAA 2WVNA 2MGQA 3S90A 2YSRA 3OYCA 2VPRA 2GOMA 3BT9A 4RDUA 2J8WA 4AL0A 2VQCA 4IHXA 1GV2A 2GXBA 2Q9BA 3RQIA 4IJJA 3BG7A 1DGWY 2XAFA 1ZK8A 4RGSA 3W2VA 4FWVA 2FE3A 4J32B 4AIJA 3P9KA 4Y7NJ 1BR2A 1D1CA 1TW2A 2LC2A 2DPDA 1GHCA 3N2ZB 3CAXA 1TFOB 5F28E 1OFCX 2M1BA 3Q5FA 4RDAA 1SFUA 3CCRI 3OOPA 2EIKC 2OQRA 2RC4A 1HC8A 3IKVA 2Z16A 2IXOA 2VODA 4CCKA 1MMSA 5F08A 1Q0DA 4BACA 1Z5ZA 3DF8A 3F8FA 4IAOA 5HLTA 4MEYF 1E3PA 3S3NA 1OYWA 3HZJA 3MQ0A 4XL9A 1HKTA 2LSEA 2VKVA 5IP7J 1YOVB 4AIDA 2GXGA 1UJ8A 3WGHA 4A4AA 4C3IJ 4PZJA 1S8NA 3GEIA 4JTAB 2XXAA 1TBXA 4NQWA 1T0FA 2MSYA 4UUSA 1R7JA 3T8RA 2OCCC 3AG4H 1V54C 2VONA 1SVOA 1KQ9A 1V55H 3CMYA 5BPDA 3M79A 3GWLA 1M57C 2EIKH 2GXAA 4CCLA 3LFKA 5DLJA 3OYFA 4HDUA 3FX3A 4MTFA 4UUVA 2H7OA 4U5BE 1EH8A 1OCOC 1SR2A 3BWGA 2LREA 5IOYA 2HS5A 2KRCA 2IA0A 1ULYA 1J2XA 1Z3XA 2ELHA 2EILC 2NS0A 3HUGB 2M5WA 4BY7J 4QPOA 2HFHA 1EJ9A 2A07F 1U9OA 1SMTA 2WC2A 3PFIA 2EK5A 4J00A 1REPC 2VOPA 1FSHA 1RESA 3NMJA 4KMUX 2L6HA 3RPUD 3FMQA 4LLCA 2F2EA 4I09A 4TV7A 3DQVC 4RB1A 3DU5A 4ZYEA 5EF6A 3S1NJ 2J9UA 2F4MB 3LJBA 3CC7I 3A4CA 1HSTA 4EV0A 2R7VA 3W2AA 2QYOA 2LLKA 2HXIA 3T6GB 1MJAA 3SDBA 1T2KA 2IXPA 3FXRA 3K4KA 4UUTA 3ZQLA 3OYJA 1B8IB 2LCHA 2P0WA 3OR2C 2ZNYA 3HDDA 1OCRH 2M8EA 1JT0A 4L18B 3PFYA 3VPRA 5IP9J 1PV3A 1HA8A 1LEAA 1U2WA 4GYGA 4Q48A 3O6XA 1WJDA 1IN8A 1Y6DA 5T1DB 1J7KA 5L0GA 4XMYA 4XLFA 4ZZDA 4J01A 3RYPA 1G2HA 2E1MC 2E5NA 3WG7H 1FBQA 2XLOA 1I1GA 3ZQYA 5EDNA 4ULVA 2H8WA 3IRQA 2K5CA 3RJPA 2R5YB 2MA3A 1IF1A 1ZREA 3ITFA 4JX6A 2Y30A 4KFCA 3GO5A 2HJ3A 4JCZA 3MN2A 1TWHJ 2AVKA 1QZYA 4BY1J 1WQ2A 2LKSA 2DTRA 5FGMA 3K4CA 5FO5A 5DM7F 2LIGA 4BG0A 3U1KA 4KUMA 1K04A 1QPIA 3W8IA 4XKWA 3U2LA 1Z7Qc 3L2UA 4BPMA 1EQ1A 4A3CJ 3FDYA 3KFWX 1OR7C 1HDDC 4LLLA 2M34A 1AKHB 1VLSA 4I3MA 3RKYA 3ZG1A 4OMZA 4A3IJ 2CW0F 2QQ9A 1FP2A 4XLPF 2KT0A 4P9UA 4UB6C 4HFFB 4RM3A 4MNUA 2V9KA 5D5XB 4U0YA 4HF2A 4KI2A 4FQGA 2L4MA 4JIOA 3S2DJ 2QUPA 4CICA 2GAUA 2Z15A 2EV0A 1CGOA 1ZHZA 3AGUA 3PMRA 2ASRA 4Z9HA 3TULA 1ZARA 2J9WA 3HOWJ 1IC8A 3BY6A 1UMQA 1KU3A 3MWMA 3K4MA 5GADJ 3BLYA 4MW3A 5DM6F 4JVSA 2XC7A 5EJCA 3FOOA 2FBIA 1N25A 1KGSA 4DYCA 2MFZA 2EPLX 3GTJJ 3SFIA 4EGYA 4DJAA 3MBGA 1X1PA 5JLWA 2DO7A 4B47A 3CQZA 1BIBA 1FBUA 5E3MA 2JA7J 1V3FA 4NC7A 2JSCA 1FZPB 3S3MA 1TNSA 1CPRA 1M1EB 1NG6A 1RR8C 1ORSC 4H4KC 4LITA 5F0HA 2EFQA 1A5JA 2CDQA 1OXBA 1JUSA 2XAHA 5F1RA 2HXOA 2UXXA 1K05A 2OTJI 4ZLCA 2BHYA 3OYEA 1I27A 4I1MA 4IRIA 2XM0A 4XTKA 5AONA 4ZLDA 3HNKA 2DT6A 1QPMA 3FXHA 3HTSB 1X4PA 2DI3A 3PSIA 5TRDA 4EJTA 3D5LA 4IAQA 2P4WA 4EM2A 1M2VB 1KYWA 2CMPA 3N24A 4UVCA 3H5AA 3KZIC 2OTLI 2NNNA 3OL4A 3B0PA 3G1OA 3TMOA 4ESJA 1ZG5A 3OA1A 2V1NA 1ZELA 3KEQA 2FNPA 4JYKA 2VN2A 2OJED 3COAC 1D3YA 1OR3A 5AC5A 5JFRA 1X2NA 2ZXWH 1YZAA 2KQ9A 3BG3A 3DI5A 2DFFA 5DS6A 3GCMA 4CX9A 3GTQJ 1SEUA 2PJRA 3DAFA 2XF5A 4C7OB 5HS9A 1DOVA 4XWJA 1B4AA 1T6UA 5F0FA 1WJAA 1T95A 1UZCA 1XSXA 1U5TA 3PNVA 4O7GA 1T6SA 1XWJA 1YQAA 2EIMH 2WVOA 2FOKA 4RBOA 1V4AA 2XAQA 2WAQA 1YJ9I 4CSAC 1VQKI 4PJNA 4CS9C 1PJRA 3JSEO 3QYFA 4HX4A 3VSLA 4ABZA 2KJBA
chains in the Genus database with same CATH topology
2IXSA 3H0DA 3ABMC 1VZ0A 3SEQA 4A2NB 2XRHA 2XDVA 2WB7A 4OD4A 3UGOA 1Z63A 3F46A 3OL3A 4HSTA 2IYLD 4YJWA 2WAEA 1WJ5A 3OEOA 2WB1A 3C2HA 2H7BA 5E3AA 2VPLA 2D5RB 2R4GA 3KH2A 2VJ5A 2X51A 2ZSHB 3SEZA 3VYRB 1FMWA 3NRHA 2M7AA 1D1BA 1DQUA 4PFOA 1TWGA 3SNHA 2A6HF 4U5DE 2K9MA 1NG1A 1ZHYA 3CJRB 4JZAA 1MNDA 4G7ZF 1D0ZA 3K1HA 1X1AA 3LLKA 3OS1A 4G7HF 2HPIA 2L2OA 3LFUA 2HVQA 1V5GA 1JI8A 2XSEA 5HNHA 4N06A 5KYNA 2E1MB 3JYHA 2F6CA 2Q2EB 2VJIA 2VLAA 4F4BA 4U5GA 4B43A 2R7QA 2Y0SA 3ECSA 3BCBA 3Q7LA 1QHHD 4XR6A 4E7JA 2IS1A 3TBIA 4IRUA 2L7KA 3KKBA 2CH0A 4CSWA 2O9XA 4ANJA 2ZXIA 2KL4A 3OYNA 4FESA 4O6YA 4Q5SF 3O39A 3OS2A 3GODA 2G3KA 3W8HA 3DPUA 2Y3DA 3S28A 1TWHA 4C3BA 2M4EA 4DVYP 2M7BA 1MNEA 4U7BA 2L9SA 1W36D 3KMIA 2Z2SB 4BL0B 3UMKA 4F52A 2W45A 3ASOC 2JA2A 3FBIB 3JRTA 3OOUA 2M0MA 2DXIA 4U5FE 3UMIA 5DS5A 3PJRA 3DXJF 4RBNA 1X4OA 1SZIA 4XKBA 4IWBA 3JSZA 3VDXA 2WZGA 3QYBA 2A69F 2ZPAA 2IGOA 2YZSA 3EGDB 2AQEA 4P1WA 2B0JA 2X6WA 3EGXB 2VQHA 3EH2A 1LKXA 4JJGA 5KYWA 4D1QA 3A1YA 3LS1A 2WY7Q 1EA3A 2X6XA 3AG2C 2R7TA 3DZAA 1SF8A 2DCEA 3K4NA 3HG9A 4LLEA 2PX3A 3LAYA 3AKZA 1OKKD 4BE0A 4QI0A 1WFXA 4YT5A 3OMYA 4FASD 3MKYB 4BEJA 3LEVA 4ULWA 2IS6A 1LDKB 1OCCC 1LS1A 1IRXA 4NUBA 4IKFA 1M56C 4BGDA 4B48A 4F55A 1RJ9A 2X1EA 4C30A 4BDYA 2VB6A 1VYKA 2KZVA 4BJ5C 1E0EA 4NY3A 3E1SA 4CCJA 2LBFA 3CJQB 3TD7A 5L3VA 4C7OB 3MLGA 4IZZA 4HRIA 3EZIA 3IAM2 3TL4X 5CKTA 5JHFA 3S8PA 1GLNA 3L2VA 1NG7A 1PD0A 4BJ1A 2RNGA 5DQTA 2R7RA 3RKOF 2MABA 3PHF2 3FBNB 3DKXA 2HNHA 1FMVA 1V5FA 1MW7A 1Z21A 2DT7B 2LH9A 3HL2A 1V5EA 4E7IA 2IS2A 2ZXWC 3ZVRA 2H7VC 2CS3A 5BUOA 5D91A 2G3VA 2W82A 2VXDA 2X1DA 3H65A 1YX3A 2XAUA 2V4JC 2IXNA 2WADA 1ZHXA 4RLFA 3UNGC 3SZGA 2R7UA 3CESA 3W8IA 2PFDA 2NOJB 2IGNA 2W00A 3IP4B 4U87A 2Z1DA 2QTVA 3AG3C 4KNVA 5KYXA 2K9LA 4II2A 3HOTA 2R7SA 3V7OA 4B6IA 4ZDLA 5LD2C 2P7VA 1R6RA 1X1DA 4KITB 3DEEA 3M1CA 2Y39A 5B3SC 5KYWB 3CSKA 4O79A 2EIMC 4W8KA 2VKDA 3I5PA 1TR2A 1D0XA 2O5RA 3SEOA 2WZFA 3EG9B 2WAFA 3U21A 3EFOA 3OWTA 3K1IC 4CH7A 2BVMA 2KLOA 3ABKC 4XOPA 2MYSA 3LSHA 4HNTA 1TWAA 2CV0A 5DS4A 2A6TA 3HKZA 4XQFA 2KGOA 3FDQA 3HPGA 4Q4ZF 3BG6A 1N77A 1N1CA 1O5HA 2FFHA 3JT1A 4XLCA 4OD5A 3DTKA 4GRIA 3S32A 3DTEA 4NNJA 3HJCA 3W3CA 2LBFB 3VSKA 2A1DD 2G62A 3AG1C 3G2BA 3QYEA 4HSRA 3OY9A 3K6BA 1VYIA 4MQ9F 2R7OA 2KHMA 3K4JA 5CQGA 3K4BA 4CCNA 4OAZA 4E4HA 4JW1A 4XNFA 3B0VC 1X1BA 2F4IA 4JQFA 4M63A 4D9JA 2CUZA 2KDOA 3OYBA 2VIXA 2UWMA 4RLQA 3FHNA 2FUG2 2VKHA 3DM9B 4XKVA 4BE1A 4PK4A 2HU9A 1N78A 3K10A 3M8JA 1ST6A 4R79A 2NUTA 3GANA 3EZHA 3PL8A 3PUBA 5KNLA 2A68F 3CP2A 1BR1A 3DKYA 1X1CA 3AFHA 3AQCA 3KEYA 5CI8A 2VASA 4PSWA 2HQAA 2QKMB 2R7XA 4C9YA 4IX7A 4DIQA 3ZIBA 4CS8A 3MX3A 5KYXB 2L9NA 3E9VA 4ZC3A 5E3CA 3T4RA 4CIHA 3M1CB 3B0UX 1U0JA 3D5SC 3I3LA 4JCHA 5B1BC 3POVA 4YRVA 1KU2A 1WJBA 2OUMA 2FGYA 3ZCOA 3EUHC 2W7NA 3EFOB 4OIQF 3DLAA 1OKKA 2IGMA 1P9QC 3J7AY 3E70C 3RCOA 4C2TA 3OYHA 4ZTJA 1O87A 4LERA 3SP1A 1NZEA 2BVLA 5HVQC 4CCMA 2NUPB 2GFHA 4ZTFA 4KISA 1YX5A 4CS7A 2BW3A 2PJRB 4BQOA 3AL0C 4HE8D 1VK5A 4CA0A 2L9JA 3H5RA 3I9V2 3DPTA 3OYAA 3L2RA 2ELJA 1ZYRF 4BJ5A 4EWCA 4DOZA 4AK9A 4C3DA 2P6VA 4DBQA 2E87A 3NYJA 3CF2A 4ZJZA 3H9QA 3GBGA 4E7SA 2KP6A 5HNFA 4N4OB 1BOBA 2Y69C 3AQBA 3T6JA 2CUJA 2CW7A 2OV7A 4KJZA 4RD9A 3K66A 4KC9A 2HZDA 3DTIA 2VH3A 3H9GA 2X6YA 3NWSA 4BDZA 3Q6MA 5TGTA 4LG3A 3E0JB 3OS0A 4CS8C 5IY5C 1J09A 1J8MF 1J8YF 5KYYA 3DWLE 4DVZA 2W1OA 2WY8Q 2KJGA 2W9YA 2ZSIB 4AE4A 4OWRB 4E7LA 4FETA 3ZGKA 4E6KG 3ZSUA 2QKLB 2M3AA 3LSMA 2J7PD 4XN0A 1WJCA 1JPJA 4XOTA 1TKNA 3F47A 4E7KA 3RQ4A 1Z23A 4U5CE 3SYNA 4PSXA 4K0DA 4BEHA 3A2KA 3EHMA 2R7WA 3UR3C 4G6TB 4PJMA 4PJJA 4ZDPA 4BS9A 2KNHA 2KW3C 3WODF 2CFOA 4JOMA 2W4BA 1FFHA 3K4LA 3QODA 1WJEA 1QHGA 1M2OA 4BU2A 2LYCA 4RM2A 2C04A 4PFPA 2KRHA 3PNYA 5KCMA 2UUZA 2IS4A 2JVGA 4BUPA 4AU7A 2WVQA 1X19A 2CNWA 3OYKA 1FTSA 4YN0B 1G59A 3ZRGA 4MNDA 2DJIA 3SZRA 2WVNA 4IQ4A 2IOQA 2J45A 2BOLA 4LACB 3OYCA 3H35A 4HNUA 2GOMA 2DYRC 1Z3YA 2VQCA 3OYMA 4HEAJ 3IAS2 2JD3A 1LVKA 2HDWA 4K7BA 4WJ0A 3VYWA 3NKDA 2Q9BA 4IJJA 2Q3TA 3BG7A 1DGWY 1S9HA 3W2VA 2L81A 3HLZA 4FWVA 2KPMA 4J32B 3OIQA 4LIVA 3EHNA 1BR2A 1D1CA 2LC2A 3N2ZB 2XSJC 5B1AC 2MC4A 2PP4A 3LS0A 3FVYA 1TZLA 4AE4B 2AQFA 1S7ZA 4RDAA 3CZ6A 3K6GA 3HPHA 2DOAA 2EIKC 2OC6A 4XLEA 2V6EA 2Z16A 2IXOA 4CCKA 4DGWB 4BACA 1Z5ZA 4BEHB 4ITVA 3LL7A 1UELB 5HLTA 4ZDOA 1NU7D 3DJNB 4IAOA 4YWQA 3LSIA 1DGRM 3S3NA 2LSEA 4XL9A 3OYDA 4QPQA 4YT2A 4XN3A 3UMHA 4HFKB 1VOMA 3FKJA 3VAYA 1Y6IA 3NDBB 2KMUA 3RFYA 2EINC 2VJ4A 3KX2A 4CBEA 3S0XA 4EBBA 1RJ9B 1Z3IX 4JURI 2XXAA 3MKZA 1ERDA 1ZHTA 1ZHWA 3C2GA 1JPNA 1WJFA 4CZCA 5FRNA 3D5RC 5FCLA 5F5HA 2OCCC 3K70D 4Y3OA 1V54C 3LNRA 2CW8A 2RREA 5KHDA 4Y33A 2C03A 1M57C 4XM3A 4F3QA 4NC8A 3Q7GA 1MMGA 2V7FA 1MMNA 4CCLA 4OIRF 3BCAA 3HC7A 3OYFA 2J0XA 5DLJA 3S93A 2I8BA 2A6EF 2H7OA 4O6MA 4HEA2 3EUKL 4U5BE 3K7DA 2QY9A 1OCOC 2LREA 2WBMA 1OLTA 5FRMA 2F5VA 2KRCA 3S27A 1Z3XA 2EILC 4XLHA 4Y4RA 2X85A 4P5OA 3HUGB 4KNWA 3IUOA 4QPOA 2JUGA 4J00A 3L2QA 4BE2A 5F5FA 4J30B 3L34A 5T3WA 4XONA 3QZCA 5CPRB 3RPUD 2IGKA 1MMDA 4LLCA 2ZFUA 1BR4A 2WA0A 3F9KA 2LG4A 1UAAA 4G7OF 3DQVC 4O6NA 3DJUB 3DU5A 4OAYA 2YHSA 2J9UA 3LJBA 2VXZA 3A4CA 3OR1C 3IEEA 5D92A 3RTRA 2R7VA 1DP3A 3W2AA 4OINF 2Y3BA 3PSFA 2EIJC 1D0YA 3SDBA 3KYLA 1T0FC 2GOXB 2IXPA 3K4KA 3EGDA 3EGXA 4GYTA 3OYJA 2XXAB 2P0WA 3OR2C 4PUSA 4NQWB 2Q1ZB 5FROA 3ZXSA 3DD7A 3FHDA 4X0GA 3PFYA 3AL0B 1WGWA 3ASNC 1HA8A 4IQJA 4OIPF 3O6XA 4KT6A 3ZQQA 1WJDA 1TWCA 3N0TA 4QDLA 5LFAA 2ZXRA 3RH3A 5T1DB 1SFKA 5EHHA 4LIUA 1W36C 4XMYA 2LRDA 4XLFA 1SMYF 3DAGA 3I5QA 1ZU5A 2J0WA 4J01A 2E1MC 2E5NA 4X0RA 3EH1A 2NUTB 2MWQA 3DU6A 2YEVA 5HSWA 3DM5A 3ABLC 3MMYB 2K5CA 3MKWB 2PF4E 3ITFA 3OYGA 3EUAA 4XKCA 2CGEA 3S3OA 4ZYAA 1IW7F 4RMNA 3RSNA 2PMZA 2Q9AA 3X1OA 3B9QA 2I8DA 5HOOA 2A5WA 3K4CA 3NKEA 2PX0A 3EPVA 2L5QA 3L2WA 3CP8A 4FX5A 2JVHA 2WZLA 3QMKA 1IZMA 4KBLA 4BG0A 1KONA 1N75A 4XKWA 2CV1A 1G8XA 4AYBA 5CQEA 3OYIA 3L2UA 3KL4A 4Q7CA 3DMDA 3BC8A 4XORA 1AA7A 3FDYA 3NYLA 2J46A 3VWBA 2XL4A 1OR7C 4I1OB 1VMAA 4F93B 3LSGA 3EQLF 3I4UA 4I3MA 3S29A 3ZG1A 2M4GA 4II3A 3DPLC 4DBRA 1Z6AA 2BW3B 1D1AA 2CW0F 4E7ZA 3V42A 2DGJA 4OIOF 2RQQA 1M2VA 1PCXA 4XLPF 3NWTA 4HFFB 4EATA 4RM3A 2HVRA 4YT4A 2V9KA 4B3XA 4KI2A 3EG9A 5E2QA 2W4MA 4CCOA 3ONQA 1NU9C 1UG0A 5E33A 1W2WA 4XLAA 3K33A 3T6BA 2Z15A 3VYTB 3PMRA 4U5EE 3LSKA 3LMMA 1ZHZA 3EJNA 3OYLA 3RIPA 4YEJA 1FFTC 2J9WA 4QI2A 3JCUQ 3K4MA 1MMAA 2Y3GA 3W2WA 1K6YA 3BLYA 2OG2A 3L0IA 5KYYB 4JVSA 5L3QA 2LOOA 4MLOA 2XC7A 3HOSA 4BJTA 2DYSC 4C7OA 3AG4C 2MFZA 4BJ6A 1V55C 2Y3HA 2V26A 3N05A 4DJAA 4P6IC 1Y56A 3UGPA 2M4KA 4HG2A 3CQZA 4B47A 4E7HA 2HVSA 2WL8A 5KYUA 4B44A 2CV2A 3HTKC 4NC7A 4U5HA 2UV1A 4PJLA 3S3MA 4F92B 1NG6A 2W4SA 2LY2A 4H4KC 4LITA 2E60A 5T3TA 2CDQA 2VQLA 4AX2A 2VL8A 2XF6A 4G0HA 4C2UA 4GEHA 4YELA 4CSAA 3NYMA 4BQNA 4AVZA 4CS9A 4ZLCA 3MD2A 3OYEA 3CMMA 4BXFA 4I1MA 4HPQA 1ZU4A 4ZLDA 1QU3A 4XTKA 2DT6A 3LLIA 5DVWA 1X4PA 3OIPA 2K3PA 1Z7LA 3PSIA 3LESA 1YE9A 2MD0A 3D5LA 3X2QC 3K70C 3H5NA 3VYUB 3NG1A 1OCZC 1M2VB 2X1CA 1PYVA 2CMPA 4YT8A 3N24A 3H5AA 2HV7A 2KQRA 3OL4A 2IXMA 3B0PA 3TMOA 3OA1A 2ZXPA 2V1NA 1ZELA 2VJJA 2XF7A 2HPMA 2BE5F 4N4NB 3RYLA 2HV6A 3FAJA 2KQ9A 2NUPA 5DS6A 2CNWD 2JSPA 3EPZA 4BJ6C 1OCRC 2ZXHA 2PJRA 3DAFA 5CI9A 2XF5A 4C3EA 3H9JA 2ZXOA 4I44A 3ZR8X 3HXLA 2NG1A 4XWJA 1SAUA 5DQZA 1TT0A 2E5ZA 1WJAA 2LY1A 1T95A 1PD1A 4XLNF 4CUGA 5EGYA 3PNVA 1QZXA 4O7GA 1LFPA 3ZC4A 2VQGA 1QLEC 2V3CC 2J7PA 3PNTA 4F91B 5KYUB 3Q6NA 3SYTA 2WVOA 4BQQA 4JJFA 3WG7C 4CSAC 3QOEA 2WAQA 4PJNA 2Q9CA 4CS9C 1PJRA 2J9VA 3QYFA 3VSLA 3VYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJ5 C;  3CZ6 A;  3K6G A;  3OWT A;  4BJ6 C;  4BJT A; 
#chains in the Genus database with same CATH topology
 3ZMD A;  3H0D A;  3TP3 A;  2XLV A;  1T8I A;  3QU3 A;  3GTP J;  3ABK H;  2VCC A;  2QSG X;  2XRH A;  3L8J A;  3M8F A;  1R49 A;  5IYB J;  1Z63 A;  4NC6 A;  3C2H A;  2AS5 F;  2EFP A;  3QU6 A;  2X51 A;  3VYR B;  1T56 A;  2ZCW A;  3DKW A;  5DYM A;  2ZKZ A;  3NRH A;  1D1B A;  1DQU A;  5A2Q Z;  4BHP A;  1ORK A;  3NRV A;  1O3R A;  3R60 A;  5C4X J;  2XRN A;  3IRR A;  2JQ7 A;  1NG1 A;  2R93 J;  1MND A;  1R00 A;  3HOX J;  3PCV A;  1A7E A;  1X1A A;  3LLK A;  3M4C A;  4G7H F;  4F7Z A;  2EWN A;  2E1M B;  2F6C A;  2Q2E B;  3W4Y A;  3TO9 A;  3BQY A;  3ZQC A;  4B43 A;  3IQ5 A;  2GLO A;  3WE3 A;  2EV5 A;  3Q7L A;  2E2I J;  1QHH D;  5D6E A;  4E7J A;  3C18 A;  1YLF A;  1Z6T A;  2OJQ A;  1OYY A;  4XRS A;  2ZXI A;  3OYN A;  4G78 A;  4Q5S F;  3R61 A;  3FAP B;  3CF5 F;  2G3K A;  3P9C A;  3QVY A;  3W8H A;  3K0L A;  4Q47 A;  1RET A;  3E5U A;  3KMI A;  5B1B H;  2HWV A;  4KMF A;  2W45 A;  1R9T J;  3ASO C;  2JA2 A;  1G3Y A;  1BC8 C;  4U5F E;  1B72 B;  3UMI A;  1YS6 A;  2LSO A;  5HDK A;  2PEX A;  1ETO A;  4XKB A;  3WHB A;  5E20 A;  3VDX A;  4EEF G;  1PVE A;  1MSF C;  1OIS A;  2YZS A;  2VQH A;  1W7P B;  5L0H A;  2L7M P;  2ZJ2 A;  5AIQ A;  2E2J J;  2X6X A;  2PLY A;  4M9S A;  1S29 A;  1SF8 A;  2G0E A;  3K4N A;  2HI3 A;  4M9X A;  3H2V A;  4LLE A;  4FX0 A;  4MIM A;  1VFC A;  3LAY A;  3F0C A;  4QI0 A;  1FTT A;  1ZLJ A;  3J80 K;  3R7C A;  3LSR A;  1I5N A;  3HYI A;  3LEV A;  3DBH B;  2IS6 A;  1S7A A;  2Z9O A;  2MH9 A;  1A31 A;  4KIG A;  4AD9 A;  3FOP A;  3RQF A;  1VYK A;  3J80 Z;  4C30 A;  2R02 A;  3TQO A;  3POV A;  1E0E A;  5B3I A;  4CCJ A;  2MLK A;  5IP6 A;  5L3V A;  4I01 A;  3CCS I;  1YIJ I;  4IZZ A;  4FE7 A;  3SDG A;  3HRM A;  3WTZ A;  2XRO A;  1VQ8 I;  4HF1 A;  1GLN A;  3ZMS A;  1KQ8 A;  1HKQ A;  3AAF A;  1YYV A;  3PHF 2;  3FXU A;  1AUE A;  3DKX A;  2JT1 A;  2DT7 B;  3FKI J;  4NHJ A;  2LH9 A;  3WAQ A;  3ZVR A;  3CDL A;  2ACJ A;  4HOB A;  5D91 A;  2G3V A;  4RB3 C;  5E3O A;  2VXD A;  4PGH A;  4D0P A;  3H65 A;  2LDU A;  3SZG A;  2FSW A;  4WCG A;  2H8R A;  3NEU A;  5FKK A;  1B59 A;  4RAY A;  2K4J A;  2PFD A;  3M4O J;  1VQP I;  5KYX A;  2K9L A;  4II2 A;  2CG4 A;  4HZF A;  3WGG A;  1A36 A;  1JE8 A;  4B6I A;  3CCY A;  1Z05 A;  2Y39 A;  3DEE A;  3TO7 A;  1A0B A;  2FF4 A;  1XZQ A;  4A69 C;  1TR2 A;  3ERM A;  2BL2 A;  5M5W J;  2O5R A;  3SEO A;  2A5Y B;  3KZZ A;  4AM3 A;  3EG9 B;  2L4A A;  4E17 A;  3MFN A;  4CH7 A;  1ENH A;  3ZMT A;  3IQ6 A;  3LSH A;  4HNT A;  2CV0 A;  4EJW A;  4IO9 F;  1D5Y A;  2WV0 A;  2AWY A;  2LNB A;  3GOR A;  3HPG A;  3HBL A;  4CDG A;  1N77 A;  1UFM A;  1W5S A;  4D7N A;  1M6T A;  2FFH A;  2LKP A;  4GRI A;  1RR7 A;  2YL3 A;  1XSV A;  1FTZ A;  2QUF A;  2LBF B;  2A1D D;  1IN7 A;  4IB4 A;  5CVI A;  4HSR A;  3OY9 A;  3TOB A;  2R7O A;  2KHM A;  4A3F J;  3K4B A;  1ETW A;  2D45 A;  4JQF A;  4M63 A;  1U6H A;  3FHN A;  2XKO A;  1VQ7 I;  3DM9 B;  4XKV A;  3DE9 A;  4PK4 A;  1MBF A;  4IHV A;  1ST6 A;  3A03 A;  5HDN A;  3EZH A;  4B3A A;  5KNL A;  2FX0 A;  5GPG B;  2A68 F;  1TQI A;  2Y9Z A;  2Q8K A;  2JA8 J;  2VC9 A;  3AQC A;  2IA1 A;  3KEY A;  5CI8 A;  2HQA A;  1CGM E;  4DIQ A;  1K78 B;  2G7H A;  2QBY B;  3K9T A;  4BKX A;  5GTI C;  2ZFW A;  2DAO A;  1SFX A;  2P7V B;  1U0J A;  1R4N B;  2M9H A;  3T1B A;  4YRV A;  3QRF F;  1KU2 A;  1WJB A;  4NDL A;  1XGN A;  5EGO A;  3CDH A;  2WAQ N;  3EUH C;  3FIW A;  5ERI A;  5H20 A;  2W7N A;  3HNL A;  4OIQ F;  4XSZ F;  2IGM A;  3RCO A;  2JPU A;  1O3Q A;  4LDK A;  1NZE A;  2MC3 A;  3JTG A;  1STZ A;  4UV8 A;  5HVQ C;  3QTH A;  4MEX F;  1IG7 A;  2P7C B;  4ZTF A;  4CS7 A;  1E3O C;  3AL0 C;  1R4M B;  4MTD A;  4CA0 A;  2YR2 A;  2BC5 A;  2HSQ A;  2ELJ A;  1TWC J;  4EWC A;  1VQ6 I;  4C3D A;  1MJ9 A;  1WSU A;  4ENN A;  2FQ4 A;  1U89 A;  2DA4 A;  3NYJ A;  4M71 A;  1GVD A;  1O3S A;  3CCV I;  5IYD J;  2Y69 C;  2ELK A;  3AQB A;  2CW7 A;  4RGX A;  2ADU A;  1K4T A;  4KC9 A;  1A6I A;  4C3J J;  2ZJP F;  4EHP A;  2W48 A;  1UHS A;  2PBI A;  4LG3 A;  2E71 A;  4CJG A;  1W0U A;  1HW2 A;  3A02 A;  2DT5 A;  4Y15 A;  3TJ5 A;  2WY8 Q;  4MW8 A;  2ME0 A;  4AE4 A;  2AXL A;  4FET A;  5A69 A;  1U8B A;  1V4R A;  1XDS A;  2HOA A;  2IBD A;  2ECB A;  4B1R A;  3ZSU A;  3LSM A;  5DD4 A;  5D5V B;  1E2X A;  5J4Y A;  1DU0 A;  1TKN A;  3F47 A;  2V79 A;  2H27 A;  3SYN A;  2IPQ X;  1ETX A;  2Z5U A;  2KIF A;  4IHW A;  3WG9 A;  2M8G X;  2R7W A;  2RD9 A;  4P9T A;  4ZDP A;  9ANT A;  3WOD F;  4JOM A;  2M2E A;  1IAW A;  1S3J A;  3K4L A;  2C6Y A;  1WJE A;  5JUA A;  2Y69 H;  2ME6 A;  4OU0 A;  1LPE A;  4DRJ B;  2F5E A;  4G6Q A;  4IEJ A;  2L7Z A;  2C04 A;  4W97 A;  1UB9 A;  3HRT A;  1VI0 A;  2DW4 A;  2H09 A;  2XGE A;  2H1K A;  3I58 A;  1FTS A;  1G3S A;  3ABL H;  1H88 C;  3C8G A;  2FNA A;  1LNW A;  5JHU A;  2L3D A;  1I4Z A;  1VQM I;  4A93 J;  1MSE C;  4P9F A;  4V2G A;  2GM4 A;  4QTR A;  4RB2 C;  1Z3Y A;  3JRA A;  4CYD A;  1LVK A;  3RKQ A;  3ISP A;  4WJ0 A;  2L7A A;  3WHC A;  3HLZ A;  1S9H A;  4B09 A;  3IWZ A;  3J7Z I;  2KPM A;  5COF A;  2Z3Y A;  1ETQ A;  1E83 A;  2O7O A;  4LIV A;  1S72 I;  3TKY A;  1X2M A;  3HOY J;  2O61 A;  2XSJ C;  1RXQ A;  5B1A C;  2KKO A;  1PP7 U;  2XLD A;  2AQF A;  3HJE A;  3CZ6 A;  3K6G A;  3LOC A;  3CCM I;  3N97 A;  1K79 A;  4XLE A;  1ZG1 A;  2V6E A;  5DEQ A;  5E8I A;  4DGW B;  2ID3 A;  3FK6 A;  4BEH B;  4ITV A;  3LL7 A;  5D5U B;  1YJN I;  3LSI A;  2XGX A;  3OYD A;  2HSB A;  4YT2 A;  2ETH A;  5K5R A;  4RS8 A;  1BDJ B;  3B73 A;  4ZYH A;  1VOM A;  3FKJ A;  2HDC A;  1EKE A;  1Y6I A;  3HOU J;  2KMU A;  3V5Y A;  2EIN C;  2VJ4 A;  4DJ9 A;  1RJ9 B;  3RYR A;  1Z3I X;  3PUF A;  1ERD A;  1ZHT A;  2EPO A;  5J1R A;  3WU2 C;  5FCL A;  4WXH A;  5B1A H;  5F5H A;  2I15 A;  4NBQ A;  3LNR A;  2GA1 A;  4MTG A;  3KP5 A;  1VND A;  1FNT c;  2VCA A;  1H7I A;  4XM3 A;  2FOW A;  4F3Q A;  4NC8 A;  3GF2 A;  4OIR F;  2V7F A;  1MMN A;  3Q7G A;  4WGZ A;  3DEU A;  1RKT A;  3HC7 A;  3TOL A;  2PI0 A;  1ZVZ A;  2I8B A;  2ZB9 A;  1BI0 A;  4XBF A;  1PUE E;  5EK0 A;  3NMI A;  2QA4 I;  5CYV A;  1YW9 A;  3ZQG A;  2WBM A;  5JVE A;  1R58 A;  1AWC A;  4AWX B;  2XUB A;  1P4A A;  2Y9Y A;  5IT3 A;  2LY9 A;  5J1Y A;  2V1U A;  4XLH A;  4Y4R A;  3JRD A;  3RKX A;  1YI2 I;  2EIN H;  3IUO A;  2XVC A;  3CCU I;  4EBJ A;  2Z99 A;  3BPX A;  1NBB A;  3GVA A;  4BE2 A;  1YRN B;  3MKL A;  3L34 A;  1T39 A;  1RUO A;  4J30 B;  3X2Q H;  2QQA A;  3LWF A;  3GZ5 A;  5CPR B;  3TDU C;  1OCZ H;  4NTF A;  2ZFU A;  3KET A;  4G7O F;  2IA2 A;  3ZTZ A;  1MDM A;  3DJU B;  4CGZ A;  1C0W A;  4OAY A;  2YHS A;  4HLX A;  3KYD B;  1P92 A;  3LNM B;  4H0E A;  3OR1 C;  4L5E A;  3IEE A;  1DP3 A;  1FOY A;  3QP6 A;  2EA4 A;  3S14 J;  1MZB A;  2XL8 A;  3PSF A;  2EIJ C;  2Y3B A;  2YL0 A;  3S9O A;  2MHR A;  3JRC A;  1OR7 A;  3TGN A;  5A6B D;  4HAM A;  2DMT A;  2BGC A;  1F5T A;  2BY0 A;  3ZXS A;  4X0G A;  3AL0 B;  3GZ6 A;  3ASN C;  4OIP F;  1MD0 A;  3HTU A;  3WTU C;  2NOG A;  3ZQQ A;  5ILU A;  2XAJ A;  2DDB A;  1AOY A;  3RH3 A;  4WXC A;  1W36 C;  3I5Q A;  1J59 A;  1U6G A;  3DAG A;  4LJZ F;  1SD6 A;  5EEA A;  3EH1 A;  4X0R A;  5D4S A;  2NUT B;  2MWQ A;  1ZR2 A;  4JRZ A;  5HSW A;  1MH4 A;  3VOE A;  3BR1 A;  1JKP C;  3K69 A;  2HKV A;  1QRY A;  3PIP F;  2PF4 E;  2F5F A;  3MZY A;  4L9T A;  2EIJ H;  3I5U A;  1JXS A;  3AOU A;  2P8T A;  3EUA A;  4XKC A;  2CGE A;  3S3O A;  4M3F A;  3DBR B;  1J9I A;  2Q9A A;  3NKE A;  1Z0X A;  3ASN H;  3EPV A;  2HFI A;  2L5Q A;  1S6L A;  2OZU A;  3CP8 A;  2JVH A;  3I4P A;  4ZH4 F;  3WTX C;  3L2W A;  1IZM A;  4FX5 A;  1N75 A;  2CV1 A;  2XIG A;  3OYI A;  3QPT A;  3KL4 A;  3L09 A;  2NYX A;  4MVM A;  4XOR A;  3NYL A;  1KTM A;  2J46 A;  1QQI A;  2XL4 A;  4F93 B;  3EQL F;  3LSG A;  5D4R A;  2JTV A;  1ZLK A;  3S29 A;  2M4G A;  3DPL C;  2W85 A;  1AU7 A;  1D1A A;  3LSJ A;  3PQK A;  4E7Z A;  2DGJ A;  5EG0 A;  4OIO F;  3U8V A;  2CGP A;  1PCX A;  5JP7 A;  1KZH A;  4EAT A;  5E79 C;  2HVR A;  4YT4 A;  4R8H A;  3NMK A;  3EG9 A;  5E2Q A;  2FMY A;  3ONQ A;  1UG0 A;  1NU9 C;  3GTK J;  1FPQ A;  4XLA A;  3AGT A;  3GWN A;  4NTA A;  4U5E E;  3LSK A;  3EJN A;  3RIP A;  5FKM A;  1WH5 A;  2IBF A;  3RQG A;  2M45 A;  1ZZP A;  1MMA A;  5L0F A;  1QGP A;  3K1M A;  1NK2 P;  3CDI A;  1K6Y A;  2ICW G;  1HW5 A;  1G4U S;  3GM3 A;  3ATP A;  3L0I A;  4MLO A;  5L3Q A;  5KYY B;  2DYS C;  4MHG A;  2DFH A;  3AG4 C;  4YL1 A;  5BOX A;  1EF4 A;  3JSP A;  2Q00 A;  1ZG3 A;  1LE8 B;  1V55 C;  2GA2 A;  1WKM A;  2V26 A;  1UHW A;  3WTY C;  3ZDL A;  4EGZ A;  1E17 A;  1ZQ3 P;  1T98 A;  1NH3 A;  1E85 A;  3G6E I;  2EPN A;  5F64 A;  5KYU A;  1WGX A;  2WL8 A;  4B44 A;  3HTK C;  2OEV A;  4U5H A;  5M5Y J;  1NTC A;  3HSF A;  3WE2 A;  5FZT A;  4GO1 A;  3HB9 A;  5T3T A;  4CSA A;  3NYM A;  5LRS A;  4CS9 A;  2FU4 A;  2R3S A;  4HPQ A;  1T38 A;  1QU3 A;  2JX0 A;  2CQ7 A;  4JX5 A;  1Z7L A;  1E3H A;  2QSF X;  2F22 A;  2MD0 A;  2DYS H;  3FK7 A;  4CZZ A;  3H5N A;  3LA7 A;  2EZK A;  1W5T A;  1G4W R;  1MIJ A;  3CUQ C;  1PYV A;  2PBE A;  4YT8 A;  3LQQ A;  3IH2 A;  4I98 B;  2KQR A;  2TRT A;  1DOW A;  2LVS A;  3S1Q J;  5GPC A;  1TWA J;  5COM A;  2HPM A;  4I76 A;  4NCQ A;  1TTY A;  3F22 A;  4N4N B;  5FLV A;  3FAJ A;  1FP1 D;  4BQA A;  2JN6 A;  4D4X A;  4ONS A;  3EPZ A;  1OCR C;  3QPS A;  4C3E A;  2ZXO A;  3HSR A;  3K2A A;  2NG1 A;  2IP2 A;  1B9M A;  1SAU A;  3WTV C;  1Y39 A;  2E5Z A;  1CQT A;  1PD1 A;  1EA8 A;  1QZX A;  1Z91 A;  5GAE J;  1LFP A;  2KRF A;  5HS8 A;  2VQG A;  3ZC4 A;  2O8K A;  3H0G J;  2V3C C;  2J7P A;  3PNT A;  1JHH A;  4S0H B;  4MTO A;  2V9V A;  3Q6N A;  3O3K A;  3SYT A;  1ZR4 A;  1JGS A;  3WG7 C;  4JJF A;  4AIH A;  3QOE A;  5FKL A;  1APL C;  5K7H A;  4LD5 A;  3LQR A;  2QZ8 A;  1E86 A;  3ZMZ A;  4I7H A;  2IXS A;  5KAI C;  3HOV J;  2L54 A;  4LOC A;  1XCB A;  1S5L C;  1MNM C;  1VZ0 A;  5HS7 A;  3SEQ A;  3V8K A;  2OKU A;  4WGY A;  3BRJ A;  4OD4 A;  3A0B C;  3F46 A;  1Z77 A;  2ISY A;  5ILS A;  2IYL D;  1JAF A;  2WB1 A;  2JA5 J;  2VPL A;  1D8K A;  3KH2 A;  2E1N A;  2ZSH B;  4A3D J;  2VBW A;  2M7A A;  1TWG A;  3AG1 H;  4PFO A;  2UXN A;  3T9O A;  3JR9 A;  3FZV A;  2K9M A;  1GXQ A;  2JPC A;  1TT5 B;  4L0Z B;  1D0Z A;  1USS A;  1IRG A;  2ZD9 A;  3OS1 A;  4BBR J;  1A41 A;  2XSE A;  2HVQ A;  2FD5 A;  3GFJ A;  1X58 A;  2QQB A;  3EYY A;  1FWZ A;  2CQK A;  4N9H A;  2FJ1 A;  2X6O A;  4DZJ A;  2XV4 S;  2XPU A;  3ECS A;  3H1C A;  3UKG A;  2HR3 A;  2H1L A;  2PFB A;  3TBI A;  2OF7 A;  2Z33 A;  3S15 J;  1YIO A;  4ANJ A;  1JGG A;  4BH9 A;  3M8E A;  2HOT A;  4O6Y A;  1R71 A;  3L8I A;  3OS2 A;  1ZRF A;  3TO6 A;  2XLW A;  4DVY P;  5DCM A;  4U7B A;  4J7Y A;  3RZD J;  2Z2S B;  2HEO A;  3OOU A;  4UDV A;  2V6C A;  2KJC A;  3TW7 A;  2DA6 A;  1ZGA A;  4IWB A;  4M72 A;  1S05 A;  3GZN B;  1VQN I;  5H2F C;  1B68 A;  2J5O A;  1YJW I;  3BOQ A;  1XS9 A;  3EGX B;  2RGV A;  4JJG A;  1OQC A;  2A3S A;  5F27 A;  3AG2 C;  4HQM A;  2XLE A;  1WH7 A;  4C2M J;  5J8F A;  2R7T A;  3A01 B;  1TQP A;  3DZA A;  4M73 A;  1RNL A;  4MTE A;  1A6Q A;  4A5M A;  2Q7R A;  3KYC B;  4MVU A;  3FMS A;  3HG9 A;  5FD5 A;  4A3L J;  2PX3 A;  2F5C A;  2Y48 A;  3AKZ A;  5COG A;  2KIU A;  3G1M A;  2P61 A;  5LHG A;  4YL0 A;  3OMY A;  4FAS D;  3MKY B;  4U88 A;  4ULW A;  5ICG A;  1LDK B;  1I6X A;  4K1O A;  1M56 C;  1FAP B;  3E6D A;  2DTZ A;  4BGD A;  1RJ9 A;  2O3F A;  4BDY A;  2KZV A;  5B5E C;  4NQF A;  2PMU A;  4XSX F;  3CJQ B;  3TP0 A;  3MLG A;  4LMY A;  4HRI A;  3L2V A;  2R92 J;  5CKT A;  4LGW A;  1P2F A;  2TMV P;  4ASN A;  4XRM A;  3RKO F;  2MAB A;  5DUI A;  3AG2 H;  1V5F A;  1Z21 A;  1MW7 A;  1BW5 A;  4RA2 A;  3VB2 A;  3HL2 A;  1FOW A;  4ZYG A;  3ZQI A;  2H7V C;  2ZXW C;  1WAS A;  2VCB A;  1JKO C;  2W82 A;  2X1D A;  1YX3 A;  2V4J C;  1BJZ A;  4FE4 A;  4RLF A;  3UNG C;  3VRC A;  2ZO4 A;  2NS8 A;  3FHZ A;  2W00 A;  2IGN A;  2F5D A;  2Z1D A;  2QTV A;  3HOT A;  3T0Y A;  2EPM X;  2BY2 A;  4YFK F;  4IRH A;  5JI6 A;  2NXN B;  1X1D A;  4KIT B;  5B3S C;  5KYW B;  2HTS A;  2RV8 A;  1MBE A;  1U9N A;  2BBY A;  1B6A A;  2NVY J;  3TQN A;  3G71 I;  1XGM A;  1ZRC A;  1GQA A;  2EIM C;  3I5P A;  3RW0 A;  4OOI A;  2WZF A;  4L0Y B;  2QEN A;  3CUQ B;  1G4D A;  3EFO A;  4KA4 A;  3K1I C;  1ETV A;  3EUH A;  3WU0 A;  2BVM A;  2KLO A;  3ABK C;  2YL1 A;  2HQ5 A;  1W0T A;  2VUM J;  2VC1 A;  2A6T A;  5DDG A;  1IJW C;  5ILV A;  1R36 A;  4UB8 C;  3I64 A;  2QEX I;  3L00 A;  1G5Z A;  1N1C A;  1O5H A;  2HGC A;  2BHZ A;  5JLI A;  2CYD A;  3S84 A;  3JT1 A;  3DTK A;  4WXD A;  1E84 A;  4NNJ A;  3HJC A;  1JKR C;  2R9R B;  3VSK A;  1OCP A;  2KIQ A;  3PIO F;  3QYE A;  3KEO A;  4MQ9 F;  2HZ8 A;  3K6B A;  3PO2 J;  3FXK A;  3K4J A;  2JZY A;  5B3S H;  5TIS C;  4HX8 A;  5FKO A;  4E4H A;  4JW1 A;  1TWF J;  4XNF A;  1X1B A;  3PO3 J;  5A6K A;  3OYB A;  4IPA A;  2D5V A;  2VIX A;  1X3W B;  2GZW A;  2X4H A;  5B66 C;  2VKH A;  2KYH A;  2VKE A;  1N78 A;  1HQC A;  3M8J A;  2NUT A;  4YFX F;  3GAN A;  1UFB A;  4CYC B;  3PL8 A;  1HDP A;  3H3Z A;  3PUB A;  4X1E A;  3DKY A;  3ZMU A;  3AFH A;  2VAS A;  2QKM B;  2O6G E;  3ZIB A;  2RVC A;  4IOA F;  1QZE A;  3E9V A;  2YLI A;  5A2Q K;  4A3M J;  2CUE A;  4MVZ A;  4CIH A;  1OJL A;  1OW6 A;  3M1C B;  4JCH A;  3F3X A;  3ZQ7 A;  3I4N J;  2TDX A;  4LG0 B;  1LE4 A;  5B1B C;  2V9P A;  2DN0 A;  1H0M A;  1I1S A;  4J7T A;  4U9E A;  5AGF A;  3MZ8 A;  2IW5 A;  3Q0W A;  2ZME A;  3C2B A;  3ZCO A;  2FGY A;  1PUF A;  3RVY A;  2DOF A;  3ECO A;  3SJM A;  1P9Q C;  3E70 C;  1L0O C;  5FLM J;  2XLM A;  4R32 A;  3SP1 A;  3ZPL A;  4LB6 B;  3N4M A;  3J7Y J;  2NUP B;  3MYF A;  3DV8 A;  1UG2 A;  4KIS A;  1LDJ A;  3HGY A;  4HE8 D;  2L9J A;  3I9V 2;  1FNN A;  2WB1 N;  2LF8 A;  3I53 A;  3O6B B;  4BJ5 A;  4DOZ A;  4ETS A;  3CO7 C;  3LUT B;  2P6V A;  2W57 A;  2E87 A;  4XEF A;  3CF2 A;  2CFX A;  4ZJZ A;  1FBS A;  3K1P A;  3H9Q A;  4E7S A;  1RUN A;  2QVO A;  2OOC A;  5HNF A;  3F6V A;  4ENK A;  3FXL A;  3T6J A;  2HMZ A;  3EET A;  2OV7 A;  3GX4 X;  3K66 A;  2HZD A;  3DTI A;  4KDP A;  2VH3 A;  3H9G A;  1P6R A;  4BDZ A;  2OEX A;  1RIO H;  5KYY A;  1J09 A;  1J8Y F;  4LFU A;  2XB0 X;  2DB4 A;  4DVZ A;  3PDM P;  4IAR A;  1FEX A;  4KIB A;  3R0J A;  2KJG A;  5IPA A;  2X0L A;  2ZSI B;  3G3Z A;  1T08 B;  4OWR B;  2OU6 A;  3ZGK A;  4E6K G;  5L0J A;  3BTI A;  1R23 A;  3KE2 A;  1JPJ A;  3CCL I;  3CO6 C;  3RQ4 A;  4E7K A;  3U2M A;  3RZO J;  2QM3 A;  4A3E J;  1OW8 A;  1IZ1 A;  1R1V A;  3HHG A;  3LA3 A;  2QLZ A;  3EHM A;  4RAZ A;  2VBX A;  5GPA A;  3RPQ A;  2KW3 C;  1B9N A;  2CFO A;  5IT9 K;  2W4B A;  5AC4 A;  1FFH A;  1O57 A;  4V2F A;  2YUS A;  2YLG A;  2XAG A;  1M2O A;  3IHU A;  4HNV A;  3FXQ A;  4JBA A;  2JVG A;  2ETS A;  5E1Z B;  4KNY A;  5IT9 Z;  4W1U A;  1X19 A;  4BXX J;  1J5Y A;  2CNW A;  2RKH A;  4YN0 B;  4UNO A;  3HM5 A;  2IOQ A;  5CVJ A;  4JKV A;  4A6D A;  4LAC B;  1IRF A;  3HRS A;  3H35 A;  3CC2 I;  1H89 C;  3OYM A;  2R0Q C;  3IAS 2;  1VQL I;  2JD3 A;  4HEA J;  4DW6 A;  2Q3T A;  2OD5 A;  1Y1V J;  3CLO A;  5E18 F;  2E1C A;  2L81 A;  1BBH A;  4R1H A;  1PDN C;  3SXZ A;  2UUI A;  2DA3 A;  1OMI A;  2E36 A;  3FVY A;  4XQ1 A;  4MVR A;  3HUG A;  1F36 A;  3CQZ J;  1UST A;  3HPH A;  1R5G A;  2M0C A;  4XEV A;  2OC6 A;  2DMP A;  3GFI A;  3L2C A;  1SAN A;  1UEL B;  4YWQ A;  3J7A O;  1FIP A;  4QPQ A;  4HYE A;  4XN3 A;  3UMH A;  3IKT A;  2K86 A;  4HFK B;  2JPB A;  1QQ3 A;  5KVR A;  2DPU A;  3NDB B;  1VQ5 I;  1F4K A;  2YU9 J;  4A3G J;  1B8I A;  4CBE A;  4EBB A;  1WCM J;  2HYJ A;  3MKZ A;  2LF7 A;  2DU9 A;  2CQX A;  1JPN A;  4GDF A;  5FRN A;  2NSF A;  3D5R C;  4IHT A;  3BJA A;  3K70 D;  2A0U A;  1IGN A;  4Y3O A;  3QW0 A;  4Y33 A;  1IN5 A;  4U0W A;  1Y0U A;  1ZW2 A;  1IN4 A;  3M1E A;  3BCA A;  2ZJQ F;  1LFB A;  4M6V A;  4DRI B;  4MVO A;  3RIR A;  2QY9 A;  1BA5 A;  3HGG A;  4DYR A;  3R2P A;  2R5Y A;  3S27 A;  1XPX A;  2ZC2 A;  4Z9J A;  2X85 A;  4P5O A;  3AJM A;  3S1R J;  2CO5 A;  3HIF A;  2JUG A;  2YPR A;  3L2Q A;  5F5F A;  3CTA A;  2GIV A;  4JX4 A;  4XON A;  1C17 M;  4ER9 A;  3S2W A;  1Q1H A;  1MMD A;  2IGK A;  3LAP A;  3F9K A;  1XGS A;  2LG4 A;  2EZH A;  1UAA A;  4O6N A;  4CDV A;  1TL8 A;  1Y1W J;  4N4W A;  3DEW A;  5M3M J;  3TOA A;  3O8G A;  1JTY A;  5F0C A;  2PG4 A;  5D92 A;  2X0C A;  3RTR A;  4ENJ A;  1MBJ A;  2X48 A;  1IXS B;  4OIN F;  3V8L A;  1AKH A;  1QKR A;  1ETK A;  5K7F A;  4L9V A;  1RKE B;  3EGX A;  4GYT A;  1XN7 A;  3P9I A;  3HNI A;  1JR8 A;  2XXA B;  4NQW B;  2Q1Z B;  4ZZL A;  3DD7 A;  3FHD A;  4QLC U;  5A6A A;  1WGW A;  2LMD A;  2FXA A;  3B29 A;  3E7L A;  1RC9 A;  3A01 A;  2KIS A;  4K2E A;  3N0T A;  3M07 A;  4QDL A;  2ZXR A;  1P7J A;  4XEK A;  5EHH A;  4LIU A;  3GXO A;  2B0H A;  2LRD A;  1SMY F;  1RI7 A;  1YA9 A;  3C7J A;  2GBY A;  1AHD P;  1KU9 A;  1WTY A;  2P6S A;  3V7C A;  3VEP A;  1ACI A;  3RVZ A;  4M9Z A;  5D8K B;  3DM5 A;  3IWF A;  3IQC A;  3ABL C;  1MBK A;  2VI6 A;  5J1U A;  1SD5 A;  2IEK A;  5M5X J;  1U5T C;  1IXC A;  4CDA A;  5C44 J;  4QI2 A;  5IOZ A;  3CJN A;  2V1D A;  4LK1 F;  5JSL A;  4RMN A;  3ZQV A;  2L7F P;  4XPX A;  2I10 A;  2I8D A;  4P96 A;  5HOO A;  4NTB A;  4G7Z F;  2PX0 A;  1SFO J;  1Q0K A;  1YLM A;  4G94 A;  5E3L A;  3GTG J;  2WZL A;  3BR6 A;  3QMK A;  5CQE A;  2ZJR F;  3DMD A;  3BC8 A;  1R4T A;  3DWW A;  1JOG A;  4HLY A;  2E7X A;  2XB5 A;  4I1O B;  1VMA A;  4YL3 A;  3VF0 A;  1QNT A;  3I4U A;  2XGC A;  3FWE A;  2HTJ A;  4DBR A;  2BW3 B;  2EH3 A;  1JKQ C;  1T5O A;  3U2R A;  4X6A J;  2KK1 A;  5L0C A;  3V42 A;  2QE9 A;  1M2V A;  2DA1 A;  3NWT A;  3P5J A;  256B A;  2ECC A;  1SVL A;  2KFD A;  2DOD A;  1K61 A;  1CGP A;  3CUQ A;  5L3D A;  2XKP A;  1W2W A;  3JTL O;  3VYT B;  2LD5 A;  5J40 A;  3OYL A;  2NSG A;  1XG1 A;  2FRH A;  2OU2 A;  1GXP A;  3S17 J;  3FM3 A;  4XID A;  1SYQ A;  3I55 I;  3OSG A;  2NVX J;  2CUF A;  4N9I A;  4FIS A;  2Y3G A;  2JRM A;  1S7E A;  2OG2 A;  2M87 A;  1L7C A;  2LOO A;  4HBL A;  3JRG A;  4C7O A;  3BZC A;  4CJO A;  4U0V A;  1HKS A;  4FX4 A;  1S7O A;  3JSO A;  1L3L A;  3H92 A;  2L6F A;  1HXD A;  3E6B A;  2NPU A;  1BI3 A;  3N05 A;  4G9Y A;  3JRM O;  3UGP A;  3F8M A;  4HG2 A;  3LSP A;  2HVS A;  3KIO A;  2Y2Z A;  2CV2 A;  3FXO A;  1IUY A;  2CQQ A;  2H8A A;  4F92 B;  5FFX A;  2W4S A;  3A9C A;  2LY2 A;  4KN7 X;  4OMY A;  3R4K A;  4A0Z A;  2VQL A;  2VL8 A;  3S2H J;  3BJ6 A;  1BI1 A;  4LLG F;  4YEL A;  3HEF A;  4CYC A;  4BQN A;  5EZH A;  4C2U A;  4GEH A;  3MD2 A;  3CMM A;  2B63 J;  1ZN2 A;  1BZ4 A;  3RI4 A;  4BXF A;  2J9B A;  2F4O B;  1ZU4 A;  4RB0 A;  2EBI A;  3LLI A;  4MVQ A;  4M74 A;  2M30 A;  3DKA A;  2UUH A;  3G4S I;  5A6B A;  3X2Q C;  3K70 C;  3I59 B;  1HLV A;  1OCZ C;  2AWC A;  1SAX A;  3W6J B;  4LG0 A;  2GIZ A;  1U8R A;  3HRU A;  3ZQF A;  2HUJ A;  1BW6 A;  1ON1 A;  1HBX G;  2ZXP A;  2VJJ A;  2EJR A;  1LEB A;  2H6C A;  3Q0U A;  2VOO A;  2E7W A;  4M3G A;  1A35 A;  2Q2E A;  2NUP A;  2RSE B;  3ULQ B;  4EJO A;  2HYG D;  1LIH A;  5CI9 A;  4BJ6 C;  3KCC A;  5J4V A;  1RCP A;  2RAE A;  3NQO A;  3C8G D;  4I44 A;  1TT0 A;  1YAR O;  4XLN F;  3AG3 H;  4W8P A;  5K7Z A;  1F1M A;  1HY5 A;  3T8T A;  2R05 A;  5D8L B;  1ZAO A;  4IXA A;  5BQI A;  1LS4 A;  1FOX A;  1PP8 F;  1I4Y A;  1RKC A;  2LR8 A;  4FT8 A;  4PDK A;  1TW3 A;  1XB4 A;  2ZXJ A;  2J9V A;  3HNJ A;  1B72 A;  3T5X A;  1JUP A;  5DTD A;  3VYS B;  5DV5 A;  2QCO A;  3ABM C;  4EM1 A;  4MQV A;  1HMD A;  4A2N B;  4EKW A;  3ZN1 A;  3W6V A;  3U9J A;  4DXW A;  1W7P A;  4YJW A;  2HZT A;  4YII A;  4PR9 A;  4J19 A;  2H7B A;  5E3A A;  3CC4 I;  2VJ5 A;  4HV5 A;  2GQQ A;  5A6J A;  3ZQH A;  1IDY A;  2DA2 A;  1EI7 A;  3SNH A;  2NRA C;  4PJ0 C;  1BN5 A;  1ODD A;  3CJR B;  3GM1 A;  3K1H A;  3W6K B;  1JI8 A;  3GEE A;  5HNH A;  3IQT A;  5KYN A;  3JYH A;  2IRF G;  2FML A;  4E70 A;  3V5Z A;  4U5G A;  3C63 A;  5LRR A;  3ABM H;  2L02 A;  2R7Q A;  3BCB A;  1I3Q J;  1RPW A;  4XR6 A;  2IS1 A;  5LHI A;  2QLA A;  2L7K A;  5DUK A;  2CH0 A;  1JJ8 C;  2O9X A;  4AVP A;  1U5T B;  4EIY A;  2KL4 A;  4BHC A;  4Y13 A;  2W4M A;  3GYH X;  3TK0 A;  1Z6R A;  4AIK A;  1GUU A;  4HA8 A;  1HE9 A;  3O39 A;  5L0D A;  3DPU A;  2VC0 A;  5F6F A;  2O8X A;  1TWH A;  2IM8 A;  2M4E A;  1T6Q A;  4O79 A;  4U9D A;  4BL0 B;  4KIC A;  5L3G A;  3HSE A;  3BPV A;  4F52 A;  2NNY A;  3UMK A;  3F8C A;  3FBI B;  2K7L A;  2M0M A;  2R25 A;  3F8B A;  4L5I A;  2EA2 A;  3MAJ A;  1SZI A;  3JSZ A;  3F6O A;  3H3V K;  2WZG A;  3QYB A;  3LEO A;  2O0Y A;  3ZOB A;  2IGO A;  2Q4F A;  3EGD B;  2AQE A;  4P1W A;  2B0J A;  2STW A;  1C02 A;  1LKX A;  3A1Y A;  3LS1 A;  2GAQ A;  5LBQ A;  4HW0 A;  1YYX A;  2IT0 A;  3D0S A;  2E2H J;  3ZWI A;  5LGU A;  3F72 A;  2KIM A;  2DCE A;  3DFG A;  4CXF A;  1WWX A;  4I6Z A;  1APC A;  4EUK B;  5K1Y A;  2BY3 A;  1OKK D;  4I2O A;  1XCV A;  1LI7 A;  4BEJ A;  2PNO A;  3E3V A;  1I39 A;  3FF5 A;  1LS1 A;  4IKF A;  2WWY A;  5TJJ A;  4O6J A;  4B48 A;  4F55 A;  5HLH A;  1WWP A;  1LDD A;  2DK5 A;  2VB6 A;  5IY5 H;  3JRF A;  3ABT A;  2LBF A;  2CYY A;  1XDU A;  1MBG A;  3EZI A;  2DK8 A;  3IAM 2;  5JHF A;  4WX9 A;  3S8P A;  4BJ1 A;  3JAM K;  4E0I A;  1PD0 A;  5DQT A;  1ZKG A;  2R7R A;  4JP0 A;  2LFB A;  1FYM A;  2CU7 A;  3ERE D;  1FMV A;  1SFE A;  2HNH A;  3NAU A;  2IS2 A;  4E7I A;  5BUO A;  1B1B A;  1V5E A;  3RPU A;  2CS3 A;  1YHQ I;  4RGR A;  3JAM Z;  4G12 A;  2K40 A;  4JEB A;  2NVU B;  3A0H C;  2XAU A;  3KYJ A;  2ESN A;  4V19 K;  3O55 A;  4BAY A;  2IXN A;  1ZHX A;  1VQO I;  3CES A;  4MS2 A;  1LE2 A;  1IXR C;  1FIA A;  1MJB A;  2NOJ B;  3IP4 B;  4I0B A;  4U87 A;  4UXN A;  1K78 A;  2QBY A;  4KNV A;  2W24 A;  3C1D A;  2R7S A;  3I54 A;  4DRH B;  2YVK A;  4ZDL A;  2P81 A;  5LD2 C;  2P7V A;  1IUF A;  1L3P A;  1K83 J;  2KDZ A;  2VKD A;  4D4N A;  2ZBK A;  3TJ6 A;  3JRE A;  3CLQ A;  2YLD A;  3OV8 A;  1HE1 A;  2PJP A;  3SXY A;  2D1H A;  2EQR A;  1DU6 A;  2MYS A;  2R7F A;  1FX7 A;  2BY1 A;  5DS4 A;  1LM3 B;  2GDC A;  1A7V A;  3IH4 A;  5C3E J;  3HKZ A;  4XQF A;  2DFE A;  3FDQ A;  1RKE A;  1BOA A;  3D1N I;  4NC3 A;  3BTL A;  4OD5 A;  4XLC A;  6PAX A;  5F04 A;  3S32 A;  4B8X A;  2X9D A;  3DTE A;  2ISZ A;  2P5K A;  5FD6 A;  4LB5 A;  3GW2 A;  3AG1 C;  3FM5 A;  3G2B A;  2TCT A;  3GTM J;  3KP7 A;  1AVO B;  4OAZ A;  2IAI A;  3MEX A;  5CVV A;  2LFF A;  4M6Y A;  4D9J A;  2KDO A;  2UWM A;  2FUG 2;  4RAG A;  1GVJ A;  1Z7U A;  1SVM A;  1XX5 A;  2CWE A;  2HU9 A;  3K10 A;  2LP4 A;  2JUC A;  3CP2 A;  1BR1 A;  3WGI A;  3LNQ A;  3M3Y J;  1Y8R B;  5EEH A;  4IX7 A;  3PQJ A;  4GYI A;  1FY7 A;  1LB2 A;  2L9N A;  3MX3 A;  5KYX B;  1HW1 A;  3MZH A;  3T4R A;  5EZG A;  5LGT A;  3KP2 A;  2QNL A;  3B0U X;  3BR5 A;  3IH3 A;  2YWA A;  3JYY A;  4IF4 A;  5K5O A;  1UHM A;  3BTC A;  1W4M A;  2CQN A;  4EQQ A;  4HQE A;  2EV6 A;  2IJL A;  2OCC H;  3JRH A;  1V54 H;  4IVN A;  1RZ4 A;  4WAB A;  3PM1 A;  4E18 A;  1ZTR A;  1CGN A;  3G1L A;  3V5X A;  4LER A;  3OYH A;  1O87 A;  2DLL A;  4UV9 A;  4L9J A;  1ORJ A;  2MG4 A;  1BI2 A;  3MVP A;  4IRG A;  3BR0 A;  4XRF A;  5E1W A;  5IYC J;  4XPW A;  2GFH A;  1Q0G A;  2COM A;  1YX5 A;  4MFD A;  4CIP A;  2BW3 A;  2VT2 A;  1OCO H;  2RNJ A;  1V74 B;  1VK5 A;  3H5R A;  2BZT A;  1FOK A;  3L2R A;  4JTD B;  1OQY A;  1F9N A;  4D7M A;  4DBQ A;  3F21 A;  3IPM O;  2COB A;  2EIL H;  1YVI A;  3GBG A;  4EMS A;  2F48 A;  4KIF A;  3ECH A;  2YS9 A;  4D5F A;  4N4O B;  1BOB A;  1CF7 B;  2CUJ A;  4RD9 A;  2K4B A;  2LP0 A;  3IV5 A;  3BZK A;  1BC7 C;  2X6Y A;  3NWS A;  5TGT A;  1K4S A;  2OBP A;  2OCE A;  3C62 A;  3E0J B;  1LJ9 A;  2OQG A;  3OS0 A;  1J8M F;  4CS8 C;  2STT A;  1ZGJ A;  1RKW A;  4B4C A;  3EYI A;  1YDI A;  2L9R A;  4BEM J;  2Y75 A;  2PN6 A;  2QKL B;  2J7P D;  1HMO A;  4XN0 A;  1WJC A;  1UG7 A;  2MD5 A;  4U5C E;  1VB5 A;  1J75 A;  4PSX A;  4G8X A;  4A0X A;  2YX7 A;  4K0D A;  1EH6 A;  4BEH A;  1YIT I;  4GFB A;  2E1O A;  5EGO B;  3QP5 A;  3UR3 C;  4PJJ A;  4BS9 A;  4M3D A;  4E0H A;  5JVT A;  1TFK B;  5DCF A;  1QHG A;  1GS9 A;  2LYC A;  4RM2 A;  2KRH A;  3PNY A;  4UVB A;  2UUZ A;  2QQ8 A;  4BUP A;  4AU7 A;  2O03 A;  2WVQ A;  4HDV A;  2LKX A;  1G59 A;  1XMX A;  3ZRG A;  2D4U A;  4MND A;  3SZR A;  3I59 A;  2P1A A;  2BXZ A;  2OPT A;  3K1N A;  1JT6 A;  4ENM A;  2J45 A;  1H9G A;  2BOL A;  2K9Q A;  2HDD A;  5JVG F;  3RF3 A;  2QSH X;  4IHS A;  4HNU A;  5M3F J;  1WI9 A;  2DYR C;  2W25 A;  3SFZ A;  3BP8 A;  1QVT A;  3H3U A;  3VYW A;  2HDW A;  4K7B A;  3NKD A;  2GA0 A;  4GXO A;  3ZP5 A;  4U7D A;  2HKX A;  2EFW A;  3BZ6 A;  1Q0M A;  2Y31 A;  3OIQ A;  3F8N A;  3EHN A;  4I99 C;  3U9G A;  1BL0 A;  3U0C A;  3WHN A;  2MC4 A;  2PP4 A;  3LS0 A;  1LFU P;  1TZL A;  3JRB A;  4AE4 B;  4PCQ A;  1S7Z A;  1LPQ A;  3E97 A;  4MGR A;  3CME I;  3QW1 A;  1R5H A;  2DOA A;  3U1D A;  4A5N A;  1YRN A;  2DMU A;  2OZ6 A;  1TQM A;  4BYY A;  2HKO A;  1R1T A;  5FJ8 J;  3SXM A;  1NU7 D;  1WVR A;  4ZDO A;  1QZZ A;  3DJN B;  1OKR A;  1DGR M;  1P7I A;  2DYR H;  3I0T A;  4N0B A;  1X3U A;  1FYK A;  2P0N A;  1H8A C;  2P5V A;  3OSF A;  2EFO A;  4LLN A;  3L1M A;  3VAY A;  4FAP B;  4UY8 I;  2O9L A;  3RFY A;  2CCY A;  3US6 A;  3KX2 A;  3Q9V A;  2MLG A;  3S0X A;  4HV6 A;  4JUR I;  2IVM A;  5J8C A;  2YKZ A;  3P7N A;  2HQR A;  5L3F A;  2XRL A;  5C4J J;  3C2G A;  1ZHW A;  4MVS A;  1WJF A;  4CZC A;  2HOE A;  3C8G B;  2CW8 A;  2RRE A;  3SQN A;  5KHD A;  4ZYD A;  3MFK A;  2C03 A;  5JLX A;  2JJ7 A;  1I6H J;  4AL1 A;  2XGD A;  1KU7 A;  2CRG A;  1MMG A;  3HHH A;  1YYJ A;  3JW4 A;  3QOP A;  3JZ0 A;  1O3T A;  2J0X A;  3S93 A;  2A6E F;  5DD8 A;  4O6M A;  2VBY A;  4HEA 2;  3EUK L;  5H6R A;  1WOL A;  3KP3 A;  3K7D A;  2LK2 A;  3HKZ N;  3EDP A;  1IV8 A;  5J47 A;  2PMH A;  4KT5 C;  2FBK A;  1TP4 A;  3LAJ A;  3F23 A;  1VLT A;  1OLT A;  5ICF A;  5FRM A;  2F5V A;  3DBL B;  3BR3 A;  3C3W A;  1ON2 A;  3WTT C;  2FQ3 A;  2MW8 A;  4KNW A;  4BBS J;  3CJT B;  2OQM A;  1ETY A;  1WHU A;  1CPQ A;  3I56 I;  2ZNZ A;  2E34 A;  5T3W A;  5FFZ A;  3QZC A;  3GFM A;  3KLN A;  1VQ4 I;  1IV6 A;  4RGU A;  1BR4 A;  2WA0 A;  5FLX K;  2JK3 A;  5HOD A;  2YRF A;  2R7D A;  2VXZ A;  4I02 A;  3M7G A;  1YO5 C;  2EPK X;  4N6H A;  1JUM A;  2LD6 A;  1U3E M;  1D0Y A;  5FLX Z;  3KYL A;  1T0F C;  2GOX B;  3EGD A;  1ORY A;  1OW7 A;  2XHK A;  4IOC F;  3FIS A;  2WTE A;  3GUD A;  4PUS A;  1IDZ A;  5FRO A;  1TWG J;  1R5I D;  2H6B A;  4IQJ A;  2FA5 A;  4KT6 A;  3WTW C;  1TWC A;  2NVT J;  4GGG A;  3M4B A;  1H9T A;  5LFA A;  2H94 A;  1SFK A;  4WK8 F;  2EFN A;  2AU5 A;  4YG2 F;  3ML6 A;  5HDG A;  1ZU5 A;  1QVU A;  2J0W A;  4YK5 A;  2HOS A;  4M3B A;  2FAP B;  5CVR A;  3DP7 A;  3DU6 A;  3GLX A;  3H36 A;  2B7E A;  2YEV A;  4Z2Y A;  4BXU A;  3HOZ J;  5K5Q A;  3G4X A;  3MMY B;  3MKW B;  3RKW A;  4NB5 A;  1LE8 A;  3GWZ A;  1W5C C;  5L0I A;  3OYG A;  5F1J A;  4L6R A;  1QO0 D;  4ZYA A;  5L3B A;  1MGT A;  4UHT A;  1IW7 F;  1SD4 A;  3KP6 A;  3RSN A;  2PMZ A;  2BXY A;  5AIP A;  5FKN A;  1VTM P;  3X1O A;  3B9Q A;  2A5W A;  5GAG J;  1KQ0 A;  1TNT A;  3O8H A;  2DJN A;  3E5Q A;  1KON A;  1G8X A;  4AYB A;  4Q7C A;  2K02 A;  3U3F A;  1MDM B;  4A3J J;  4N6C A;  4FTH A;  1KNY A;  1AA7 A;  3A11 A;  3Q3S A;  5DS9 A;  1DP7 P;  1O7F A;  3VWB A;  3QAH A;  5FB2 A;  3LST A;  4YIF A;  1R22 A;  4II3 A;  5GTH C;  1Z6A A;  1Z1D A;  3KYI A;  4QIW N;  5JS5 A;  2E35 A;  2R5Z B;  5K0I A;  4IHY A;  2RQQ A;  3HKK A;  2V1X A;  4BHB A;  4B3X A;  4PGG A;  1QA6 A;  2DBB A;  1OXK A;  1IN6 A;  2D1V A;  1IO2 A;  1XGO A;  2BYV E;  2GWR A;  4CCO A;  5E33 A;  3K33 A;  3T6B A;  4ESF A;  2Q0O A;  4AUX A;  3C8Z A;  3L7W A;  4GQH A;  3LMM A;  4DZP A;  1YG2 A;  5D5W B;  3G73 A;  1LVA A;  4YEJ A;  1FFT C;  1ZRD A;  1Y0N A;  3JCU Q;  2LTP A;  1ZW3 A;  1JTX A;  3W2W A;  4A0Y A;  3KPH A;  2XSD C;  1YZC A;  3GTL J;  3M15 A;  3HOS A;  3ASO H;  3RQE A;  4BJT A;  1D8J A;  4BJ6 A;  1YA7 O;  3B6C A;  2DMN A;  2Y3H A;  5E1X A;  1F1Z A;  2XM4 A;  1ITY A;  3SXK A;  3CMA I;  4P6I C;  1RMV A;  1Y56 A;  2M4K A;  3MCZ A;  4E7H A;  3CCJ I;  4JE9 A;  3DE8 A;  3G50 A;  2UV1 A;  4PJL A;  4EBK A;  3KZY A;  1I5Z A;  2E60 A;  3E6C C;  4AX2 A;  2XF6 A;  2KC3 A;  2EPF A;  3JRI A;  4G0H A;  4IGG A;  2YU3 A;  4AVZ A;  4QSH A;  5D6F A;  3V7R A;  3BQZ A;  1JHF A;  4KBL A;  4H54 A;  2XLH A;  2W84 A;  1OCT C;  5DVW A;  3U5S A;  3OIP A;  3LES A;  2K3P A;  2YQY A;  5TJ5 E;  1YE9 A;  5CJ9 A;  1TC3 C;  3S1M J;  5ED4 A;  5BMZ A;  3VYU B;  1KA8 A;  5EG0 B;  3NG1 A;  3BJO A;  2DQL A;  2X1C A;  1K40 A;  1TQG A;  3TW6 A;  5L3E A;  2HV7 A;  1GV5 A;  3FXM A;  4S04 A;  4EVI A;  2IXM A;  1U78 A;  1EV7 A;  2DA5 A;  1GT0 C;  2VBZ A;  4CHU A;  2XF7 A;  2L01 A;  2BE5 F;  1WAT A;  2PQ8 A;  2L6G A;  3U8P A;  5JT4 A;  1FR0 A;  2QGU A;  1I50 J;  3FMR A;  1WPK A;  4M6X A;  2HV6 A;  2R03 A;  2AO9 A;  3RYL A;  5BQT A;  3U9M A;  1R1U A;  2BV6 A;  1DPR A;  2CNW D;  2JSP A;  4L9N A;  5BPI A;  1Z9C A;  2ZXH A;  1OYI A;  2JMW A;  1IRZ A;  1JRA A;  4LDQ A;  3GLL A;  3H9J A;  3ZR8 X;  3HXL A;  5DQZ A;  2LY1 A;  5EGY A;  4CUG A;  5JRA A;  2LFD A;  4MO7 A;  1QLE C;  3G4Z A;  3I71 A;  1FSE A;  1F43 A;  4F91 B;  1MH3 A;  4Y52 J;  4JC7 A;  3IC7 A;  1DUX C;  1BBY A;  5KYU B;  1CF7 A;  1Q1V A;  3ESW B;  3KLO A;  3J81 K;  1D5V A;  4IL6 C;  3SZT A;  4BQQ A;  1YTY A;  2B9S A;  4EJV A;  1ZGW A;  5BS6 A;  2Q9C A;  4L5J A;  4DYQ A;  3ELK A;  1Y4C A;  2JA6 J;  2YX4 A;  3J81 Z;  5HLI A;  4KYW A;  4IJA A;  2XDV A;  2WB7 A;  3UGO A;  4PAC A;  2MBF A;  4M3E A;  1VF9 A;  4I0A A;  2WV1 A;  3OL3 A;  4HST A;  1AEP A;  2WAE A;  1WJ5 A;  3OEO A;  2RN7 A;  3GTO J;  2J5P A;  4D5C A;  4UUS B;  1NFO A;  2E19 A;  2R4G A;  3QPL A;  1SC7 A;  5HLG A;  4A12 A;  1YJG A;  3SEZ A;  2D5R B;  3MYI A;  1MQV A;  1FMW A;  4GCV A;  4JTC B;  3L9F A;  4FHT A;  1BIA A;  4DNC A;  2A6H F;  2KZG A;  1HF0 A;  5CLS A;  4U5D E;  4LK0 F;  1ZHY A;  2ESH A;  4JEA A;  1FYL A;  5J3L A;  4JZA A;  1EH7 A;  2L9V A;  2L2O A;  2HPI A;  3ABU A;  1V5G A;  2CJJ A;  3LFU A;  2XS8 A;  3K7A J;  4N06 A;  3E6M A;  2D2W A;  2VJI A;  2VLA A;  1OR2 A;  4XK4 A;  4F4B A;  2VE9 A;  3CD6 I;  2Y0S A;  3R0A A;  3TDZ C;  2M64 A;  4IRU A;  5ICC A;  5E8G A;  3KKB A;  4CSW A;  1WZ2 A;  5J6X A;  4FES A;  2QWW A;  1XMK A;  2JWT A;  3GOD A;  4C3B A;  4EJU A;  2Y3D A;  3S28 A;  5BQH A;  2M7B A;  1MNE A;  1W36 D;  1MBH A;  2L9S A;  4O3M A;  2A61 A;  2HMQ A;  5EEG A;  1HOM A;  1POG A;  2L0K A;  1X3Z B;  3V8J A;  1WRJ A;  4RAF A;  1GM5 A;  3JRT A;  1G3W A;  2DXI A;  5DS5 A;  3DXJ F;  3PJR A;  1C03 A;  3K2Z A;  1X4O A;  2VE8 A;  1YAU O;  4RBN A;  3M9A A;  5KK1 A;  1NK3 P;  2A69 F;  2XPV A;  3Q0V A;  2NAZ A;  2ZPA A;  1QSP A;  3BG5 A;  2X6W A;  3EH2 A;  5KYW A;  5LLQ A;  4D1Q A;  5CIV A;  1G6N A;  4Z9I A;  2WY7 Q;  1EA3 A;  3S16 J;  3BTJ A;  2A05 A;  2PMZ N;  3TED A;  3V4G A;  4LDR A;  3QQA A;  1KYZ A;  2FEZ A;  2HYF A;  2ZME C;  2EB7 A;  1Z67 A;  3GFL A;  2N8G A;  4AYB N;  5LEJ A;  2AXT C;  1WFX A;  4BE0 A;  4XPY A;  4YT5 A;  1FLI A;  4O5V A;  1VTN C;  1JMW A;  3LA2 A;  4ESB A;  1OCC C;  3Q9S A;  1YW7 A;  1IRX A;  4NUB A;  3U3B A;  1BJA A;  1NFN A;  2OA4 A;  2X1E A;  4BJ5 C;  4NY3 A;  4UVA A;  3E1S A;  5LEK A;  1OPC A;  1XC5 A;  3TD7 A;  1ONV A;  2DQR A;  1I3A A;  3TL4 X;  1T9K A;  1NG7 A;  4XIC A;  3DLL F;  2RNG A;  2EZL A;  5LGN A;  3FBN B;  3BG9 A;  2DOE A;  4AC0 A;  3ZN0 A;  5DCM B;  4DQ2 A;  2HQN A;  2P5L C;  3WU1 B;  5KAF C;  3ZTM A;  2DMQ A;  2WAD A;  1W1W E;  2RDP A;  5BNG A;  2R7U A;  2EZI A;  3AG3 C;  4P55 A;  1MKM A;  1OCC H;  1RRJ A;  3V7O A;  5HV9 A;  2YL7 A;  4XRS G;  3H2U A;  1FJL A;  1NSG B;  1R6R A;  1XD7 A;  3M1C A;  2UZK A;  2OAZ A;  2K85 A;  3CSK A;  3TOM A;  3ZMV A;  4W8K A;  3V7S A;  2NVQ J;  2KSF A;  1FC3 A;  1D0X A;  3ROU A;  4HF0 A;  5JR3 A;  3VOD A;  1BM9 A;  1LUJ B;  1T33 A;  2WAF A;  3OIO A;  3OWT A;  3QWL A;  4WF2 A;  3U21 A;  3VM6 A;  4XOP A;  4CO8 A;  2MH2 A;  4A3K J;  1TWA A;  1T6I A;  2VT3 A;  1HCR A;  3KP4 A;  1H6G A;  2G9W A;  2KGO A;  4Q4Z F;  3BG6 A;  2RQP A;  4C3H J;  5GAH J;  3SZP A;  1J0R A;  2DDA A;  3W3C A;  1XZP A;  2G62 A;  2XPW A;  3CUO A;  1VYI A;  4BNC A;  3CCQ I;  5CQG A;  5E17 F;  4FCY A;  4CCN A;  5ICE A;  3B0V C;  3VFZ A;  2F4I A;  1Y8Q B;  2K9N A;  3FXJ A;  2CUZ A;  5BQG A;  4KN4 X;  1A04 A;  1HSJ A;  4RLQ A;  2K27 A;  4BE1 A;  3SHF A;  3I4M J;  1JJ6 C;  2PX9 A;  3BDD A;  4R79 A;  3BRO A;  3NAR A;  2FBH A;  1YFH A;  3B71 A;  1X1C A;  2XS1 A;  3B6A A;  4PSW A;  1Q0F A;  1T01 A;  2R7X A;  4C9Y A;  5E3N A;  4A2U A;  4CS8 A;  1SD7 A;  3B02 A;  1YW8 A;  1GGQ A;  4ZC3 A;  1NHA A;  2B0L A;  5E3C A;  5L3C A;  2LQG A;  2G7U A;  2K9S A;  3JCU C;  3D5S C;  3I3L A;  1QVX A;  4EM0 B;  3GEZ A;  3QVZ A;  1UCR A;  2OUM A;  4CDY A;  2NS7 A;  3O10 A;  2AHQ A;  4Y17 A;  1DDN A;  3EFO B;  2P6T A;  3DLA A;  1OKK A;  2JRT A;  3J7A Y;  2HJM A;  3CCE I;  4A3B J;  4C2T A;  4ZTJ A;  3L1P A;  1YS7 A;  2LK4 A;  2BVL A;  3J06 A;  4CCM A;  1GDT A;  1K6O A;  2K3F A;  5H6Q A;  2DFI A;  4BQO A;  2PJR B;  1O4X A;  3OYA A;  3DPT A;  2R5Z A;  1QPU A;  1ZYR F;  5EYR A;  1WN0 A;  4AK9 A;  2R7Z J;  2CSO A;  1DPU A;  2KP6 A;  1K7A A;  1EKY A;  1VQ9 I;  4WWC A;  1O3U A;  4KJZ A;  3BEH A;  4JK1 X;  1O7L A;  4QWQ A;  1LQ1 A;  3JTH A;  3REO A;  4MFE A;  4ON0 A;  3Q6M A;  2Y0M A;  3WTS C;  1TLH B;  1A7D A;  5IY5 C;  5LHH A;  3DWL E;  2XL6 A;  2DA7 A;  1XSD A;  2W1O A;  3O2P E;  4YFN F;  1ZH5 A;  3E5X A;  2AP3 A;  2A0B A;  2W9Y A;  5CVU A;  2Y0S N;  2GWW A;  3GEH A;  3BR2 A;  3GME A;  4E7L A;  4HX7 A;  1WI3 A;  4G6D A;  2M3A A;  4Z6Y A;  3CEX A;  4XOT A;  1G3T A;  1Z23 A;  5GP9 A;  2XAS A;  4YIR X;  3DCF A;  3R6S A;  1XMA A;  3A2K A;  1QBJ A;  4G6T B;  1LI5 A;  4PJM A;  2ZME B;  3RDI A;  2KNH A;  2I5U A;  1PUF B;  2ID6 A;  3QPH A;  3QOD A;  2QF7 A;  3K1I A;  1U0B B;  4S05 A;  4A6E A;  4BU2 A;  3GM2 A;  4PFP A;  1P4W A;  5KCM A;  2IS4 A;  2BEO A;  1W7P D;  3OYK A;  1ZHF A;  2DJI A;  1NLX A;  1FT9 A;  3IL2 A;  1P4X A;  4IQ4 A;  1XTA A;  2WVN A;  2MGQ A;  3S90 A;  2YSR A;  3OYC A;  2VPR A;  2GOM A;  3BT9 A;  4RDU A;  2J8W A;  4AL0 A;  2VQC A;  4IHX A;  1GV2 A;  2GXB A;  2Q9B A;  3RQI A;  4IJJ A;  3BG7 A;  1DGW Y;  2XAF A;  1ZK8 A;  4RGS A;  3W2V A;  4FWV A;  2FE3 A;  4J32 B;  4AIJ A;  3P9K A;  4Y7N J;  1BR2 A;  1D1C A;  1TW2 A;  2LC2 A;  2DPD A;  1GHC A;  3N2Z B;  3CAX A;  1TFO B;  5F28 E;  1OFC X;  2M1B A;  3Q5F A;  4RDA A;  1SFU A;  3CCR I;  3OOP A;  2EIK C;  2OQR A;  2RC4 A;  1HC8 A;  3IKV A;  2Z16 A;  2IXO A;  2VOD A;  4CCK A;  1MMS A;  5F08 A;  1Q0D A;  4BAC A;  1Z5Z A;  3DF8 A;  3F8F A;  4IAO A;  5HLT A;  4MEY F;  1E3P A;  3S3N A;  1OYW A;  3HZJ A;  3MQ0 A;  4XL9 A;  1HKT A;  2LSE A;  2VKV A;  5IP7 J;  1YOV B;  4AID A;  2GXG A;  1UJ8 A;  3WGH A;  4A4A A;  4C3I J;  4PZJ A;  1S8N A;  3GEI A;  4JTA B;  2XXA A;  1TBX A;  4NQW A;  1T0F A;  2MSY A;  4UUS A;  1R7J A;  3T8R A;  2OCC C;  3AG4 H;  1V54 C;  2VON A;  1SVO A;  1KQ9 A;  1V55 H;  3CMY A;  5BPD A;  3M79 A;  3GWL A;  1M57 C;  2EIK H;  2GXA A;  4CCL A;  3LFK A;  5DLJ A;  3OYF A;  4HDU A;  3FX3 A;  4MTF A;  4UUV A;  2H7O A;  4U5B E;  1EH8 A;  1OCO C;  1SR2 A;  3BWG A;  2LRE A;  5IOY A;  2HS5 A;  2KRC A;  2IA0 A;  1ULY A;  1J2X A;  1Z3X A;  2ELH A;  2EIL C;  2NS0 A;  3HUG B;  2M5W A;  4BY7 J;  4QPO A;  2HFH A;  1EJ9 A;  2A07 F;  1U9O A;  1SMT A;  2WC2 A;  3PFI A;  2EK5 A;  4J00 A;  1REP C;  2VOP A;  1FSH A;  1RES A;  3NMJ A;  4KMU X;  2L6H A;  3RPU D;  3FMQ A;  4LLC A;  2F2E A;  4I09 A;  4TV7 A;  3DQV C;  4RB1 A;  3DU5 A;  4ZYE A;  5EF6 A;  3S1N J;  2J9U A;  2F4M B;  3LJB A;  3CC7 I;  3A4C A;  1HST A;  4EV0 A;  2R7V A;  3W2A A;  2QYO A;  2LLK A;  2HXI A;  3T6G B;  1MJA A;  3SDB A;  1T2K A;  2IXP A;  3FXR A;  3K4K A;  4UUT A;  3ZQL A;  3OYJ A;  1B8I B;  2LCH A;  2P0W A;  3OR2 C;  2ZNY A;  3HDD A;  1OCR H;  2M8E A;  1JT0 A;  4L18 B;  3PFY A;  3VPR A;  5IP9 J;  1PV3 A;  1HA8 A;  1LEA A;  1U2W A;  4GYG A;  4Q48 A;  3O6X A;  1WJD A;  1IN8 A;  1Y6D A;  5T1D B;  1J7K A;  5L0G A;  4XMY A;  4XLF A;  4ZZD A;  4J01 A;  3RYP A;  1G2H A;  2E1M C;  2E5N A;  3WG7 H;  1FBQ A;  2XLO A;  1I1G A;  3ZQY A;  5EDN A;  4ULV A;  2H8W A;  3IRQ A;  2K5C A;  3RJP A;  2R5Y B;  2MA3 A;  1IF1 A;  1ZRE A;  3ITF A;  4JX6 A;  2Y30 A;  4KFC A;  3GO5 A;  2HJ3 A;  4JCZ A;  3MN2 A;  1TWH J;  2AVK A;  1QZY A;  4BY1 J;  1WQ2 A;  2LKS A;  2DTR A;  5FGM A;  3K4C A;  5FO5 A;  5DM7 F;  2LIG A;  4BG0 A;  3U1K A;  4KUM A;  1K04 A;  1QPI A;  3W8I A;  4XKW A;  3U2L A;  1Z7Q c;  3L2U A;  4BPM A;  1EQ1 A;  4A3C J;  3FDY A;  3KFW X;  1OR7 C;  1HDD C;  4LLL A;  2M34 A;  1AKH B;  1VLS A;  4I3M A;  3RKY A;  3ZG1 A;  4OMZ A;  4A3I J;  2CW0 F;  2QQ9 A;  1FP2 A;  4XLP F;  2KT0 A;  4P9U A;  4UB6 C;  4HFF B;  4RM3 A;  4MNU A;  2V9K A;  5D5X B;  4U0Y A;  4HF2 A;  4KI2 A;  4FQG A;  2L4M A;  4JIO A;  3S2D J;  2QUP A;  4CIC A;  2GAU A;  2Z15 A;  2EV0 A;  1CGO A;  1ZHZ A;  3AGU A;  3PMR A;  2ASR A;  4Z9H A;  3TUL A;  1ZAR A;  2J9W A;  3HOW J;  1IC8 A;  3BY6 A;  1UMQ A;  1KU3 A;  3MWM A;  3K4M A;  5GAD J;  3BLY A;  4MW3 A;  5DM6 F;  4JVS A;  2XC7 A;  5EJC A;  3FOO A;  2FBI A;  1N25 A;  1KGS A;  4DYC A;  2MFZ A;  2EPL X;  3GTJ J;  3SFI A;  4EGY A;  4DJA A;  3MBG A;  1X1P A;  5JLW A;  2DO7 A;  4B47 A;  3CQZ A;  1BIB A;  1FBU A;  5E3M A;  2JA7 J;  1V3F A;  4NC7 A;  2JSC A;  1FZP B;  3S3M A;  1TNS A;  1CPR A;  1M1E B;  1NG6 A;  1RR8 C;  1ORS C;  4H4K C;  4LIT A;  5F0H A;  2EFQ A;  1A5J A;  2CDQ A;  1OXB A;  1JUS A;  2XAH A;  5F1R A;  2HXO A;  2UXX A;  1K05 A;  2OTJ I;  4ZLC A;  2BHY A;  3OYE A;  1I27 A;  4I1M A;  4IRI A;  2XM0 A;  4XTK A;  5AON A;  4ZLD A;  3HNK A;  2DT6 A;  1QPM A;  3FXH A;  3HTS B;  1X4P A;  2DI3 A;  3PSI A;  5TRD A;  4EJT A;  3D5L A;  4IAQ A;  2P4W A;  4EM2 A;  1M2V B;  1KYW A;  2CMP A;  3N24 A;  4UVC A;  3H5A A;  3KZI C;  2OTL I;  2NNN A;  3OL4 A;  3B0P A;  3G1O A;  3TMO A;  4ESJ A;  1ZG5 A;  3OA1 A;  2V1N A;  1ZEL A;  3KEQ A;  2FNP A;  4JYK A;  2VN2 A;  2OJE D;  3COA C;  1D3Y A;  1OR3 A;  5AC5 A;  5JFR A;  1X2N A;  2ZXW H;  1YZA A;  2KQ9 A;  3BG3 A;  3DI5 A;  2DFF A;  5DS6 A;  3GCM A;  4CX9 A;  3GTQ J;  1SEU A;  2PJR A;  3DAF A;  2XF5 A;  4C7O B;  5HS9 A;  1DOV A;  4XWJ A;  1B4A A;  1T6U A;  5F0F A;  1WJA A;  1T95 A;  1UZC A;  1XSX A;  1U5T A;  3PNV A;  4O7G A;  1T6S A;  1XWJ A;  1YQA A;  2EIM H;  2WVO A;  2FOK A;  4RBO A;  1V4A A;  2XAQ A;  2WAQ A;  1YJ9 I;  4CSA C;  1VQK I;  4PJN A;  4CS9 C;  1PJR A;  3JSE O;  3QYF A;  4HX4 A;  3VSL A;  4ABZ A;  2KJB A; 
#chains in the Genus database with same CATH homology
 2IXS A;  3H0D A;  3ABM C;  1VZ0 A;  3SEQ A;  4A2N B;  2XRH A;  2XDV A;  2WB7 A;  4OD4 A;  3UGO A;  1Z63 A;  3F46 A;  3OL3 A;  4HST A;  2IYL D;  4YJW A;  2WAE A;  1WJ5 A;  3OEO A;  2WB1 A;  3C2H A;  2H7B A;  5E3A A;  2VPL A;  2D5R B;  2R4G A;  3KH2 A;  2VJ5 A;  2X51 A;  2ZSH B;  3SEZ A;  3VYR B;  1FMW A;  3NRH A;  2M7A A;  1D1B A;  1DQU A;  4PFO A;  1TWG A;  3SNH A;  2A6H F;  4U5D E;  2K9M A;  1NG1 A;  1ZHY A;  3CJR B;  4JZA A;  1MND A;  4G7Z F;  1D0Z A;  3K1H A;  1X1A A;  3LLK A;  3OS1 A;  4G7H F;  2HPI A;  2L2O A;  3LFU A;  2HVQ A;  1V5G A;  1JI8 A;  2XSE A;  5HNH A;  4N06 A;  5KYN A;  2E1M B;  3JYH A;  2F6C A;  2Q2E B;  2VJI A;  2VLA A;  4F4B A;  4U5G A;  4B43 A;  2R7Q A;  2Y0S A;  3ECS A;  3BCB A;  3Q7L A;  1QHH D;  4XR6 A;  4E7J A;  2IS1 A;  3TBI A;  4IRU A;  2L7K A;  3KKB A;  2CH0 A;  4CSW A;  2O9X A;  4ANJ A;  2ZXI A;  2KL4 A;  3OYN A;  4FES A;  4O6Y A;  4Q5S F;  3O39 A;  3OS2 A;  3GOD A;  2G3K A;  3W8H A;  3DPU A;  2Y3D A;  3S28 A;  1TWH A;  4C3B A;  2M4E A;  4DVY P;  2M7B A;  1MNE A;  4U7B A;  2L9S A;  1W36 D;  3KMI A;  2Z2S B;  4BL0 B;  3UMK A;  4F52 A;  2W45 A;  3ASO C;  2JA2 A;  3FBI B;  3JRT A;  3OOU A;  2M0M A;  2DXI A;  4U5F E;  3UMI A;  5DS5 A;  3PJR A;  3DXJ F;  4RBN A;  1X4O A;  1SZI A;  4XKB A;  4IWB A;  3JSZ A;  3VDX A;  2WZG A;  3QYB A;  2A69 F;  2ZPA A;  2IGO A;  2YZS A;  3EGD B;  2AQE A;  4P1W A;  2B0J A;  2X6W A;  3EGX B;  2VQH A;  3EH2 A;  1LKX A;  4JJG A;  5KYW A;  4D1Q A;  3A1Y A;  3LS1 A;  2WY7 Q;  1EA3 A;  2X6X A;  3AG2 C;  2R7T A;  3DZA A;  1SF8 A;  2DCE A;  3K4N A;  3HG9 A;  4LLE A;  2PX3 A;  3LAY A;  3AKZ A;  1OKK D;  4BE0 A;  4QI0 A;  1WFX A;  4YT5 A;  3OMY A;  4FAS D;  3MKY B;  4BEJ A;  3LEV A;  4ULW A;  2IS6 A;  1LDK B;  1OCC C;  1LS1 A;  1IRX A;  4NUB A;  4IKF A;  1M56 C;  4BGD A;  4B48 A;  4F55 A;  1RJ9 A;  2X1E A;  4C30 A;  4BDY A;  2VB6 A;  1VYK A;  2KZV A;  4BJ5 C;  1E0E A;  4NY3 A;  3E1S A;  4CCJ A;  2LBF A;  3CJQ B;  3TD7 A;  5L3V A;  4C7O B;  3MLG A;  4IZZ A;  4HRI A;  3EZI A;  3IAM 2;  3TL4 X;  5CKT A;  5JHF A;  3S8P A;  1GLN A;  3L2V A;  1NG7 A;  1PD0 A;  4BJ1 A;  2RNG A;  5DQT A;  2R7R A;  3RKO F;  2MAB A;  3PHF 2;  3FBN B;  3DKX A;  2HNH A;  1FMV A;  1V5F A;  1MW7 A;  1Z21 A;  2DT7 B;  2LH9 A;  3HL2 A;  1V5E A;  4E7I A;  2IS2 A;  2ZXW C;  3ZVR A;  2H7V C;  2CS3 A;  5BUO A;  5D91 A;  2G3V A;  2W82 A;  2VXD A;  2X1D A;  3H65 A;  1YX3 A;  2XAU A;  2V4J C;  2IXN A;  2WAD A;  1ZHX A;  4RLF A;  3UNG C;  3SZG A;  2R7U A;  3CES A;  3W8I A;  2PFD A;  2NOJ B;  2IGN A;  2W00 A;  3IP4 B;  4U87 A;  2Z1D A;  2QTV A;  3AG3 C;  4KNV A;  5KYX A;  2K9L A;  4II2 A;  3HOT A;  2R7S A;  3V7O A;  4B6I A;  4ZDL A;  5LD2 C;  2P7V A;  1R6R A;  1X1D A;  4KIT B;  3DEE A;  3M1C A;  2Y39 A;  5B3S C;  5KYW B;  3CSK A;  4O79 A;  2EIM C;  4W8K A;  2VKD A;  3I5P A;  1TR2 A;  1D0X A;  2O5R A;  3SEO A;  2WZF A;  3EG9 B;  2WAF A;  3U21 A;  3EFO A;  3OWT A;  3K1I C;  4CH7 A;  2BVM A;  2KLO A;  3ABK C;  4XOP A;  2MYS A;  3LSH A;  4HNT A;  1TWA A;  2CV0 A;  5DS4 A;  2A6T A;  3HKZ A;  4XQF A;  2KGO A;  3FDQ A;  3HPG A;  4Q4Z F;  3BG6 A;  1N77 A;  1N1C A;  1O5H A;  2FFH A;  3JT1 A;  4XLC A;  4OD5 A;  3DTK A;  4GRI A;  3S32 A;  3DTE A;  4NNJ A;  3HJC A;  3W3C A;  2LBF B;  3VSK A;  2A1D D;  2G62 A;  3AG1 C;  3G2B A;  3QYE A;  4HSR A;  3OY9 A;  3K6B A;  1VYI A;  4MQ9 F;  2R7O A;  2KHM A;  3K4J A;  5CQG A;  3K4B A;  4CCN A;  4OAZ A;  4E4H A;  4JW1 A;  4XNF A;  3B0V C;  1X1B A;  2F4I A;  4JQF A;  4M63 A;  4D9J A;  2CUZ A;  2KDO A;  3OYB A;  2VIX A;  2UWM A;  4RLQ A;  3FHN A;  2FUG 2;  2VKH A;  3DM9 B;  4XKV A;  4BE1 A;  4PK4 A;  2HU9 A;  1N78 A;  3K10 A;  3M8J A;  1ST6 A;  4R79 A;  2NUT A;  3GAN A;  3EZH A;  3PL8 A;  3PUB A;  5KNL A;  2A68 F;  3CP2 A;  1BR1 A;  3DKY A;  1X1C A;  3AFH A;  3AQC A;  3KEY A;  5CI8 A;  2VAS A;  4PSW A;  2HQA A;  2QKM B;  2R7X A;  4C9Y A;  4IX7 A;  4DIQ A;  3ZIB A;  4CS8 A;  3MX3 A;  5KYX B;  2L9N A;  3E9V A;  4ZC3 A;  5E3C A;  3T4R A;  4CIH A;  3M1C B;  3B0U X;  1U0J A;  3D5S C;  3I3L A;  4JCH A;  5B1B C;  3POV A;  4YRV A;  1KU2 A;  1WJB A;  2OUM A;  2FGY A;  3ZCO A;  3EUH C;  2W7N A;  3EFO B;  4OIQ F;  3DLA A;  1OKK A;  2IGM A;  1P9Q C;  3J7A Y;  3E70 C;  3RCO A;  4C2T A;  3OYH A;  4ZTJ A;  1O87 A;  4LER A;  3SP1 A;  1NZE A;  2BVL A;  5HVQ C;  4CCM A;  2NUP B;  2GFH A;  4ZTF A;  4KIS A;  1YX5 A;  4CS7 A;  2BW3 A;  2PJR B;  4BQO A;  3AL0 C;  4HE8 D;  1VK5 A;  4CA0 A;  2L9J A;  3H5R A;  3I9V 2;  3DPT A;  3OYA A;  3L2R A;  2ELJ A;  1ZYR F;  4BJ5 A;  4EWC A;  4DOZ A;  4AK9 A;  4C3D A;  2P6V A;  4DBQ A;  2E87 A;  3NYJ A;  3CF2 A;  4ZJZ A;  3H9Q A;  3GBG A;  4E7S A;  2KP6 A;  5HNF A;  4N4O B;  1BOB A;  2Y69 C;  3AQB A;  3T6J A;  2CUJ A;  2CW7 A;  2OV7 A;  4KJZ A;  4RD9 A;  3K66 A;  4KC9 A;  2HZD A;  3DTI A;  2VH3 A;  3H9G A;  2X6Y A;  3NWS A;  4BDZ A;  3Q6M A;  5TGT A;  4LG3 A;  3E0J B;  3OS0 A;  4CS8 C;  5IY5 C;  1J09 A;  1J8M F;  1J8Y F;  5KYY A;  3DWL E;  4DVZ A;  2W1O A;  2WY8 Q;  2KJG A;  2W9Y A;  2ZSI B;  4AE4 A;  4OWR B;  4E7L A;  4FET A;  3ZGK A;  4E6K G;  3ZSU A;  2QKL B;  2M3A A;  3LSM A;  2J7P D;  4XN0 A;  1WJC A;  1JPJ A;  4XOT A;  1TKN A;  3F47 A;  4E7K A;  3RQ4 A;  1Z23 A;  4U5C E;  3SYN A;  4PSX A;  4K0D A;  4BEH A;  3A2K A;  3EHM A;  2R7W A;  3UR3 C;  4G6T B;  4PJM A;  4PJJ A;  4ZDP A;  4BS9 A;  2KNH A;  2KW3 C;  3WOD F;  2CFO A;  4JOM A;  2W4B A;  1FFH A;  3K4L A;  3QOD A;  1WJE A;  1QHG A;  1M2O A;  4BU2 A;  2LYC A;  4RM2 A;  2C04 A;  4PFP A;  2KRH A;  3PNY A;  5KCM A;  2UUZ A;  2IS4 A;  2JVG A;  4BUP A;  4AU7 A;  2WVQ A;  1X19 A;  2CNW A;  3OYK A;  1FTS A;  4YN0 B;  1G59 A;  3ZRG A;  4MND A;  2DJI A;  3SZR A;  2WVN A;  4IQ4 A;  2IOQ A;  2J45 A;  2BOL A;  4LAC B;  3OYC A;  3H35 A;  4HNU A;  2GOM A;  2DYR C;  1Z3Y A;  2VQC A;  3OYM A;  4HEA J;  3IAS 2;  2JD3 A;  1LVK A;  2HDW A;  4K7B A;  4WJ0 A;  3VYW A;  3NKD A;  2Q9B A;  4IJJ A;  2Q3T A;  3BG7 A;  1DGW Y;  1S9H A;  3W2V A;  2L81 A;  3HLZ A;  4FWV A;  2KPM A;  4J32 B;  3OIQ A;  4LIV A;  3EHN A;  1BR2 A;  1D1C A;  2LC2 A;  3N2Z B;  2XSJ C;  5B1A C;  2MC4 A;  2PP4 A;  3LS0 A;  3FVY A;  1TZL A;  4AE4 B;  2AQF A;  1S7Z A;  4RDA A;  3CZ6 A;  3K6G A;  3HPH A;  2DOA A;  2EIK C;  2OC6 A;  4XLE A;  2V6E A;  2Z16 A;  2IXO A;  4CCK A;  4DGW B;  4BAC A;  1Z5Z A;  4BEH B;  4ITV A;  3LL7 A;  1UEL B;  5HLT A;  4ZDO A;  1NU7 D;  3DJN B;  4IAO A;  4YWQ A;  3LSI A;  1DGR M;  3S3N A;  2LSE A;  4XL9 A;  3OYD A;  4QPQ A;  4YT2 A;  4XN3 A;  3UMH A;  4HFK B;  1VOM A;  3FKJ A;  3VAY A;  1Y6I A;  3NDB B;  2KMU A;  3RFY A;  2EIN C;  2VJ4 A;  3KX2 A;  4CBE A;  3S0X A;  4EBB A;  1RJ9 B;  1Z3I X;  4JUR I;  2XXA A;  3MKZ A;  1ERD A;  1ZHT A;  1ZHW A;  3C2G A;  1JPN A;  1WJF A;  4CZC A;  5FRN A;  3D5R C;  5FCL A;  5F5H A;  2OCC C;  3K70 D;  4Y3O A;  1V54 C;  3LNR A;  2CW8 A;  2RRE A;  5KHD A;  4Y33 A;  2C03 A;  1M57 C;  4XM3 A;  4F3Q A;  4NC8 A;  3Q7G A;  1MMG A;  2V7F A;  1MMN A;  4CCL A;  4OIR F;  3BCA A;  3HC7 A;  3OYF A;  2J0X A;  5DLJ A;  3S93 A;  2I8B A;  2A6E F;  2H7O A;  4O6M A;  4HEA 2;  3EUK L;  4U5B E;  3K7D A;  2QY9 A;  1OCO C;  2LRE A;  2WBM A;  1OLT A;  5FRM A;  2F5V A;  2KRC A;  3S27 A;  1Z3X A;  2EIL C;  4XLH A;  4Y4R A;  2X85 A;  4P5O A;  3HUG B;  4KNW A;  3IUO A;  4QPO A;  2JUG A;  4J00 A;  3L2Q A;  4BE2 A;  5F5F A;  4J30 B;  3L34 A;  5T3W A;  4XON A;  3QZC A;  5CPR B;  3RPU D;  2IGK A;  1MMD A;  4LLC A;  2ZFU A;  1BR4 A;  2WA0 A;  3F9K A;  2LG4 A;  1UAA A;  4G7O F;  3DQV C;  4O6N A;  3DJU B;  3DU5 A;  4OAY A;  2YHS A;  2J9U A;  3LJB A;  2VXZ A;  3A4C A;  3OR1 C;  3IEE A;  5D92 A;  3RTR A;  2R7V A;  1DP3 A;  3W2A A;  4OIN F;  2Y3B A;  3PSF A;  2EIJ C;  1D0Y A;  3SDB A;  3KYL A;  1T0F C;  2GOX B;  2IXP A;  3K4K A;  3EGD A;  3EGX A;  4GYT A;  3OYJ A;  2XXA B;  2P0W A;  3OR2 C;  4PUS A;  4NQW B;  2Q1Z B;  5FRO A;  3ZXS A;  3DD7 A;  3FHD A;  4X0G A;  3PFY A;  3AL0 B;  1WGW A;  3ASN C;  1HA8 A;  4IQJ A;  4OIP F;  3O6X A;  4KT6 A;  3ZQQ A;  1WJD A;  1TWC A;  3N0T A;  4QDL A;  5LFA A;  2ZXR A;  3RH3 A;  5T1D B;  1SFK A;  5EHH A;  4LIU A;  1W36 C;  4XMY A;  2LRD A;  4XLF A;  1SMY F;  3DAG A;  3I5Q A;  1ZU5 A;  2J0W A;  4J01 A;  2E1M C;  2E5N A;  4X0R A;  3EH1 A;  2NUT B;  2MWQ A;  3DU6 A;  2YEV A;  5HSW A;  3DM5 A;  3ABL C;  3MMY B;  2K5C A;  3MKW B;  2PF4 E;  3ITF A;  3OYG A;  3EUA A;  4XKC A;  2CGE A;  3S3O A;  4ZYA A;  1IW7 F;  4RMN A;  3RSN A;  2PMZ A;  2Q9A A;  3X1O A;  3B9Q A;  2I8D A;  5HOO A;  2A5W A;  3K4C A;  3NKE A;  2PX0 A;  3EPV A;  2L5Q A;  3L2W A;  3CP8 A;  4FX5 A;  2JVH A;  2WZL A;  3QMK A;  1IZM A;  4KBL A;  4BG0 A;  1KON A;  1N75 A;  4XKW A;  2CV1 A;  1G8X A;  4AYB A;  5CQE A;  3OYI A;  3L2U A;  3KL4 A;  4Q7C A;  3DMD A;  3BC8 A;  4XOR A;  1AA7 A;  3FDY A;  3NYL A;  2J46 A;  3VWB A;  2XL4 A;  1OR7 C;  4I1O B;  1VMA A;  4F93 B;  3LSG A;  3EQL F;  3I4U A;  4I3M A;  3S29 A;  3ZG1 A;  2M4G A;  4II3 A;  3DPL C;  4DBR A;  1Z6A A;  2BW3 B;  1D1A A;  2CW0 F;  4E7Z A;  3V42 A;  2DGJ A;  4OIO F;  2RQQ A;  1M2V A;  1PCX A;  4XLP F;  3NWT A;  4HFF B;  4EAT A;  4RM3 A;  2HVR A;  4YT4 A;  2V9K A;  4B3X A;  4KI2 A;  3EG9 A;  5E2Q A;  2W4M A;  4CCO A;  3ONQ A;  1NU9 C;  1UG0 A;  5E33 A;  1W2W A;  4XLA A;  3K33 A;  3T6B A;  2Z15 A;  3VYT B;  3PMR A;  4U5E E;  3LSK A;  3LMM A;  1ZHZ A;  3EJN A;  3OYL A;  3RIP A;  4YEJ A;  1FFT C;  2J9W A;  4QI2 A;  3JCU Q;  3K4M A;  1MMA A;  2Y3G A;  3W2W A;  1K6Y A;  3BLY A;  2OG2 A;  3L0I A;  5KYY B;  4JVS A;  5L3Q A;  2LOO A;  4MLO A;  2XC7 A;  3HOS A;  4BJT A;  2DYS C;  4C7O A;  3AG4 C;  2MFZ A;  4BJ6 A;  1V55 C;  2Y3H A;  2V26 A;  3N05 A;  4DJA A;  4P6I C;  1Y56 A;  3UGP A;  2M4K A;  4HG2 A;  3CQZ A;  4B47 A;  4E7H A;  2HVS A;  2WL8 A;  5KYU A;  4B44 A;  2CV2 A;  3HTK C;  4NC7 A;  4U5H A;  2UV1 A;  4PJL A;  3S3M A;  4F92 B;  1NG6 A;  2W4S A;  2LY2 A;  4H4K C;  4LIT A;  2E60 A;  5T3T A;  2CDQ A;  2VQL A;  4AX2 A;  2VL8 A;  2XF6 A;  4G0H A;  4C2U A;  4GEH A;  4YEL A;  4CSA A;  3NYM A;  4BQN A;  4AVZ A;  4CS9 A;  4ZLC A;  3MD2 A;  3OYE A;  3CMM A;  4BXF A;  4I1M A;  4HPQ A;  1ZU4 A;  4ZLD A;  1QU3 A;  4XTK A;  2DT6 A;  3LLI A;  5DVW A;  1X4P A;  3OIP A;  2K3P A;  1Z7L A;  3PSI A;  3LES A;  1YE9 A;  2MD0 A;  3D5L A;  3X2Q C;  3K70 C;  3H5N A;  3VYU B;  3NG1 A;  1OCZ C;  1M2V B;  2X1C A;  1PYV A;  2CMP A;  4YT8 A;  3N24 A;  3H5A A;  2HV7 A;  2KQR A;  3OL4 A;  2IXM A;  3B0P A;  3TMO A;  3OA1 A;  2ZXP A;  2V1N A;  1ZEL A;  2VJJ A;  2XF7 A;  2HPM A;  2BE5 F;  4N4N B;  3RYL A;  2HV6 A;  3FAJ A;  2KQ9 A;  2NUP A;  5DS6 A;  2CNW D;  2JSP A;  3EPZ A;  4BJ6 C;  1OCR C;  2ZXH A;  2PJR A;  3DAF A;  5CI9 A;  2XF5 A;  4C3E A;  3H9J A;  2ZXO A;  4I44 A;  3ZR8 X;  3HXL A;  2NG1 A;  4XWJ A;  1SAU A;  5DQZ A;  1TT0 A;  2E5Z A;  1WJA A;  2LY1 A;  1T95 A;  1PD1 A;  4XLN F;  4CUG A;  5EGY A;  3PNV A;  1QZX A;  4O7G A;  1LFP A;  3ZC4 A;  2VQG A;  1QLE C;  2V3C C;  2J7P A;  3PNT A;  4F91 B;  5KYU B;  3Q6N A;  3SYT A;  2WVO A;  4BQQ A;  4JJF A;  3WG7 C;  4CSA C;  3QOE A;  2WAQ A;  4PJN A;  2Q9C A;  4CS9 C;  1PJR A;  2J9V A;  3QYF A;  3VSL A;  3VYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...