2W45A

Epstein-barr virus alkaline nuclease
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
460
structure length
449
Chain Sequence
LEDPMEEMTSYTFARFLRSPETEAFVRNLDRPPQMPAMRFVYLYCLCKQIQEFSGETGFCDFVSSLVQEDGPSLKSIYWGLQEATDEQRTVLCSYVESMTRGQSENLMWDILRNGIISSSKLLSTIKNGPTKVFEPAFGGPVAFGLRCEDTVKDIVCKLICGDASANRQFGFMISPTDGIFGVSLDLCVNVESQGDFILFTDRSCIYEIKCRFKYLFSKSEFDPIYPSYTALYKRPCKRSFIRFINSIARPTVEYVPDGRLPSEGDYLLTQDEAWNLKDVRKRKLGPGHDLVADSLAANRGVESMLYVMTDPSENAGRIGIKDRVPVNIFINPRHNYFYQVLLQYKIVGDYVRHSGGGKPGRDCSPRVNIVTAFFRKRSPLDPATCTLGSDLLLDASVEIPVAVLVTPVVLPDSVIRKTLSTAAGSWKAYADNTFDTAPWVPSGLFADD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALKALINE EXONUCLEASE
publication title A Bridge Crosses the Active Site Canyon of the Epstein-Barr Virus Nuclease with DNase and Rnase Activity.
pubmed doi rcsb
source organism Human herpesvirus 4
total genus 142
structure length 449
sequence length 460
chains with identical sequence B
ec nomenclature ec 3.1.11.-:
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01771 Viral_alk_exo Viral alkaline exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.860 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w45A01
3POVA 3FHDA 2W4BA 5HSWA 2W45A
chains in the Genus database with same CATH superfamily
4FX5A 3LEVA 2R7RA 1OKKD 1VB5A 1NFOA 1HE9A 3CSKA 4LDRA 1U0BB 2L9JA 2XM0A 4E18A 4CDVA 1NZEA 2IOQA 3EQLF 2AU5A 4MVRA 2Y69C 4E0IA 4C3BA 4MW8A 3DZAA 2Q7RA 1FTSA 3S0XA 3LLIA 3T6JA 4LERA 2WVNA 4U5DE 3LESA 1HW1A 5BQGA 3MLGA 2XL4A 4YK5A 4DRHB 1E83A 3BRJA 4BJ6C 1WASA 1O87A 3E70C 4WGZA 2YZSA 4YN0B 2YL0A 2RSEB 1TR2A 3ATPA 4JJGA 4HE8D 1T9KA 4QI0A 2ZPAA 2YWAA 3DI5A 1YZCA 3KYJA 3V5XA 3W8HA 4O6MA 4MVMA 3C8GD 3JRTA 1J8YF 4H54A 4JTAB 2V26A 4KNVA 3QMKA 4O7GA 3VRCA 2R7WA 1LI7A 3ASNC 1A0BA 2KC3A 5FZTA 2OQMA 4P6IC 4MVSA 4U5HA 1ZU4A 5JS5A 2H7VC 2NG1A 1JAFA 1FFHA 1YYJA 1Y4CA 2J9BA 2W45A 1HMDA 3CEXA 3JZ0A 2CDQA 4IB4A 1AVOB 3RQFA 2OOCA 5KYNA 5L3QA 4NY3A 2VASA 5COFA 2QTVA 3UMIA 3H2UA 2A69F 4BJ5A 1JOGA 3B0PA 2NSFA 2FAPB 4DBQA 2OU6A 4RDAA 1BDJB 3I5PA 4U5CE 1TFKB 4MVZA 1LM3B 3TJ6A 2L81A 5BUOA 5F5HA 4JTCB 3JSEO 4MNDA 3RQEA 4JE9A 4WGYA 2A6EF 4N6CA 5GPGB 3TK0A 2J7PD 3B29A 1NFNA 1OQCA 5FCLA 1Z3IX 2C03A 2J9UA 1T6IA 3EPVA 3AG2C 3MX3A 2IXPA 4JRZA 4W8KA 3U3FA 3WAQA 1RCPA 1Z63A 1ZHYA 2OJED 3GORA 4XEFA 1NG1A 1M2VB 2CNWD 2P6VA 1ST6A 2I15A 2PNOA 3FXHA 3GWLA 3B71A 3U9MA 3G4XA 3NDBB 3FVYA 1F1MA 2YRFA 3ZVRA 1OW6A 2DYSC 1D0YA 1NSGB 2J9VA 3NYMA 4G0HA 5D92A 2JD3A 4XPYA 1Q0GA 2TMVP 1LS1A 2HUJA 2H7OA 2YL1A 4D4XA 4BPMA 5DQTA 3NKEA 4YL3A 1HY5A 2J8WA 2NUTB 4CS7A 2DGJA 1JR8A 4BJ1A 1H9TA 2Q4FA 5KYXB 4JKVA 4YT5A 1VLSA 4W8PA 2HSQA 5BQIA 5A69A 1RKCA 1ZHWA 2A1DD 1K40A 2XL8A 3SXZA 5EHHA 2XLEA 4JW1A 3ABKC 1SYQA 3EGXB 3GWNA 1A7DA 4N4WA 2Y3BA 1QZXA 2BC5A 1R4TA 2YLGA 3TJ5A 2KJGA 2R05A 2HMZA 3HJCA 4EHPA 2Q00A 2MYSA 3NRHA 3U0CA 4JVSA 3S27A 1FMVA 4Z9IA 2MWQA 1TWHA 3RQGA 1SMYF 2XM4A 4CJOA 4MVOA 3O6XA 4Z9HA 3M15A 3JT1A 2WB7A 4PR9A 3FOOA 4IARA 2XLMA 4JCZA 2XLHA 1ZW2A 3X2QC 2P1AA 2LIGA 3DE8A 1AUEA 5JP7A 4AE4B 1E85A 3K1IC 4J7YA 4Q5SF 2XLVA 5KYWB 4G7OF 3DJUB 4R32A 1OCCC 1QLEC 4F4BA 4Q4ZF 3U2LA 1M2VA 2LCHA 3Q7LA 2QLAA 1A41A 3DAGA 2IYLD 2ZXWC 1D0ZA 3K7DA 3L1MA 2G3VA 4K0DA 4EIYA 3DAFA 3TQOA 4O6YA 2W9YA 1L7CA 4DVYP 1ZHXA 3SNHA 1CPRA 3ZSUA 3F46A 2W4BA 1V54C 3QZCA 4DRIB 1FNTc 3PMRA 2R02A 2L7AA 3KL4A 5DLJA 1CGME 1I5NA 2EPOA 2Y3HA 1OCZC 3NG1A 2NUTA 5A6JA 3HLZA 1WGWA 2XLDA 2GDCA 4HFKB 2BL2A 2LQGA 2R9RB 1SR2A 2WZLA 3QW0A 3RKOF 3WG7C 5KYXA 4C3EA 1ZZPA 4LLEA 1OCOC 1BZ4A 1V55C 2X51A 2Y39A 4JZAA 3SXMA 3L8JA 1LPEA 1T6QA 2F22A 4MTFA 3EGXA 4ONSA 2DYRC 4GQHA 2OJQA 1H9GA 3AG1C 4EUKB 1G4WR 3N2ZB 5L0GA 4C7OB 3C8ZA 2ZXRA 1C03A 5F28E 1HMOA 1ZVZA 3EZHA 2VCBA 3NYLA 4H4KC 3L34A 3UR3C 2PX0A 4P9FA 1MQVA 4ULVA 1RXQA 1S05A 1G5ZA 1TFOB 1V4AA 3W2VA 4CSAA 1C02A 1QKRA 5T1DB 4AE4A 3KPHA 4A2NB 4DBRA 3K66A 5BQHA 2P61A 3A9CA 3C7JA 5TJ5E 1V74B 3QVZA 2KK1A 3R2PA 5HSWA 1LE2A 1R5ID 1T01A 3G50A 3M1CB 4LDQA 5HV9A 3EH1A 4MW3A 3RVYA 4ANJA 1EA8A 2A0BA 4LDKA 3DJNB 3SZRA 4CS9C 5L0DA 256BA 1WOLA 1LKXA 2PF4E 4LLCA 5COMA 2VH3A 1M6TA 1YARO 1FAPB 2AWCA 2L6FA 2DI3A 3FAPB 3LNRA 2UUIA 4YT2A 1OR3A 4OIQF 3KYIA 3RF3A 2L6GA 4E0HA 4AX2A 1JMWA 2FFHA 2PP4A 2XRHA 3AQCA 4IGGA 4XPWA 4HFFB 1H6GA 3HKKA 4CBEA 3AQBA 3E9VA 3K1HA 3PDMP 2JX0A 3V5ZA 4XQ1A 1RKEB 3ASOC 4LACB 4NTBA 3OWTA 4GEHA 5E33A 3ZIBA 5B3IA 2M4EA 1VTMP 2VC9A 4K1OA 4NTFA 4AL1A 3NKDA 4BG0A 3JTLO 5JVEA 4BJTA 2Q9AA 2YQYA 1E84A 4I44A 1VK5A 3LS1A 1M56C 4MTGA 4O6NA 4QI2A 2AWYA 2EPNA 4E7SA 1MMAA 2OEVA 2EPMX 3M79A 2GA0A 1MMGA 3NMIA 4C7OA 1TKNA 2R03A 1WWPA 2WVQA 3SXYA 1APCA 3X1OA 2XS1A 4EBKA 2XSEA 1KNYA 1M57C 1YYXA 4NTAA 2H7BA 2ASRA 3Q6NA 3O39A 2QUPA 5T3TA 4PACA 1CGOA 3I4UA 3IEEA 4PJNA 4YL1A 4I1OB 4MTOA 2EPLX 1NU7D 1PD1A 4YJWA 2L6HA 3EGDB 4CS8A 2LD6A 2Y3DA 2JPUA 2M64A 4U5EE 1ZHTA 4JIOA 2EIMC 5KYYA 4ULWA 5DS6A 1SZIA 4PK4A 2GWWA 2R25A 5D91A 5DQZA 3S29A 3K6BA 3T4RA 2Q3TA 2XLOA 2HS5A 1MMNA 1PV3A 2P7VA 3N24A 2PX3A 3RH3A 3U5SA 1VLTA 4G7HF 5AGFA 3LS0A 4JURI 5COGA 2A68F 3IQ6A 4E17A 2A0UA 5A6KA 1QPUA 3AGTA 2D4UA 3DKAA 3FOPA 1TWGA 3LJBA 4QDLA 2CYDA 1I4YA 1RJ9B 4M63A 4XWJA 4DOZA 3EJNA 3LNMB 3K33A 5L0IA 2AVKA 3VF0A 1RKEA 1U6HA 2IXOA 2UUHA 2EIKC 3ZQYA 4A4AA 4CIHA 1T5OA 3NMJA 5JLIA 2J0WA 2LFFA 1LIHA 1BBHA 1UFBA 3UNGC 2I8BA 3V5YA 4DJ9A 1DOWA 3R7CA 3PCVA 2G3KA 2V3CC 3B9QA 3FMSA 4KBLA 4C3DA 2XS8A 5JRAA 3Q6MA 1QQ3A 1VYKA 1N1CA 2HFIA 3HNJA 1G8XA 2HJ3A 3T9OA 4IJJA 3C62A 4CDYA 1AEPA 2ZD9A 1TWCA 3T6GB 4ZLCA 3GEEA 5L3VA 4MVUA 4PJMA 3S84A 3GEIA 3MYIA 1YDIA 4Z9JA 4EWCA 2J45A 2QY9A 4YT4A 1JPJA 4YL0A 3EGDA 4J32B 2PFDA 5KYUB 4WABA 1H7IA 3VAYA 2J9WA 3W2WA 2HV6A 3WHNA 4K7BA 5L0HA 1YLMA 5E3AA 1PD0A 3CAXA 3GEHA 2IXMA 2J7PA 2KGOA 3FHDA 2IXNA 5L0JA 3ZG1A 3UMHA 1QSPA 3JCUQ 3VYWA 1W2WA 2AP3A 4AK9A 4OD4A 4RD9A 2KYHA 3M4CA 1A7VA 4YWQA 1YJGA 3H2VA 4U9EA 2J46A 1JPNA 2DB4A 3L8IA 2WZGA 4FWVA 4MVQA 5B3SC 2P0NA 3U9JA 3GM1A 1ZHZA 1OXBA 2NUPB 1HE1A 1YA7O 1RJ9A 2YVKA 3I5QA 5T3WA 5A6AA 1FR0A 3LEOA 3U8PA 3K1IA 1MNEA 3DM5A 3EZIA 3EH2A 4UDVA 5A6BA 4U5GA 3GM2A 4WJ0A 3TD7A 2Q9BA 3GANA 5L0CA 2VCAA 4AL0A 3JRMO 2Q9CA 4PFOA 4X0RA 3AG3C 3HNKA 4G7ZF 3KMIA 5L0FA 4CDAA 3ZWIA 4IAOA 2FGYA 3DXJF 1EQ1A 5B1AC 3MYFA 4BJ5C 3IQCA 3ABLC 3L0IA 5KYWA 1EKYA 2EIJC 3S90A 2YL7A 3CZ6A 1ORYA 5E3CA 1MMDA 4N6HA 1BR2A 2OEXA 1OR2A 1TWAA 2H8AA 2W4MA 2NPUA 2Z15A 2MHRA 1LE4A 5KYYB 2PBEA 2NSGA 1D0XA 1Q0FA 3JSZA 5KYUA 3ZQVA 3KH2A 1D1AA 4ZLDA 2KW3C 1ZYRF 1NLXA 3TOLA 4FAPB 3IHUA 4KNWA 2IBFA 2RD9A 5DS4A 2QE9A 4E7ZA 2R7OA 2ZXOA 1I4ZA 1O5HA 3U2MA 4I3MA 3SEOA 3PHF2 2ICWG 2ZXPA 2OKUA 5DS5A 1E86A 2R7SA 4I1MA 3MBGA 2R7VA 3EHNA 3IPMO 3US6A 4DXWA 3UMKA 1O3UA 2B0JA 3C8GB 4U5BE 1Z5ZA 2R7UA 2ETSA 1XWJA 1LVKA 2R7XA 1Z7Qc 4OIRF 3SYNA 3Q7GA 4BEMJ 3DE9A 2XLWA 1IW7F 4FESA 4CS8C 3ZDLA 1Y6DA 2CGEA 5DVWA 4BJ6A 4YT8A 2NUPA 1M2OA 2EPKX 3WODF 1WATA 5CIVA 5EK0A 1C17M 3QTHA 5E2QA 3RW0A 1A7EA 2GAQA 3RVZA 1VMAA 3AJMA 1Q0KA 1Q0MA 3M4BA 4Q7CA 4G78A 5K0IA 1IZMA 1DOVA 1YAUO 3ZC4A 3KKBA 4J30B 1K04A 1CGNA 4MS2A 1FFTC 1OCRC 1T6UA 2IM8A 1CPQA 2YHSA 4RBNA 3RIPA 5JT4A 1D1BA 3TULA 3O10A 1Q0DA 3LUTB 2XXAB 4CS9A 4IAQA 3VM6A 3W4YA 3SP1A 3B0UX 3ZTMA 2OCCC 4OIPF 2WL8A 3CQZA 2WZFA 4U5FE 5EGYA 4HEAJ 4IWBA 3B0VC 4L6RA 4JC7A 4XEVA 4DVZA 3UGPA 3EHMA 1OKKA 3ECSA 1HW2A 1OW8A 2HSBA 3W8IA 3ZTZA 2B0HA 3TOMA 2G62A 3J06A 3GODA 2KNHA 2WVOA 4BEJA 1YZAA 1TQGA 3AOUA 4JEAA 3G4ZA 4XTKA 5B1BC 3JYHA 1KU2A 1U89A 2J0XA 3S9OA 4EBBA 3UGOA 5CI9A 4CJGA 2D5RB 1G4US 3NYJA 2LFDA 2HZ8A 3O55A 1RMVA 4NCQA 3OEOA 3SXKA 3A11A 2X0CA 4XLPF 3GM3A 4NQFA 4U9DA 4JTDB 4D4NA 2HMQA 2Y3GA 5A6BD 2R7TA 2EINC 1XZQA 4NC3A 2QNLA 2LSEA 2YL3A 1KTMA 4CX9A 4B6IA 4J7TA 3U3BA 2O9XA 3EFOB 3HNIA 4KC9A 1D1CA 4PFPA 1L3PA 3HNLA 1LS4A 3C8GA 3POVA 4OIOF 3V7OA 2C04A 4GYTA 4DRJB 1PCXA 2OG2A 1XZPA 3DMDA 1ZW3A 3EG9B 3HTKC 2VB6A 1OXKA 4N06A 4XLNF 3QW1A 1J8MF 5JUAA 3JYYA 3LAYA 3QVYA 2GFHA 4PJLA 1BR1A 1WN0A 3C18A 3H65A 3FAJA 2CW0F 3AG4C 2EILC 1E2XA 2R7QA 1MNDA 4O79A 4P9TA 2A6HF 2XXAA 1FMWA 4XEKA 3RFYA 1Z23A 2E87A 2XL6A 2YKZA 3C63A 3OA1A 1BR4A 1OW7A 4CIPA 1S7ZA 3ITFA 1NBBA 1VYIA 3DD7A 3F47A 2LP4A 4JJFA 2KSFA 1LI5A 5JSLA 3RYLA 5CI8A 4EBJA 2HKVA 1Z6AA 2CCYA 4IRUA 2KQ9A 3FDQA 1WTYA 1YA9A 1GS9A 1ZU5A 2HJMA 2YLIA 2YLDA 1B68A 1GQAA 2CNWA 1YVIA 5AC4A 4CSAC 3DM9B 4KI2A 2LK4A 4ER9A 5AC5A 1ORJA 3IQTA 4OINF 4OD5A 4XPXA 1GGQA 2VCCA 3NMKA 4EKWA 1ORSC 2HV7A 4MQ9F 3N0TA 3IQ5A 1NU9C 3EFOA 3U8VA 2YEVA 3ABMC 1K05A 1VOMA 2BE5F 1GM5A 3DWWA 3BEHA 4JEBA 3T6BA 1EI7A 1QVXA 3S28A 1JRAA 3EG9A 5F5FA 5IY5C 4PJJA 3AGUA 1UG7A 1SF8A 4JCHA 3MFNA 3LLKA
chains in the Genus database with same CATH topology
4FX5A 3LEVA 2R7RA 1OKKD 3CSKA 2L9JA 1NZEA 2IOQA 3EQLF 2Y69C 4C3BA 3DZAA 1FTSA 3S0XA 3LLIA 3T6JA 4LERA 2WVNA 4U5DE 3LESA 3MLGA 2XL4A 4BJ6C 1O87A 3E70C 4YN0B 2YZSA 1TR2A 4JJGA 4HE8D 4QI0A 2ZPAA 3W8HA 4O6MA 3JRTA 1J8YF 2R7WA 2V26A 4KNVA 3QMKA 4O7GA 3ASNC 4P6IC 4U5HA 1ZU4A 2H7VC 2NG1A 1FFHA 2W45A 5L3QA 2CDQA 5KYYB 4NY3A 2VASA 4BJ5A 2QTVA 3UMIA 2A69F 3B0PA 4DBQA 4RDAA 3I5PA 4U5CE 2L81A 5BUOA 5F5HA 4MNDA 2A6EF 2J7PD 5FCLA 1Z3IX 2C03A 2J9UA 3EPVA 3MX3A 3AG2C 4W8KA 2IXPA 1Z63A 1ZHYA 1NG1A 1M2VB 2CNWD 2P6VA 1ST6A 3NDBB 3FVYA 3ZVRA 2DYSC 1D0YA 2J9VA 5D92A 3NYMA 4G0HA 2JD3A 1LS1A 2H7OA 5DQTA 3NKEA 2NUTB 4CS7A 2DGJA 4BJ1A 5KYXB 4YT5A 5KYNA 5KYYA 1ZHWA 2A1DD 5EHHA 4JW1A 3ABKC 3EGXB 2Y3BA 1QZXA 2KJGA 3HJCA 3NRHA 2MYSA 4JVSA 3S27A 1FMVA 2MWQA 1TWHA 1SMYF 3O6XA 3JT1A 2WB7A 3X2QC 4AE4B 3K1IC 4Q5SF 5KYWB 4G7OF 3DJUB 1OCCC 1QLEC 4F4BA 4Q4ZF 1M2VA 3Q7LA 3DAGA 4K0DA 2IYLD 2ZXWC 1D0ZA 3K7DA 2G3VA 3DAFA 4O6YA 2W9YA 4DVYP 1ZHXA 3SNHA 3ZSUA 3F46A 2W4BA 1V54C 3QZCA 3PMRA 3KL4A 5DLJA 2Y3HA 1OCZC 3NG1A 2NUTA 3HLZA 1WGWA 4HFKB 2WZLA 3RKOF 5KYXA 4C3EA 4LLEA 1OCOC 2X51A 1V55C 2Y39A 4JZAA 3EGXA 2DYRC 3AG1C 3N2ZB 4C7OB 2ZXRA 3EZHA 4H4KC 3UR3C 3NYLA 3L34A 2PX0A 4CSAA 3W2VA 5T1DB 4AE4A 4A2NB 4DBRA 3K66A 5HSWA 3M1CB 3EH1A 4ANJA 3SZRA 3DJNB 4CS9C 1LKXA 2PF4E 4LLCA 2VH3A 3LNRA 4YT2A 4OIQF 4AX2A 3AQCA 2FFHA 2PP4A 2XRHA 4HFFB 4CBEA 3AQBA 3E9VA 3K1HA 3ASOC 4LACB 3ZIBA 3OWTA 4GEHA 5E33A 2M4EA 3NKDA 4BG0A 4BJTA 2Q9AA 4I44A 1VK5A 3LS1A 1M56C 4O6NA 4QI2A 4E7SA 1MMAA 1MMGA 4C7OA 1TKNA 2WVQA 3X1OA 2XSEA 1M57C 2H7BA 3Q6NA 3O39A 5T3TA 3I4UA 3IEEA 4PJNA 4I1OB 1NU7D 1PD1A 4YJWA 3EGDB 4CS8A 2Y3DA 4U5EE 1ZHTA 2EIMC 4ULWA 5DS6A 1SZIA 4PK4A 5D91A 5DQZA 3S29A 3K6BA 3T4RA 2Q3TA 1MMNA 2P7VA 3N24A 2PX3A 3RH3A 4G7HF 3LS0A 4JURI 2A68F 1TWGA 3LJBA 4QDLA 4XWJA 1RJ9B 4M63A 4DOZA 3EJNA 3K33A 3B0VC 2IXOA 2EIKC 4CIHA 2J0WA 3UNGC 2I8BA 2V3CC 2G3KA 3B9QA 4C3DA 4KBLA 3Q6MA 1VYKA 1N1CA 1G8XA 4IJJA 1TWCA 4ZLCA 5L3VA 4PJMA 4EWCA 2J45A 2QY9A 4YT4A 1JPJA 3EGDA 4J32B 2PFDA 5KYUB 3VAYA 2J9WA 3W2WA 2HV6A 4K7BA 5E3AA 1PD0A 2IXMA 2J7PA 2KGOA 3FHDA 2IXNA 3ZG1A 3UMHA 3VYWA 3JCUQ 1W2WA 4AK9A 4OD4A 4RD9A 4YWQA 2J46A 1JPNA 4FWVA 2WZGA 5B3SC 1ZHZA 2NUPB 1RJ9A 3I5QA 5T3WA 1MNEA 3DM5A 3EZIA 3EH2A 4U5GA 4WJ0A 3TD7A 2Q9BA 3GANA 2Q9CA 4PFOA 4X0RA 3AG3C 4G7ZF 3KMIA 4IAOA 2FGYA 3DXJF 5B1AC 4BJ5C 3ABLC 3L0IA 5KYWA 2EIJC 3CZ6A 5E3CA 1MMDA 1BR2A 1TWAA 2W4MA 2Z15A 1D0XA 3JSZA 5KYUA 3KH2A 1D1AA 4ZLDA 2KW3C 1ZYRF 4KNWA 5DS4A 4E7ZA 2R7OA 2ZXOA 1O5HA 4I3MA 3SEOA 3PHF2 5DS5A 2ZXPA 2R7SA 2R7VA 4I1MA 3EHNA 3UMKA 2B0JA 2R7UA 4U5BE 1Z5ZA 2R7XA 1LVKA 4OIRF 3SYNA 3Q7GA 1IW7F 4FESA 4CS8C 4BJ6A 2CGEA 5DVWA 4YT8A 2NUPA 1M2OA 3WODF 5E2QA 1VMAA 4Q7CA 1IZMA 3ZC4A 3KKBA 4J30B 1FFTC 1OCRC 2YHSA 4RBNA 3RIPA 1D1BA 2XXAB 4CS9A 3B0UX 3SP1A 2OCCC 4OIPF 2WL8A 3CQZA 2WZFA 4U5FE 5EGYA 4HEAJ 4IWBA 4DVZA 3UGPA 3EHMA 1OKKA 3ECSA 3W8IA 2G62A 3GODA 2KNHA 2WVOA 4BEJA 4XTKA 4EBBA 5B1BC 3JYHA 1KU2A 2J0XA 3UGOA 5CI9A 2D5RB 3NYJA 3OEOA 4XLPF 2Y3GA 2R7TA 2EINC 2LSEA 4B6IA 2O9XA 3EFOB 4KC9A 1D1CA 4PFPA 3POVA 4OIOF 3V7OA 2C04A 4GYTA 1PCXA 2OG2A 3DMDA 3EG9B 3HTKC 2VB6A 4N06A 4XLNF 1J8MF 3LAYA 2GFHA 4PJLA 1BR1A 3H65A 3FAJA 2CW0F 3AG4C 2EILC 2R7QA 1MNDA 4O79A 2A6HF 2XXAA 1FMWA 3RFYA 1Z23A 2E87A 3OA1A 1BR4A 1S7ZA 3ITFA 3F47A 1VYIA 3DD7A 4JJFA 3RYLA 5CI8A 1Z6AA 4IRUA 2KQ9A 3FDQA 1ZU5A 2CNWA 4CSAC 3DM9B 4KI2A 4OINF 4OD5A 2HV7A 4MQ9F 3N0TA 1NU9C 3EFOA 2YEVA 3ABMC 2BE5F 1VOMA 3T6BA 3S28A 3EG9A 5F5FA 5IY5C 4PJJA 1SF8A 4JCHA 3WG7C 3LLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POV A;  3FHD A;  2W4B A;  5HSW A;  2W45 A; 
#chains in the Genus database with same CATH topology
 4FX5 A;  3LEV A;  2R7R A;  1OKK D;  1VB5 A;  1NFO A;  1HE9 A;  3CSK A;  4LDR A;  1U0B B;  2L9J A;  2XM0 A;  4E18 A;  4CDV A;  1NZE A;  2IOQ A;  3EQL F;  2AU5 A;  4MVR A;  2Y69 C;  4E0I A;  4C3B A;  4MW8 A;  3DZA A;  2Q7R A;  1FTS A;  3S0X A;  3LLI A;  3T6J A;  4LER A;  2WVN A;  4U5D E;  3LES A;  1HW1 A;  5BQG A;  3MLG A;  2XL4 A;  4YK5 A;  4DRH B;  1E83 A;  3BRJ A;  4BJ6 C;  1WAS A;  1O87 A;  3E70 C;  4WGZ A;  2YZS A;  4YN0 B;  2YL0 A;  2RSE B;  1TR2 A;  3ATP A;  4JJG A;  4HE8 D;  1T9K A;  4QI0 A;  2ZPA A;  2YWA A;  3DI5 A;  1YZC A;  3KYJ A;  3V5X A;  3W8H A;  4O6M A;  4MVM A;  3C8G D;  3JRT A;  1J8Y F;  4H54 A;  4JTA B;  2V26 A;  4KNV A;  3QMK A;  4O7G A;  3VRC A;  2R7W A;  1LI7 A;  3ASN C;  1A0B A;  2KC3 A;  5FZT A;  2OQM A;  4P6I C;  4MVS A;  4U5H A;  1ZU4 A;  5JS5 A;  2H7V C;  2NG1 A;  1JAF A;  1FFH A;  1YYJ A;  1Y4C A;  2J9B A;  2W45 A;  1HMD A;  3CEX A;  3JZ0 A;  2CDQ A;  4IB4 A;  1AVO B;  3RQF A;  2OOC A;  5KYN A;  5L3Q A;  4NY3 A;  2VAS A;  5COF A;  2QTV A;  3UMI A;  3H2U A;  2A69 F;  4BJ5 A;  1JOG A;  3B0P A;  2NSF A;  2FAP B;  4DBQ A;  2OU6 A;  4RDA A;  1BDJ B;  3I5P A;  4U5C E;  1TFK B;  4MVZ A;  1LM3 B;  3TJ6 A;  2L81 A;  5BUO A;  5F5H A;  4JTC B;  3JSE O;  4MND A;  3RQE A;  4JE9 A;  4WGY A;  2A6E F;  4N6C A;  5GPG B;  3TK0 A;  2J7P D;  3B29 A;  1NFN A;  1OQC A;  5FCL A;  1Z3I X;  2C03 A;  2J9U A;  1T6I A;  3EPV A;  3AG2 C;  3MX3 A;  2IXP A;  4JRZ A;  4W8K A;  3U3F A;  3WAQ A;  1RCP A;  1Z63 A;  1ZHY A;  2OJE D;  3GOR A;  4XEF A;  1NG1 A;  1M2V B;  2CNW D;  2P6V A;  1ST6 A;  2I15 A;  2PNO A;  3FXH A;  3GWL A;  3B71 A;  3U9M A;  3G4X A;  3NDB B;  3FVY A;  1F1M A;  2YRF A;  3ZVR A;  1OW6 A;  2DYS C;  1D0Y A;  1NSG B;  2J9V A;  3NYM A;  4G0H A;  5D92 A;  2JD3 A;  4XPY A;  1Q0G A;  2TMV P;  1LS1 A;  2HUJ A;  2H7O A;  2YL1 A;  4D4X A;  4BPM A;  5DQT A;  3NKE A;  4YL3 A;  1HY5 A;  2J8W A;  2NUT B;  4CS7 A;  2DGJ A;  1JR8 A;  4BJ1 A;  1H9T A;  2Q4F A;  5KYX B;  4JKV A;  4YT5 A;  1VLS A;  4W8P A;  2HSQ A;  5BQI A;  5A69 A;  1RKC A;  1ZHW A;  2A1D D;  1K40 A;  2XL8 A;  3SXZ A;  5EHH A;  2XLE A;  4JW1 A;  3ABK C;  1SYQ A;  3EGX B;  3GWN A;  1A7D A;  4N4W A;  2Y3B A;  1QZX A;  2BC5 A;  1R4T A;  2YLG A;  3TJ5 A;  2KJG A;  2R05 A;  2HMZ A;  3HJC A;  4EHP A;  2Q00 A;  2MYS A;  3NRH A;  3U0C A;  4JVS A;  3S27 A;  1FMV A;  4Z9I A;  2MWQ A;  1TWH A;  3RQG A;  1SMY F;  2XM4 A;  4CJO A;  4MVO A;  3O6X A;  4Z9H A;  3M15 A;  3JT1 A;  2WB7 A;  4PR9 A;  3FOO A;  4IAR A;  2XLM A;  4JCZ A;  2XLH A;  1ZW2 A;  3X2Q C;  2P1A A;  2LIG A;  3DE8 A;  1AUE A;  5JP7 A;  4AE4 B;  1E85 A;  3K1I C;  4J7Y A;  4Q5S F;  2XLV A;  5KYW B;  4G7O F;  3DJU B;  4R32 A;  1OCC C;  1QLE C;  4F4B A;  4Q4Z F;  3U2L A;  1M2V A;  2LCH A;  3Q7L A;  2QLA A;  1A41 A;  3DAG A;  2IYL D;  2ZXW C;  1D0Z A;  3K7D A;  3L1M A;  2G3V A;  4K0D A;  4EIY A;  3DAF A;  3TQO A;  4O6Y A;  2W9Y A;  1L7C A;  4DVY P;  1ZHX A;  3SNH A;  1CPR A;  3ZSU A;  3F46 A;  2W4B A;  1V54 C;  3QZC A;  4DRI B;  1FNT c;  3PMR A;  2R02 A;  2L7A A;  3KL4 A;  5DLJ A;  1CGM E;  1I5N A;  2EPO A;  2Y3H A;  1OCZ C;  3NG1 A;  2NUT A;  5A6J A;  3HLZ A;  1WGW A;  2XLD A;  2GDC A;  4HFK B;  2BL2 A;  2LQG A;  2R9R B;  1SR2 A;  2WZL A;  3QW0 A;  3RKO F;  3WG7 C;  5KYX A;  4C3E A;  1ZZP A;  4LLE A;  1OCO C;  1BZ4 A;  1V55 C;  2X51 A;  2Y39 A;  4JZA A;  3SXM A;  3L8J A;  1LPE A;  1T6Q A;  2F22 A;  4MTF A;  3EGX A;  4ONS A;  2DYR C;  4GQH A;  2OJQ A;  1H9G A;  3AG1 C;  4EUK B;  1G4W R;  3N2Z B;  5L0G A;  4C7O B;  3C8Z A;  2ZXR A;  1C03 A;  5F28 E;  1HMO A;  1ZVZ A;  3EZH A;  2VCB A;  3NYL A;  4H4K C;  3L34 A;  3UR3 C;  2PX0 A;  4P9F A;  1MQV A;  4ULV A;  1RXQ A;  1S05 A;  1G5Z A;  1TFO B;  1V4A A;  3W2V A;  4CSA A;  1C02 A;  1QKR A;  5T1D B;  4AE4 A;  3KPH A;  4A2N B;  4DBR A;  3K66 A;  5BQH A;  2P61 A;  3A9C A;  3C7J A;  5TJ5 E;  1V74 B;  3QVZ A;  2KK1 A;  3R2P A;  5HSW A;  1LE2 A;  1R5I D;  1T01 A;  3G50 A;  3M1C B;  4LDQ A;  5HV9 A;  3EH1 A;  4MW3 A;  3RVY A;  4ANJ A;  1EA8 A;  2A0B A;  4LDK A;  3DJN B;  3SZR A;  4CS9 C;  5L0D A;  256B A;  1WOL A;  1LKX A;  2PF4 E;  4LLC A;  5COM A;  2VH3 A;  1M6T A;  1YAR O;  1FAP B;  2AWC A;  2L6F A;  2DI3 A;  3FAP B;  3LNR A;  2UUI A;  4YT2 A;  1OR3 A;  4OIQ F;  3KYI A;  3RF3 A;  2L6G A;  4E0H A;  4AX2 A;  1JMW A;  2FFH A;  2PP4 A;  2XRH A;  3AQC A;  4IGG A;  4XPW A;  4HFF B;  1H6G A;  3HKK A;  4CBE A;  3AQB A;  3E9V A;  3K1H A;  3PDM P;  2JX0 A;  3V5Z A;  4XQ1 A;  1RKE B;  3ASO C;  4LAC B;  4NTB A;  3OWT A;  4GEH A;  5E33 A;  3ZIB A;  5B3I A;  2M4E A;  1VTM P;  2VC9 A;  4K1O A;  4NTF A;  4AL1 A;  3NKD A;  4BG0 A;  3JTL O;  5JVE A;  4BJT A;  2Q9A A;  2YQY A;  1E84 A;  4I44 A;  1VK5 A;  3LS1 A;  1M56 C;  4MTG A;  4O6N A;  4QI2 A;  2AWY A;  2EPN A;  4E7S A;  1MMA A;  2OEV A;  2EPM X;  3M79 A;  2GA0 A;  1MMG A;  3NMI A;  4C7O A;  1TKN A;  2R03 A;  1WWP A;  2WVQ A;  3SXY A;  1APC A;  3X1O A;  2XS1 A;  4EBK A;  2XSE A;  1KNY A;  1M57 C;  1YYX A;  4NTA A;  2H7B A;  2ASR A;  3Q6N A;  3O39 A;  2QUP A;  5T3T A;  4PAC A;  1CGO A;  3I4U A;  3IEE A;  4PJN A;  4YL1 A;  4I1O B;  4MTO A;  2EPL X;  1NU7 D;  1PD1 A;  4YJW A;  2L6H A;  3EGD B;  4CS8 A;  2LD6 A;  2Y3D A;  2JPU A;  2M64 A;  4U5E E;  1ZHT A;  4JIO A;  2EIM C;  5KYY A;  4ULW A;  5DS6 A;  1SZI A;  4PK4 A;  2GWW A;  2R25 A;  5D91 A;  5DQZ A;  3S29 A;  3K6B A;  3T4R A;  2Q3T A;  2XLO A;  2HS5 A;  1MMN A;  1PV3 A;  2P7V A;  3N24 A;  2PX3 A;  3RH3 A;  3U5S A;  1VLT A;  4G7H F;  5AGF A;  3LS0 A;  4JUR I;  5COG A;  2A68 F;  3IQ6 A;  4E17 A;  2A0U A;  5A6K A;  1QPU A;  3AGT A;  2D4U A;  3DKA A;  3FOP A;  1TWG A;  3LJB A;  4QDL A;  2CYD A;  1I4Y A;  1RJ9 B;  4M63 A;  4XWJ A;  4DOZ A;  3EJN A;  3LNM B;  3K33 A;  5L0I A;  2AVK A;  3VF0 A;  1RKE A;  1U6H A;  2IXO A;  2UUH A;  2EIK C;  3ZQY A;  4A4A A;  4CIH A;  1T5O A;  3NMJ A;  5JLI A;  2J0W A;  2LFF A;  1LIH A;  1BBH A;  1UFB A;  3UNG C;  2I8B A;  3V5Y A;  4DJ9 A;  1DOW A;  3R7C A;  3PCV A;  2G3K A;  2V3C C;  3B9Q A;  3FMS A;  4KBL A;  4C3D A;  2XS8 A;  5JRA A;  3Q6M A;  1QQ3 A;  1VYK A;  1N1C A;  2HFI A;  3HNJ A;  1G8X A;  2HJ3 A;  3T9O A;  4IJJ A;  3C62 A;  4CDY A;  1AEP A;  2ZD9 A;  1TWC A;  3T6G B;  4ZLC A;  3GEE A;  5L3V A;  4MVU A;  4PJM A;  3S84 A;  3GEI A;  3MYI A;  1YDI A;  4Z9J A;  4EWC A;  2J45 A;  2QY9 A;  4YT4 A;  1JPJ A;  4YL0 A;  3EGD A;  4J32 B;  2PFD A;  5KYU B;  4WAB A;  1H7I A;  3VAY A;  2J9W A;  3W2W A;  2HV6 A;  3WHN A;  4K7B A;  5L0H A;  1YLM A;  5E3A A;  1PD0 A;  3CAX A;  3GEH A;  2IXM A;  2J7P A;  2KGO A;  3FHD A;  2IXN A;  5L0J A;  3ZG1 A;  3UMH A;  1QSP A;  3JCU Q;  3VYW A;  1W2W A;  2AP3 A;  4AK9 A;  4OD4 A;  4RD9 A;  2KYH A;  3M4C A;  1A7V A;  4YWQ A;  1YJG A;  3H2V A;  4U9E A;  2J46 A;  1JPN A;  2DB4 A;  3L8I A;  2WZG A;  4FWV A;  4MVQ A;  5B3S C;  2P0N A;  3U9J A;  3GM1 A;  1ZHZ A;  1OXB A;  2NUP B;  1HE1 A;  1YA7 O;  1RJ9 A;  2YVK A;  3I5Q A;  5T3W A;  5A6A A;  1FR0 A;  3LEO A;  3U8P A;  3K1I A;  1MNE A;  3DM5 A;  3EZI A;  3EH2 A;  4UDV A;  5A6B A;  4U5G A;  3GM2 A;  4WJ0 A;  3TD7 A;  2Q9B A;  3GAN A;  5L0C A;  2VCA A;  4AL0 A;  3JRM O;  2Q9C A;  4PFO A;  4X0R A;  3AG3 C;  3HNK A;  4G7Z F;  3KMI A;  5L0F A;  4CDA A;  3ZWI A;  4IAO A;  2FGY A;  3DXJ F;  1EQ1 A;  5B1A C;  3MYF A;  4BJ5 C;  3IQC A;  3ABL C;  3L0I A;  5KYW A;  1EKY A;  2EIJ C;  3S90 A;  2YL7 A;  3CZ6 A;  1ORY A;  5E3C A;  1MMD A;  4N6H A;  1BR2 A;  2OEX A;  1OR2 A;  1TWA A;  2H8A A;  2W4M A;  2NPU A;  2Z15 A;  2MHR A;  1LE4 A;  5KYY B;  2PBE A;  2NSG A;  1D0X A;  1Q0F A;  3JSZ A;  5KYU A;  3ZQV A;  3KH2 A;  1D1A A;  4ZLD A;  2KW3 C;  1ZYR F;  1NLX A;  3TOL A;  4FAP B;  3IHU A;  4KNW A;  2IBF A;  2RD9 A;  5DS4 A;  2QE9 A;  4E7Z A;  2R7O A;  2ZXO A;  1I4Z A;  1O5H A;  3U2M A;  4I3M A;  3SEO A;  3PHF 2;  2ICW G;  2ZXP A;  2OKU A;  5DS5 A;  1E86 A;  2R7S A;  4I1M A;  3MBG A;  2R7V A;  3EHN A;  3IPM O;  3US6 A;  4DXW A;  3UMK A;  1O3U A;  2B0J A;  3C8G B;  4U5B E;  1Z5Z A;  2R7U A;  2ETS A;  1XWJ A;  1LVK A;  2R7X A;  1Z7Q c;  4OIR F;  3SYN A;  3Q7G A;  4BEM J;  3DE9 A;  2XLW A;  1IW7 F;  4FES A;  4CS8 C;  3ZDL A;  1Y6D A;  2CGE A;  5DVW A;  4BJ6 A;  4YT8 A;  2NUP A;  1M2O A;  2EPK X;  3WOD F;  1WAT A;  5CIV A;  5EK0 A;  1C17 M;  3QTH A;  5E2Q A;  3RW0 A;  1A7E A;  2GAQ A;  3RVZ A;  1VMA A;  3AJM A;  1Q0K A;  1Q0M A;  3M4B A;  4Q7C A;  4G78 A;  5K0I A;  1IZM A;  1DOV A;  1YAU O;  3ZC4 A;  3KKB A;  4J30 B;  1K04 A;  1CGN A;  4MS2 A;  1FFT C;  1OCR C;  1T6U A;  2IM8 A;  1CPQ A;  2YHS A;  4RBN A;  3RIP A;  5JT4 A;  1D1B A;  3TUL A;  3O10 A;  1Q0D A;  3LUT B;  2XXA B;  4CS9 A;  4IAQ A;  3VM6 A;  3W4Y A;  3SP1 A;  3B0U X;  3ZTM A;  2OCC C;  4OIP F;  2WL8 A;  3CQZ A;  2WZF A;  4U5F E;  5EGY A;  4HEA J;  4IWB A;  3B0V C;  4L6R A;  4JC7 A;  4XEV A;  4DVZ A;  3UGP A;  3EHM A;  1OKK A;  3ECS A;  1HW2 A;  1OW8 A;  2HSB A;  3W8I A;  3ZTZ A;  2B0H A;  3TOM A;  2G62 A;  3J06 A;  3GOD A;  2KNH A;  2WVO A;  4BEJ A;  1YZA A;  1TQG A;  3AOU A;  4JEA A;  3G4Z A;  4XTK A;  5B1B C;  3JYH A;  1KU2 A;  1U89 A;  2J0X A;  3S9O A;  4EBB A;  3UGO A;  5CI9 A;  4CJG A;  2D5R B;  1G4U S;  3NYJ A;  2LFD A;  2HZ8 A;  3O55 A;  1RMV A;  4NCQ A;  3OEO A;  3SXK A;  3A11 A;  2X0C A;  4XLP F;  3GM3 A;  4NQF A;  4U9D A;  4JTD B;  4D4N A;  2HMQ A;  2Y3G A;  5A6B D;  2R7T A;  2EIN C;  1XZQ A;  4NC3 A;  2QNL A;  2LSE A;  2YL3 A;  1KTM A;  4CX9 A;  4B6I A;  4J7T A;  3U3B A;  2O9X A;  3EFO B;  3HNI A;  4KC9 A;  1D1C A;  4PFP A;  1L3P A;  3HNL A;  1LS4 A;  3C8G A;  3POV A;  4OIO F;  3V7O A;  2C04 A;  4GYT A;  4DRJ B;  1PCX A;  2OG2 A;  1XZP A;  3DMD A;  1ZW3 A;  3EG9 B;  3HTK C;  2VB6 A;  1OXK A;  4N06 A;  4XLN F;  3QW1 A;  1J8M F;  5JUA A;  3JYY A;  3LAY A;  3QVY A;  2GFH A;  4PJL A;  1BR1 A;  1WN0 A;  3C18 A;  3H65 A;  3FAJ A;  2CW0 F;  3AG4 C;  2EIL C;  1E2X A;  2R7Q A;  1MND A;  4O79 A;  4P9T A;  2A6H F;  2XXA A;  1FMW A;  4XEK A;  3RFY A;  1Z23 A;  2E87 A;  2XL6 A;  2YKZ A;  3C63 A;  3OA1 A;  1BR4 A;  1OW7 A;  4CIP A;  1S7Z A;  3ITF A;  1NBB A;  1VYI A;  3DD7 A;  3F47 A;  2LP4 A;  4JJF A;  2KSF A;  1LI5 A;  5JSL A;  3RYL A;  5CI8 A;  4EBJ A;  2HKV A;  1Z6A A;  2CCY A;  4IRU A;  2KQ9 A;  3FDQ A;  1WTY A;  1YA9 A;  1GS9 A;  1ZU5 A;  2HJM A;  2YLI A;  2YLD A;  1B68 A;  1GQA A;  2CNW A;  1YVI A;  5AC4 A;  4CSA C;  3DM9 B;  4KI2 A;  2LK4 A;  4ER9 A;  5AC5 A;  1ORJ A;  3IQT A;  4OIN F;  4OD5 A;  4XPX A;  1GGQ A;  2VCC A;  3NMK A;  4EKW A;  1ORS C;  2HV7 A;  4MQ9 F;  3N0T A;  3IQ5 A;  1NU9 C;  3EFO A;  3U8V A;  2YEV A;  3ABM C;  1K05 A;  1VOM A;  2BE5 F;  1GM5 A;  3DWW A;  3BEH A;  4JEB A;  3T6B A;  1EI7 A;  1QVX A;  3S28 A;  1JRA A;  3EG9 A;  5F5F A;  5IY5 C;  4PJJ A;  3AGU A;  1UG7 A;  1SF8 A;  4JCH A;  3MFN A;  3LLK A; 
#chains in the Genus database with same CATH homology
 4FX5 A;  3LEV A;  2R7R A;  1OKK D;  3CSK A;  2L9J A;  1NZE A;  2IOQ A;  3EQL F;  2Y69 C;  4C3B A;  3DZA A;  1FTS A;  3S0X A;  3LLI A;  3T6J A;  4LER A;  2WVN A;  4U5D E;  3LES A;  3MLG A;  2XL4 A;  4BJ6 C;  1O87 A;  3E70 C;  4YN0 B;  2YZS A;  1TR2 A;  4JJG A;  4HE8 D;  4QI0 A;  2ZPA A;  3W8H A;  4O6M A;  3JRT A;  1J8Y F;  2R7W A;  2V26 A;  4KNV A;  3QMK A;  4O7G A;  3ASN C;  4P6I C;  4U5H A;  1ZU4 A;  2H7V C;  2NG1 A;  1FFH A;  2W45 A;  5L3Q A;  2CDQ A;  5KYY B;  4NY3 A;  2VAS A;  4BJ5 A;  2QTV A;  3UMI A;  2A69 F;  3B0P A;  4DBQ A;  4RDA A;  3I5P A;  4U5C E;  2L81 A;  5BUO A;  5F5H A;  4MND A;  2A6E F;  2J7P D;  5FCL A;  1Z3I X;  2C03 A;  2J9U A;  3EPV A;  3MX3 A;  3AG2 C;  4W8K A;  2IXP A;  1Z63 A;  1ZHY A;  1NG1 A;  1M2V B;  2CNW D;  2P6V A;  1ST6 A;  3NDB B;  3FVY A;  3ZVR A;  2DYS C;  1D0Y A;  2J9V A;  5D92 A;  3NYM A;  4G0H A;  2JD3 A;  1LS1 A;  2H7O A;  5DQT A;  3NKE A;  2NUT B;  4CS7 A;  2DGJ A;  4BJ1 A;  5KYX B;  4YT5 A;  5KYN A;  5KYY A;  1ZHW A;  2A1D D;  5EHH A;  4JW1 A;  3ABK C;  3EGX B;  2Y3B A;  1QZX A;  2KJG A;  3HJC A;  3NRH A;  2MYS A;  4JVS A;  3S27 A;  1FMV A;  2MWQ A;  1TWH A;  1SMY F;  3O6X A;  3JT1 A;  2WB7 A;  3X2Q C;  4AE4 B;  3K1I C;  4Q5S F;  5KYW B;  4G7O F;  3DJU B;  1OCC C;  1QLE C;  4F4B A;  4Q4Z F;  1M2V A;  3Q7L A;  3DAG A;  4K0D A;  2IYL D;  2ZXW C;  1D0Z A;  3K7D A;  2G3V A;  3DAF A;  4O6Y A;  2W9Y A;  4DVY P;  1ZHX A;  3SNH A;  3ZSU A;  3F46 A;  2W4B A;  1V54 C;  3QZC A;  3PMR A;  3KL4 A;  5DLJ A;  2Y3H A;  1OCZ C;  3NG1 A;  2NUT A;  3HLZ A;  1WGW A;  4HFK B;  2WZL A;  3RKO F;  5KYX A;  4C3E A;  4LLE A;  1OCO C;  2X51 A;  1V55 C;  2Y39 A;  4JZA A;  3EGX A;  2DYR C;  3AG1 C;  3N2Z B;  4C7O B;  2ZXR A;  3EZH A;  4H4K C;  3UR3 C;  3NYL A;  3L34 A;  2PX0 A;  4CSA A;  3W2V A;  5T1D B;  4AE4 A;  4A2N B;  4DBR A;  3K66 A;  5HSW A;  3M1C B;  3EH1 A;  4ANJ A;  3SZR A;  3DJN B;  4CS9 C;  1LKX A;  2PF4 E;  4LLC A;  2VH3 A;  3LNR A;  4YT2 A;  4OIQ F;  4AX2 A;  3AQC A;  2FFH A;  2PP4 A;  2XRH A;  4HFF B;  4CBE A;  3AQB A;  3E9V A;  3K1H A;  3ASO C;  4LAC B;  3ZIB A;  3OWT A;  4GEH A;  5E33 A;  2M4E A;  3NKD A;  4BG0 A;  4BJT A;  2Q9A A;  4I44 A;  1VK5 A;  3LS1 A;  1M56 C;  4O6N A;  4QI2 A;  4E7S A;  1MMA A;  1MMG A;  4C7O A;  1TKN A;  2WVQ A;  3X1O A;  2XSE A;  1M57 C;  2H7B A;  3Q6N A;  3O39 A;  5T3T A;  3I4U A;  3IEE A;  4PJN A;  4I1O B;  1NU7 D;  1PD1 A;  4YJW A;  3EGD B;  4CS8 A;  2Y3D A;  4U5E E;  1ZHT A;  2EIM C;  4ULW A;  5DS6 A;  1SZI A;  4PK4 A;  5D91 A;  5DQZ A;  3S29 A;  3K6B A;  3T4R A;  2Q3T A;  1MMN A;  2P7V A;  3N24 A;  2PX3 A;  3RH3 A;  4G7H F;  3LS0 A;  4JUR I;  2A68 F;  1TWG A;  3LJB A;  4QDL A;  4XWJ A;  1RJ9 B;  4M63 A;  4DOZ A;  3EJN A;  3K33 A;  3B0V C;  2IXO A;  2EIK C;  4CIH A;  2J0W A;  3UNG C;  2I8B A;  2V3C C;  2G3K A;  3B9Q A;  4C3D A;  4KBL A;  3Q6M A;  1VYK A;  1N1C A;  1G8X A;  4IJJ A;  1TWC A;  4ZLC A;  5L3V A;  4PJM A;  4EWC A;  2J45 A;  2QY9 A;  4YT4 A;  1JPJ A;  3EGD A;  4J32 B;  2PFD A;  5KYU B;  3VAY A;  2J9W A;  3W2W A;  2HV6 A;  4K7B A;  5E3A A;  1PD0 A;  2IXM A;  2J7P A;  2KGO A;  3FHD A;  2IXN A;  3ZG1 A;  3UMH A;  3VYW A;  3JCU Q;  1W2W A;  4AK9 A;  4OD4 A;  4RD9 A;  4YWQ A;  2J46 A;  1JPN A;  4FWV A;  2WZG A;  5B3S C;  1ZHZ A;  2NUP B;  1RJ9 A;  3I5Q A;  5T3W A;  1MNE A;  3DM5 A;  3EZI A;  3EH2 A;  4U5G A;  4WJ0 A;  3TD7 A;  2Q9B A;  3GAN A;  2Q9C A;  4PFO A;  4X0R A;  3AG3 C;  4G7Z F;  3KMI A;  4IAO A;  2FGY A;  3DXJ F;  5B1A C;  4BJ5 C;  3ABL C;  3L0I A;  5KYW A;  2EIJ C;  3CZ6 A;  5E3C A;  1MMD A;  1BR2 A;  1TWA A;  2W4M A;  2Z15 A;  1D0X A;  3JSZ A;  5KYU A;  3KH2 A;  1D1A A;  4ZLD A;  2KW3 C;  1ZYR F;  4KNW A;  5DS4 A;  4E7Z A;  2R7O A;  2ZXO A;  1O5H A;  4I3M A;  3SEO A;  3PHF 2;  5DS5 A;  2ZXP A;  2R7S A;  2R7V A;  4I1M A;  3EHN A;  3UMK A;  2B0J A;  2R7U A;  4U5B E;  1Z5Z A;  2R7X A;  1LVK A;  4OIR F;  3SYN A;  3Q7G A;  1IW7 F;  4FES A;  4CS8 C;  4BJ6 A;  2CGE A;  5DVW A;  4YT8 A;  2NUP A;  1M2O A;  3WOD F;  5E2Q A;  1VMA A;  4Q7C A;  1IZM A;  3ZC4 A;  3KKB A;  4J30 B;  1FFT C;  1OCR C;  2YHS A;  4RBN A;  3RIP A;  1D1B A;  2XXA B;  4CS9 A;  3B0U X;  3SP1 A;  2OCC C;  4OIP F;  2WL8 A;  3CQZ A;  2WZF A;  4U5F E;  5EGY A;  4HEA J;  4IWB A;  4DVZ A;  3UGP A;  3EHM A;  1OKK A;  3ECS A;  3W8I A;  2G62 A;  3GOD A;  2KNH A;  2WVO A;  4BEJ A;  4XTK A;  4EBB A;  5B1B C;  3JYH A;  1KU2 A;  2J0X A;  3UGO A;  5CI9 A;  2D5R B;  3NYJ A;  3OEO A;  4XLP F;  2Y3G A;  2R7T A;  2EIN C;  2LSE A;  4B6I A;  2O9X A;  3EFO B;  4KC9 A;  1D1C A;  4PFP A;  3POV A;  4OIO F;  3V7O A;  2C04 A;  4GYT A;  1PCX A;  2OG2 A;  3DMD A;  3EG9 B;  3HTK C;  2VB6 A;  4N06 A;  4XLN F;  1J8M F;  3LAY A;  2GFH A;  4PJL A;  1BR1 A;  3H65 A;  3FAJ A;  2CW0 F;  3AG4 C;  2EIL C;  2R7Q A;  1MND A;  4O79 A;  2A6H F;  2XXA A;  1FMW A;  3RFY A;  1Z23 A;  2E87 A;  3OA1 A;  1BR4 A;  1S7Z A;  3ITF A;  3F47 A;  1VYI A;  3DD7 A;  4JJF A;  3RYL A;  5CI8 A;  1Z6A A;  4IRU A;  2KQ9 A;  3FDQ A;  1ZU5 A;  2CNW A;  4CSA C;  3DM9 B;  4KI2 A;  4OIN F;  4OD5 A;  2HV7 A;  4MQ9 F;  3N0T A;  1NU9 C;  3EFO A;  2YEV A;  3ABM C;  2BE5 F;  1VOM A;  3T6B A;  3S28 A;  3EG9 A;  5F5F A;  5IY5 C;  4PJJ A;  1SF8 A;  4JCH A;  3WG7 C;  3LLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...