2W45A

Epstein-barr virus alkaline nuclease
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
460
structure length
449
Chain Sequence
b'LEDPMEEMTSYTFARFLRSPETEAFVRNLDRPPQMPAMRFVYLYCLCKQIQEFSGETGFCDFVSSLVQEDGPSLKSIYWGLQEATDEQRTVLCSYVESMTRGQSENLMWDILRNGIISSSKLLSTIKNGPTKVFEPAFGGPVAFGLRCEDTVKDIVCKLICGDASANRQFGFMISPTDGIFGVSLDLCVNVESQGDFILFTDRSCIYEIKCRFKYLFSKSEFDPIYPSYTALYKRPCKRSFIRFINSIARPTVEYVPDGRLPSEGDYLLTQDEAWNLKDVRKRKLGPGHDLVADSLAANRGVESMLYVMTDPSENAGRIGIKDRVPVNIFINPRHNYFYQVLLQYKIVGDYVRHSGGGKPGRDCSPRVNIVTAFFRKRSPLDPATCTLGSDLLLDASVEIPVAVLVTPVVLPDSVIRKTLSTAAGSWKAYADNTFDTAPWVPSGLFADD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALKALINE EXONUCLEASE
publication title A Bridge Crosses the Active Site Canyon of the Epstein-Barr Virus Nuclease with DNase and Rnase Activity.
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Hydrolase
total genus 142
structure length 449
sequence length 460
chains with identical sequence B
ec nomenclature ec 3.1.11.-:
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01771 Viral_alk_exo Viral alkaline exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.860 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w45A01
2W4BA 3POVA 5HSWA 3FHDA 2W45A
chains in the Genus database with same CATH superfamily
3MX3A 1Y6DA 2YL7A 1GM5A 4CDVA 1CPRA 2W4BA 2BE5F 3DAFA 3W2VA 4KI2A 2YZSA 2P7VA 4PACA 4BJTA 3AG2C 2Q9BA 2XS8A 4CIHA 5CI9A 1OCOC 1Q0FA 3K33A 2YL1A 3AQCA 3KKBA 3VAYA 4OIQF 2A6HF 4GQHA 3R7CA 2BC5A 1O5HA 2A0UA 2H7VC 2HZ8A 2IXPA 2LD6A 1T6IA 2YL0A 3K1IA 5AGFA 1K04A 3EHNA 3NKDA 3AG3C 3ASNC 4YWQA 5EHHA 2YHSA 1G8XA 3K7DA 3RFYA 5E33A 3L8IA 1H9TA 2G3KA 3W8HA 2A68F 2Q4FA 1M2VA 3X2QC 2Y3HA 3ZVRA 4E7SA 4J7TA 2GA0A 2E87A 3JYYA 4AL0A 4DXWA 4JRZA 1FNTc 3E70C 2VC9A 3FOOA 4IRUA 1G4WR 4J30B 3ZQVA 1MMAA 1QPUA 1U89A 1YVIA 2LCHA 3FHDA 1ZHXA 1A7EA 3JT1A 5JLIA 1JOGA 3JSEO 5A69A 1YYJA 4Q5SF 1EI7A 4XPXA 3EZIA 5DLJA 3EZHA 2A6EF 2JPUA 3L34A 2LFFA 2GFHA 2EPNA 1OQCA 2MHRA 3IEEA 3NKEA 1NBBA 3VRCA 2B0HA 3ASOC 2PX0A 4L6RA 1LI5A 4PJLA 5TJ5E 3HTKC 3S27A 5B3SC 2HSBA 4IJJA 2FGYA 5FZTA 4E17A 2IOQA 3IHUA 4O79A 2ASRA 2EPLX 2KGOA 3LLKA 3S29A 3U8VA 1MMDA 2XL8A 4N6HA 5L0CA 4HFFB 4BJ6A 3OEOA 4YT2A 4D4XA 3RW0A 2HUJA 2DGJA 2FFHA 3RYLA 3UMKA 4C7OA 3BRJA 3GM3A 1T6QA 2W45A 5A6JA 5L0FA 3N2ZB 1YZCA 3CAXA 1QZXA 4H4KC 1YA7O 2KNHA 4Z9HA 4CS7A 5T3WA 4EHPA 4EUKB 3G50A 3V5XA 2ZD9A 1A7DA 1VOMA 4G0HA 2CNWD 1Q0MA 2EIKC 2J0WA 2VH3A 3AG1C 2R02A 3EFOA 2YRFA 3GANA 2XLMA 1KU2A 3KYJA 1C03A 3VF0A 5BQIA 2XRHA 3OWTA 4NC3A 4YL0A 2OKUA 2YEVA 3FDQA 2J7PA 3JSZA 2EIJC 4ULVA 3PMRA 1M2VB 1ST6A 1LPEA 3K1IC 2XM4A 1M6TA 4NY3A 2P6VA 3ABLC 4U9EA 2L81A 1L7CA 1J8MF 5KYXA 3NDBB 4KBLA 3C8GD 2R7RA 1VTMP 2Y3GA 3GWNA 3ZDLA 3BEHA 4JC7A 1UG7A 1D1AA 1Z6AA 2X51A 1YJGA 4JURI 2YQYA 2J9VA 1Q0GA 4N06A 4IB4A 5JSLA 4ER9A 3RVYA 4LLEA 4LDRA 4Z9JA 1PD1A 5AC5A 1DOWA 1JRAA 2Q7RA 1QQ3A 3GEEA 2XLOA 4YL1A 4M63A 2D4UA 2AP3A 1TR2A 1Q0KA 2UUHA 4PJJA 1WWPA 5A6BD 1E85A 4GEHA 1EQ1A 3ZSUA 2OEVA 4AX2A 2KW3C 3HNLA 3HNJA 2R03A 1D1CA 256BA 4YK5A 1H9GA 5COMA 1Z63A 2XLWA 1LE2A 1R5ID 5T3TA 4MW8A 3RF3A 1OW7A 3HKKA 3SXKA 2RD9A 5L3VA 1J8YF 3DZAA 4MTFA 2HMZA 1KNYA 1OW8A 3B0PA 4AK9A 1RMVA 2LIGA 3KYIA 3LS0A 4XPYA 4BJ1A 1Q0DA 1RKCA 5F5FA 4MNDA 4G7ZF 2AWCA 3DJNB 1UFBA 2VCBA 4MVUA 4BJ6C 3C18A 1ZYRF 1S7ZA 3FAJA 5B3IA 2QE9A 1A41A 2GWWA 4ONSA 1WASA 2GAQA 3T6JA 3U5SA 1YZAA 4MQ9F 2J8WA 2ZXOA 3CQZA 3I4UA 3JYHA 3T9OA 2NUPA 3EFOB 4U5CE 4G7HF 4CSAA 4KNVA 4K1OA 3QW0A 3QTHA 3SNHA 2OCCC 3OA1A 3TD7A 2I15A 3DJUB 4I1MA 4BG0A 3AQBA 4BEJA 3DAGA 1A7VA 2A1DD 2LSEA 1YA9A 4ZLDA 5L0IA 4DRIB 1OKKA 2QTVA 4QI2A 1R4TA 2PNOA 3SP1A 1Z23A 2EIMC 3EHMA 3KL4A 1T6UA 3R2PA 4FX5A 4RD9A 3I5PA 2D5RB 2NSGA 4MVRA 2J46A 4JZAA 4JCZA 4B6IA 1CGOA 4QI0A 2R05A 3DE8A 4CBEA 1OCRC 5L3QA 5T1DB 4DRJB 3L8JA 2KC3A 3GORA 4GYTA 2HMQA 3HLZA 5BUOA 2H8AA 2B0JA 3ECSA 1K40A 4MVSA 4I1OB 3H65A 3RKOF 2LFDA 3HNKA 3TQOA 4MS2A 5CIVA 1MQVA 5EK0A 1FFTC 1V4AA 3T6BA 3W4YA 4LERA 4MVMA 3IQTA 1JMWA 1BR4A 5JUAA 1BZ4A 1HMDA 1CPQA 3KH2A 4MVZA 5JS5A 5DS4A 2CGEA 2H7OA 2NUTA 4EWCA 2OQMA 3H2UA 4FWVA 2WL8A 4R32A 2OJED 3MFNA 3K1HA 1TWGA 2RSEB 3C62A 1BR1A 4JIOA 4DBRA 1A0BA 2EILC 3GM1A 3VM6A 4O6NA 1V55C 4EBJA 4X0RA 1RKEA 3NMKA 2NG1A 3EH1A 2IXNA 2X0CA 2R7VA 3RIPA 4U5EE 2A69F 1GQAA 4JW1A 1TKNA 2NUPB 2CW0F 4W8KA 3K6BA 3GEHA 1OXKA 3IPMO 3GM2A 1GGQA 1NZEA 3V5ZA 3WAQA 3KMIA 5CI8A 4C3BA 4PJMA 4YN0B 2PFDA 3HNIA 3UMHA 2XL6A 3JTLO 4N4WA 3TK0A 2P1AA 3A11A 4JKVA 3L1MA 2HJMA 1VB5A 3JZ0A 4JE9A 3S28A 4YT4A 3PDMP 4OIOF 1U0BB 2GDCA 1YLMA 3C8ZA 1BDJB 2WB7A 3B9QA 2J0XA 4LDKA 4P9FA 3IQ6A 3LUTB 3SXYA 4AL1A 4CJGA 3DKAA 4E7ZA 4YT5A 5AC4A 1FMWA 1MNEA 2IXOA 3WHNA 2DYRC 2R7OA 4F4BA 3ZTZA 3DM5A 1VYKA 4JVSA 3RQGA 4UDVA 1LE4A 2YKZA 5DQZA 1TQGA 3QW1A 2FAPB 4WGZA 1FR0A 4DOZA 2CDQA 1D0XA 1XZPA 1FAPB 4PJNA 2KSFA 4U5BE 4EBKA 1TFKB 2C04A 4YT8A 2Q00A 1F1MA 1FTSA 5DS5A 3LEVA 3ZC4A 1NG1A 2WZFA 3WG7C 3DM9B 4ULWA 4Q7CA 2R7SA 1NU9C 2WVQA 5DQTA 1E83A 4HFKB 2NUTB 2PF4E 4CDYA 4NTBA 4J7YA 1MNDA 2G3VA 4MVOA 1WATA 1U6HA 4JJGA 3U2MA 1SR2A 1NSGB 2YWAA 3EH2A 2C03A 3N24A 4JTCB 3U8PA 5A6AA 5B1BC 1IZMA 5L0DA 1T5OA 4E18A 1RKEB 1TWAA 2XL4A 1M57C 3Q6NA 3LAYA 1VLSA 4LLCA 1SMYF 4HEAJ 4KNWA 2LQGA 3NYJA 3AGUA 5E3CA 2IYLD 4CS9A 1JPNA 4CX9A 3EGDB 3NYMA 2ICWG 3ITFA 3T6GB 3AOUA 1EKYA 4MVQA 1RJ9A 4DJ9A 1YARO 4XEKA 1OR2A 2MWQA 5DVWA 1SZIA 4IWBA 1YAUO 1VMAA 4RDAA 1QSPA 5K0IA 2QY9A 3V7OA 2DYSC 3MYIA 1HW1A 4DBQA 2P61A 1M2OA 2UUIA 2YLDA 1C02A 2W4MA 4RBNA 4FESA 4O7GA 4XEFA 3U9MA 3T4RA 3S90A 3UNGC 2CCYA 5IY5C 2HV7A 3UR3C 1VLTA 4OD4A 1ZW3A 2KQ9A 3NRHA 1QKRA 4E0HA 4K7BA 2IXMA 4CIPA 2V3CC 1Z5ZA 2F22A 2ZPAA 1T01A 3U3FA 1B68A 2KK1A 4EIYA 3AGTA 4EKWA 2OU6A 2YLIA 2OEXA 3GODA 1EA8A 4JTAB 3W2WA 4NQFA 5A6KA 3KPHA 3IQ5A 3LESA 1E86A 2PX3A 1TFOB 3O55A 4WABA 2EPKX 4OIPF 4MW3A 3FMSA 4PFOA 4OINF 2R25A 1QVXA 4CDAA 4XPWA 2PP4A 4XTKA 1ORSC 2CNWA 2L6FA 2L9JA 3F46A 3M1CB 4J32B 2QUPA 2A0BA 3QVYA 1V74B 1VYIA 1AVOB 1OCZC 3A9CA 1C17M 1ZHZA 3UGPA 2Y69C 2XLEA 2TMVP 2Y3DA 1RJ9B 2Q9AA 3AJMA 4XEVA 2VASA 3M4CA 3PCVA 5D92A 4O6MA 5JP7A 4ANJA 4CS9C 1OW6A 2XXAB 2BL2A 2J9BA 3C8GA 2HJ3A 2NPUA 3DMDA 4K0DA 3X1OA 5EGYA 4LACB 4NCQA 4U5HA 2EPOA 2J7PD 1Y4CA 5D91A 4O6YA 3M15A 4HE8D 3RVZA 5KYNA 3EGXB 3HJCA 3TULA 4BJ5A 1LIHA 2W9YA 3PHF2 4IAQA 1RCPA 1G4US 1O87A 3NYLA 2R7WA 1WTYA 3ATPA 4XLNF 2VCCA 2ZXRA 3C7JA 2IM8A 1LS4A 2M4EA 5COFA 2DI3A 5A6BA 4YJWA 3ZIBA 4XWJA 5KYWA 2EPMX 2CYDA 2XLDA 5JRAA 5KYYA 3EGDA 4JEBA 4YL3A 4I3MA 1QLEC 2R7QA 4LDQA 3U3BA 1WGWA 5B1AC 1ZVZA 5F28E 3SEOA 3S0XA 3UGOA 4P9TA 3DWWA 1V54C 3MYFA 4CS8A 1G5ZA 3ZG1A 2OG2A 4AE4A 2J9WA 3MLGA 3NMIA 5KYUB 1PD0A 3G4ZA 2XLHA 1E2XA 4IARA 1LM3B 3F47A 1AEPA 4DVZA 2Z15A 3MBGA 4CSAC 4U5DE 5L0HA 2H7BA 4JEAA 2AU5A 5GPGB 3DI5A 1O3UA 2O9XA 3B71A 3LEOA 2IBFA 5BQHA 3NG1A 3S84A 3CSKA 5E3AA 4U5GA 1IW7F 4U5FE 4DRHB 1OR3A 1WOLA 1FFHA 1TWCA 1JPJA 2KJGA 2QLAA 4E0IA 1ORYA 2M64A 2R7XA 3JRTA 3ZQYA 3WODF 3ABKC 5E2QA 2ETSA 3RH3A 1NFOA 3U2LA 2OJQA 3IQCA 4PK4A 4N6CA 1T9KA 4WGYA 3FXHA 1L3PA 1H7IA 1ZU4A 3SYNA 3RQFA 1LS1A 2XS1A 4D4NA 3VYWA 1PV3A 3C8GB 3LS1A 3UMIA 3C63A 3I5QA 2WVNA 1SF8A 4OD5A 1Z7Qc 5DS6A 1E84A 2WZGA 3EQLF 3O6XA 1LVKA 2R9RB 3J06A 1KTMA 2HKVA 1SYQA 1OKKD 2Y3BA 3LNMB 5COGA 3ZWIA 5FCLA 2HSQA 4U9DA 1RXQA 2J45A 3U9JA 4CJOA 3B0VC 1HE1A 3SXMA 4H54A 1YDIA 2HV6A 3LJBA 5BQGA 4P6IC 4JJFA 1OCCC 4BJ5C 1HMOA 2R7UA 1PCXA 5L0GA 4IAOA 4BPMA 4EBBA 2AWYA 1ZHTA 4XQ1A 4Z9IA 1I5NA 3SXZA 1ORJA 5KYWB 4BEMJ 1HW2A 1BBHA 3B29A 1APCA 4C3DA 5KYYB 1DOVA 1ZU5A 4OIRF 1NU7D 1YYXA 4KC9A 4NTAA 5JT4A 3EG9A 2DB4A 4JCHA 1JR8A 2JD3A 4PR9A 5HSWA 2XXAA 4W8PA 3ABMC 4AE4B 2P0NA 1D0YA 3QZCA 2G62A 4MTGA 3LNRA 2YLGA 3FVYA 3NMJA 1MMNA 2YVKA 2HS5A 3EGXA 4CS8C 4MTOA 4I44A 3TJ5A 4FAPB 3M79A 3QVZA 2R7TA 2HFIA 3Q6MA 1JAFA 3JCUQ 4DVYP 5L0JA 2LP4A 1AUEA 1NLXA 3O39A 4IGGA 3EPVA 3AG4C 3S9OA 1HY5A 3V5YA 2J9UA 3SZRA 1Z3IX 1HE9A 1H6GA 3CEXA 3Q7LA 2Q3TA 1S05A 2LK4A 1VK5A 1N1CA 3K66A 1ZZPA 2KYHA 2PBEA 1CGNA 2XSEA 3TJ6A 1WN0A 3US6A 4ZLCA 4XLPF 1LKXA 3GWLA 3L0IA 5JVEA 3RQEA 3FOPA 1TWHA 1FMVA 2VB6A 3O10A 1I4YA 1I4ZA 1OXBA 2AVKA 2L6GA 4C7OB 2JX0A 5KYUA 1K05A 2Q9CA 1LI7A 2L6HA 3EJNA 3DXJF 3W8IA 5HV9A 4WJ0A 2YL3A 1D1BA 3DE9A 3TOMA 1GS9A 2I8BA 4JTDB 3FAPB 3ZTMA 5F5HA 3M4BA 4A2NB 1NFNA 3LLIA 2L7AA 2XM0A 3POVA 1ZHWA 2QNLA 2Y39A 2XLVA 4NTFA 2V26A 2ZXPA 3QMKA 3Q7GA 4G78A 3TOLA 3E9VA 2WZLA 1W2WA 3EG9B 4Q4ZF 3GEIA 2MYSA 3H2VA 4C3EA 1XZQA 4A4AA 3DD7A 1XWJA 3U0CA 1MMGA 2VCAA 4G7OF 1D0ZA 3B0UX 3N0TA 5KYXB 3G4XA 2NSFA 3CZ6A 2EINC 1ZHYA 1CGME 2ZXWC 4QDLA 1M56C 1BR2A 2WVOA 2OOCA 3JRMO 1ZW2A 4PFPA
chains in the Genus database with same CATH topology
3MX3A 2W4BA 2BE5F 3DAFA 3W2VA 4KI2A 2YZSA 2P7VA 4BJTA 4CIHA 3AG2C 2Q9BA 5CI9A 1OCOC 3K33A 3KKBA 3AQCA 3VAYA 4OIQF 2A6HF 1O5HA 2H7VC 2IXPA 4YWQA 5EHHA 3EHNA 3NKDA 3AG3C 3ASNC 2YHSA 1G8XA 3K7DA 3RFYA 5E33A 2G3KA 3W8HA 2A68F 3X2QC 1M2VA 2Y3HA 3ZVRA 4E7SA 2E87A 3E70C 4IRUA 4J30B 1MMAA 3FHDA 1ZHXA 3JT1A 4Q5SF 3EZIA 5DLJA 3EZHA 2A6EF 3L34A 2GFHA 3IEEA 3NKEA 3ASOC 2PX0A 4PJLA 3HTKC 3S27A 5B3SC 4IJJA 2FGYA 2IOQA 4O79A 2KGOA 3LLKA 3S29A 1MMDA 4HFFB 4BJ6A 3OEOA 4YT2A 2DGJA 2FFHA 3RYLA 3UMKA 4C7OA 2W45A 3N2ZB 1QZXA 4H4KC 2KNHA 4CS7A 5T3WA 1VOMA 4G0HA 2CNWD 2VH3A 2EIKC 2J0WA 3AG1C 3GANA 3EFOA 1KU2A 2XRHA 3OWTA 2YEVA 3FDQA 2J7PA 3JSZA 2EIJC 3PMRA 1M2VB 1ST6A 3K1IC 4NY3A 2P6VA 3ABLC 2L81A 1J8MF 5KYXA 3NDBB 4KBLA 2R7RA 2Y3GA 1D1AA 1Z6AA 2X51A 4JURI 2J9VA 4N06A 4LLEA 1PD1A 4M63A 1TR2A 4PJJA 4GEHA 3ZSUA 4AX2A 2KW3C 1D1CA 1Z63A 5T3TA 1J8YF 3DZAA 4AK9A 3B0PA 4BJ1A 3LS0A 5F5FA 4MNDA 4G7ZF 3DJNB 4BJ6C 3FAJA 1ZYRF 1S7ZA 3T6JA 4MQ9F 2ZXOA 3CQZA 3I4UA 3JYHA 4G7HF 2NUPA 3EFOB 4U5CE 4CSAA 4KNVA 3SNHA 2OCCC 3OA1A 3TD7A 3DJUB 4I1MA 4BG0A 4BEJA 3AQBA 3DAGA 4ZLDA 2A1DD 2LSEA 1OKKA 2QTVA 4QI2A 3SP1A 1Z23A 2EIMC 3EHMA 3KL4A 4FX5A 4RD9A 3I5PA 2D5RB 2J46A 4JZAA 4B6IA 5L3QA 4QI0A 4CBEA 1OCRC 5T1DB 4GYTA 5BUOA 3HLZA 2B0JA 3ECSA 4I1OB 3H65A 3RKOF 1FFTC 3T6BA 4LERA 1BR4A 3KH2A 5DS4A 2CGEA 2H7OA 2NUTA 4EWCA 4FWVA 2WL8A 3K1HA 1TWGA 1BR1A 4DBRA 2EILC 4O6NA 1V55C 4X0RA 2NG1A 3EH1A 2IXNA 2R7VA 3RIPA 4U5EE 2A69F 4JW1A 1TKNA 2NUPB 2CW0F 4W8KA 3K6BA 5L3VA 4C3BA 1NZEA 3KMIA 5CI8A 4PJMA 4YN0B 2PFDA 3UMHA 4CSAC 3S28A 4YT4A 4OIOF 2WB7A 3B9QA 2J0XA 4E7ZA 4YT5A 1FMWA 1MNEA 2IXOA 2DYRC 2R7OA 4F4BA 3DM5A 1VYKA 4JVSA 5DQZA 4DOZA 2CDQA 1D0XA 4U5BE 4PJNA 2C04A 4YT8A 5DS5A 1FTSA 3LEVA 3ZC4A 1NG1A 2WZFA 3WG7C 3DM9B 4ULWA 4Q7CA 2R7SA 1NU9C 2WVQA 5DQTA 4HFKB 2NUTB 2PF4E 1MNDA 2G3VA 4JJGA 3EH2A 2C03A 3N24A 5B1BC 1IZMA 2XL4A 1TWAA 1M57C 3Q6NA 3LAYA 4LLCA 1SMYF 4HEAJ 4KNWA 3NYJA 5E3CA 2IYLD 4CS9A 1JPNA 3EGDB 3NYMA 3ITFA 1RJ9A 2MWQA 5DVWA 1SZIA 4IWBA 4RDAA 1VMAA 2QY9A 3V7OA 2DYSC 4DBQA 1M2OA 4RBNA 2W4MA 4FESA 4O7GA 3T4RA 3UNGC 5IY5C 2HV7A 3UR3C 4OD4A 2KQ9A 3NRHA 4K7BA 2IXMA 2V3CC 1Z5ZA 2ZPAA 3GODA 3W2WA 3LESA 2PX3A 4OIPF 4PFOA 4OINF 2PP4A 4XTKA 2CNWA 3F46A 3M1CB 2L9JA 4J32B 1VYIA 1OCZC 1ZHZA 2Y69C 2Y3DA 1RJ9B 2Q9AA 2VASA 4ANJA 4CS9C 5D92A 4O6MA 2XXAB 3DMDA 3X1OA 4K0DA 5EGYA 4LACB 4U5HA 2J7PD 5D91A 5KYNA 4O6YA 4HE8D 3EGXB 3HJCA 4BJ5A 2W9YA 3PHF2 1O87A 3NYLA 2R7WA 4XLNF 2ZXRA 2M4EA 4YJWA 3ZIBA 4XWJA 5KYWA 5KYYA 3EGDA 4I3MA 1QLEC 2R7QA 1WGWA 5B1AC 3SEOA 3S0XA 3UGOA 4CS8A 1V54C 3ZG1A 2OG2A 4AE4A 2J9WA 3MLGA 5KYUB 3UGPA 1PD0A 3F47A 4DVZA 2Z15A 4U5DE 2H7BA 2O9XA 3NG1A 3CSKA 5E3AA 4U5GA 1IW7F 4U5FE 1TWCA 2KJGA 1FFHA 1JPJA 2R7XA 3JRTA 3WODF 3ABKC 5E2QA 3RH3A 4PK4A 1ZU4A 3SYNA 1LS1A 3VYWA 3LS1A 3UMIA 4OD5A 3I5QA 2WVNA 1SF8A 5DS6A 2WZGA 3EQLF 3O6XA 1LVKA 1OKKD 2Y3BA 5FCLA 3B0VC 2J45A 2HV6A 3LJBA 4P6IC 4JJFA 1OCCC 4BJ5C 2R7UA 1PCXA 4IAOA 4EBBA 1ZHTA 5KYWB 5KYYB 4C3DA 1ZU5A 4OIRF 1NU7D 4KC9A 3EG9A 4JCHA 2JD3A 5HSWA 2XXAA 3ABMC 4AE4B 1D0YA 3QZCA 2G62A 3LNRA 3FVYA 1MMNA 4CS8C 3EGXA 4I44A 2R7TA 3Q6MA 4DVYP 3JCUQ 3O39A 3EPVA 3AG4C 2J9UA 3SZRA 1Z3IX 3Q7LA 2Q3TA 1VK5A 1N1CA 3K66A 4ZLCA 2XSEA 4XLPF 1LKXA 3L0IA 1TWHA 1FMVA 2VB6A 4C7OB 5KYUA 2Q9CA 3EJNA 3DXJF 3W8IA 4WJ0A 1D1BA 2I8BA 5F5HA 4A2NB 3LLIA 3POVA 1ZHWA 2Y39A 2V26A 2ZXPA 3QMKA 3Q7GA 3E9VA 2WZLA 1W2WA 3EG9B 4Q4ZF 2MYSA 4C3EA 3DD7A 4G7OF 1MMGA 1D0ZA 3B0UX 3N0TA 5KYXB 3CZ6A 2EINC 1ZHYA 2ZXWC 4QDLA 1M56C 1BR2A 2WVOA 4PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W4B A;  3POV A;  5HSW A;  3FHD A;  2W45 A; 
#chains in the Genus database with same CATH topology
 3MX3 A;  1Y6D A;  2YL7 A;  1GM5 A;  4CDV A;  1CPR A;  2W4B A;  2BE5 F;  3DAF A;  3W2V A;  4KI2 A;  2YZS A;  2P7V A;  4PAC A;  4BJT A;  3AG2 C;  2Q9B A;  2XS8 A;  4CIH A;  5CI9 A;  1OCO C;  1Q0F A;  3K33 A;  2YL1 A;  3AQC A;  3KKB A;  3VAY A;  4OIQ F;  2A6H F;  4GQH A;  3R7C A;  2BC5 A;  1O5H A;  2A0U A;  2H7V C;  2HZ8 A;  2IXP A;  2LD6 A;  1T6I A;  2YL0 A;  3K1I A;  5AGF A;  1K04 A;  3EHN A;  3NKD A;  3AG3 C;  3ASN C;  4YWQ A;  5EHH A;  2YHS A;  1G8X A;  3K7D A;  3RFY A;  5E33 A;  3L8I A;  1H9T A;  2G3K A;  3W8H A;  2A68 F;  2Q4F A;  1M2V A;  3X2Q C;  2Y3H A;  3ZVR A;  4E7S A;  4J7T A;  2GA0 A;  2E87 A;  3JYY A;  4AL0 A;  4DXW A;  4JRZ A;  1FNT c;  3E70 C;  2VC9 A;  3FOO A;  4IRU A;  1G4W R;  4J30 B;  3ZQV A;  1MMA A;  1QPU A;  1U89 A;  1YVI A;  2LCH A;  3FHD A;  1ZHX A;  1A7E A;  3JT1 A;  5JLI A;  1JOG A;  3JSE O;  5A69 A;  1YYJ A;  4Q5S F;  1EI7 A;  4XPX A;  3EZI A;  5DLJ A;  3EZH A;  2A6E F;  2JPU A;  3L34 A;  2LFF A;  2GFH A;  2EPN A;  1OQC A;  2MHR A;  3IEE A;  3NKE A;  1NBB A;  3VRC A;  2B0H A;  3ASO C;  2PX0 A;  4L6R A;  1LI5 A;  4PJL A;  5TJ5 E;  3HTK C;  3S27 A;  5B3S C;  2HSB A;  4IJJ A;  2FGY A;  5FZT A;  4E17 A;  2IOQ A;  3IHU A;  4O79 A;  2ASR A;  2EPL X;  2KGO A;  3LLK A;  3S29 A;  3U8V A;  1MMD A;  2XL8 A;  4N6H A;  5L0C A;  4HFF B;  4BJ6 A;  3OEO A;  4YT2 A;  4D4X A;  3RW0 A;  2HUJ A;  2DGJ A;  2FFH A;  3RYL A;  3UMK A;  4C7O A;  3BRJ A;  3GM3 A;  1T6Q A;  2W45 A;  5A6J A;  5L0F A;  3N2Z B;  1YZC A;  3CAX A;  1QZX A;  4H4K C;  1YA7 O;  2KNH A;  4Z9H A;  4CS7 A;  5T3W A;  4EHP A;  4EUK B;  3G50 A;  3V5X A;  2ZD9 A;  1A7D A;  1VOM A;  4G0H A;  2CNW D;  1Q0M A;  2EIK C;  2J0W A;  2VH3 A;  3AG1 C;  2R02 A;  3EFO A;  2YRF A;  3GAN A;  2XLM A;  1KU2 A;  3KYJ A;  1C03 A;  3VF0 A;  5BQI A;  2XRH A;  3OWT A;  4NC3 A;  4YL0 A;  2OKU A;  2YEV A;  3FDQ A;  2J7P A;  3JSZ A;  2EIJ C;  4ULV A;  3PMR A;  1M2V B;  1ST6 A;  1LPE A;  3K1I C;  2XM4 A;  1M6T A;  4NY3 A;  2P6V A;  3ABL C;  4U9E A;  2L81 A;  1L7C A;  1J8M F;  5KYX A;  3NDB B;  4KBL A;  3C8G D;  2R7R A;  1VTM P;  2Y3G A;  3GWN A;  3ZDL A;  3BEH A;  4JC7 A;  1UG7 A;  1D1A A;  1Z6A A;  2X51 A;  1YJG A;  4JUR I;  2YQY A;  2J9V A;  1Q0G A;  4N06 A;  4IB4 A;  5JSL A;  4ER9 A;  3RVY A;  4LLE A;  4LDR A;  4Z9J A;  1PD1 A;  5AC5 A;  1DOW A;  1JRA A;  2Q7R A;  1QQ3 A;  3GEE A;  2XLO A;  4YL1 A;  4M63 A;  2D4U A;  2AP3 A;  1TR2 A;  1Q0K A;  2UUH A;  4PJJ A;  1WWP A;  5A6B D;  1E85 A;  4GEH A;  1EQ1 A;  3ZSU A;  2OEV A;  4AX2 A;  2KW3 C;  3HNL A;  3HNJ A;  2R03 A;  1D1C A;  256B A;  4YK5 A;  1H9G A;  5COM A;  1Z63 A;  2XLW A;  1LE2 A;  1R5I D;  5T3T A;  4MW8 A;  3RF3 A;  1OW7 A;  3HKK A;  3SXK A;  2RD9 A;  5L3V A;  1J8Y F;  3DZA A;  4MTF A;  2HMZ A;  1KNY A;  1OW8 A;  3B0P A;  4AK9 A;  1RMV A;  2LIG A;  3KYI A;  3LS0 A;  4XPY A;  4BJ1 A;  1Q0D A;  1RKC A;  5F5F A;  4MND A;  4G7Z F;  2AWC A;  3DJN B;  1UFB A;  2VCB A;  4MVU A;  4BJ6 C;  3C18 A;  1ZYR F;  1S7Z A;  3FAJ A;  5B3I A;  2QE9 A;  1A41 A;  2GWW A;  4ONS A;  1WAS A;  2GAQ A;  3T6J A;  3U5S A;  1YZA A;  4MQ9 F;  2J8W A;  2ZXO A;  3CQZ A;  3I4U A;  3JYH A;  3T9O A;  2NUP A;  3EFO B;  4U5C E;  4G7H F;  4CSA A;  4KNV A;  4K1O A;  3QW0 A;  3QTH A;  3SNH A;  2OCC C;  3OA1 A;  3TD7 A;  2I15 A;  3DJU B;  4I1M A;  4BG0 A;  3AQB A;  4BEJ A;  3DAG A;  1A7V A;  2A1D D;  2LSE A;  1YA9 A;  4ZLD A;  5L0I A;  4DRI B;  1OKK A;  2QTV A;  4QI2 A;  1R4T A;  2PNO A;  3SP1 A;  1Z23 A;  2EIM C;  3EHM A;  3KL4 A;  1T6U A;  3R2P A;  4FX5 A;  4RD9 A;  3I5P A;  2D5R B;  2NSG A;  4MVR A;  2J46 A;  4JZA A;  4JCZ A;  4B6I A;  1CGO A;  4QI0 A;  2R05 A;  3DE8 A;  4CBE A;  1OCR C;  5L3Q A;  5T1D B;  4DRJ B;  3L8J A;  2KC3 A;  3GOR A;  4GYT A;  2HMQ A;  3HLZ A;  5BUO A;  2H8A A;  2B0J A;  3ECS A;  1K40 A;  4MVS A;  4I1O B;  3H65 A;  3RKO F;  2LFD A;  3HNK A;  3TQO A;  4MS2 A;  5CIV A;  1MQV A;  5EK0 A;  1FFT C;  1V4A A;  3T6B A;  3W4Y A;  4LER A;  4MVM A;  3IQT A;  1JMW A;  1BR4 A;  5JUA A;  1BZ4 A;  1HMD A;  1CPQ A;  3KH2 A;  4MVZ A;  5JS5 A;  5DS4 A;  2CGE A;  2H7O A;  2NUT A;  4EWC A;  2OQM A;  3H2U A;  4FWV A;  2WL8 A;  4R32 A;  2OJE D;  3MFN A;  3K1H A;  1TWG A;  2RSE B;  3C62 A;  1BR1 A;  4JIO A;  4DBR A;  1A0B A;  2EIL C;  3GM1 A;  3VM6 A;  4O6N A;  1V55 C;  4EBJ A;  4X0R A;  1RKE A;  3NMK A;  2NG1 A;  3EH1 A;  2IXN A;  2X0C A;  2R7V A;  3RIP A;  4U5E E;  2A69 F;  1GQA A;  4JW1 A;  1TKN A;  2NUP B;  2CW0 F;  4W8K A;  3K6B A;  3GEH A;  1OXK A;  3IPM O;  3GM2 A;  1GGQ A;  1NZE A;  3V5Z A;  3WAQ A;  3KMI A;  5CI8 A;  4C3B A;  4PJM A;  4YN0 B;  2PFD A;  3HNI A;  3UMH A;  2XL6 A;  3JTL O;  4N4W A;  3TK0 A;  2P1A A;  3A11 A;  4JKV A;  3L1M A;  2HJM A;  1VB5 A;  3JZ0 A;  4JE9 A;  3S28 A;  4YT4 A;  3PDM P;  4OIO F;  1U0B B;  2GDC A;  1YLM A;  3C8Z A;  1BDJ B;  2WB7 A;  3B9Q A;  2J0X A;  4LDK A;  4P9F A;  3IQ6 A;  3LUT B;  3SXY A;  4AL1 A;  4CJG A;  3DKA A;  4E7Z A;  4YT5 A;  5AC4 A;  1FMW A;  1MNE A;  2IXO A;  3WHN A;  2DYR C;  2R7O A;  4F4B A;  3ZTZ A;  3DM5 A;  1VYK A;  4JVS A;  3RQG A;  4UDV A;  1LE4 A;  2YKZ A;  5DQZ A;  1TQG A;  3QW1 A;  2FAP B;  4WGZ A;  1FR0 A;  4DOZ A;  2CDQ A;  1D0X A;  1XZP A;  1FAP B;  4PJN A;  2KSF A;  4U5B E;  4EBK A;  1TFK B;  2C04 A;  4YT8 A;  2Q00 A;  1F1M A;  1FTS A;  5DS5 A;  3LEV A;  3ZC4 A;  1NG1 A;  2WZF A;  3WG7 C;  3DM9 B;  4ULW A;  4Q7C A;  2R7S A;  1NU9 C;  2WVQ A;  5DQT A;  1E83 A;  4HFK B;  2NUT B;  2PF4 E;  4CDY A;  4NTB A;  4J7Y A;  1MND A;  2G3V A;  4MVO A;  1WAT A;  1U6H A;  4JJG A;  3U2M A;  1SR2 A;  1NSG B;  2YWA A;  3EH2 A;  2C03 A;  3N24 A;  4JTC B;  3U8P A;  5A6A A;  5B1B C;  1IZM A;  5L0D A;  1T5O A;  4E18 A;  1RKE B;  1TWA A;  2XL4 A;  1M57 C;  3Q6N A;  3LAY A;  1VLS A;  4LLC A;  1SMY F;  4HEA J;  4KNW A;  2LQG A;  3NYJ A;  3AGU A;  5E3C A;  2IYL D;  4CS9 A;  1JPN A;  4CX9 A;  3EGD B;  3NYM A;  2ICW G;  3ITF A;  3T6G B;  3AOU A;  1EKY A;  4MVQ A;  1RJ9 A;  4DJ9 A;  1YAR O;  4XEK A;  1OR2 A;  2MWQ A;  5DVW A;  1SZI A;  4IWB A;  1YAU O;  1VMA A;  4RDA A;  1QSP A;  5K0I A;  2QY9 A;  3V7O A;  2DYS C;  3MYI A;  1HW1 A;  4DBQ A;  2P61 A;  1M2O A;  2UUI A;  2YLD A;  1C02 A;  2W4M A;  4RBN A;  4FES A;  4O7G A;  4XEF A;  3U9M A;  3T4R A;  3S90 A;  3UNG C;  2CCY A;  5IY5 C;  2HV7 A;  3UR3 C;  1VLT A;  4OD4 A;  1ZW3 A;  2KQ9 A;  3NRH A;  1QKR A;  4E0H A;  4K7B A;  2IXM A;  4CIP A;  2V3C C;  1Z5Z A;  2F22 A;  2ZPA A;  1T01 A;  3U3F A;  1B68 A;  2KK1 A;  4EIY A;  3AGT A;  4EKW A;  2OU6 A;  2YLI A;  2OEX A;  3GOD A;  1EA8 A;  4JTA B;  3W2W A;  4NQF A;  5A6K A;  3KPH A;  3IQ5 A;  3LES A;  1E86 A;  2PX3 A;  1TFO B;  3O55 A;  4WAB A;  2EPK X;  4OIP F;  4MW3 A;  3FMS A;  4PFO A;  4OIN F;  2R25 A;  1QVX A;  4CDA A;  4XPW A;  2PP4 A;  4XTK A;  1ORS C;  2CNW A;  2L6F A;  2L9J A;  3F46 A;  3M1C B;  4J32 B;  2QUP A;  2A0B A;  3QVY A;  1V74 B;  1VYI A;  1AVO B;  1OCZ C;  3A9C A;  1C17 M;  1ZHZ A;  3UGP A;  2Y69 C;  2XLE A;  2TMV P;  2Y3D A;  1RJ9 B;  2Q9A A;  3AJM A;  4XEV A;  2VAS A;  3M4C A;  3PCV A;  5D92 A;  4O6M A;  5JP7 A;  4ANJ A;  4CS9 C;  1OW6 A;  2XXA B;  2BL2 A;  2J9B A;  3C8G A;  2HJ3 A;  2NPU A;  3DMD A;  4K0D A;  3X1O A;  5EGY A;  4LAC B;  4NCQ A;  4U5H A;  2EPO A;  2J7P D;  1Y4C A;  5D91 A;  4O6Y A;  3M15 A;  4HE8 D;  3RVZ A;  5KYN A;  3EGX B;  3HJC A;  3TUL A;  4BJ5 A;  1LIH A;  2W9Y A;  3PHF 2;  4IAQ A;  1RCP A;  1G4U S;  1O87 A;  3NYL A;  2R7W A;  1WTY A;  3ATP A;  4XLN F;  2VCC A;  2ZXR A;  3C7J A;  2IM8 A;  1LS4 A;  2M4E A;  5COF A;  2DI3 A;  5A6B A;  4YJW A;  3ZIB A;  4XWJ A;  5KYW A;  2EPM X;  2CYD A;  2XLD A;  5JRA A;  5KYY A;  3EGD A;  4JEB A;  4YL3 A;  4I3M A;  1QLE C;  2R7Q A;  4LDQ A;  3U3B A;  1WGW A;  5B1A C;  1ZVZ A;  5F28 E;  3SEO A;  3S0X A;  3UGO A;  4P9T A;  3DWW A;  1V54 C;  3MYF A;  4CS8 A;  1G5Z A;  3ZG1 A;  2OG2 A;  4AE4 A;  2J9W A;  3MLG A;  3NMI A;  5KYU B;  1PD0 A;  3G4Z A;  2XLH A;  1E2X A;  4IAR A;  1LM3 B;  3F47 A;  1AEP A;  4DVZ A;  2Z15 A;  3MBG A;  4CSA C;  4U5D E;  5L0H A;  2H7B A;  4JEA A;  2AU5 A;  5GPG B;  3DI5 A;  1O3U A;  2O9X A;  3B71 A;  3LEO A;  2IBF A;  5BQH A;  3NG1 A;  3S84 A;  3CSK A;  5E3A A;  4U5G A;  1IW7 F;  4U5F E;  4DRH B;  1OR3 A;  1WOL A;  1FFH A;  1TWC A;  1JPJ A;  2KJG A;  2QLA A;  4E0I A;  1ORY A;  2M64 A;  2R7X A;  3JRT A;  3ZQY A;  3WOD F;  3ABK C;  5E2Q A;  2ETS A;  3RH3 A;  1NFO A;  3U2L A;  2OJQ A;  3IQC A;  4PK4 A;  4N6C A;  1T9K A;  4WGY A;  3FXH A;  1L3P A;  1H7I A;  1ZU4 A;  3SYN A;  3RQF A;  1LS1 A;  2XS1 A;  4D4N A;  3VYW A;  1PV3 A;  3C8G B;  3LS1 A;  3UMI A;  3C63 A;  3I5Q A;  2WVN A;  1SF8 A;  4OD5 A;  1Z7Q c;  5DS6 A;  1E84 A;  2WZG A;  3EQL F;  3O6X A;  1LVK A;  2R9R B;  3J06 A;  1KTM A;  2HKV A;  1SYQ A;  1OKK D;  2Y3B A;  3LNM B;  5COG A;  3ZWI A;  5FCL A;  2HSQ A;  4U9D A;  1RXQ A;  2J45 A;  3U9J A;  4CJO A;  3B0V C;  1HE1 A;  3SXM A;  4H54 A;  1YDI A;  2HV6 A;  3LJB A;  5BQG A;  4P6I C;  4JJF A;  1OCC C;  4BJ5 C;  1HMO A;  2R7U A;  1PCX A;  5L0G A;  4IAO A;  4BPM A;  4EBB A;  2AWY A;  1ZHT A;  4XQ1 A;  4Z9I A;  1I5N A;  3SXZ A;  1ORJ A;  5KYW B;  4BEM J;  1HW2 A;  1BBH A;  3B29 A;  1APC A;  4C3D A;  5KYY B;  1DOV A;  1ZU5 A;  4OIR F;  1NU7 D;  1YYX A;  4KC9 A;  4NTA A;  5JT4 A;  3EG9 A;  2DB4 A;  4JCH A;  1JR8 A;  2JD3 A;  4PR9 A;  5HSW A;  2XXA A;  4W8P A;  3ABM C;  4AE4 B;  2P0N A;  1D0Y A;  3QZC A;  2G62 A;  4MTG A;  3LNR A;  2YLG A;  3FVY A;  3NMJ A;  1MMN A;  2YVK A;  2HS5 A;  3EGX A;  4CS8 C;  4MTO A;  4I44 A;  3TJ5 A;  4FAP B;  3M79 A;  3QVZ A;  2R7T A;  2HFI A;  3Q6M A;  1JAF A;  3JCU Q;  4DVY P;  5L0J A;  2LP4 A;  1AUE A;  1NLX A;  3O39 A;  4IGG A;  3EPV A;  3AG4 C;  3S9O A;  1HY5 A;  3V5Y A;  2J9U A;  3SZR A;  1Z3I X;  1HE9 A;  1H6G A;  3CEX A;  3Q7L A;  2Q3T A;  1S05 A;  2LK4 A;  1VK5 A;  1N1C A;  3K66 A;  1ZZP A;  2KYH A;  2PBE A;  1CGN A;  2XSE A;  3TJ6 A;  1WN0 A;  3US6 A;  4ZLC A;  4XLP F;  1LKX A;  3GWL A;  3L0I A;  5JVE A;  3RQE A;  3FOP A;  1TWH A;  1FMV A;  2VB6 A;  3O10 A;  1I4Y A;  1I4Z A;  1OXB A;  2AVK A;  2L6G A;  4C7O B;  2JX0 A;  5KYU A;  1K05 A;  2Q9C A;  1LI7 A;  2L6H A;  3EJN A;  3DXJ F;  3W8I A;  5HV9 A;  4WJ0 A;  2YL3 A;  1D1B A;  3DE9 A;  3TOM A;  1GS9 A;  2I8B A;  4JTD B;  3FAP B;  3ZTM A;  5F5H A;  3M4B A;  4A2N B;  1NFN A;  3LLI A;  2L7A A;  2XM0 A;  3POV A;  1ZHW A;  2QNL A;  2Y39 A;  2XLV A;  4NTF A;  2V26 A;  2ZXP A;  3QMK A;  3Q7G A;  4G78 A;  3TOL A;  3E9V A;  2WZL A;  1W2W A;  3EG9 B;  4Q4Z F;  3GEI A;  2MYS A;  3H2V A;  4C3E A;  1XZQ A;  4A4A A;  3DD7 A;  1XWJ A;  3U0C A;  1MMG A;  2VCA A;  4G7O F;  1D0Z A;  3B0U X;  3N0T A;  5KYX B;  3G4X A;  2NSF A;  3CZ6 A;  2EIN C;  1ZHY A;  1CGM E;  2ZXW C;  4QDL A;  1M56 C;  1BR2 A;  2WVO A;  2OOC A;  3JRM O;  1ZW2 A;  4PFP A; 
#chains in the Genus database with same CATH homology
 3MX3 A;  2W4B A;  2BE5 F;  3DAF A;  3W2V A;  4KI2 A;  2YZS A;  2P7V A;  4BJT A;  4CIH A;  3AG2 C;  2Q9B A;  5CI9 A;  1OCO C;  3K33 A;  3KKB A;  3AQC A;  3VAY A;  4OIQ F;  2A6H F;  1O5H A;  2H7V C;  2IXP A;  4YWQ A;  5EHH A;  3EHN A;  3NKD A;  3AG3 C;  3ASN C;  2YHS A;  1G8X A;  3K7D A;  3RFY A;  5E33 A;  2G3K A;  3W8H A;  2A68 F;  3X2Q C;  1M2V A;  2Y3H A;  3ZVR A;  4E7S A;  2E87 A;  3E70 C;  4IRU A;  4J30 B;  1MMA A;  3FHD A;  1ZHX A;  3JT1 A;  4Q5S F;  3EZI A;  5DLJ A;  3EZH A;  2A6E F;  3L34 A;  2GFH A;  3IEE A;  3NKE A;  3ASO C;  2PX0 A;  4PJL A;  3HTK C;  3S27 A;  5B3S C;  4IJJ A;  2FGY A;  2IOQ A;  4O79 A;  2KGO A;  3LLK A;  3S29 A;  1MMD A;  4HFF B;  4BJ6 A;  3OEO A;  4YT2 A;  2DGJ A;  2FFH A;  3RYL A;  3UMK A;  4C7O A;  2W45 A;  3N2Z B;  1QZX A;  4H4K C;  2KNH A;  4CS7 A;  5T3W A;  1VOM A;  4G0H A;  2CNW D;  2VH3 A;  2EIK C;  2J0W A;  3AG1 C;  3GAN A;  3EFO A;  1KU2 A;  2XRH A;  3OWT A;  2YEV A;  3FDQ A;  2J7P A;  3JSZ A;  2EIJ C;  3PMR A;  1M2V B;  1ST6 A;  3K1I C;  4NY3 A;  2P6V A;  3ABL C;  2L81 A;  1J8M F;  5KYX A;  3NDB B;  4KBL A;  2R7R A;  2Y3G A;  1D1A A;  1Z6A A;  2X51 A;  4JUR I;  2J9V A;  4N06 A;  4LLE A;  1PD1 A;  4M63 A;  1TR2 A;  4PJJ A;  4GEH A;  3ZSU A;  4AX2 A;  2KW3 C;  1D1C A;  1Z63 A;  5T3T A;  1J8Y F;  3DZA A;  4AK9 A;  3B0P A;  4BJ1 A;  3LS0 A;  5F5F A;  4MND A;  4G7Z F;  3DJN B;  4BJ6 C;  3FAJ A;  1ZYR F;  1S7Z A;  3T6J A;  4MQ9 F;  2ZXO A;  3CQZ A;  3I4U A;  3JYH A;  4G7H F;  2NUP A;  3EFO B;  4U5C E;  4CSA A;  4KNV A;  3SNH A;  2OCC C;  3OA1 A;  3TD7 A;  3DJU B;  4I1M A;  4BG0 A;  4BEJ A;  3AQB A;  3DAG A;  4ZLD A;  2A1D D;  2LSE A;  1OKK A;  2QTV A;  4QI2 A;  3SP1 A;  1Z23 A;  2EIM C;  3EHM A;  3KL4 A;  4FX5 A;  4RD9 A;  3I5P A;  2D5R B;  2J46 A;  4JZA A;  4B6I A;  5L3Q A;  4QI0 A;  4CBE A;  1OCR C;  5T1D B;  4GYT A;  5BUO A;  3HLZ A;  2B0J A;  3ECS A;  4I1O B;  3H65 A;  3RKO F;  1FFT C;  3T6B A;  4LER A;  1BR4 A;  3KH2 A;  5DS4 A;  2CGE A;  2H7O A;  2NUT A;  4EWC A;  4FWV A;  2WL8 A;  3K1H A;  1TWG A;  1BR1 A;  4DBR A;  2EIL C;  4O6N A;  1V55 C;  4X0R A;  2NG1 A;  3EH1 A;  2IXN A;  2R7V A;  3RIP A;  4U5E E;  2A69 F;  4JW1 A;  1TKN A;  2NUP B;  2CW0 F;  4W8K A;  3K6B A;  5L3V A;  4C3B A;  1NZE A;  3KMI A;  5CI8 A;  4PJM A;  4YN0 B;  2PFD A;  3UMH A;  4CSA C;  3S28 A;  4YT4 A;  4OIO F;  2WB7 A;  3B9Q A;  2J0X A;  4E7Z A;  4YT5 A;  1FMW A;  1MNE A;  2IXO A;  2DYR C;  2R7O A;  4F4B A;  3DM5 A;  1VYK A;  4JVS A;  5DQZ A;  4DOZ A;  2CDQ A;  1D0X A;  4U5B E;  4PJN A;  2C04 A;  4YT8 A;  5DS5 A;  1FTS A;  3LEV A;  3ZC4 A;  1NG1 A;  2WZF A;  3WG7 C;  3DM9 B;  4ULW A;  4Q7C A;  2R7S A;  1NU9 C;  2WVQ A;  5DQT A;  4HFK B;  2NUT B;  2PF4 E;  1MND A;  2G3V A;  4JJG A;  3EH2 A;  2C03 A;  3N24 A;  5B1B C;  1IZM A;  2XL4 A;  1TWA A;  1M57 C;  3Q6N A;  3LAY A;  4LLC A;  1SMY F;  4HEA J;  4KNW A;  3NYJ A;  5E3C A;  2IYL D;  4CS9 A;  1JPN A;  3EGD B;  3NYM A;  3ITF A;  1RJ9 A;  2MWQ A;  5DVW A;  1SZI A;  4IWB A;  4RDA A;  1VMA A;  2QY9 A;  3V7O A;  2DYS C;  4DBQ A;  1M2O A;  4RBN A;  2W4M A;  4FES A;  4O7G A;  3T4R A;  3UNG C;  5IY5 C;  2HV7 A;  3UR3 C;  4OD4 A;  2KQ9 A;  3NRH A;  4K7B A;  2IXM A;  2V3C C;  1Z5Z A;  2ZPA A;  3GOD A;  3W2W A;  3LES A;  2PX3 A;  4OIP F;  4PFO A;  4OIN F;  2PP4 A;  4XTK A;  2CNW A;  3F46 A;  3M1C B;  2L9J A;  4J32 B;  1VYI A;  1OCZ C;  1ZHZ A;  2Y69 C;  2Y3D A;  1RJ9 B;  2Q9A A;  2VAS A;  4ANJ A;  4CS9 C;  5D92 A;  4O6M A;  2XXA B;  3DMD A;  3X1O A;  4K0D A;  5EGY A;  4LAC B;  4U5H A;  2J7P D;  5D91 A;  5KYN A;  4O6Y A;  4HE8 D;  3EGX B;  3HJC A;  4BJ5 A;  2W9Y A;  3PHF 2;  1O87 A;  3NYL A;  2R7W A;  4XLN F;  2ZXR A;  2M4E A;  4YJW A;  3ZIB A;  4XWJ A;  5KYW A;  5KYY A;  3EGD A;  4I3M A;  1QLE C;  2R7Q A;  1WGW A;  5B1A C;  3SEO A;  3S0X A;  3UGO A;  4CS8 A;  1V54 C;  3ZG1 A;  2OG2 A;  4AE4 A;  2J9W A;  3MLG A;  5KYU B;  3UGP A;  1PD0 A;  3F47 A;  4DVZ A;  2Z15 A;  4U5D E;  2H7B A;  2O9X A;  3NG1 A;  3CSK A;  5E3A A;  4U5G A;  1IW7 F;  4U5F E;  1TWC A;  2KJG A;  1FFH A;  1JPJ A;  2R7X A;  3JRT A;  3WOD F;  3ABK C;  5E2Q A;  3RH3 A;  4PK4 A;  1ZU4 A;  3SYN A;  1LS1 A;  3VYW A;  3LS1 A;  3UMI A;  4OD5 A;  3I5Q A;  2WVN A;  1SF8 A;  5DS6 A;  2WZG A;  3EQL F;  3O6X A;  1LVK A;  1OKK D;  2Y3B A;  5FCL A;  3B0V C;  2J45 A;  2HV6 A;  3LJB A;  4P6I C;  4JJF A;  1OCC C;  4BJ5 C;  2R7U A;  1PCX A;  4IAO A;  4EBB A;  1ZHT A;  5KYW B;  5KYY B;  4C3D A;  1ZU5 A;  4OIR F;  1NU7 D;  4KC9 A;  3EG9 A;  4JCH A;  2JD3 A;  5HSW A;  2XXA A;  3ABM C;  4AE4 B;  1D0Y A;  3QZC A;  2G62 A;  3LNR A;  3FVY A;  1MMN A;  4CS8 C;  3EGX A;  4I44 A;  2R7T A;  3Q6M A;  4DVY P;  3JCU Q;  3O39 A;  3EPV A;  3AG4 C;  2J9U A;  3SZR A;  1Z3I X;  3Q7L A;  2Q3T A;  1VK5 A;  1N1C A;  3K66 A;  4ZLC A;  2XSE A;  4XLP F;  1LKX A;  3L0I A;  1TWH A;  1FMV A;  2VB6 A;  4C7O B;  5KYU A;  2Q9C A;  3EJN A;  3DXJ F;  3W8I A;  4WJ0 A;  1D1B A;  2I8B A;  5F5H A;  4A2N B;  3LLI A;  3POV A;  1ZHW A;  2Y39 A;  2V26 A;  2ZXP A;  3QMK A;  3Q7G A;  3E9V A;  2WZL A;  1W2W A;  3EG9 B;  4Q4Z F;  2MYS A;  4C3E A;  3DD7 A;  4G7O F;  1MMG A;  1D0Z A;  3B0U X;  3N0T A;  5KYX B;  3CZ6 A;  2EIN C;  1ZHY A;  2ZXW C;  4QDL A;  1M56 C;  1BR2 A;  2WVO A;  4PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...