2W45A

Epstein-barr virus alkaline nuclease
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
460
structure length
449
Chain Sequence
LEDPMEEMTSYTFARFLRSPETEAFVRNLDRPPQMPAMRFVYLYCLCKQIQEFSGETGFCDFVSSLVQEDGPSLKSIYWGLQEATDEQRTVLCSYVESMTRGQSENLMWDILRNGIISSSKLLSTIKNGPTKVFEPAFGGPVAFGLRCEDTVKDIVCKLICGDASANRQFGFMISPTDGIFGVSLDLCVNVESQGDFILFTDRSCIYEIKCRFKYLFSKSEFDPIYPSYTALYKRPCKRSFIRFINSIARPTVEYVPDGRLPSEGDYLLTQDEAWNLKDVRKRKLGPGHDLVADSLAANRGVESMLYVMTDPSENAGRIGIKDRVPVNIFINPRHNYFYQVLLQYKIVGDYVRHSGGGKPGRDCSPRVNIVTAFFRKRSPLDPATCTLGSDLLLDASVEIPVAVLVTPVVLPDSVIRKTLSTAAGSWKAYADNTFDTAPWVPSGLFADD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALKALINE EXONUCLEASE
publication title A Bridge Crosses the Active Site Canyon of the Epstein-Barr Virus Nuclease with DNase and Rnase Activity.
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Hydrolase
total genus 142
structure length 449
sequence length 460
chains with identical sequence B
ec nomenclature ec 3.1.11.-:
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01771 Viral_alk_exo Viral alkaline exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.860 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w45A01
2W4BA 3POVA 2W45A 5HSWA 3FHDA
chains in the Genus database with same CATH superfamily
3JT1A 4CJGA 3IQ6A 1LVKA 2WVNA 2H7VC 3T6JA 1RMVA 2M64A 3VYWA 3N0TA 2NG1A 3U5SA 4AX2A 2HV7A 3K1IA 2CW0F 5D92A 2EIJC 2RSEB 5COFA 4DRJB 4BJ6C 3ZVRA 1Q0DA 1D1CA 2IXPA 3DZAA 4YJWA 2R7SA 4NTFA 1OKKD 1TR2A 2XS8A 3EZHA 4KNWA 2ICWG 5A6BD 4NTBA 3U9JA 3DKAA 3G50A 1OXKA 3ASOC 3EHMA 1QZXA 2NUPB 2OG2A 3LLIA 3VF0A 2R9RB 4ULWA 2QTVA 3M4CA 3NG1A 1TWCA 4PFOA 4W8KA 1D1AA 3HKKA 2YL0A 2WVQA 5CIVA 1H7IA 4I1MA 4ZLCA 1RKEA 3EG9A 1RKEB 3EG9B 3V5ZA 3ZC4A 3FHDA 5A69A 1V4AA 4PK4A 3K7DA 1L3PA 1YZAA 4R32A 3CZ6A 3HNJA 2P61A 1A7DA 2DYSC 3KMIA 1ZYRF 3FAJA 4JZAA 2D4UA 3NYLA 4O6MA 4I1OB 3O10A 4O7GA 4KC9A 5IY5C 3OA1A 2A1DD 3GWNA 1HW1A 1M57C 1H9GA 3UR3C 1JPJA 2ASRA 3RW0A 2R7XA 4RDAA 2L9JA 4E17A 4CIHA 1XZPA 1FMVA 4MVSA 4D4NA 4YT8A 3DMDA 4CDYA 1O87A 3M1CB 2Q9AA 2WZLA 2XS1A 2DGJA 4G0HA 1H9TA 2R7UA 3DJNB 1ZZPA 4IAQA 3DAGA 2A0BA 3O6XA 4YT2A 2MWQA 2VC9A 1J8YF 4DVZA 1C03A 2HMZA 3SZRA 2BE5F 5JS5A 5T3WA 1LI7A 1APCA 3RIPA 3Q7GA 4PFPA 5BQIA 1CPQA 1LI5A 1YA7O 3G4XA 3ZG1A 4NC3A 3ZSUA 5KYYA 3U0CA 4N4WA 2KJGA 1OR2A 4G7ZF 1H6GA 2HV6A 1OCRC 3SP1A 3KKBA 2HS5A 3LAYA 5JP7A 4QI2A 3DJUB 2WZFA 2UUHA 2CCYA 3I5QA 1Y6DA 1WATA 4YK5A 4XLPF 1EA8A 1Y4CA 2P1AA 3ECSA 3W8HA 3RQEA 1ORSC 3MX3A 2HMQA 4J7YA 3ZDLA 3PMRA 2J46A 2LIGA 3N24A 4CSAA 1BBHA 1E84A 3W2VA 2DYRC 1CGME 4LLCA 4OIPF 4EUKB 3L0IA 2EILC 3EFOA 3JYYA 3K6BA 3S0XA 2M4EA 4P9FA 1SZIA 5T3TA 1YJGA 2YL7A 3Q7LA 5T1DB 2R05A 1M2VA 3GORA 5DS4A 4U5GA 2C03A 4CJOA 3IQCA 4PJMA 5KYXA 1QLEC 3UGPA 1SF8A 4DRHB 2LSEA 3CAXA 4AE4B 5COMA 2RD9A 3TULA 3AG3C 1M56C 2KC3A 3AG1C 4EKWA 3U2MA 4Z9JA 2J9WA 2LCHA 4NY3A 3HLZA 2WL8A 1RCPA 2Y3BA 2YKZA 2FFHA 1FFTC 3JSZA 2W4BA 3LEVA 4JJFA 3UMHA 1XZQA 4DVYP 4F4BA 2VH3A 5L0IA 4OIOF 2QNLA 3TD7A 5TJ5E 3JSEO 4JVSA 4YL0A 1OCOC 5JVEA 3PDMP 2TMVP 2YWAA 4PR9A 1Q0FA 1ZHTA 1A0BA 3EGDB 4BJ5A 4DBQA 2IXNA 3U9MA 4E0IA 4K0DA 4BJTA 4U5HA 3M4BA 3BEHA 4WJ0A 3WAQA 1D0XA 3ASNC 2GDCA 1HMOA 2H8AA 3N2ZB 2P7VA 4MVRA 2YLIA 3NMJA 2E87A 3DE8A 3E70C 3OWTA 1A7VA 3C8ZA 3JRTA 4E18A 4CS8C 2LD6A 4G7HF 3J06A 2NSGA 3Q6NA 2CGEA 1E85A 1QQ3A 2EPLX 4JEAA 5D91A 5F28E 3RFYA 1M6TA 1N1CA 2PX3A 1BZ4A 3NRHA 4RD9A 4JKVA 2PF4E 1Z3IX 4LDRA 3KYIA 4G7OF 3DI5A 3TJ5A 4CBEA 1YLMA 3QMKA 3TK0A 4HEAJ 4KBLA 1CGOA 2QE9A 5EK0A 2X0CA 3MBGA 4CDVA 1F1MA 1YAUO 4LLEA 1G8XA 3QVZA 2HJMA 2GFHA 1K04A 1S7ZA 1XWJA 3W2WA 5DS6A 3EJNA 3EGXA 3GM2A 5HSWA 3EGXB 4YT4A 3HNIA 2HZ8A 2Q9BA 2Y69C 3O55A 5L0CA 1MMNA 1ORYA 1T6UA 4MVOA 4D4XA 2YVKA 3B29A 1AUEA 2QLAA 1VYIA 1OW8A 4GEHA 3WHNA 3KH2A 5L0FA 1S05A 1JMWA 2EIMC 2ZXWC 2ZXOA 2Z15A 4L6RA 3AQBA 1L7CA 4N06A 3DM9B 3VRCA 4C7OA 3QVYA 5DS5A 4GQHA 3E9VA 1E2XA 3IQTA 4BJ6A 3LNRA 4MTFA 4C7OB 3EH2A 2Q4FA 1G4WR 2NUPA 3ABKC 4JTDB 5L0GA 4OIQF 3L34A 4DJ9A 3DM5A 3V5XA 1TWHA 2J9VA 1IW7F 3Q6MA 3H2VA 2OJQA 3NMIA 1D0YA 3NYMA 2JD3A 4MNDA 1VB5A 3OEOA 2GA0A 2KNHA 4U5DE 1JOGA 3FOPA 3HJCA 4NQFA 1YYXA 3QW1A 2YZSA 1WASA 2EINC 4G78A 4N6HA 4QI0A 3L8JA 4H54A 3A11A 4E0HA 1LIHA 4WGYA 4I44A 2OQMA 4HFKB 4Q5SF 5E2QA 3JYHA 4H4KC 3ZTZA 3AG2C 1U0BB 3H2UA 5E3CA 2HUJA 1R5ID 1WOLA 4X0RA 1BDJB 2IXOA 2KQ9A 4B6IA 1MMDA 3V7OA 4NTAA 5AC5A 1YARO 3T9OA 5EHHA 2NSFA 3LUTB 4YL3A 1TWGA 3UNGC 2KYHA 3GODA 1JRAA 4N6CA 3RVZA 4CS9C 3MFNA 3TOMA 2KSFA 1TWAA 1KNYA 3AG4C 4JEBA 1I4YA 2OCCC 2J45A 2VASA 3AGUA 3TQOA 2W4MA 4XPXA 2W9YA 4ANJA 1RJ9B 2J8WA 4MVUA 2AWCA 2OEVA 3AGTA 1TFKB 2LK4A 5AGFA 4C3BA 2V3CC 3JTLO 1VK5A 4JW1A 1YVIA 4JC7A 1V55C 3U8PA 4BJ1A 3T6BA 1QSPA 4HE8D 1SMYF 2J7PA 4PACA 4JCHA 4PJJA 4JIOA 4PJNA 2CNWA 4U9EA 2ZXRA 3IPMO 3IEEA 1VOMA 1RKCA 5B1AC 2G62A 4AL1A 4YWQA 4ZLDA 3B0UX 1ZW3A 3CQZA 4MW8A 5K0IA 2XSEA 3K1HA 3MLGA 5F5HA 2JX0A 4K1OA 2G3KA 2YQYA 4LDKA 4A4AA 3RVYA 2XLDA 3SEOA 3ITFA 2BL2A 3BRJA 4MVMA 2QUPA 3RQGA 3W4YA 1NU7D 1O5HA 1ZVZA 1T6IA 2GAQA 1Z5ZA 3UGOA 3QW0A 5EGYA 4LERA 4MVQA 2DB4A 3S84A 3GEEA 4I3MA 1QVXA 1OR3A 3HTKC 5F5FA 3VM6A 2XLHA 2XLVA 2D5RB 4Q7CA 4J32B 4PJLA 3C8GA 3C8GB 3S9OA 4BEJA 4MW3A 2EPNA 1HMDA 3A9CA 4MQ9F 4XEVA 2EIKC 3RF3A 1QPUA 1ZW2A 3T6GB 1DOVA 4AE4A 3QZCA 4CDAA 2XXAA 3ABLC 2FAPB 3I5PA 2XM0A 5E3AA 1FFHA 2H7OA 2XXAB 1A7EA 3T4RA 5KYNA 3SXKA 2Y39A 3LESA 2OJED 4BEMJ 5DQZA 2CDQA 1A41A 4ER9A 2L6GA 2AU5A 3HNLA 3DXJF 4CIPA 2R7OA 3RKOF 2XLEA 1RXQA 4C3DA 2XLOA 1ZHWA 2MYSA 2IXMA 1M2OA 2F22A 3DE9A 2B0JA 3NYJA 1ZHXA 3EGDA 4FESA 1G4US 4XTKA 3DD7A 2NPUA 1PCXA 1LS1A 4WGZA 2OU6A 3H65A 1HY5A 3R7CA 4U5EE 3ZQVA 2L81A 4KNVA 2IYLD 3C63A 4M63A 1NLXA 1TKNA 3GANA 1ZU5A 4O79A 5CI9A 1EI7A 1GM5A 5L3VA 1BR4A 2EPKX 2OOCA 3ABMC 3GWLA 3JZ0A 2LFFA 4IB4A 3GM1A 3MYFA 4OINF 4XLNF 2YL1A 5BQHA 2IM8A 4RBNA 1FMWA 1ZHYA 4CS8A 1ZU4A 2A69F 2OKUA 4GYTA 3C18A 4CS7A 4MTGA 2DI3A 4FX5A 5JRAA 3U2LA 1YA9A 2R03A 1NU9C 1E86A 5HV9A 1EKYA 3DAFA 2G3VA 1LPEA 1OW7A 2I8BA 2A0UA 1T01A 2BC5A 2OEXA 3L8IA 4XWJA 1K05A 5JSLA 4AL0A 1YDIA 5COGA 2R7RA 2WVOA 4EIYA 1QKRA 3B9QA 4P6IC 2Y3GA 4U5FE 4JURI 4JE9A 4IWBA 4IRUA 3EZIA 1HW2A 1YZCA 3DWWA 4DXWA 2YEVA 2FGYA 3VAYA 3AOUA 3PCVA 2A6EF 1MMGA 4ULVA 4MTOA 2L6FA 1TFOB 4OIRF 5E33A 2PP4A 1IZMA 1BR1A 3QTHA 2P0NA 1NFNA 3K66A 2MHRA 3G4ZA 3LNMB 3NDBB 4XEFA 2QY9A 3GEIA 3U8VA 4AK9A 2V26A 3K1IC 2KW3C 2ETSA 3EPVA 4EBJA 3U3BA 2LP4A 1NZEA 2J7PD 3S27A 4BPMA 2P6VA 4HFFB 4E7SA 5L3QA 3CSKA 3C62A 3UMIA 2HKVA 3B0PA 1DOWA 2CNWD 2R7WA 4XPWA 4YN0B 1AEPA 1Q0MA 4W8PA 3C7JA 4ONSA 5GPGB 1Z23A 3TOLA 4C3EA 4IARA 3SXZA 5B3SC 1LE2A 2A6HF 3WODF 2AVKA 2KGOA 2XL4A 1PD0A 2HSBA 2XM4A 4OD4A 1YYJA 2XRHA 3EQLF 3MYIA 2L7AA 2XL8A 3RYLA 1E83A 2XL6A 1GQAA 4IJJA 4Z9IA 1FAPB 4BG0A 3B71A 1VLTA 3LLKA 3W8IA 1RJ9A 4XEKA 2L6HA 3S90A 2J0XA 2VCCA 2R7TA 1D0ZA 2AP3A 3RH3A 1PV3A 3FXHA 4CS9A 1C17M 2H7BA 1NSGB 2YLGA 3LS1A 4J7TA 1OXBA 3C8GD 3IHUA 1NFOA 1KU2A 4IAOA 4OD5A 1I5NA 1TQGA 3FMSA 3I4UA 3AQCA 5KYUA 2R25A 2XLMA 5JLIA 3NMKA 1WWPA 5KYUB 5DVWA 2NUTA 1G5ZA 2NUTB 1B68A 3AJMA 1LS4A 2VB6A 3NKDA 4JTCB 3FDQA 4U9DA 2IBFA 4XQ1A 4P9TA 1CGNA 1O3UA 3EHNA 3R2PA 1V54C 4NCQA 3SXYA 5B3IA 3V5YA 1OKKA 2B0HA 3UMKA 5BUOA 4J30B 5A6BA 4K7BA 1VYKA 1OCZC 5DQTA 3POVA 4U5CE 4YL1A 1WN0A 4Z9HA 5A6KA 1I4ZA 256BA 4XPYA 1HE1A 1CPRA 3NKEA 3JCUQ 4JTAB 4DBRA 5A6JA 4YT5A 1WTYA 4WABA 4JJGA 1MNDA 1MMAA 3JRMO 3IQ5A 1JR8A 3X1OA 3GM3A 3ZQYA 5KYYB 1ST6A 3S28A 3S29A 1HE9A 3SNHA 2EPMX 3SYNA 4EWCA 1V74B 2PNOA 4FAPB 1OQCA 2YRFA 2R7VA 5FCLA 4CSAC 3U3FA 3F46A 4MS2A 1VLSA 1LE4A 2YL3A 3SXMA 3US6A 3ZIBA 2Q7RA 2LFDA 4O6YA 3FOOA 3B0VC 1LKXA 2VCAA 2J9BA 4A2NB 3F47A 2CYDA 4UDVA 1FR0A 2HFIA 1K40A 2VCBA 1Z63A 4FWVA 4LACB 1Q0GA 1SR2A 5JT4A 4KI2A 3EFOB 4U5BE 5A6AA 2HSQA 3TJ6A 3M79A 4EBBA 3X2QC 1NBBA 3EH1A 5CI8A 2WZGA 5L0JA 1M2VB 2JPUA 5JUAA 1Z6AA 2IOQA 1NG1A 3CEXA 3KYJA 5B1BC 3FVYA 5KYWA 1JPNA 3M15A 5KYXB 3LS0A 2J0WA 5KYWB 1JAFA 4IGGA 1W2WA 1UG7A 1FTSA 2R02A 3K33A 4JCZA 2I15A 1KTMA 2A68F 5L0HA 3LJBA 1ZHZA 2YHSA 1FNTc 1T6QA 1U89A 3ZWIA 4QDLA 5L0DA 1U6HA 2ZD9A 2UUIA 4DOZA 1C02A 1SYQA 3PHF2 2Q9CA 5BQGA 2R7QA 4EHPA 2YLDA 4BJ5C 2J9UA 2PX0A 1D1BA 2ZXPA 3FAPB 3L1MA 5DLJA 1GS9A 1GGQA 3KPHA 2EPOA 4E7ZA 1OCCC 3HNKA 5AC4A 2WB7A 2Y3HA 2Q3TA 2ZPAA 4LDQA 3GEHA 3LEOA 3WG7C 4Q4ZF 4O6NA 1Q0KA 2O9XA 1BR2A 2GWWA 2W45A 2HJ3A 1EQ1A 3O39A 1J8MF 1R4TA 3KL4A 5FZTA 1T5OA 2PBEA 2Q00A 4CX9A 4EBKA 1LM3B 1ORJA 2KK1A 4JRZA 2X51A 1Z7Qc 4DRIB 3ZTMA 2Y3DA 1OW6A 1VTMP 2PFDA 3RQFA 1VMAA 3ATPA 1UFBA 1AVOB 1MQVA 2AWYA 2XLWA 1MNEA 2C04A 1PD1A 2LQGA 4MVZA 1T9KA 1WGWA
chains in the Genus database with same CATH topology
3JT1A 1LVKA 2WVNA 2H7VC 3T6JA 3VYWA 3N0TA 2NG1A 4AX2A 2HV7A 5D92A 2CW0F 2EIJC 4BJ6C 3ZVRA 1D1CA 2IXPA 3DZAA 4YJWA 2R7SA 1OKKD 1TR2A 3EZHA 4KNWA 3ASOC 3EHMA 1QZXA 2NUPB 2OG2A 3LLIA 4ULWA 2QTVA 3NG1A 1TWCA 4PFOA 4W8KA 1D1AA 2WVQA 4I1MA 4ZLCA 3EG9A 3EG9B 3ZC4A 3FHDA 4PK4A 3K7DA 3CZ6A 2DYSC 3KMIA 1ZYRF 3FAJA 4JZAA 4O6MA 3NYLA 4I1OB 4O7GA 4KC9A 5IY5C 3OA1A 2A1DD 1M57C 3UR3C 1JPJA 2R7XA 4RDAA 2L9JA 4CIHA 1FMVA 4YT8A 3DMDA 1O87A 3M1CB 2Q9AA 2WZLA 2DGJA 4G0HA 2R7UA 3DJNB 3DAGA 3O6XA 4YT2A 2MWQA 4DVZA 1J8YF 3SZRA 2BE5F 5T3WA 3RIPA 3Q7GA 4PFPA 3ZG1A 3ZSUA 5KYYA 4G7ZF 2KJGA 2HV6A 1OCRC 3SP1A 3KKBA 3LAYA 4QI2A 3DJUB 2WZFA 3I5QA 4XLPF 3ECSA 3W8HA 3MX3A 3PMRA 2J46A 4CSAA 3N24A 3W2VA 2DYRC 4LLCA 4OIPF 3L0IA 2EILC 3EFOA 3K6BA 3S0XA 2M4EA 1SZIA 5T3TA 3Q7LA 5T1DB 1M2VA 5DS4A 4U5GA 2C03A 4PJMA 5KYXA 1QLEC 3UGPA 1SF8A 2LSEA 4AE4B 3AG3C 1M56C 3AG1C 2J9WA 4NY3A 3HLZA 2WL8A 2Y3BA 2FFHA 1FFTC 3JSZA 2W4BA 3LEVA 4JJFA 3UMHA 4DVYP 4F4BA 2VH3A 4OIOF 3TD7A 4JVSA 1OCOC 1ZHTA 3EGDB 4BJ5A 4DBQA 2IXNA 4K0DA 4BJTA 4U5HA 4WJ0A 1D0XA 3ASNC 3N2ZB 2P7VA 2E87A 3E70C 3OWTA 3JRTA 4G7HF 4CS8C 3Q6NA 2CGEA 5D91A 3RFYA 2PX3A 1N1CA 3NRHA 4RD9A 2PF4E 1Z3IX 4G7OF 4CBEA 3QMKA 4HEAJ 4KBLA 4LLEA 1G8XA 2GFHA 1S7ZA 3W2WA 5DS6A 3EJNA 3EGXA 5HSWA 3EGXB 4YT4A 2Q9BA 2Y69C 1MMNA 1VYIA 4GEHA 3KH2A 2EIMC 2ZXWC 2ZXOA 2Z15A 3AQBA 4N06A 3DM9B 4C7OA 5DS5A 4C7OB 3E9VA 4BJ6A 3LNRA 3EH2A 2NUPA 3ABKC 4OIQF 3L34A 3DM5A 1TWHA 2J9VA 1IW7F 3Q6MA 4MNDA 3NYMA 1D0YA 2JD3A 3OEOA 2KNHA 4U5DE 3HJCA 2YZSA 2EINC 4QI0A 4I44A 4Q5SF 4HFKB 5E2QA 3JYHA 4H4KC 3AG2C 5E3CA 4X0RA 2IXOA 2KQ9A 4B6IA 1MMDA 3V7OA 5EHHA 1TWGA 3UNGC 3GODA 4CS9C 1TWAA 3AG4C 2OCCC 2VASA 2J45A 2W4MA 4ANJA 2W9YA 1RJ9B 4C3BA 2V3CC 1VK5A 4JW1A 1V55C 4BJ1A 3T6BA 4HE8D 1SMYF 2J7PA 4JCHA 4PJJA 4PJNA 2CNWA 2ZXRA 3IEEA 1VOMA 5B1AC 4YWQA 2G62A 4ZLDA 3B0UX 3CQZA 2XSEA 3K1HA 3MLGA 5F5HA 2G3KA 3SEOA 3ITFA 1NU7D 1O5HA 1Z5ZA 3UGOA 5EGYA 4LERA 4I3MA 5F5FA 3HTKC 2D5RB 4Q7CA 4J32B 4PJLA 4BEJA 4MQ9F 4AE4A 2EIKC 3QZCA 2XXAA 3ABLC 3I5PA 2XXAB 5E3AA 1FFHA 2H7OA 3T4RA 5KYNA 2Y39A 3LESA 5DQZA 2CDQA 3DXJF 2R7OA 3RKOF 4C3DA 1ZHWA 2MYSA 2IXMA 1M2OA 3NYJA 2B0JA 1ZHXA 3EGDA 4FESA 4XTKA 3DD7A 1PCXA 1LS1A 3H65A 4U5EE 2L81A 4KNVA 2IYLD 4M63A 5CI9A 1TKNA 3GANA 1ZU5A 4O79A 5L3VA 1BR4A 3ABMC 4XLNF 4OINF 4RBNA 1FMWA 1ZHYA 4CS8A 1ZU4A 2A69F 4GYTA 4CS7A 4FX5A 1NU9C 3DAFA 2G3VA 2I8BA 4XWJA 2R7RA 2WVOA 3B9QA 4P6IC 2Y3GA 4U5FE 4JURI 4IWBA 4IRUA 3EZIA 2YEVA 2FGYA 3VAYA 2A6EF 1MMGA 4OIRF 5E33A 2PP4A 1IZMA 1BR1A 3K66A 3NDBB 2QY9A 4AK9A 2V26A 3K1IC 2KW3C 3EPVA 1NZEA 2J7PD 3S27A 4E7SA 2P6VA 4HFFB 5L3QA 3CSKA 3UMIA 2R7WA 3B0PA 2CNWD 4YN0B 1Z23A 4C3EA 5B3SC 2A6HF 3WODF 2KGOA 2XL4A 1PD0A 4OD4A 2XRHA 3EQLF 3RYLA 4IJJA 4BG0A 3LLKA 3W8IA 1RJ9A 2J0XA 2R7TA 1D0ZA 4CS9A 3RH3A 3LS1A 2H7BA 1KU2A 4IAOA 4OD5A 3I4UA 3AQCA 5KYUA 5KYUB 5DVWA 2NUTA 3NKDA 2NUTB 3FDQA 2VB6A 3EHNA 1V54C 1OKKA 3UMKA 5BUOA 4J30B 4K7BA 1VYKA 1OCZC 5DQTA 3POVA 4U5CE 3NKEA 4DBRA 3JCUQ 4YT5A 4JJGA 1MNDA 1MMAA 3X1OA 5KYYB 1ST6A 3S28A 3S29A 3SNHA 3SYNA 4EWCA 2R7VA 5FCLA 4CSAC 3F46A 3ZIBA 4O6YA 3B0VC 1LKXA 4A2NB 3F47A 1Z63A 4FWVA 4LACB 4KI2A 3EFOB 4U5BE 4EBBA 3X2QC 5CI8A 3EH1A 2WZGA 1M2VB 1Z6AA 2IOQA 1NG1A 5B1BC 3FVYA 5KYWA 1JPNA 5KYXB 3LS0A 2J0WA 5KYWB 1W2WA 1FTSA 3K33A 2A68F 3LJBA 1ZHZA 2YHSA 4QDLA 4DOZA 3PHF2 2Q9CA 2R7QA 4BJ5C 2J9UA 2PX0A 1D1BA 2ZXPA 5DLJA 4E7ZA 1OCCC 2WB7A 2Y3HA 2Q3TA 2ZPAA 3WG7C 4Q4ZF 4O6NA 2O9XA 1BR2A 2W45A 3O39A 1J8MF 3KL4A 2X51A 2Y3DA 2PFDA 1VMAA 1MNEA 2C04A 1PD1A 1WGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W4B A;  3POV A;  2W45 A;  5HSW A;  3FHD A; 
#chains in the Genus database with same CATH topology
 3JT1 A;  4CJG A;  3IQ6 A;  1LVK A;  2WVN A;  2H7V C;  3T6J A;  1RMV A;  2M64 A;  3VYW A;  3N0T A;  2NG1 A;  3U5S A;  4AX2 A;  2HV7 A;  3K1I A;  2CW0 F;  5D92 A;  2EIJ C;  2RSE B;  5COF A;  4DRJ B;  4BJ6 C;  3ZVR A;  1Q0D A;  1D1C A;  2IXP A;  3DZA A;  4YJW A;  2R7S A;  4NTF A;  1OKK D;  1TR2 A;  2XS8 A;  3EZH A;  4KNW A;  2ICW G;  5A6B D;  4NTB A;  3U9J A;  3DKA A;  3G50 A;  1OXK A;  3ASO C;  3EHM A;  1QZX A;  2NUP B;  2OG2 A;  3LLI A;  3VF0 A;  2R9R B;  4ULW A;  2QTV A;  3M4C A;  3NG1 A;  1TWC A;  4PFO A;  4W8K A;  1D1A A;  3HKK A;  2YL0 A;  2WVQ A;  5CIV A;  1H7I A;  4I1M A;  4ZLC A;  1RKE A;  3EG9 A;  1RKE B;  3EG9 B;  3V5Z A;  3ZC4 A;  3FHD A;  5A69 A;  1V4A A;  4PK4 A;  3K7D A;  1L3P A;  1YZA A;  4R32 A;  3CZ6 A;  3HNJ A;  2P61 A;  1A7D A;  2DYS C;  3KMI A;  1ZYR F;  3FAJ A;  4JZA A;  2D4U A;  3NYL A;  4O6M A;  4I1O B;  3O10 A;  4O7G A;  4KC9 A;  5IY5 C;  3OA1 A;  2A1D D;  3GWN A;  1HW1 A;  1M57 C;  1H9G A;  3UR3 C;  1JPJ A;  2ASR A;  3RW0 A;  2R7X A;  4RDA A;  2L9J A;  4E17 A;  4CIH A;  1XZP A;  1FMV A;  4MVS A;  4D4N A;  4YT8 A;  3DMD A;  4CDY A;  1O87 A;  3M1C B;  2Q9A A;  2WZL A;  2XS1 A;  2DGJ A;  4G0H A;  1H9T A;  2R7U A;  3DJN B;  1ZZP A;  4IAQ A;  3DAG A;  2A0B A;  3O6X A;  4YT2 A;  2MWQ A;  2VC9 A;  1J8Y F;  4DVZ A;  1C03 A;  2HMZ A;  3SZR A;  2BE5 F;  5JS5 A;  5T3W A;  1LI7 A;  1APC A;  3RIP A;  3Q7G A;  4PFP A;  5BQI A;  1CPQ A;  1LI5 A;  1YA7 O;  3G4X A;  3ZG1 A;  4NC3 A;  3ZSU A;  5KYY A;  3U0C A;  4N4W A;  2KJG A;  1OR2 A;  4G7Z F;  1H6G A;  2HV6 A;  1OCR C;  3SP1 A;  3KKB A;  2HS5 A;  3LAY A;  5JP7 A;  4QI2 A;  3DJU B;  2WZF A;  2UUH A;  2CCY A;  3I5Q A;  1Y6D A;  1WAT A;  4YK5 A;  4XLP F;  1EA8 A;  1Y4C A;  2P1A A;  3ECS A;  3W8H A;  3RQE A;  1ORS C;  3MX3 A;  2HMQ A;  4J7Y A;  3ZDL A;  3PMR A;  2J46 A;  2LIG A;  3N24 A;  4CSA A;  1BBH A;  1E84 A;  3W2V A;  2DYR C;  1CGM E;  4LLC A;  4OIP F;  4EUK B;  3L0I A;  2EIL C;  3EFO A;  3JYY A;  3K6B A;  3S0X A;  2M4E A;  4P9F A;  1SZI A;  5T3T A;  1YJG A;  2YL7 A;  3Q7L A;  5T1D B;  2R05 A;  1M2V A;  3GOR A;  5DS4 A;  4U5G A;  2C03 A;  4CJO A;  3IQC A;  4PJM A;  5KYX A;  1QLE C;  3UGP A;  1SF8 A;  4DRH B;  2LSE A;  3CAX A;  4AE4 B;  5COM A;  2RD9 A;  3TUL A;  3AG3 C;  1M56 C;  2KC3 A;  3AG1 C;  4EKW A;  3U2M A;  4Z9J A;  2J9W A;  2LCH A;  4NY3 A;  3HLZ A;  2WL8 A;  1RCP A;  2Y3B A;  2YKZ A;  2FFH A;  1FFT C;  3JSZ A;  2W4B A;  3LEV A;  4JJF A;  3UMH A;  1XZQ A;  4DVY P;  4F4B A;  2VH3 A;  5L0I A;  4OIO F;  2QNL A;  3TD7 A;  5TJ5 E;  3JSE O;  4JVS A;  4YL0 A;  1OCO C;  5JVE A;  3PDM P;  2TMV P;  2YWA A;  4PR9 A;  1Q0F A;  1ZHT A;  1A0B A;  3EGD B;  4BJ5 A;  4DBQ A;  2IXN A;  3U9M A;  4E0I A;  4K0D A;  4BJT A;  4U5H A;  3M4B A;  3BEH A;  4WJ0 A;  3WAQ A;  1D0X A;  3ASN C;  2GDC A;  1HMO A;  2H8A A;  3N2Z B;  2P7V A;  4MVR A;  2YLI A;  3NMJ A;  2E87 A;  3DE8 A;  3E70 C;  3OWT A;  1A7V A;  3C8Z A;  3JRT A;  4E18 A;  4CS8 C;  2LD6 A;  4G7H F;  3J06 A;  2NSG A;  3Q6N A;  2CGE A;  1E85 A;  1QQ3 A;  2EPL X;  4JEA A;  5D91 A;  5F28 E;  3RFY A;  1M6T A;  1N1C A;  2PX3 A;  1BZ4 A;  3NRH A;  4RD9 A;  4JKV A;  2PF4 E;  1Z3I X;  4LDR A;  3KYI A;  4G7O F;  3DI5 A;  3TJ5 A;  4CBE A;  1YLM A;  3QMK A;  3TK0 A;  4HEA J;  4KBL A;  1CGO A;  2QE9 A;  5EK0 A;  2X0C A;  3MBG A;  4CDV A;  1F1M A;  1YAU O;  4LLE A;  1G8X A;  3QVZ A;  2HJM A;  2GFH A;  1K04 A;  1S7Z A;  1XWJ A;  3W2W A;  5DS6 A;  3EJN A;  3EGX A;  3GM2 A;  5HSW A;  3EGX B;  4YT4 A;  3HNI A;  2HZ8 A;  2Q9B A;  2Y69 C;  3O55 A;  5L0C A;  1MMN A;  1ORY A;  1T6U A;  4MVO A;  4D4X A;  2YVK A;  3B29 A;  1AUE A;  2QLA A;  1VYI A;  1OW8 A;  4GEH A;  3WHN A;  3KH2 A;  5L0F A;  1S05 A;  1JMW A;  2EIM C;  2ZXW C;  2ZXO A;  2Z15 A;  4L6R A;  3AQB A;  1L7C A;  4N06 A;  3DM9 B;  3VRC A;  4C7O A;  3QVY A;  5DS5 A;  4GQH A;  3E9V A;  1E2X A;  3IQT A;  4BJ6 A;  3LNR A;  4MTF A;  4C7O B;  3EH2 A;  2Q4F A;  1G4W R;  2NUP A;  3ABK C;  4JTD B;  5L0G A;  4OIQ F;  3L34 A;  4DJ9 A;  3DM5 A;  3V5X A;  1TWH A;  2J9V A;  1IW7 F;  3Q6M A;  3H2V A;  2OJQ A;  3NMI A;  1D0Y A;  3NYM A;  2JD3 A;  4MND A;  1VB5 A;  3OEO A;  2GA0 A;  2KNH A;  4U5D E;  1JOG A;  3FOP A;  3HJC A;  4NQF A;  1YYX A;  3QW1 A;  2YZS A;  1WAS A;  2EIN C;  4G78 A;  4N6H A;  4QI0 A;  3L8J A;  4H54 A;  3A11 A;  4E0H A;  1LIH A;  4WGY A;  4I44 A;  2OQM A;  4HFK B;  4Q5S F;  5E2Q A;  3JYH A;  4H4K C;  3ZTZ A;  3AG2 C;  1U0B B;  3H2U A;  5E3C A;  2HUJ A;  1R5I D;  1WOL A;  4X0R A;  1BDJ B;  2IXO A;  2KQ9 A;  4B6I A;  1MMD A;  3V7O A;  4NTA A;  5AC5 A;  1YAR O;  3T9O A;  5EHH A;  2NSF A;  3LUT B;  4YL3 A;  1TWG A;  3UNG C;  2KYH A;  3GOD A;  1JRA A;  4N6C A;  3RVZ A;  4CS9 C;  3MFN A;  3TOM A;  2KSF A;  1TWA A;  1KNY A;  3AG4 C;  4JEB A;  1I4Y A;  2OCC C;  2J45 A;  2VAS A;  3AGU A;  3TQO A;  2W4M A;  4XPX A;  2W9Y A;  4ANJ A;  1RJ9 B;  2J8W A;  4MVU A;  2AWC A;  2OEV A;  3AGT A;  1TFK B;  2LK4 A;  5AGF A;  4C3B A;  2V3C C;  3JTL O;  1VK5 A;  4JW1 A;  1YVI A;  4JC7 A;  1V55 C;  3U8P A;  4BJ1 A;  3T6B A;  1QSP A;  4HE8 D;  1SMY F;  2J7P A;  4PAC A;  4JCH A;  4PJJ A;  4JIO A;  4PJN A;  2CNW A;  4U9E A;  2ZXR A;  3IPM O;  3IEE A;  1VOM A;  1RKC A;  5B1A C;  2G62 A;  4AL1 A;  4YWQ A;  4ZLD A;  3B0U X;  1ZW3 A;  3CQZ A;  4MW8 A;  5K0I A;  2XSE A;  3K1H A;  3MLG A;  5F5H A;  2JX0 A;  4K1O A;  2G3K A;  2YQY A;  4LDK A;  4A4A A;  3RVY A;  2XLD A;  3SEO A;  3ITF A;  2BL2 A;  3BRJ A;  4MVM A;  2QUP A;  3RQG A;  3W4Y A;  1NU7 D;  1O5H A;  1ZVZ A;  1T6I A;  2GAQ A;  1Z5Z A;  3UGO A;  3QW0 A;  5EGY A;  4LER A;  4MVQ A;  2DB4 A;  3S84 A;  3GEE A;  4I3M A;  1QVX A;  1OR3 A;  3HTK C;  5F5F A;  3VM6 A;  2XLH A;  2XLV A;  2D5R B;  4Q7C A;  4J32 B;  4PJL A;  3C8G A;  3C8G B;  3S9O A;  4BEJ A;  4MW3 A;  2EPN A;  1HMD A;  3A9C A;  4MQ9 F;  4XEV A;  2EIK C;  3RF3 A;  1QPU A;  1ZW2 A;  3T6G B;  1DOV A;  4AE4 A;  3QZC A;  4CDA A;  2XXA A;  3ABL C;  2FAP B;  3I5P A;  2XM0 A;  5E3A A;  1FFH A;  2H7O A;  2XXA B;  1A7E A;  3T4R A;  5KYN A;  3SXK A;  2Y39 A;  3LES A;  2OJE D;  4BEM J;  5DQZ A;  2CDQ A;  1A41 A;  4ER9 A;  2L6G A;  2AU5 A;  3HNL A;  3DXJ F;  4CIP A;  2R7O A;  3RKO F;  2XLE A;  1RXQ A;  4C3D A;  2XLO A;  1ZHW A;  2MYS A;  2IXM A;  1M2O A;  2F22 A;  3DE9 A;  2B0J A;  3NYJ A;  1ZHX A;  3EGD A;  4FES A;  1G4U S;  4XTK A;  3DD7 A;  2NPU A;  1PCX A;  1LS1 A;  4WGZ A;  2OU6 A;  3H65 A;  1HY5 A;  3R7C A;  4U5E E;  3ZQV A;  2L81 A;  4KNV A;  2IYL D;  3C63 A;  4M63 A;  1NLX A;  1TKN A;  3GAN A;  1ZU5 A;  4O79 A;  5CI9 A;  1EI7 A;  1GM5 A;  5L3V A;  1BR4 A;  2EPK X;  2OOC A;  3ABM C;  3GWL A;  3JZ0 A;  2LFF A;  4IB4 A;  3GM1 A;  3MYF A;  4OIN F;  4XLN F;  2YL1 A;  5BQH A;  2IM8 A;  4RBN A;  1FMW A;  1ZHY A;  4CS8 A;  1ZU4 A;  2A69 F;  2OKU A;  4GYT A;  3C18 A;  4CS7 A;  4MTG A;  2DI3 A;  4FX5 A;  5JRA A;  3U2L A;  1YA9 A;  2R03 A;  1NU9 C;  1E86 A;  5HV9 A;  1EKY A;  3DAF A;  2G3V A;  1LPE A;  1OW7 A;  2I8B A;  2A0U A;  1T01 A;  2BC5 A;  2OEX A;  3L8I A;  4XWJ A;  1K05 A;  5JSL A;  4AL0 A;  1YDI A;  5COG A;  2R7R A;  2WVO A;  4EIY A;  1QKR A;  3B9Q A;  4P6I C;  2Y3G A;  4U5F E;  4JUR I;  4JE9 A;  4IWB A;  4IRU A;  3EZI A;  1HW2 A;  1YZC A;  3DWW A;  4DXW A;  2YEV A;  2FGY A;  3VAY A;  3AOU A;  3PCV A;  2A6E F;  1MMG A;  4ULV A;  4MTO A;  2L6F A;  1TFO B;  4OIR F;  5E33 A;  2PP4 A;  1IZM A;  1BR1 A;  3QTH A;  2P0N A;  1NFN A;  3K66 A;  2MHR A;  3G4Z A;  3LNM B;  3NDB B;  4XEF A;  2QY9 A;  3GEI A;  3U8V A;  4AK9 A;  2V26 A;  3K1I C;  2KW3 C;  2ETS A;  3EPV A;  4EBJ A;  3U3B A;  2LP4 A;  1NZE A;  2J7P D;  3S27 A;  4BPM A;  2P6V A;  4HFF B;  4E7S A;  5L3Q A;  3CSK A;  3C62 A;  3UMI A;  2HKV A;  3B0P A;  1DOW A;  2CNW D;  2R7W A;  4XPW A;  4YN0 B;  1AEP A;  1Q0M A;  4W8P A;  3C7J A;  4ONS A;  5GPG B;  1Z23 A;  3TOL A;  4C3E A;  4IAR A;  3SXZ A;  5B3S C;  1LE2 A;  2A6H F;  3WOD F;  2AVK A;  2KGO A;  2XL4 A;  1PD0 A;  2HSB A;  2XM4 A;  4OD4 A;  1YYJ A;  2XRH A;  3EQL F;  3MYI A;  2L7A A;  2XL8 A;  3RYL A;  1E83 A;  2XL6 A;  1GQA A;  4IJJ A;  4Z9I A;  1FAP B;  4BG0 A;  3B71 A;  1VLT A;  3LLK A;  3W8I A;  1RJ9 A;  4XEK A;  2L6H A;  3S90 A;  2J0X A;  2VCC A;  2R7T A;  1D0Z A;  2AP3 A;  3RH3 A;  1PV3 A;  3FXH A;  4CS9 A;  1C17 M;  2H7B A;  1NSG B;  2YLG A;  3LS1 A;  4J7T A;  1OXB A;  3C8G D;  3IHU A;  1NFO A;  1KU2 A;  4IAO A;  4OD5 A;  1I5N A;  1TQG A;  3FMS A;  3I4U A;  3AQC A;  5KYU A;  2R25 A;  2XLM A;  5JLI A;  3NMK A;  1WWP A;  5KYU B;  5DVW A;  2NUT A;  1G5Z A;  2NUT B;  1B68 A;  3AJM A;  1LS4 A;  2VB6 A;  3NKD A;  4JTC B;  3FDQ A;  4U9D A;  2IBF A;  4XQ1 A;  4P9T A;  1CGN A;  1O3U A;  3EHN A;  3R2P A;  1V54 C;  4NCQ A;  3SXY A;  5B3I A;  3V5Y A;  1OKK A;  2B0H A;  3UMK A;  5BUO A;  4J30 B;  5A6B A;  4K7B A;  1VYK A;  1OCZ C;  5DQT A;  3POV A;  4U5C E;  4YL1 A;  1WN0 A;  4Z9H A;  5A6K A;  1I4Z A;  256B A;  4XPY A;  1HE1 A;  1CPR A;  3NKE A;  3JCU Q;  4JTA B;  4DBR A;  5A6J A;  4YT5 A;  1WTY A;  4WAB A;  4JJG A;  1MND A;  1MMA A;  3JRM O;  3IQ5 A;  1JR8 A;  3X1O A;  3GM3 A;  3ZQY A;  5KYY B;  1ST6 A;  3S28 A;  3S29 A;  1HE9 A;  3SNH A;  2EPM X;  3SYN A;  4EWC A;  1V74 B;  2PNO A;  4FAP B;  1OQC A;  2YRF A;  2R7V A;  5FCL A;  4CSA C;  3U3F A;  3F46 A;  4MS2 A;  1VLS A;  1LE4 A;  2YL3 A;  3SXM A;  3US6 A;  3ZIB A;  2Q7R A;  2LFD A;  4O6Y A;  3FOO A;  3B0V C;  1LKX A;  2VCA A;  2J9B A;  4A2N B;  3F47 A;  2CYD A;  4UDV A;  1FR0 A;  2HFI A;  1K40 A;  2VCB A;  1Z63 A;  4FWV A;  4LAC B;  1Q0G A;  1SR2 A;  5JT4 A;  4KI2 A;  3EFO B;  4U5B E;  5A6A A;  2HSQ A;  3TJ6 A;  3M79 A;  4EBB A;  3X2Q C;  1NBB A;  3EH1 A;  5CI8 A;  2WZG A;  5L0J A;  1M2V B;  2JPU A;  5JUA A;  1Z6A A;  2IOQ A;  1NG1 A;  3CEX A;  3KYJ A;  5B1B C;  3FVY A;  5KYW A;  1JPN A;  3M15 A;  5KYX B;  3LS0 A;  2J0W A;  5KYW B;  1JAF A;  4IGG A;  1W2W A;  1UG7 A;  1FTS A;  2R02 A;  3K33 A;  4JCZ A;  2I15 A;  1KTM A;  2A68 F;  5L0H A;  3LJB A;  1ZHZ A;  2YHS A;  1FNT c;  1T6Q A;  1U89 A;  3ZWI A;  4QDL A;  5L0D A;  1U6H A;  2ZD9 A;  2UUI A;  4DOZ A;  1C02 A;  1SYQ A;  3PHF 2;  2Q9C A;  5BQG A;  2R7Q A;  4EHP A;  2YLD A;  4BJ5 C;  2J9U A;  2PX0 A;  1D1B A;  2ZXP A;  3FAP B;  3L1M A;  5DLJ A;  1GS9 A;  1GGQ A;  3KPH A;  2EPO A;  4E7Z A;  1OCC C;  3HNK A;  5AC4 A;  2WB7 A;  2Y3H A;  2Q3T A;  2ZPA A;  4LDQ A;  3GEH A;  3LEO A;  3WG7 C;  4Q4Z F;  4O6N A;  1Q0K A;  2O9X A;  1BR2 A;  2GWW A;  2W45 A;  2HJ3 A;  1EQ1 A;  3O39 A;  1J8M F;  1R4T A;  3KL4 A;  5FZT A;  1T5O A;  2PBE A;  2Q00 A;  4CX9 A;  4EBK A;  1LM3 B;  1ORJ A;  2KK1 A;  4JRZ A;  2X51 A;  1Z7Q c;  4DRI B;  3ZTM A;  2Y3D A;  1OW6 A;  1VTM P;  2PFD A;  3RQF A;  1VMA A;  3ATP A;  1UFB A;  1AVO B;  1MQV A;  2AWY A;  2XLW A;  1MNE A;  2C04 A;  1PD1 A;  2LQG A;  4MVZ A;  1T9K A;  1WGW A; 
#chains in the Genus database with same CATH homology
 3JT1 A;  1LVK A;  2WVN A;  2H7V C;  3T6J A;  3VYW A;  3N0T A;  2NG1 A;  4AX2 A;  2HV7 A;  5D92 A;  2CW0 F;  2EIJ C;  4BJ6 C;  3ZVR A;  1D1C A;  2IXP A;  3DZA A;  4YJW A;  2R7S A;  1OKK D;  1TR2 A;  3EZH A;  4KNW A;  3ASO C;  3EHM A;  1QZX A;  2NUP B;  2OG2 A;  3LLI A;  4ULW A;  2QTV A;  3NG1 A;  1TWC A;  4PFO A;  4W8K A;  1D1A A;  2WVQ A;  4I1M A;  4ZLC A;  3EG9 A;  3EG9 B;  3ZC4 A;  3FHD A;  4PK4 A;  3K7D A;  3CZ6 A;  2DYS C;  3KMI A;  1ZYR F;  3FAJ A;  4JZA A;  4O6M A;  3NYL A;  4I1O B;  4O7G A;  4KC9 A;  5IY5 C;  3OA1 A;  2A1D D;  1M57 C;  3UR3 C;  1JPJ A;  2R7X A;  4RDA A;  2L9J A;  4CIH A;  1FMV A;  4YT8 A;  3DMD A;  1O87 A;  3M1C B;  2Q9A A;  2WZL A;  2DGJ A;  4G0H A;  2R7U A;  3DJN B;  3DAG A;  3O6X A;  4YT2 A;  2MWQ A;  4DVZ A;  1J8Y F;  3SZR A;  2BE5 F;  5T3W A;  3RIP A;  3Q7G A;  4PFP A;  3ZG1 A;  3ZSU A;  5KYY A;  4G7Z F;  2KJG A;  2HV6 A;  1OCR C;  3SP1 A;  3KKB A;  3LAY A;  4QI2 A;  3DJU B;  2WZF A;  3I5Q A;  4XLP F;  3ECS A;  3W8H A;  3MX3 A;  3PMR A;  2J46 A;  4CSA A;  3N24 A;  3W2V A;  2DYR C;  4LLC A;  4OIP F;  3L0I A;  2EIL C;  3EFO A;  3K6B A;  3S0X A;  2M4E A;  1SZI A;  5T3T A;  3Q7L A;  5T1D B;  1M2V A;  5DS4 A;  4U5G A;  2C03 A;  4PJM A;  5KYX A;  1QLE C;  3UGP A;  1SF8 A;  2LSE A;  4AE4 B;  3AG3 C;  1M56 C;  3AG1 C;  2J9W A;  4NY3 A;  3HLZ A;  2WL8 A;  2Y3B A;  2FFH A;  1FFT C;  3JSZ A;  2W4B A;  3LEV A;  4JJF A;  3UMH A;  4DVY P;  4F4B A;  2VH3 A;  4OIO F;  3TD7 A;  4JVS A;  1OCO C;  1ZHT A;  3EGD B;  4BJ5 A;  4DBQ A;  2IXN A;  4K0D A;  4BJT A;  4U5H A;  4WJ0 A;  1D0X A;  3ASN C;  3N2Z B;  2P7V A;  2E87 A;  3E70 C;  3OWT A;  3JRT A;  4G7H F;  4CS8 C;  3Q6N A;  2CGE A;  5D91 A;  3RFY A;  2PX3 A;  1N1C A;  3NRH A;  4RD9 A;  2PF4 E;  1Z3I X;  4G7O F;  4CBE A;  3QMK A;  4HEA J;  4KBL A;  4LLE A;  1G8X A;  2GFH A;  1S7Z A;  3W2W A;  5DS6 A;  3EJN A;  3EGX A;  5HSW A;  3EGX B;  4YT4 A;  2Q9B A;  2Y69 C;  1MMN A;  1VYI A;  4GEH A;  3KH2 A;  2EIM C;  2ZXW C;  2ZXO A;  2Z15 A;  3AQB A;  4N06 A;  3DM9 B;  4C7O A;  5DS5 A;  4C7O B;  3E9V A;  4BJ6 A;  3LNR A;  3EH2 A;  2NUP A;  3ABK C;  4OIQ F;  3L34 A;  3DM5 A;  1TWH A;  2J9V A;  1IW7 F;  3Q6M A;  4MND A;  3NYM A;  1D0Y A;  2JD3 A;  3OEO A;  2KNH A;  4U5D E;  3HJC A;  2YZS A;  2EIN C;  4QI0 A;  4I44 A;  4Q5S F;  4HFK B;  5E2Q A;  3JYH A;  4H4K C;  3AG2 C;  5E3C A;  4X0R A;  2IXO A;  2KQ9 A;  4B6I A;  1MMD A;  3V7O A;  5EHH A;  1TWG A;  3UNG C;  3GOD A;  4CS9 C;  1TWA A;  3AG4 C;  2OCC C;  2VAS A;  2J45 A;  2W4M A;  4ANJ A;  2W9Y A;  1RJ9 B;  4C3B A;  2V3C C;  1VK5 A;  4JW1 A;  1V55 C;  4BJ1 A;  3T6B A;  4HE8 D;  1SMY F;  2J7P A;  4JCH A;  4PJJ A;  4PJN A;  2CNW A;  2ZXR A;  3IEE A;  1VOM A;  5B1A C;  4YWQ A;  2G62 A;  4ZLD A;  3B0U X;  3CQZ A;  2XSE A;  3K1H A;  3MLG A;  5F5H A;  2G3K A;  3SEO A;  3ITF A;  1NU7 D;  1O5H A;  1Z5Z A;  3UGO A;  5EGY A;  4LER A;  4I3M A;  5F5F A;  3HTK C;  2D5R B;  4Q7C A;  4J32 B;  4PJL A;  4BEJ A;  4MQ9 F;  4AE4 A;  2EIK C;  3QZC A;  2XXA A;  3ABL C;  3I5P A;  2XXA B;  5E3A A;  1FFH A;  2H7O A;  3T4R A;  5KYN A;  2Y39 A;  3LES A;  5DQZ A;  2CDQ A;  3DXJ F;  2R7O A;  3RKO F;  4C3D A;  1ZHW A;  2MYS A;  2IXM A;  1M2O A;  3NYJ A;  2B0J A;  1ZHX A;  3EGD A;  4FES A;  4XTK A;  3DD7 A;  1PCX A;  1LS1 A;  3H65 A;  4U5E E;  2L81 A;  4KNV A;  2IYL D;  4M63 A;  5CI9 A;  1TKN A;  3GAN A;  1ZU5 A;  4O79 A;  5L3V A;  1BR4 A;  3ABM C;  4XLN F;  4OIN F;  4RBN A;  1FMW A;  1ZHY A;  4CS8 A;  1ZU4 A;  2A69 F;  4GYT A;  4CS7 A;  4FX5 A;  1NU9 C;  3DAF A;  2G3V A;  2I8B A;  4XWJ A;  2R7R A;  2WVO A;  3B9Q A;  4P6I C;  2Y3G A;  4U5F E;  4JUR I;  4IWB A;  4IRU A;  3EZI A;  2YEV A;  2FGY A;  3VAY A;  2A6E F;  1MMG A;  4OIR F;  5E33 A;  2PP4 A;  1IZM A;  1BR1 A;  3K66 A;  3NDB B;  2QY9 A;  4AK9 A;  2V26 A;  3K1I C;  2KW3 C;  3EPV A;  1NZE A;  2J7P D;  3S27 A;  4E7S A;  2P6V A;  4HFF B;  5L3Q A;  3CSK A;  3UMI A;  2R7W A;  3B0P A;  2CNW D;  4YN0 B;  1Z23 A;  4C3E A;  5B3S C;  2A6H F;  3WOD F;  2KGO A;  2XL4 A;  1PD0 A;  4OD4 A;  2XRH A;  3EQL F;  3RYL A;  4IJJ A;  4BG0 A;  3LLK A;  3W8I A;  1RJ9 A;  2J0X A;  2R7T A;  1D0Z A;  4CS9 A;  3RH3 A;  3LS1 A;  2H7B A;  1KU2 A;  4IAO A;  4OD5 A;  3I4U A;  3AQC A;  5KYU A;  5KYU B;  5DVW A;  2NUT A;  3NKD A;  2NUT B;  3FDQ A;  2VB6 A;  3EHN A;  1V54 C;  1OKK A;  3UMK A;  5BUO A;  4J30 B;  4K7B A;  1VYK A;  1OCZ C;  5DQT A;  3POV A;  4U5C E;  3NKE A;  4DBR A;  3JCU Q;  4YT5 A;  4JJG A;  1MND A;  1MMA A;  3X1O A;  5KYY B;  1ST6 A;  3S28 A;  3S29 A;  3SNH A;  3SYN A;  4EWC A;  2R7V A;  5FCL A;  4CSA C;  3F46 A;  3ZIB A;  4O6Y A;  3B0V C;  1LKX A;  4A2N B;  3F47 A;  1Z63 A;  4FWV A;  4LAC B;  4KI2 A;  3EFO B;  4U5B E;  4EBB A;  3X2Q C;  5CI8 A;  3EH1 A;  2WZG A;  1M2V B;  1Z6A A;  2IOQ A;  1NG1 A;  5B1B C;  3FVY A;  5KYW A;  1JPN A;  5KYX B;  3LS0 A;  2J0W A;  5KYW B;  1W2W A;  1FTS A;  3K33 A;  2A68 F;  3LJB A;  1ZHZ A;  2YHS A;  4QDL A;  4DOZ A;  3PHF 2;  2Q9C A;  2R7Q A;  4BJ5 C;  2J9U A;  2PX0 A;  1D1B A;  2ZXP A;  5DLJ A;  4E7Z A;  1OCC C;  2WB7 A;  2Y3H A;  2Q3T A;  2ZPA A;  3WG7 C;  4Q4Z F;  4O6N A;  2O9X A;  1BR2 A;  2W45 A;  3O39 A;  1J8M F;  3KL4 A;  2X51 A;  2Y3D A;  2PFD A;  1VMA A;  1MNE A;  2C04 A;  1PD1 A;  1WGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...