5T1DB

Crystal structure of ebv ghgl/gp42/e1d1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
99
Chain Sequence
b'PCCHVTQLALENISDIYLVSNQTCDGFSLASLNSPNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title Structural basis for Epstein-Barr virus host cell tropism mediated by gp42 and gHgL entry glycoproteins.
pubmed doi rcsb
source organism Epstein-barr virus (strain b95-8)
molecule tags Viral protein
total genus 14
structure length 99
sequence length 109
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11108 Phage_glycop_gL Viral glycoprotein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1580 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5t1dB00
5T1DB 3PHF2
chains in the Genus database with same CATH superfamily
3TOMA 3MYFA 3EZHA 4KNVA 1SR2A 2YLDA 3U9MA 3ZTMA 3U5SA 1QZXA 3EFOA 2Y39A 3LESA 5E33A 4CDAA 1OW6A 5A6KA 4JEAA 4JW1A 5T3TA 3RF3A 3AGTA 1O87A 3GODA 2L81A 2XSEA 4C3BA 1OCRC 1WATA 2XRHA 3K7DA 4GEHA 4P9FA 3RKOF 4BEMJ 2EILC 1AUEA 4XQ1A 4KC9A 2WL8A 2Z15A 5BQHA 5CIVA 3K1HA 3Q6NA 4PFOA 3PCVA 2YWAA 4JEBA 2KSFA 5A6AA 4JJGA 2J46A 1TKNA 3KMIA 2ZD9A 2M4EA 1FMWA 3IQ5A 1RKEB 2GWWA 2PFDA 3GWNA 1E84A 4DRHB 2V3CC 2AWYA 2J0WA 3K1IC 3NMIA 3U2MA 3HLZA 5DLJA 1H6GA 4G78A 1XZPA 4DBQA 1LS4A 2DYSC 2YVKA 4U9DA 2XS1A 2RSEB 2IXPA 5D92A 4IJJA 4WABA 4ER9A 3AJMA 2PNOA 3V5XA 1FR0A 4DRJB 2OCCC 4Z9JA 3ZSUA 1Q0FA 2XM0A 2ASRA 3GORA 3H2UA 1XWJA 3QVZA 4ULVA 3C62A 3ASOC 4DVZA 1WASA 1B68A 1QQ3A 2F22A 4PACA 4BJ6A 5EK0A 2HJ3A 2LFFA 3EHNA 1O3UA 4NC3A 1WGWA 3EH2A 3FHDA 1MNDA 2UUHA 3N0TA 2JX0A 3W2VA 3JRTA 1R5ID 1U6HA 2XLOA 3EJNA 1IZMA 4CDYA 4JCHA 3RVZA 3N2ZB 4CS7A 5DS4A 3WHNA 1OKKD 3S29A 3SXYA 2AVKA 2CDQA 2LIGA 5L3VA 3VYWA 3KYIA 5JP7A 3ZDLA 2VCAA 5DQZA 2A1DD 2A0UA 3ABKC 4BJ5A 5F5HA 1R4TA 3Q6MA 4JRZA 4DBRA 2BE5F 3AQBA 1V74B 2HJMA 3C7JA 1CGNA 4NQFA 3H2VA 3U8VA 4OD4A 1NU7D 1VLTA 1VLSA 1ZW2A 3FDQA 2J9VA 1RJ9B 3PDMP 4AE4A 2YZSA 4JJFA 4MVUA 2A6HF 5AC5A 1O5HA 2B0HA 4JVSA 3EZIA 4L6RA 3SNHA 1TFKB 4EHPA 2XLHA 2A0BA 2XS8A 4PJMA 4PFPA 2L7AA 3T6JA 3CSKA 4UDVA 1K05A 1T01A 3NYJA 4KNWA 4A4AA 5KYYA 2R7WA 2Y3HA 2NUTA 3PMRA 3RW0A 1HE9A 5JRAA 2HUJA 4CX9A 1TWCA 2HZ8A 3DAFA 2MHRA 2FGYA 4HE8D 4MVRA 4O6MA 4Q5SF 2OG2A 3MBGA 4OIQF 3NYMA 4JKVA 1PD0A 4A2NB 1ZU4A 4MTOA 4QI0A 3FOPA 2HFIA 4W8KA 4YT4A 3K6BA 5B3SC 4YL1A 4Q7CA 4Q4ZF 2YL7A 3ZVRA 4MS2A 1Z7Qc 3PHF2 2FFHA 2UUIA 1V55C 4QDLA 1LVKA 2GDCA 4IAQA 2ETSA 3DE8A 4H4KC 2IXNA 2NG1A 3KL4A 3ZG1A 4U9EA 1ZHTA 5COMA 3UMIA 2R7TA 3LLIA 1PCXA 1NG1A 3C63A 3FXHA 3DAGA 3HKKA 1S7ZA 4NCQA 5DS6A 3GEIA 3S27A 4YL3A 5EHHA 4JTCB 3EG9B 3EH1A 4XTKA 3VAYA 4CS8C 3U3FA 4YN0B 5F28E 4IRUA 3NG1A 3TQOA 3ZWIA 4CBEA 2KC3A 3MX3A 1J8YF 2WB7A 2A69F 2HKVA 4R32A 3E70C 4O7GA 2ZXWC 1E2XA 1T9KA 1MMAA 3CEXA 4G0HA 1RXQA 1A7DA 1DOVA 2YHSA 3LJBA 4U5CE 4WJ0A 2G3VA 3GEEA 3JRMO 3C8ZA 4YL0A 5JSLA 1G4WR 1YARO 3LNRA 2H7VC 1TWAA 4JC7A 3HNIA 4E7ZA 4CIHA 5L0HA 1G4US 2XL6A 2WZLA 1OR2A 3AOUA 1D0XA 2VH3A 2WVQA 2MYSA 4BG0A 4MVQA 2WVOA 1YZCA 3UGOA 2LSEA 3AG1C 5D91A 3ITFA 1Z63A 1WWPA 1LE2A 2G62A 2YEVA 2XL4A 1ZVZA 4YK5A 1A41A 4H54A 2EPMX 3DM5A 2LK4A 3EGDA 2HV6A 3FAPB 4CIPA 2Q9AA 2HSBA 1GQAA 4BPMA 2XLMA 1KTMA 2L6HA 1OCCC 4LDRA 3RIPA 3DM9B 4MVSA 1RMVA 1AVOB 2IBFA 3TOLA 3AQCA 4W8PA 2XXAB 1AEPA 1XZQA 5A6BD 2R25A 5CI9A 5L0JA 2OJQA 2GAQA 1OCOC 4RBNA 2V26A 3JSEO 2J7PA 3IQCA 2O9XA 3UNGC 2D5RB 2KYHA 2DB4A 2Q9CA 2X51A 3CAXA 1I5NA 2FAPB 3HNLA 2LQGA 1ZHXA 3C18A 5JS5A 2NUTB 3C8GA 4YT2A 1ZYRF 4YT8A 2H8AA 1G8XA 3V5ZA 1CPQA 1W2WA 3MFNA 1KU2A 4O6NA 3QZCA 1Q0KA 5A6JA 3U3BA 1LPEA 2CNWA 3R2PA 5HV9A 4CSAA 3B71A 2Y3DA 1FNTc 4YJWA 1A7VA 3S9OA 1D1CA 3WODF 5DQTA 2L6GA 1NBBA 4LACB 4XEKA 4ZLDA 3RQGA 1OXBA 3DI5A 4MW8A 2R7RA 256BA 3WAQA 2VC9A 1SZIA 1M2VB 3F47A 2R7XA 3LS0A 3FAJA 4NTAA 3DKAA 4XPYA 2OEXA 5DVWA 4EBKA 2OQMA 4PK4A 4XEFA 2R7SA 1CPRA 1YJGA 2D4UA 1BR2A 5B1AC 3R7CA 3DD7A 5L0GA 3JYYA 1VMAA 1JRAA 2QUPA 5E2QA 3VM6A 3N24A 2I15A 2HV7A 4P9TA 2OU6A 3HNKA 3MYIA 1H9GA 5FZTA 4U5BE 5B3IA 4G7OF 3T6BA 5F5FA 1JR8A 1I4ZA 1LIHA 1ZHWA 1L3PA 2KQ9A 3IQTA 3OA1A 3US6A 3WG7C 2NUPB 1ZW3A 4U5FE 2Q3TA 3RVYA 4RDAA 4MVOA 5E3CA 2Y3GA 1NLXA 3IEEA 4C7OA 1N1CA 2QNLA 3ZC4A 3QVYA 4OIPF 2EINC 3IPMO 4K7BA 1BDJB 4XEVA 1APCA 2R7QA 3LUTB 4JCZA 3EGXA 4JURI 2GA0A 2QLAA 2VASA 4B6IA 2YL3A 3OWTA 4JTDB 2PX3A 2P6VA 2R03A 1LS1A 1JMWA 1H7IA 2XLVA 5DS5A 3LEOA 3LLKA 1A7EA 3NKDA 3K66A 1C03A 1Q0GA 4I1OB 3SXZA 3L0IA 2CYDA 3S0XA 1VOMA 5L0CA 4RD9A 2YQYA 3KPHA 3JCUQ 3AG2C 3GEHA 3IQ6A 3EGDB 5BQIA 4EKWA 1GM5A 1GGQA 1S05A 4HFKB 3EFOB 4N6CA 4QI2A 4BJ6C 4I3MA 1H9TA 1EQ1A 1Z5ZA 1ZU5A 1FFHA 4XWJA 1BBHA 1T6QA 2ZXRA 3T6GB 3NKEA 4FESA 3JTLO 2W9YA 3LS1A 4IB4A 4XPXA 1Y6DA 3M15A 3B0UX 4E0HA 1M6TA 4Z9IA 2EPLX 1YLMA 2HS5A 4YWQA 5FCLA 3NDBB 1OW7A 3DXJF 2YLIA 4BJ5C 2E87A 4P6IC 4DJ9A 1JPJA 1RKEA 4O6YA 2DI3A 4OD5A 4C3DA 4K0DA 1LI5A 4PR9A 3FOOA 3KYJA 4U5EE 2R7OA 1LE4A 1YDIA 1FMVA 2EPKX 2W45A 4E0IA 2HSQA 4AL0A 2J9BA 1V54C 3S90A 2PP4A 1JPNA 2Y3BA 3AG4C 1Y4CA 1OXKA 3O39A 4U5GA 2EIKC 3V5YA 1U89A 3L8JA 4EBBA 5L0FA 4ZLCA 3U2LA 4PJNA 1UFBA 2TMVP 2YL0A 5IY5C 2RD9A 1Q0MA 2KJGA 3JSZA 3VF0A 3X2QC 4E17A 4EIYA 3A11A 4X0RA 4LDQA 1D1AA 2MWQA 1TQGA 2A68F 2PX0A 4XLPF 1EA8A 2LFDA 3W4YA 4J7TA 2C04A 1CGOA 4I44A 4XLNF 3V7OA 3FMSA 2EPOA 1K40A 3B0PA 5JUAA 4K1OA 5E3AA 3SEOA 1IW7F 1D0ZA 2EPNA 2ZPAA 4LLEA 3UR3C 3O55A 3T4RA 4CS9C 1QLEC 5L0DA 3B0VC 3M4CA 1ZHYA 5A69A 1TR2A 4GYTA 1MQVA 1F1MA 3QW1A 3U9JA 1PD1A 4BJ1A 3BEHA 1VB5A 5K0IA 4OIRF 2P1AA 2CW0F 4ONSA 1QKRA 4C7OB 3K1IA 1QSPA 1SYQA 3ECSA 3O6XA 3B9QA 2WVNA 3EPVA 4XPWA 1YYXA 4IWBA 5JT4A 4AE4B 2CCYA 1YA9A 2OEVA 2R7VA 2J8WA 5CI8A 1U0BB 2P0NA 4LDKA 1VK5A 3RFYA 3T9OA 1HW1A 2KNHA 1NFOA 3GM3A 5KYXA 4J32B 2W4BA 1EI7A 4IGGA 4WGZA 1J8MF 3L8IA 3L34A 5KYUA 5KYYB 2OOCA 4Z9HA 2L9JA 1TWHA 3NRHA 1MNEA 2YLGA 3QMKA 1NZEA 2W4MA 3QTHA 1SMYF 3S28A 2J9UA 3H65A 2BC5A 1ZZPA 3UMHA 2R02A 4DRIB 1OCZC 4DOZA 4N6HA 4NTBA 2HMZA 5COFA 2I8BA 2EIMC 3Q7LA 2BL2A 3M79A 3ATPA 3POVA 3VRCA 2YL1A 2J7PD 3K33A 1RKCA 3MLGA 2XLEA 4FX5A 4EWCA 5KYWA 4ULWA 4EUKB 3TJ5A 3C8GD 2EIJC 1ST6A 3IHUA 4J30B 3W8HA 1T6IA 3HJCA 4I1MA 1Z23A 2Q7RA 1HW2A 2CNWD 4CJOA 3RH3A 3JYHA 1E83A 2AU5A 1ORJA 3EG9A 5BQGA 2IXMA 4AX2A 2YKZA 2ZXOA 2OJED 3HNJA 3RQFA 3NMJA 3SYNA 1RCPA 4KBLA 4LERA 2YRFA 4FAPB 2KW3C 4NTFA 3JZ0A 3ZTZA 3TD7A 1OKKA 1ORYA 3GWLA 4J7YA 4C3EA 3ABLC 1TFOB 2R9RB 3M1CB 3NMKA 2J45A 3J06A 1L7CA 3FVYA 3M4BA 1D0YA 1FAPB 2L6FA 3G4XA 3GM2A 4N06A 3RQEA 3QW0A 4KI2A 4U5DE 1JAFA 2XLWA 2M64A 2QTVA 1D1BA 4EBJA 5T1DB 4O79A 4NY3A 3U8PA 4DVYP 2JD3A 4JIOA 1QPUA 1MMNA 3AG3C 2J0XA 2R05A 3EQLF 2AWCA 4JZAA 3SXMA 4CJGA 1VTMP 2R7UA 2XLDA 1MMDA 3AGUA 4YT5A 2J9WA 4D4NA 3CZ6A 1M56C 3JT1A 4DXWA 1T5OA 1JOGA 3LAYA 4PJJA 2NPUA 1NFNA 4G7ZF 5EGYA 1M2OA 1OR3A 5JLIA 3TK0A 1MMGA 2A6EF 2DYRC 3TULA 4CSAC 3GM1A 3U0CA 4CS8A 5BUOA 3Q7GA 1GS9A 2Q9BA 2XXAA 3OEOA 1VYIA 2VB6A 4IARA 2XM4A 1YAUO 3ZQYA 2JPUA 1HMOA 1KNYA 2QY9A 2H7BA 4MQ9F 2HMQA 1YA7O 1VYKA 3NYLA 3UMKA 4BEJA 3O10A 3G50A 2P61A 5KYXB 3I5PA 3W8IA 5KYUB 3C8GB 2C03A 2DGJA 3I5QA 4HEAJ 4OINF 2NSGA 5AGFA 3HTKC 4JE9A 2ICWG 4MVZA 3SP1A 3B29A 3ZIBA 5L0IA 3ABMC 4F4BA 1CGME 1EKYA 2VCCA 1PV3A 3I4UA 4U5HA 2Q00A 5COGA 5JVEA 4G7HF 3G4ZA 3F46A 2PF4E 4AL1A 1UG7A 1C02A 1WN0A 1Z6AA 3TJ6A 1BR4A 2AP3A 4CS9A 1FTSA 3X1OA 4ANJA 5HSWA 2X0CA 4JTAB 2ZXPA 1I4YA 2GFHA 2WZFA 2P7VA 4MTFA 4WGYA 2IXOA 1M57C 2G3KA 3L1MA 1HY5A 5KYWB 1LI7A 3DJUB 2PBEA 2OKUA 4FWVA 2CGEA 4PJLA 3W2WA 1G5ZA 4MNDA 1WOLA 2KK1A 4LLCA 1YYJA 2XL8A 4HFFB 1ZHZA 1M2VA 1BZ4A 3BRJA 3S84A 5TJ5E 3DZAA 3UGPA 4E18A 2H7OA 3DJNB 1K04A 2KGOA 3DWWA 2Q4FA 4BJTA 1NSGB 1YZAA 5B1BC 3RYLA 4IAOA 2NSFA 5GPGB 5KYNA 3E9VA 3ASNC 1OQCA 5T3WA 4GQHA 4AK9A 4CDVA 4MTGA 1QVXA 2VCBA 1BR1A 1ORSC 4MW3A 3SZRA 3SXKA 1NU9C 1SF8A 2NUPA 4M63A 1HMDA 2IOQA 2QE9A 1E85A 2WZGA 1C17M 3KH2A 1TWGA 1YVIA 3DE9A 1Z3IX 3CQZA 3ZQVA 2B0JA 1DOWA 3DMDA 1FFTC 3EHMA 3LNMB 1A0BA 1Q0DA 1RJ9A 2LP4A 2IYLD 3EGXB 3GANA 3LEVA 1T6UA 2Y69C 3A9CA 4E7SA 4MVMA 5A6BA 1LKXA 5AC4A 1WTYA 4OIOF 1HE1A 2IM8A 1LM3B 2LD6A 5L3QA 2LCHA 3KKBA 1V4AA 1OW8A 4D4XA 4N4WA 1E86A
chains in the Genus database with same CATH topology
3EZHA 4KNVA 1QZXA 3EFOA 2Y39A 3LESA 5E33A 4JW1A 5T3TA 1O87A 3GODA 2L81A 2XSEA 4C3BA 1OCRC 2XRHA 3K7DA 4GEHA 3RKOF 2EILC 4KC9A 2WL8A 2Z15A 3K1HA 3Q6NA 4PFOA 4JJGA 2J46A 1TKNA 3KMIA 2M4EA 1FMWA 2PFDA 2V3CC 2J0WA 3K1IC 5DLJA 3HLZA 4DBQA 2DYSC 2IXPA 5D92A 4IJJA 2OCCC 3ZSUA 4CSAA 4DVZA 3ASOC 4BJ6A 3EHNA 1WGWA 3EH2A 3FHDA 1MNDA 3N0TA 3W2VA 3JRTA 3EJNA 1IZMA 4JCHA 3N2ZB 4CS7A 5DS4A 1OKKD 3S29A 5L3VA 2CDQA 3VYWA 5DQZA 2A1DD 3ABKC 4BJ5A 5F5HA 3Q6MA 4DBRA 2BE5F 3AQBA 4OD4A 1NU7D 3FDQA 2J9VA 1RJ9B 4AE4A 2YZSA 4JJFA 2A6HF 1O5HA 4JVSA 3EZIA 3SNHA 4PJMA 4PFPA 3T6JA 3CSKA 4KNWA 5KYYA 3NYJA 2R7WA 2Y3HA 2NUTA 3PMRA 1TWCA 3DAFA 4HE8D 4O6MA 2FGYA 4Q5SF 2OG2A 4OIQF 3NYMA 1PD0A 4A2NB 1ZU4A 4W8KA 4QI0A 4YT4A 5B3SC 3K6BA 4Q7CA 4Q4ZF 3ZVRA 3PHF2 2FFHA 1V55C 4QDLA 1LVKA 4H4KC 2IXNA 2NG1A 3KL4A 3ZG1A 1ZHTA 3UMIA 2R7TA 3LLIA 1PCXA 1NG1A 5DS6A 3DAGA 1S7ZA 3S27A 5EHHA 3EG9B 3EH1A 4XTKA 3VAYA 4CS8C 4YN0B 4IRUA 3NG1A 4CBEA 3MX3A 1J8YF 2WB7A 2A69F 3E70C 4O7GA 2ZXWC 1MMAA 4G0HA 3LJBA 4U5CE 2YHSA 4WJ0A 2G3VA 3LNRA 4CIHA 2H7VC 1TWAA 4E7ZA 2WZLA 1D0XA 2VH3A 2WVQA 2MYSA 4BG0A 3UGOA 2WVOA 2LSEA 3AG1C 5D91A 3ITFA 1Z63A 2G62A 2YEVA 2XL4A 3DM5A 3EGDA 2HV6A 2Q9AA 1OCCC 3RIPA 3DM9B 3AQCA 2XXAB 5CI9A 1OCOC 4RBNA 2V26A 2J7PA 2O9XA 3UNGC 2D5RB 2Q9CA 2X51A 1ZHXA 2NUTB 4YT2A 1ZYRF 4YT8A 1G8XA 1W2WA 4O6NA 1KU2A 3QZCA 2CNWA 2Y3DA 4YJWA 1D1CA 3WODF 5DQTA 4LACB 4ZLDA 2R7RA 1SZIA 1M2VB 3F47A 2R7XA 3LS0A 3FAJA 5DVWA 4PK4A 1BR2A 5B1AC 3DD7A 1VMAA 5E2QA 3N24A 2HV7A 4G7OF 4U5BE 3T6BA 5F5FA 2KQ9A 1ZHWA 3OA1A 3WG7C 2NUPB 4U5FE 2Q3TA 4RDAA 5E3CA 2Y3GA 3IEEA 4C7OA 1N1CA 3ZC4A 4OIPF 2EINC 4K7BA 2R7QA 4JURI 3EGXA 2VASA 4B6IA 3OWTA 2PX3A 2P6VA 1LS1A 5DS5A 3LLKA 3NKDA 3K66A 4I1OB 3L0IA 3S0XA 1VOMA 4RD9A 3JCUQ 3AG2C 3EGDB 4HFKB 3EFOB 4QI2A 4BJ6C 4I3MA 1Z5ZA 1ZU5A 1FFHA 4XWJA 2ZXRA 3NKEA 4FESA 3LS1A 2W9YA 3B0UX 4YWQA 5FCLA 3NDBB 3DXJF 4BJ5C 2E87A 4P6IC 1JPJA 4O6YA 4OD5A 4C3DA 4K0DA 4U5EE 2R7OA 2W45A 1FMVA 1V54C 2PP4A 1JPNA 2Y3BA 3AG4C 3O39A 4U5GA 2EIKC 4EBBA 4ZLCA 4PJNA 5IY5C 3X2QC 3JSZA 2KJGA 1D1AA 2MWQA 2A68F 2PX0A 4XLPF 2C04A 4I44A 4XLNF 3V7OA 3B0PA 5E3AA 3SEOA 1IW7F 1D0ZA 2ZPAA 4LLEA 3UR3C 4CS9C 3T4RA 1QLEC 3B0VC 1ZHYA 1TR2A 4GYTA 1PD1A 4BJ1A 4OIRF 2CW0F 4C7OB 3ECSA 3O6XA 3B9QA 2WVNA 3EPVA 4IWBA 4AE4B 2R7VA 5CI8A 1VK5A 3RFYA 2KNHA 5KYXA 4J32B 2W4BA 5KYYB 5KYUA 1J8MF 3L34A 2L9JA 1TWHA 3NRHA 1MNEA 3QMKA 1NZEA 2W4MA 1SMYF 3S28A 2J9UA 3H65A 3UMHA 1OCZC 4DOZA 2I8BA 2EIMC 3Q7LA 3POVA 2J7PD 3K33A 3MLGA 4FX5A 4EWCA 5KYWA 4ULWA 2EIJC 1ST6A 4J30B 3W8HA 3HJCA 4I1MA 1Z23A 2CNWD 3RH3A 3JYHA 3EG9A 4AX2A 2IXMA 2ZXOA 3SYNA 4KBLA 4LERA 2KW3C 3TD7A 1OKKA 4C3EA 2R7SA 3ABLC 3M1CB 2J45A 3FVYA 1D0YA 4N06A 4KI2A 4U5DE 2QTVA 1D1BA 5T1DB 4O79A 4NY3A 4DVYP 2JD3A 1MMNA 3AG3C 2J0XA 3EQLF 4JZAA 2R7UA 1MMDA 4YT5A 2J9WA 3CZ6A 1M56C 3JT1A 3LAYA 4PJJA 4G7ZF 5EGYA 1M2OA 4CSAC 1MMGA 2A6EF 2DYRC 4CS8A 5BUOA 3Q7GA 2Q9BA 2XXAA 3OEOA 1VYIA 2VB6A 2QY9A 2H7BA 4MQ9F 3NYLA 1VYKA 3UMKA 4BEJA 5KYXB 3I5PA 3W8IA 5KYUB 4HEAJ 2C03A 2DGJA 3I5QA 4OINF 3HTKC 3SP1A 3ZIBA 3ABMC 4F4BA 4U5HA 3I4UA 4G7HF 3F46A 2PF4E 1Z6AA 1BR4A 4CS9A 1FTSA 3X1OA 4ANJA 5HSWA 2ZXPA 2GFHA 2WZFA 2P7VA 2IXOA 1M57C 2G3KA 5KYWB 3DJUB 4PJLA 3W2WA 4FWVA 2CGEA 4MNDA 4LLCA 4HFFB 1ZHZA 1M2VA 3DZAA 3UGPA 2H7OA 3DJNB 2KGOA 4BJTA 5B1BC 3RYLA 4IAOA 5KYNA 3E9VA 3ASNC 5T3WA 4AK9A 1BR1A 3SZRA 1NU9C 1SF8A 2NUPA 4M63A 2IOQA 2WZGA 3KH2A 1TWGA 1Z3IX 3CQZA 2B0JA 3DMDA 1FFTC 3EHMA 1RJ9A 2IYLD 3LEVA 3EGXB 3GANA 2Y69C 4E7SA 1LKXA 4OIOF 5L3QA 3KKBA 4X0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T1D B;  3PHF 2; 
#chains in the Genus database with same CATH topology
 3TOM A;  3MYF A;  3EZH A;  4KNV A;  1SR2 A;  2YLD A;  3U9M A;  3ZTM A;  3U5S A;  1QZX A;  3EFO A;  2Y39 A;  3LES A;  5E33 A;  4CDA A;  1OW6 A;  5A6K A;  4JEA A;  4JW1 A;  5T3T A;  3RF3 A;  3AGT A;  1O87 A;  3GOD A;  2L81 A;  2XSE A;  4C3B A;  1OCR C;  1WAT A;  2XRH A;  3K7D A;  4GEH A;  4P9F A;  3RKO F;  4BEM J;  2EIL C;  1AUE A;  4XQ1 A;  4KC9 A;  2WL8 A;  2Z15 A;  5BQH A;  5CIV A;  3K1H A;  3Q6N A;  4PFO A;  3PCV A;  2YWA A;  4JEB A;  2KSF A;  5A6A A;  4JJG A;  2J46 A;  1TKN A;  3KMI A;  2ZD9 A;  2M4E A;  1FMW A;  3IQ5 A;  1RKE B;  2GWW A;  2PFD A;  3GWN A;  1E84 A;  4DRH B;  2V3C C;  2AWY A;  2J0W A;  3K1I C;  3NMI A;  3U2M A;  3HLZ A;  5DLJ A;  1H6G A;  4G78 A;  1XZP A;  4DBQ A;  1LS4 A;  2DYS C;  2YVK A;  4U9D A;  2XS1 A;  2RSE B;  2IXP A;  5D92 A;  4IJJ A;  4WAB A;  4ER9 A;  3AJM A;  2PNO A;  3V5X A;  1FR0 A;  4DRJ B;  2OCC C;  4Z9J A;  3ZSU A;  1Q0F A;  2XM0 A;  2ASR A;  3GOR A;  3H2U A;  1XWJ A;  3QVZ A;  4ULV A;  3C62 A;  3ASO C;  4DVZ A;  1WAS A;  1B68 A;  1QQ3 A;  2F22 A;  4PAC A;  4BJ6 A;  5EK0 A;  2HJ3 A;  2LFF A;  3EHN A;  1O3U A;  4NC3 A;  1WGW A;  3EH2 A;  3FHD A;  1MND A;  2UUH A;  3N0T A;  2JX0 A;  3W2V A;  3JRT A;  1R5I D;  1U6H A;  2XLO A;  3EJN A;  1IZM A;  4CDY A;  4JCH A;  3RVZ A;  3N2Z B;  4CS7 A;  5DS4 A;  3WHN A;  1OKK D;  3S29 A;  3SXY A;  2AVK A;  2CDQ A;  2LIG A;  5L3V A;  3VYW A;  3KYI A;  5JP7 A;  3ZDL A;  2VCA A;  5DQZ A;  2A1D D;  2A0U A;  3ABK C;  4BJ5 A;  5F5H A;  1R4T A;  3Q6M A;  4JRZ A;  4DBR A;  2BE5 F;  3AQB A;  1V74 B;  2HJM A;  3C7J A;  1CGN A;  4NQF A;  3H2V A;  3U8V A;  4OD4 A;  1NU7 D;  1VLT A;  1VLS A;  1ZW2 A;  3FDQ A;  2J9V A;  1RJ9 B;  3PDM P;  4AE4 A;  2YZS A;  4JJF A;  4MVU A;  2A6H F;  5AC5 A;  1O5H A;  2B0H A;  4JVS A;  3EZI A;  4L6R A;  3SNH A;  1TFK B;  4EHP A;  2XLH A;  2A0B A;  2XS8 A;  4PJM A;  4PFP A;  2L7A A;  3T6J A;  3CSK A;  4UDV A;  1K05 A;  1T01 A;  3NYJ A;  4KNW A;  4A4A A;  5KYY A;  2R7W A;  2Y3H A;  2NUT A;  3PMR A;  3RW0 A;  1HE9 A;  5JRA A;  2HUJ A;  4CX9 A;  1TWC A;  2HZ8 A;  3DAF A;  2MHR A;  2FGY A;  4HE8 D;  4MVR A;  4O6M A;  4Q5S F;  2OG2 A;  3MBG A;  4OIQ F;  3NYM A;  4JKV A;  1PD0 A;  4A2N B;  1ZU4 A;  4MTO A;  4QI0 A;  3FOP A;  2HFI A;  4W8K A;  4YT4 A;  3K6B A;  5B3S C;  4YL1 A;  4Q7C A;  4Q4Z F;  2YL7 A;  3ZVR A;  4MS2 A;  1Z7Q c;  3PHF 2;  2FFH A;  2UUI A;  1V55 C;  4QDL A;  1LVK A;  2GDC A;  4IAQ A;  2ETS A;  3DE8 A;  4H4K C;  2IXN A;  2NG1 A;  3KL4 A;  3ZG1 A;  4U9E A;  1ZHT A;  5COM A;  3UMI A;  2R7T A;  3LLI A;  1PCX A;  1NG1 A;  3C63 A;  3FXH A;  3DAG A;  3HKK A;  1S7Z A;  4NCQ A;  5DS6 A;  3GEI A;  3S27 A;  4YL3 A;  5EHH A;  4JTC B;  3EG9 B;  3EH1 A;  4XTK A;  3VAY A;  4CS8 C;  3U3F A;  4YN0 B;  5F28 E;  4IRU A;  3NG1 A;  3TQO A;  3ZWI A;  4CBE A;  2KC3 A;  3MX3 A;  1J8Y F;  2WB7 A;  2A69 F;  2HKV A;  4R32 A;  3E70 C;  4O7G A;  2ZXW C;  1E2X A;  1T9K A;  1MMA A;  3CEX A;  4G0H A;  1RXQ A;  1A7D A;  1DOV A;  2YHS A;  3LJB A;  4U5C E;  4WJ0 A;  2G3V A;  3GEE A;  3JRM O;  3C8Z A;  4YL0 A;  5JSL A;  1G4W R;  1YAR O;  3LNR A;  2H7V C;  1TWA A;  4JC7 A;  3HNI A;  4E7Z A;  4CIH A;  5L0H A;  1G4U S;  2XL6 A;  2WZL A;  1OR2 A;  3AOU A;  1D0X A;  2VH3 A;  2WVQ A;  2MYS A;  4BG0 A;  4MVQ A;  2WVO A;  1YZC A;  3UGO A;  2LSE A;  3AG1 C;  5D91 A;  3ITF A;  1Z63 A;  1WWP A;  1LE2 A;  2G62 A;  2YEV A;  2XL4 A;  1ZVZ A;  4YK5 A;  1A41 A;  4H54 A;  2EPM X;  3DM5 A;  2LK4 A;  3EGD A;  2HV6 A;  3FAP B;  4CIP A;  2Q9A A;  2HSB A;  1GQA A;  4BPM A;  2XLM A;  1KTM A;  2L6H A;  1OCC C;  4LDR A;  3RIP A;  3DM9 B;  4MVS A;  1RMV A;  1AVO B;  2IBF A;  3TOL A;  3AQC A;  4W8P A;  2XXA B;  1AEP A;  1XZQ A;  5A6B D;  2R25 A;  5CI9 A;  5L0J A;  2OJQ A;  2GAQ A;  1OCO C;  4RBN A;  2V26 A;  3JSE O;  2J7P A;  3IQC A;  2O9X A;  3UNG C;  2D5R B;  2KYH A;  2DB4 A;  2Q9C A;  2X51 A;  3CAX A;  1I5N A;  2FAP B;  3HNL A;  2LQG A;  1ZHX A;  3C18 A;  5JS5 A;  2NUT B;  3C8G A;  4YT2 A;  1ZYR F;  4YT8 A;  2H8A A;  1G8X A;  3V5Z A;  1CPQ A;  1W2W A;  3MFN A;  1KU2 A;  4O6N A;  3QZC A;  1Q0K A;  5A6J A;  3U3B A;  1LPE A;  2CNW A;  3R2P A;  5HV9 A;  4CSA A;  3B71 A;  2Y3D A;  1FNT c;  4YJW A;  1A7V A;  3S9O A;  1D1C A;  3WOD F;  5DQT A;  2L6G A;  1NBB A;  4LAC B;  4XEK A;  4ZLD A;  3RQG A;  1OXB A;  3DI5 A;  4MW8 A;  2R7R A;  256B A;  3WAQ A;  2VC9 A;  1SZI A;  1M2V B;  3F47 A;  2R7X A;  3LS0 A;  3FAJ A;  4NTA A;  3DKA A;  4XPY A;  2OEX A;  5DVW A;  4EBK A;  2OQM A;  4PK4 A;  4XEF A;  2R7S A;  1CPR A;  1YJG A;  2D4U A;  1BR2 A;  5B1A C;  3R7C A;  3DD7 A;  5L0G A;  3JYY A;  1VMA A;  1JRA A;  2QUP A;  5E2Q A;  3VM6 A;  3N24 A;  2I15 A;  2HV7 A;  4P9T A;  2OU6 A;  3HNK A;  3MYI A;  1H9G A;  5FZT A;  4U5B E;  5B3I A;  4G7O F;  3T6B A;  5F5F A;  1JR8 A;  1I4Z A;  1LIH A;  1ZHW A;  1L3P A;  2KQ9 A;  3IQT A;  3OA1 A;  3US6 A;  3WG7 C;  2NUP B;  1ZW3 A;  4U5F E;  2Q3T A;  3RVY A;  4RDA A;  4MVO A;  5E3C A;  2Y3G A;  1NLX A;  3IEE A;  4C7O A;  1N1C A;  2QNL A;  3ZC4 A;  3QVY A;  4OIP F;  2EIN C;  3IPM O;  4K7B A;  1BDJ B;  4XEV A;  1APC A;  2R7Q A;  3LUT B;  4JCZ A;  3EGX A;  4JUR I;  2GA0 A;  2QLA A;  2VAS A;  4B6I A;  2YL3 A;  3OWT A;  4JTD B;  2PX3 A;  2P6V A;  2R03 A;  1LS1 A;  1JMW A;  1H7I A;  2XLV A;  5DS5 A;  3LEO A;  3LLK A;  1A7E A;  3NKD A;  3K66 A;  1C03 A;  1Q0G A;  4I1O B;  3SXZ A;  3L0I A;  2CYD A;  3S0X A;  1VOM A;  5L0C A;  4RD9 A;  2YQY A;  3KPH A;  3JCU Q;  3AG2 C;  3GEH A;  3IQ6 A;  3EGD B;  5BQI A;  4EKW A;  1GM5 A;  1GGQ A;  1S05 A;  4HFK B;  3EFO B;  4N6C A;  4QI2 A;  4BJ6 C;  4I3M A;  1H9T A;  1EQ1 A;  1Z5Z A;  1ZU5 A;  1FFH A;  4XWJ A;  1BBH A;  1T6Q A;  2ZXR A;  3T6G B;  3NKE A;  4FES A;  3JTL O;  2W9Y A;  3LS1 A;  4IB4 A;  4XPX A;  1Y6D A;  3M15 A;  3B0U X;  4E0H A;  1M6T A;  4Z9I A;  2EPL X;  1YLM A;  2HS5 A;  4YWQ A;  5FCL A;  3NDB B;  1OW7 A;  3DXJ F;  2YLI A;  4BJ5 C;  2E87 A;  4P6I C;  4DJ9 A;  1JPJ A;  1RKE A;  4O6Y A;  2DI3 A;  4OD5 A;  4C3D A;  4K0D A;  1LI5 A;  4PR9 A;  3FOO A;  3KYJ A;  4U5E E;  2R7O A;  1LE4 A;  1YDI A;  1FMV A;  2EPK X;  2W45 A;  4E0I A;  2HSQ A;  4AL0 A;  2J9B A;  1V54 C;  3S90 A;  2PP4 A;  1JPN A;  2Y3B A;  3AG4 C;  1Y4C A;  1OXK A;  3O39 A;  4U5G A;  2EIK C;  3V5Y A;  1U89 A;  3L8J A;  4EBB A;  5L0F A;  4ZLC A;  3U2L A;  4PJN A;  1UFB A;  2TMV P;  2YL0 A;  5IY5 C;  2RD9 A;  1Q0M A;  2KJG A;  3JSZ A;  3VF0 A;  3X2Q C;  4E17 A;  4EIY A;  3A11 A;  4X0R A;  4LDQ A;  1D1A A;  2MWQ A;  1TQG A;  2A68 F;  2PX0 A;  4XLP F;  1EA8 A;  2LFD A;  3W4Y A;  4J7T A;  2C04 A;  1CGO A;  4I44 A;  4XLN F;  3V7O A;  3FMS A;  2EPO A;  1K40 A;  3B0P A;  5JUA A;  4K1O A;  5E3A A;  3SEO A;  1IW7 F;  1D0Z A;  2EPN A;  2ZPA A;  4LLE A;  3UR3 C;  3O55 A;  3T4R A;  4CS9 C;  1QLE C;  5L0D A;  3B0V C;  3M4C A;  1ZHY A;  5A69 A;  1TR2 A;  4GYT A;  1MQV A;  1F1M A;  3QW1 A;  3U9J A;  1PD1 A;  4BJ1 A;  3BEH A;  1VB5 A;  5K0I A;  4OIR F;  2P1A A;  2CW0 F;  4ONS A;  1QKR A;  4C7O B;  3K1I A;  1QSP A;  1SYQ A;  3ECS A;  3O6X A;  3B9Q A;  2WVN A;  3EPV A;  4XPW A;  1YYX A;  4IWB A;  5JT4 A;  4AE4 B;  2CCY A;  1YA9 A;  2OEV A;  2R7V A;  2J8W A;  5CI8 A;  1U0B B;  2P0N A;  4LDK A;  1VK5 A;  3RFY A;  3T9O A;  1HW1 A;  2KNH A;  1NFO A;  3GM3 A;  5KYX A;  4J32 B;  2W4B A;  1EI7 A;  4IGG A;  4WGZ A;  1J8M F;  3L8I A;  3L34 A;  5KYU A;  5KYY B;  2OOC A;  4Z9H A;  2L9J A;  1TWH A;  3NRH A;  1MNE A;  2YLG A;  3QMK A;  1NZE A;  2W4M A;  3QTH A;  1SMY F;  3S28 A;  2J9U A;  3H65 A;  2BC5 A;  1ZZP A;  3UMH A;  2R02 A;  4DRI B;  1OCZ C;  4DOZ A;  4N6H A;  4NTB A;  2HMZ A;  5COF A;  2I8B A;  2EIM C;  3Q7L A;  2BL2 A;  3M79 A;  3ATP A;  3POV A;  3VRC A;  2YL1 A;  2J7P D;  3K33 A;  1RKC A;  3MLG A;  2XLE A;  4FX5 A;  4EWC A;  5KYW A;  4ULW A;  4EUK B;  3TJ5 A;  3C8G D;  2EIJ C;  1ST6 A;  3IHU A;  4J30 B;  3W8H A;  1T6I A;  3HJC A;  4I1M A;  1Z23 A;  2Q7R A;  1HW2 A;  2CNW D;  4CJO A;  3RH3 A;  3JYH A;  1E83 A;  2AU5 A;  1ORJ A;  3EG9 A;  5BQG A;  2IXM A;  4AX2 A;  2YKZ A;  2ZXO A;  2OJE D;  3HNJ A;  3RQF A;  3NMJ A;  3SYN A;  1RCP A;  4KBL A;  4LER A;  2YRF A;  4FAP B;  2KW3 C;  4NTF A;  3JZ0 A;  3ZTZ A;  3TD7 A;  1OKK A;  1ORY A;  3GWL A;  4J7Y A;  4C3E A;  3ABL C;  1TFO B;  2R9R B;  3M1C B;  3NMK A;  2J45 A;  3J06 A;  1L7C A;  3FVY A;  3M4B A;  1D0Y A;  1FAP B;  2L6F A;  3G4X A;  3GM2 A;  4N06 A;  3RQE A;  3QW0 A;  4KI2 A;  4U5D E;  1JAF A;  2XLW A;  2M64 A;  2QTV A;  1D1B A;  4EBJ A;  5T1D B;  4O79 A;  4NY3 A;  3U8P A;  4DVY P;  2JD3 A;  4JIO A;  1QPU A;  1MMN A;  3AG3 C;  2J0X A;  2R05 A;  3EQL F;  2AWC A;  4JZA A;  3SXM A;  4CJG A;  1VTM P;  2R7U A;  2XLD A;  1MMD A;  3AGU A;  4YT5 A;  2J9W A;  4D4N A;  3CZ6 A;  1M56 C;  3JT1 A;  4DXW A;  1T5O A;  1JOG A;  3LAY A;  4PJJ A;  2NPU A;  1NFN A;  4G7Z F;  5EGY A;  1M2O A;  1OR3 A;  5JLI A;  3TK0 A;  1MMG A;  2A6E F;  2DYR C;  3TUL A;  4CSA C;  3GM1 A;  3U0C A;  4CS8 A;  5BUO A;  3Q7G A;  1GS9 A;  2Q9B A;  2XXA A;  3OEO A;  1VYI A;  2VB6 A;  4IAR A;  2XM4 A;  1YAU O;  3ZQY A;  2JPU A;  1HMO A;  1KNY A;  2QY9 A;  2H7B A;  4MQ9 F;  2HMQ A;  1YA7 O;  1VYK A;  3NYL A;  3UMK A;  4BEJ A;  3O10 A;  3G50 A;  2P61 A;  5KYX B;  3I5P A;  3W8I A;  5KYU B;  3C8G B;  2C03 A;  2DGJ A;  3I5Q A;  4HEA J;  4OIN F;  2NSG A;  5AGF A;  3HTK C;  4JE9 A;  2ICW G;  4MVZ A;  3SP1 A;  3B29 A;  3ZIB A;  5L0I A;  3ABM C;  4F4B A;  1CGM E;  1EKY A;  2VCC A;  1PV3 A;  3I4U A;  4U5H A;  2Q00 A;  5COG A;  5JVE A;  4G7H F;  3G4Z A;  3F46 A;  2PF4 E;  4AL1 A;  1UG7 A;  1C02 A;  1WN0 A;  1Z6A A;  3TJ6 A;  1BR4 A;  2AP3 A;  4CS9 A;  1FTS A;  3X1O A;  4ANJ A;  5HSW A;  2X0C A;  4JTA B;  2ZXP A;  1I4Y A;  2GFH A;  2WZF A;  2P7V A;  4MTF A;  4WGY A;  2IXO A;  1M57 C;  2G3K A;  3L1M A;  1HY5 A;  5KYW B;  1LI7 A;  3DJU B;  2PBE A;  2OKU A;  4FWV A;  2CGE A;  4PJL A;  3W2W A;  1G5Z A;  4MND A;  1WOL A;  2KK1 A;  4LLC A;  1YYJ A;  2XL8 A;  4HFF B;  1ZHZ A;  1M2V A;  1BZ4 A;  3BRJ A;  3S84 A;  5TJ5 E;  3DZA A;  3UGP A;  4E18 A;  2H7O A;  3DJN B;  1K04 A;  2KGO A;  3DWW A;  2Q4F A;  4BJT A;  1NSG B;  1YZA A;  5B1B C;  3RYL A;  4IAO A;  2NSF A;  5GPG B;  5KYN A;  3E9V A;  3ASN C;  1OQC A;  5T3W A;  4GQH A;  4AK9 A;  4CDV A;  4MTG A;  1QVX A;  2VCB A;  1BR1 A;  1ORS C;  4MW3 A;  3SZR A;  3SXK A;  1NU9 C;  1SF8 A;  2NUP A;  4M63 A;  1HMD A;  2IOQ A;  2QE9 A;  1E85 A;  2WZG A;  1C17 M;  3KH2 A;  1TWG A;  1YVI A;  3DE9 A;  1Z3I X;  3CQZ A;  3ZQV A;  2B0J A;  1DOW A;  3DMD A;  1FFT C;  3EHM A;  3LNM B;  1A0B A;  1Q0D A;  1RJ9 A;  2LP4 A;  2IYL D;  3EGX B;  3GAN A;  3LEV A;  1T6U A;  2Y69 C;  3A9C A;  4E7S A;  4MVM A;  5A6B A;  1LKX A;  5AC4 A;  1WTY A;  4OIO F;  1HE1 A;  2IM8 A;  1LM3 B;  2LD6 A;  5L3Q A;  2LCH A;  3KKB A;  1V4A A;  1OW8 A;  4D4X A;  4N4W A;  1E86 A; 
#chains in the Genus database with same CATH homology
 3EZH A;  4KNV A;  1QZX A;  3EFO A;  2Y39 A;  3LES A;  5E33 A;  4JW1 A;  5T3T A;  1O87 A;  3GOD A;  2L81 A;  2XSE A;  4C3B A;  1OCR C;  2XRH A;  3K7D A;  4GEH A;  3RKO F;  2EIL C;  4KC9 A;  2WL8 A;  2Z15 A;  3K1H A;  3Q6N A;  4PFO A;  4JJG A;  2J46 A;  1TKN A;  3KMI A;  2M4E A;  1FMW A;  2PFD A;  2V3C C;  2J0W A;  3K1I C;  5DLJ A;  3HLZ A;  4DBQ A;  2DYS C;  2IXP A;  5D92 A;  4IJJ A;  2OCC C;  3ZSU A;  4CSA A;  4DVZ A;  3ASO C;  4BJ6 A;  3EHN A;  1WGW A;  3EH2 A;  3FHD A;  1MND A;  3N0T A;  3W2V A;  3JRT A;  3EJN A;  1IZM A;  4JCH A;  3N2Z B;  4CS7 A;  5DS4 A;  1OKK D;  3S29 A;  5L3V A;  2CDQ A;  3VYW A;  5DQZ A;  2A1D D;  3ABK C;  4BJ5 A;  5F5H A;  3Q6M A;  4DBR A;  2BE5 F;  3AQB A;  4OD4 A;  1NU7 D;  3FDQ A;  2J9V A;  1RJ9 B;  4AE4 A;  2YZS A;  4JJF A;  2A6H F;  1O5H A;  4JVS A;  3EZI A;  3SNH A;  4PJM A;  4PFP A;  3T6J A;  3CSK A;  4KNW A;  5KYY A;  3NYJ A;  2R7W A;  2Y3H A;  2NUT A;  3PMR A;  1TWC A;  3DAF A;  4HE8 D;  4O6M A;  2FGY A;  4Q5S F;  2OG2 A;  4OIQ F;  3NYM A;  1PD0 A;  4A2N B;  1ZU4 A;  4W8K A;  4QI0 A;  4YT4 A;  5B3S C;  3K6B A;  4Q7C A;  4Q4Z F;  3ZVR A;  3PHF 2;  2FFH A;  1V55 C;  4QDL A;  1LVK A;  4H4K C;  2IXN A;  2NG1 A;  3KL4 A;  3ZG1 A;  1ZHT A;  3UMI A;  2R7T A;  3LLI A;  1PCX A;  1NG1 A;  5DS6 A;  3DAG A;  1S7Z A;  3S27 A;  5EHH A;  3EG9 B;  3EH1 A;  4XTK A;  3VAY A;  4CS8 C;  4YN0 B;  4IRU A;  3NG1 A;  4CBE A;  3MX3 A;  1J8Y F;  2WB7 A;  2A69 F;  3E70 C;  4O7G A;  2ZXW C;  1MMA A;  4G0H A;  3LJB A;  4U5C E;  2YHS A;  4WJ0 A;  2G3V A;  3LNR A;  4CIH A;  2H7V C;  1TWA A;  4E7Z A;  2WZL A;  1D0X A;  2VH3 A;  2WVQ A;  2MYS A;  4BG0 A;  3UGO A;  2WVO A;  2LSE A;  3AG1 C;  5D91 A;  3ITF A;  1Z63 A;  2G62 A;  2YEV A;  2XL4 A;  3DM5 A;  3EGD A;  2HV6 A;  2Q9A A;  1OCC C;  3RIP A;  3DM9 B;  3AQC A;  2XXA B;  5CI9 A;  1OCO C;  4RBN A;  2V26 A;  2J7P A;  2O9X A;  3UNG C;  2D5R B;  2Q9C A;  2X51 A;  1ZHX A;  2NUT B;  4YT2 A;  1ZYR F;  4YT8 A;  1G8X A;  1W2W A;  4O6N A;  1KU2 A;  3QZC A;  2CNW A;  2Y3D A;  4YJW A;  1D1C A;  3WOD F;  5DQT A;  4LAC B;  4ZLD A;  2R7R A;  1SZI A;  1M2V B;  3F47 A;  2R7X A;  3LS0 A;  3FAJ A;  5DVW A;  4PK4 A;  1BR2 A;  5B1A C;  3DD7 A;  1VMA A;  5E2Q A;  3N24 A;  2HV7 A;  4G7O F;  4U5B E;  3T6B A;  5F5F A;  2KQ9 A;  1ZHW A;  3OA1 A;  3WG7 C;  2NUP B;  4U5F E;  2Q3T A;  4RDA A;  5E3C A;  2Y3G A;  3IEE A;  4C7O A;  1N1C A;  3ZC4 A;  4OIP F;  2EIN C;  4K7B A;  2R7Q A;  4JUR I;  3EGX A;  2VAS A;  4B6I A;  3OWT A;  2PX3 A;  2P6V A;  1LS1 A;  5DS5 A;  3LLK A;  3NKD A;  3K66 A;  4I1O B;  3L0I A;  3S0X A;  1VOM A;  4RD9 A;  3JCU Q;  3AG2 C;  3EGD B;  4HFK B;  3EFO B;  4QI2 A;  4BJ6 C;  4I3M A;  1Z5Z A;  1ZU5 A;  1FFH A;  4XWJ A;  2ZXR A;  3NKE A;  4FES A;  3LS1 A;  2W9Y A;  3B0U X;  4YWQ A;  5FCL A;  3NDB B;  3DXJ F;  4BJ5 C;  2E87 A;  4P6I C;  1JPJ A;  4O6Y A;  4OD5 A;  4C3D A;  4K0D A;  4U5E E;  2R7O A;  2W45 A;  1FMV A;  1V54 C;  2PP4 A;  1JPN A;  2Y3B A;  3AG4 C;  3O39 A;  4U5G A;  2EIK C;  4EBB A;  4ZLC A;  4PJN A;  5IY5 C;  3X2Q C;  3JSZ A;  2KJG A;  1D1A A;  2MWQ A;  2A68 F;  2PX0 A;  4XLP F;  2C04 A;  4I44 A;  4XLN F;  3V7O A;  3B0P A;  5E3A A;  3SEO A;  1IW7 F;  1D0Z A;  2ZPA A;  4LLE A;  3UR3 C;  4CS9 C;  3T4R A;  1QLE C;  3B0V C;  1ZHY A;  1TR2 A;  4GYT A;  1PD1 A;  4BJ1 A;  4OIR F;  2CW0 F;  4C7O B;  3ECS A;  3O6X A;  3B9Q A;  2WVN A;  3EPV A;  4IWB A;  4AE4 B;  2R7V A;  5CI8 A;  1VK5 A;  3RFY A;  2KNH A;  5KYX A;  4J32 B;  2W4B A;  5KYY B;  5KYU A;  1J8M F;  3L34 A;  2L9J A;  1TWH A;  3NRH A;  1MNE A;  3QMK A;  1NZE A;  2W4M A;  1SMY F;  3S28 A;  2J9U A;  3H65 A;  3UMH A;  1OCZ C;  4DOZ A;  2I8B A;  2EIM C;  3Q7L A;  3POV A;  2J7P D;  3K33 A;  3MLG A;  4FX5 A;  4EWC A;  5KYW A;  4ULW A;  2EIJ C;  1ST6 A;  4J30 B;  3W8H A;  3HJC A;  4I1M A;  1Z23 A;  2CNW D;  3RH3 A;  3JYH A;  3EG9 A;  4AX2 A;  2IXM A;  2ZXO A;  3SYN A;  4KBL A;  4LER A;  2KW3 C;  3TD7 A;  1OKK A;  4C3E A;  2R7S A;  3ABL C;  3M1C B;  2J45 A;  3FVY A;  1D0Y A;  4N06 A;  4KI2 A;  4U5D E;  2QTV A;  1D1B A;  5T1D B;  4O79 A;  4NY3 A;  4DVY P;  2JD3 A;  1MMN A;  3AG3 C;  2J0X A;  3EQL F;  4JZA A;  2R7U A;  1MMD A;  4YT5 A;  2J9W A;  3CZ6 A;  1M56 C;  3JT1 A;  3LAY A;  4PJJ A;  4G7Z F;  5EGY A;  1M2O A;  4CSA C;  1MMG A;  2A6E F;  2DYR C;  4CS8 A;  5BUO A;  3Q7G A;  2Q9B A;  2XXA A;  3OEO A;  1VYI A;  2VB6 A;  2QY9 A;  2H7B A;  4MQ9 F;  3NYL A;  1VYK A;  3UMK A;  4BEJ A;  5KYX B;  3I5P A;  3W8I A;  5KYU B;  4HEA J;  2C03 A;  2DGJ A;  3I5Q A;  4OIN F;  3HTK C;  3SP1 A;  3ZIB A;  3ABM C;  4F4B A;  4U5H A;  3I4U A;  4G7H F;  3F46 A;  2PF4 E;  1Z6A A;  1BR4 A;  4CS9 A;  1FTS A;  3X1O A;  4ANJ A;  5HSW A;  2ZXP A;  2GFH A;  2WZF A;  2P7V A;  2IXO A;  1M57 C;  2G3K A;  5KYW B;  3DJU B;  4PJL A;  3W2W A;  4FWV A;  2CGE A;  4MND A;  4LLC A;  4HFF B;  1ZHZ A;  1M2V A;  3DZA A;  3UGP A;  2H7O A;  3DJN B;  2KGO A;  4BJT A;  5B1B C;  3RYL A;  4IAO A;  5KYN A;  3E9V A;  3ASN C;  5T3W A;  4AK9 A;  1BR1 A;  3SZR A;  1NU9 C;  1SF8 A;  2NUP A;  4M63 A;  2IOQ A;  2WZG A;  3KH2 A;  1TWG A;  1Z3I X;  3CQZ A;  2B0J A;  3DMD A;  1FFT C;  3EHM A;  1RJ9 A;  2IYL D;  3LEV A;  3EGX B;  3GAN A;  2Y69 C;  4E7S A;  1LKX A;  4OIO F;  5L3Q A;  3KKB A;  4X0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...