5T1DB

Crystal structure of ebv ghgl/gp42/e1d1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
99
Chain Sequence
PCCHVTQLALENISDIYLVSNQTCDGFSLASLNSPNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title Structural basis for Epstein-Barr virus host cell tropism mediated by gp42 and gHgL entry glycoproteins.
pubmed doi rcsb
source organism Epstein-barr virus (strain b95-8)
molecule tags Viral protein
total genus 14
structure length 99
sequence length 109
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11108 Phage_glycop_gL Viral glycoprotein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1580 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5t1dB00
3PHF2 5T1DB
chains in the Genus database with same CATH superfamily
4JCZA 3NYJA 1NG1A 4LDKA 5EK0A 3EFOA 4G7OF 2ASRA 2I15A 4BJ5C 3U2LA 3ZQVA 4MVRA 2RD9A 2XLHA 3R2PA 4IARA 4MNDA 1YLMA 5KYUA 1RKEB 1VLTA 2Q9AA 1YARO 2IYLD 3GM2A 3JSZA 4O6MA 4CDVA 2EPOA 5KYWA 1RXQA 3EZIA 4JTDB 2HJMA 2NUPA 1XWJA 4O6NA 5BQIA 2XXAB 3L0IA 4MVMA 2X0CA 2AU5A 2XS1A 3DKAA 4Q4ZF 1FR0A 2YLIA 5L0DA 3FAPB 4CDYA 4C3EA 2H7BA 1D0YA 2P6VA 3M4BA 3MLGA 1Y6DA 3PDMP 2LSEA 1YYXA 4J30B 3RYLA 3FAJA 1FFHA 1LS1A 2E87A 4XEKA 1VMAA 1SMYF 2JPUA 2NSGA 1FFTC 3DMDA 3UMHA 3VRCA 1TFKB 4EWCA 5EGYA 4LDQA 4IAOA 3R7CA 3ABLC 2JD3A 3G4XA 4XTKA 2XL8A 4MVQA 3S28A 4BJ1A 3SNHA 1OCZC 4C3BA 2YZSA 2R7VA 3PMRA 1QVXA 1LE4A 3IQ6A 4DVZA 1K05A 3C8GA 1ZW2A 2HUJA 1LPEA 2Y3GA 2EPMX 1OKKD 2CNWA 3JYHA 1FNTc 4G7HF 3U8PA 4P9TA 1NU7D 1QLEC 2KNHA 3IQCA 3V5XA 1VYKA 4PFPA 2OCCC 1E85A 2EPKX 2KQ9A 3QMKA 4Z9JA 2NUTA 2QY9A 1S7ZA 2DGJA 1B68A 4PJMA 3TQOA 4GQHA 2AWCA 1ZW3A 3AQBA 3QW1A 1ZU5A 3B0VC 4JJFA 3ZSUA 3U0CA 3NRHA 5GPGB 2Z15A 4XLNF 2ETSA 4ONSA 2GWWA 3DE8A 3MBGA 1YDIA 1C02A 3JT1A 3T6GB 1WASA 4GYTA 1LM3B 4MVZA 1I5NA 3HNIA 1WTYA 1M6TA 2JX0A 3L34A 3AG1C 3FMSA 1OW7A 3GEIA 3DJUB 3KYIA 3AOUA 2PFDA 4N06A 5BQGA 4DJ9A 4LLCA 1JPNA 1Z7Qc 5L3QA 2ZXOA 1A7EA 2J9BA 3LLIA 1U89A 3CZ6A 3DD7A 3AG2C 3QVZA 3DE9A 1J8YF 5L3VA 3LNRA 2A0UA 2WL8A 1Q0KA 1FMVA 2VCBA 3M15A 3X2QC 2J45A 4YL1A 2LFFA 1Z63A 2OEXA 3EG9B 2M4EA 5DS5A 4Q7CA 1G4WR 1H6GA 4MS2A 2Q9BA 2CW0F 3NG1A 4BJ5A 3H2VA 1M56C 4N6CA 4PJNA 5E3AA 4IJJA 4ULVA 4ANJA 3EGXB 4FAPB 3S84A 2W45A 5B3IA 1VK5A 4EKWA 2B0JA 3T6BA 1HMDA 4CS9A 2NG1A 3DXJF 4LDRA 4I1OB 5JRAA 2VCAA 3H2UA 3EGDA 1KU2A 2TMVP 2YLDA 4UDVA 5JS5A 1M2VB 2OG2A 3S0XA 3BEHA 1EA8A 5BUOA 4DXWA 5JSLA 3RF3A 4M63A 2KJGA 3VAYA 5AGFA 1RKCA 5BQHA 3LEVA 2HV7A 3U5SA 1E84A 1CGME 4O6YA 4XEVA 3N24A 2HV6A 2L7AA 3LJBA 3ZG1A 2XLVA 1LKXA 3NMKA 5KYYB 2J9WA 1CGNA 3IPMO 3UR3C 3IEEA 4EBBA 2HS5A 2VH3A 1M57C 5COGA 4YL3A 4EBJA 3GEHA 2Y3DA 2G3VA 5HV9A 3RW0A 2LIGA 1A7VA 4XQ1A 1AVOB 3O55A 1LE2A 1G8XA 3LNMB 5A6KA 1RMVA 4XPYA 3DAFA 2EILC 4NTBA 3ZTZA 2KK1A 2WB7A 4DVYP 2PBEA 3JYYA 3M4CA 1XZQA 3PCVA 1WWPA 2CGEA 1H7IA 4FX5A 2YRFA 1D0XA 4G0HA 3ECSA 1OQCA 2QUPA 3U3FA 2L9JA 3ZC4A 2YLGA 3LS0A 3TULA 1J8MF 1ORSC 5JLIA 2MHRA 2HFIA 4A4AA 2HMZA 3GWNA 1RCPA 3OWTA 4AL0A 4DRIB 3NMJA 1YAUO 2RSEB 2YL7A 2L6GA 1Z5ZA 3U8VA 1LIHA 2LCHA 2Q9CA 3O39A 1YZAA 3RQEA 3W8HA 2HSQA 1C03A 1JAFA 4HFKB 3SEOA 3FHDA 2XLMA 3EFOB 4CIPA 3M1CB 2CDQA 5E3CA 2XM4A 3GODA 4KC9A 3ABMC 2FAPB 2EPLX 3DM5A 1D1CA 5KYUB 1E2XA 1OR3A 2CCYA 2LP4A 5L0GA 4CS9C 5KYXA 3K33A 5KYWB 2L6FA 3ASNC 3B29A 3TK0A 4OIPF 2GDCA 4YT2A 3LUTB 1N1CA 3DJNB 3MX3A 3UMKA 5B1BC 2NUPB 4XPXA 2R7UA 1G4US 5DS4A 4YK5A 5T3TA 2IXNA 2R7RA 1OR2A 4DBQA 1O3UA 2HJ3A 1QPUA 1ST6A 3LLKA 1R4TA 2WZGA 3C62A 2AVKA 4YL0A 1JOGA 4D4NA 2M64A 3T4RA 3QW0A 3SP1A 3C63A 4U5BE 3WHNA 4C7OA 1T6QA 3DM9B 2IBFA 4E7SA 3ZTMA 2D4UA 3CEXA 4JURI 1NSGB 1EQ1A 3J06A 3DWWA 1Z6AA 1SYQA 1V74B 3AG4C 1L7CA 2WZLA 3IQ5A 5COMA 3TOLA 3W2VA 4E0IA 4MW3A 3B0PA 2IM8A 3C8GB 2L6HA 1G5ZA 1BR2A 1UFBA 4CX9A 2DI3A 2LD6A 4IGGA 3QZCA 1A0BA 3U3BA 4JEBA 2R7SA 3TJ5A 2D5RB 1SZIA 1PD1A 1ZHWA 2IXPA 2DYRC 2NUTB 3EHNA 2H8AA 1IW7F 3QVYA 3S29A 1LI5A 2P0NA 1LI7A 2QTVA 1L3PA 2XLWA 3AGTA 4JCHA 2XL6A 2Y3HA 3LESA 2KC3A 2MWQA 1OCRC 2A0BA 1D1BA 1APCA 3Q7GA 5COFA 3AQCA 3EQLF 1YYJA 3OA1A 2YWAA 3RVZA 2Y39A 2XM0A 1T6IA 1Q0GA 1ORJA 4PK4A 4QI0A 3JSEO 4PR9A 4DRHB 3KH2A 2MYSA 2P61A 2Q3TA 2QLAA 4LACB 4MVSA 3RFYA 4AX2A 4CJGA 4N6HA 3JRMO 4AE4A 2PNOA 1BDJB 2ZD9A 2XRHA 4EHPA 4E7ZA 3W8IA 3V7OA 3SXYA 5DQZA 3O6XA 3CAXA 4JVSA 3RQGA 1MMAA 4JTCB 2PX0A 4O7GA 4U5FE 2YQYA 4J7YA 4RBNA 1KNYA 3X1OA 1AUEA 4DOZA 4WJ0A 4CDAA 4N4WA 3FXHA 3MFNA 5CIVA 4JC7A 5DS6A 1RJ9A 2OJQA 4YN0B 2C04A 4B6IA 4I1MA 5JT4A 4XWJA 3B71A 3ABKC 2J7PD 2EIJC 2KW3C 4IRUA 4U9DA 1LVKA 3VYWA 2OQMA 3EGDB 4E0HA 3RH3A 2YL1A 3C7JA 4J7TA 4MTFA 4Z9IA 3LAYA 1TWAA 3G4ZA 3SZRA 2QNLA 3ZDLA 3V5YA 2YL3A 1OKKA 2NSFA 1TWCA 3EH2A 2OKUA 3FVYA 4OIRF 1D0ZA 5L0HA 5L0FA 3NYMA 1TWGA 2NPUA 4JZAA 2HKVA 2LK4A 3T9OA 3TJ6A 3WODF 2R7XA 1SR2A 3T6JA 1VYIA 2GA0A 1EKYA 1K04A 5A6AA 4Q5SF 1BR1A 1LS4A 2IXMA 3L1MA 4MTGA 2R7QA 5JP7A 4KI2A 1FTSA 3SXZA 4QDLA 1JRAA 4FWVA 2BE5F 2AP3A 4HEAJ 3A11A 2HSBA 3DI5A 4A2NB 1TR2A 2BL2A 1FMWA 5D92A 3GM1A 2V26A 3W2WA 1I4ZA 4W8PA 4DRJB 4OINF 4DBRA 1GGQA 2OEVA 4ZLDA 3ZWIA 2A6HF 4IB4A 4F4BA 4CIHA 2XLOA 4NCQA 4MVUA 3KPHA 3SXKA 3GEEA 4P6IC 4H54A 5F28E 2G3KA 3Q6MA 1BZ4A 2A1DD 1VOMA 3JTLO 1ZZPA 5CI9A 2Q00A 1OXKA 2O9XA 4IAQA 3B9QA 4JEAA 3LEOA 4KNVA 3UNGC 3WAQA 1Q0MA 3POVA 3S9OA 2XL4A 4NC3A 3OEOA 2GAQA 2J9UA 3VF0A 4YT4A 4MQ9F 3K1IC 2CYDA 2P7VA 1VTMP 2XLDA 1H9GA 5KYNA 3JCUQ 3GM3A 3ZQYA 3Q7LA 1AEPA 4JRZA 3RVYA 1BBHA 1R5ID 3BRJA 1T01A 1E83A 1YA7O 2J0XA 3K7DA 3EPVA 5E2QA 2BC5A 2PP4A 3HTKC 5KYXB 1XZPA 2J7PA 3MYFA 1T6UA 3FOPA 1MNEA 3KL4A 2YVKA 3E9VA 3GANA 2ZPAA 3EJNA 2AWYA 4IWBA 3B0UX 4QI2A 2J9VA 5T1DB 3S27A 4U5HA 1OXBA 1ZYRF 3LS1A 3G50A 4U5CE 5L0JA 3EZHA 1HE1A 1V4AA 5HSWA 1GS9A 3O10A 3HJCA 3N0TA 4K0DA 4WGZA 2W4MA 4Z9HA 1Z23A 4BEJA 3A9CA 3AG3C 4FESA 4AK9A 1JR8A 2R02A 1W2WA 1NFNA 3I5PA 4HFFB 5FZTA 4C7OB 2QE9A 2XS8A 2OJED 1CPRA 4C3DA 4JW1A 4JTAB 2ZXPA 5FCLA 5T3WA 1RKEA 2KSFA 3HLZA 1OCCC 3AGUA 1QZXA 1TFOB 1VLSA 4HE8D 3ASOC 1WN0A 3NKEA 1HMOA 2H7OA 4CS8A 1JMWA 2FFHA 2XXAA 2ZXRA 1JPJA 1Y4CA 5IY5C 3RKOF 1CGOA 4PACA 3L8JA 4NY3A 1ZHZA 4WABA 1O5HA 1HE9A 5AC5A 4NQFA 1IZMA 1Z3IX 1PCXA 4YT5A 2PX3A 3GORA 3HNJA 3I4UA 5B3SC 1PV3A 3C18A 2LFDA 1ZHTA 2WVNA 5EHHA 2LQGA 4RDAA 1CPQA 1MMDA 4W8KA 3TD7A 4JKVA 4MTOA 4EBKA 1TQGA 3MYIA 4O79A 2F22A 4OD5A 1VB5A 4K1OA 2L81A 3I5QA 4L6RA 5DVWA 5E33A 4D4XA 1V55C 2OOCA 2OU6A 4R32A 2A69F 1QQ3A 1ZU4A 3NMIA 2V3CC 3NYLA 4ER9A 2DB4A 3F47A 4LERA 2J8WA 2J0WA 4YWQA 1ZVZA 2EPNA 5A6BD 3U9JA 1T5OA 2IXOA 4AE4B 1OW6A 1S05A 2G62A 3NKDA 4BJ6A 4E18A 5D91A 256BA 2HMQA 4JJGA 3AJMA 3L8IA 5F5FA 4NTAA 2YL0A 4J32B 5F5HA 3W4YA 3HNLA 3PHF2 5TJ5E 3IHUA 3K1IA 4CJOA 3UMIA 3FDQA 2W4BA 1WOLA 3VM6A 1WATA 4BJTA 3HNKA 3HKKA 2Y69C 3CSKA 3EH1A 3NDBB 1RJ9B 3KYJA 2R03A 4AL1A 2YKZA 3E70C 3K6BA 4OIQF 2R7TA 1O87A 4BEMJ 3ATPA 1ZHXA 4PFOA 1M2OA 2W9YA 1WGWA 2ZXWC 4P9FA 4WGYA 3ITFA 4E17A 3TOMA 1BR4A 3K66A 4CS8C 1MMGA 1YVIA 4CSAA 1D1AA 4GEHA 2J46A 2WVQA 3ZIBA 2KGOA 2UUIA 4ZLCA 1NBBA 2IOQA 1TKNA 2VC9A 3DZAA 1HW1A 4U9EA 1ORYA 2P1AA 3EG9A 3KKBA 4KBLA 1U0BB 1H9TA 1Q0DA 2WVOA 2DYSC 2VASA 3U9MA 1YA9A 3JRTA 4KNWA 4U5DE 1Q0FA 1NLXA 4I44A 4X0RA 3EGXA 3UGOA 1DOVA 1V54C 2R25A 3C8ZA 2R05A 5DLJA 3CQZA 1GQAA 1A7DA 4MVOA 4NTFA 2A68F 2C03A 5L0CA 2Q4FA 3EHMA 2A6EF 1T9KA 1M2VA 1A41A 1HY5A 4RD9A 3K1HA 4ULWA 2B0HA 3KMIA 5DQTA 4JE9A 3WG7C 2EINC 2H7VC 1OCOC 5JUAA 2KYHA 4BPMA 1F1MA 4H4KC 1YJGA 5CI8A 2GFHA 3V5ZA 5KYYA 1HW2A 1NZEA 3M79A 2VCCA 4K7BA 1QSPA 3U2MA 5A6BA 3SYNA 4U5GA 4CBEA 4CS7A 1DOWA 1SF8A 2YEVA 1TWHA 3IQTA 4JIOA 4BJ6C 1NFOA 3GWLA 4EUKB 1GM5A 3RIPA 2HZ8A 1QKRA 4EIYA 1PD0A 2EIMC 5A69A 3RQFA 2Q7RA 2YHSA 3N2ZB 5B1AC 1KTMA 1OW8A 5L0IA 4G7ZF 4XLPF 1EI7A 1I4YA 3C8GD 3QTHA 4XEFA 2Y3BA 2R7OA 2CNWD 2I8BA 1C17M 5JVEA 2R9RB 2R7WA 5A6JA 2X51A 3SXMA 4G78A 4YT8A 2WZFA 1NU9C 1U6HA 3JZ0A 4PJJA 2UUHA 1UG7A 1MQVA 4XPWA 3UGPA 4YJWA 1E86A 2XLEA 3FOOA 4PJLA 1FAPB 4BG0A 1MMNA 2VB6A 2ICWG 3F46A 1ZHYA 2PF4E 5AC4A 4I3MA 4LLEA 3S90A 4CSAC 3ZVRA 1K40A 4OD4A 1YZCA 3Q6NA 5K0IA 2XSEA 3H65A 3US6A 2EIKC 4U5EE 4OIOF 4MW8A 1MNDA 3DAGA 2FGYA
chains in the Genus database with same CATH topology
3NYJA 1NG1A 3EFOA 4G7OF 4BJ5C 4MNDA 5KYUA 2Q9AA 2IYLD 3JSZA 4O6MA 5KYWA 3EZIA 2NUPA 4O6NA 2XXAB 3L0IA 4Q4ZF 4C3EA 2H7BA 1D0YA 2P6VA 3MLGA 2LSEA 4J30B 3RYLA 3FAJA 1LS1A 1FFHA 2E87A 1VMAA 1SMYF 3DMDA 3UMHA 1FFTC 4EWCA 5EGYA 4IAOA 3ABLC 2JD3A 4XTKA 3S28A 4BJ1A 4C3BA 3SNHA 1OCZC 2YZSA 2R7VA 3PMRA 4DVZA 2Y3GA 1OKKD 2CNWA 3JYHA 4G7HF 1NU7D 1QLEC 2KNHA 1VYKA 4PFPA 2OCCC 2KQ9A 3QMKA 2NUTA 2QY9A 1S7ZA 2DGJA 4PJMA 3AQBA 1ZU5A 3B0VC 4JJFA 3ZSUA 3NRHA 2Z15A 4XLNF 3JT1A 4GYTA 3L34A 3AG1C 3DJUB 4N06A 2PFDA 4LLCA 1JPNA 5L3QA 2ZXOA 3LLIA 3CZ6A 3DD7A 3AG2C 1J8YF 5L3VA 3LNRA 2WL8A 1FMVA 3X2QC 2J45A 1Z63A 3EG9B 5DS5A 2M4EA 4Q7CA 2Q9BA 2CW0F 3NG1A 4BJ5A 4PJNA 1M56C 5E3AA 4ANJA 4IJJA 3EGXB 2W45A 1VK5A 2B0JA 3T6BA 4CS9A 2NG1A 3DXJF 4I1OB 3EGDA 1KU2A 1M2VB 2OG2A 3S0XA 5BUOA 4M63A 2KJGA 3VAYA 3LEVA 2HV7A 4O6YA 3N24A 2HV6A 3LJBA 3ZG1A 1LKXA 5KYYB 2J9WA 3UR3C 3IEEA 4EBBA 2VH3A 1M57C 2Y3DA 2G3VA 1G8XA 3DAFA 2EILC 2WB7A 4DVYP 2CGEA 4FX5A 4G0HA 1D0XA 3ECSA 3ZC4A 2L9JA 3LS0A 1J8MF 3OWTA 1Z5ZA 2Q9CA 3O39A 3W8HA 4HFKB 3SEOA 3FHDA 3EFOB 3M1CB 2CDQA 5E3CA 3GODA 4KC9A 3ABMC 3DM5A 1D1CA 5KYUB 5KYXA 4CS9C 3K33A 5KYWB 3ASNC 4OIPF 1N1CA 3DJNB 3MX3A 3UMKA 5B1BC 2NUPB 2R7UA 5DS4A 5T3TA 2IXNA 2R7RA 4DBQA 1ST6A 3LLKA 2WZGA 3T4RA 3SP1A 4U5BE 4C7OA 3DM9B 4E7SA 4JURI 1Z6AA 3AG4C 2WZLA 3W2VA 3B0PA 1BR2A 3QZCA 2R7SA 2D5RB 1SZIA 1PD1A 1ZHWA 2IXPA 2DYRC 2NUTB 3EHNA 1IW7F 3S29A 2QTVA 4JCHA 2Y3HA 3LESA 2MWQA 1OCRC 1D1BA 3Q7GA 3AQCA 3EQLF 3OA1A 2Y39A 4PK4A 4QI0A 3KH2A 2MYSA 2Q3TA 4LACB 3RFYA 4AX2A 4AE4A 2XRHA 4E7ZA 3W8IA 3V7OA 5DQZA 3O6XA 4JVSA 1MMAA 2PX0A 4O7GA 4U5FE 4RBNA 3X1OA 4DOZA 4WJ0A 5DS6A 1RJ9A 4B6IA 4YN0B 2C04A 4I1MA 4XWJA 3ABKC 2J7PD 2EIJC 2KW3C 4IRUA 3VYWA 1LVKA 3EGDB 3RH3A 3LAYA 1TWAA 3SZRA 1OKKA 1TWCA 3EH2A 3FVYA 4OIRF 1D0ZA 3NYMA 1TWGA 4JZAA 2R7XA 3WODF 3T6JA 1VYIA 4Q5SF 1BR1A 2IXMA 2R7QA 4KI2A 1FTSA 4QDLA 4FWVA 2BE5F 4HEAJ 4A2NB 1TR2A 1FMWA 5D92A 2V26A 3W2WA 4OINF 4ZLDA 2A6HF 4F4BA 4CIHA 4P6IC 2G3KA 3Q6MA 2A1DD 1VOMA 5CI9A 4DBRA 3UNGC 4YT2A 2O9XA 3UGPA 4KNVA 3B9QA 3POVA 2XL4A 3OEOA 2J9UA 4YT4A 4MQ9F 3K1IC 2P7VA 5KYNA 3JCUQ 3Q7LA 3K7DA 2J0XA 3EPVA 5E2QA 2PP4A 3HTKC 5KYXB 2J7PA 3KL4A 1MNEA 4IWBA 3E9VA 4QI2A 3GANA 2ZPAA 3EJNA 3B0UX 2J9VA 5T1DB 3S27A 4U5HA 3LS1A 1ZYRF 4U5CE 3EZHA 5HSWA 3HJCA 3N0TA 4K0DA 2W4MA 1Z23A 4BEJA 4AK9A 3AG3C 4FESA 1W2WA 3I5PA 4HFFB 4C7OB 4C3DA 4JW1A 5FCLA 2ZXPA 5T3WA 3HLZA 1OCCC 1QZXA 4HE8D 3ASOC 3NKEA 2H7OA 4CS8A 2FFHA 2XXAA 2ZXRA 1JPJA 5IY5C 3RKOF 4NY3A 1ZHZA 1O5HA 1IZMA 1Z3IX 1PCXA 4YT5A 2PX3A 3I4UA 5B3SC 1ZHTA 2WVNA 5EHHA 4RDAA 1MMDA 4W8KA 3TD7A 4O79A 4OD5A 2L81A 3I5QA 5DVWA 5E33A 1V55C 2A69F 1ZU4A 2V3CC 3NYLA 3F47A 4LERA 4YWQA 2J0WA 2IXOA 4AE4B 2G62A 3NKDA 4BJ6A 5D91A 4JJGA 5F5FA 4J32B 5F5HA 3PHF2 3FDQA 3UMIA 2W4BA 4BJTA 2Y69C 3CSKA 3EH1A 3NDBB 1RJ9B 3E70C 3K6BA 4OIQF 2R7TA 1O87A 4PFOA 1ZHXA 1M2OA 2W9YA 1WGWA 2ZXWC 3ITFA 1BR4A 3K66A 4CS8C 1MMGA 4CSAA 1D1AA 4GEHA 2J46A 2WVQA 3ZIBA 2KGOA 4ZLCA 2IOQA 1TKNA 3DZAA 3EG9A 3KKBA 4KBLA 2WVOA 2DYSC 2VASA 3JRTA 4KNWA 4U5DE 4I44A 4X0RA 3EGXA 3UGOA 1V54C 5DLJA 3CQZA 2A68F 2C03A 3EHMA 2A6EF 1M2VA 4RD9A 3K1HA 4ULWA 3KMIA 5DQTA 3WG7C 2EINC 2H7VC 1OCOC 4H4KC 5CI8A 5KYYA 2GFHA 1NZEA 4K7BA 3SYNA 4U5GA 4CBEA 4CS7A 1SF8A 2YEVA 1TWHA 4BJ6C 3RIPA 1PD0A 2EIMC 2YHSA 3N2ZB 5B1AC 4G7ZF 4XLPF 2Y3BA 2R7OA 2CNWD 2I8BA 2R7WA 2X51A 4YT8A 2WZFA 1NU9C 4PJJA 4YJWA 4PJLA 4BG0A 1MMNA 2VB6A 3F46A 1ZHYA 2PF4E 4CSAC 4I3MA 4LLEA 3ZVRA 4OD4A 3Q6NA 2XSEA 3H65A 2EIKC 4U5EE 4OIOF 1MNDA 3DAGA 2FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHF 2;  5T1D B; 
#chains in the Genus database with same CATH topology
 4JCZ A;  3NYJ A;  1NG1 A;  4LDK A;  5EK0 A;  3EFO A;  4G7O F;  2ASR A;  2I15 A;  4BJ5 C;  3U2L A;  3ZQV A;  4MVR A;  2RD9 A;  2XLH A;  3R2P A;  4IAR A;  4MND A;  1YLM A;  5KYU A;  1RKE B;  1VLT A;  2Q9A A;  1YAR O;  2IYL D;  3GM2 A;  3JSZ A;  4O6M A;  4CDV A;  2EPO A;  5KYW A;  1RXQ A;  3EZI A;  4JTD B;  2HJM A;  2NUP A;  1XWJ A;  4O6N A;  5BQI A;  2XXA B;  3L0I A;  4MVM A;  2X0C A;  2AU5 A;  2XS1 A;  3DKA A;  4Q4Z F;  1FR0 A;  2YLI A;  5L0D A;  3FAP B;  4CDY A;  4C3E A;  2H7B A;  1D0Y A;  2P6V A;  3M4B A;  3MLG A;  1Y6D A;  3PDM P;  2LSE A;  1YYX A;  4J30 B;  3RYL A;  3FAJ A;  1FFH A;  1LS1 A;  2E87 A;  4XEK A;  1VMA A;  1SMY F;  2JPU A;  2NSG A;  1FFT C;  3DMD A;  3UMH A;  3VRC A;  1TFK B;  4EWC A;  5EGY A;  4LDQ A;  4IAO A;  3R7C A;  3ABL C;  2JD3 A;  3G4X A;  4XTK A;  2XL8 A;  4MVQ A;  3S28 A;  4BJ1 A;  3SNH A;  1OCZ C;  4C3B A;  2YZS A;  2R7V A;  3PMR A;  1QVX A;  1LE4 A;  3IQ6 A;  4DVZ A;  1K05 A;  3C8G A;  1ZW2 A;  2HUJ A;  1LPE A;  2Y3G A;  2EPM X;  1OKK D;  2CNW A;  3JYH A;  1FNT c;  4G7H F;  3U8P A;  4P9T A;  1NU7 D;  1QLE C;  2KNH A;  3IQC A;  3V5X A;  1VYK A;  4PFP A;  2OCC C;  1E85 A;  2EPK X;  2KQ9 A;  3QMK A;  4Z9J A;  2NUT A;  2QY9 A;  1S7Z A;  2DGJ A;  1B68 A;  4PJM A;  3TQO A;  4GQH A;  2AWC A;  1ZW3 A;  3AQB A;  3QW1 A;  1ZU5 A;  3B0V C;  4JJF A;  3ZSU A;  3U0C A;  3NRH A;  5GPG B;  2Z15 A;  4XLN F;  2ETS A;  4ONS A;  2GWW A;  3DE8 A;  3MBG A;  1YDI A;  1C02 A;  3JT1 A;  3T6G B;  1WAS A;  4GYT A;  1LM3 B;  4MVZ A;  1I5N A;  3HNI A;  1WTY A;  1M6T A;  2JX0 A;  3L34 A;  3AG1 C;  3FMS A;  1OW7 A;  3GEI A;  3DJU B;  3KYI A;  3AOU A;  2PFD A;  4N06 A;  5BQG A;  4DJ9 A;  4LLC A;  1JPN A;  1Z7Q c;  5L3Q A;  2ZXO A;  1A7E A;  2J9B A;  3LLI A;  1U89 A;  3CZ6 A;  3DD7 A;  3AG2 C;  3QVZ A;  3DE9 A;  1J8Y F;  5L3V A;  3LNR A;  2A0U A;  2WL8 A;  1Q0K A;  1FMV A;  2VCB A;  3M15 A;  3X2Q C;  2J45 A;  4YL1 A;  2LFF A;  1Z63 A;  2OEX A;  3EG9 B;  2M4E A;  5DS5 A;  4Q7C A;  1G4W R;  1H6G A;  4MS2 A;  2Q9B A;  2CW0 F;  3NG1 A;  4BJ5 A;  3H2V A;  1M56 C;  4N6C A;  4PJN A;  5E3A A;  4IJJ A;  4ULV A;  4ANJ A;  3EGX B;  4FAP B;  3S84 A;  2W45 A;  5B3I A;  1VK5 A;  4EKW A;  2B0J A;  3T6B A;  1HMD A;  4CS9 A;  2NG1 A;  3DXJ F;  4LDR A;  4I1O B;  5JRA A;  2VCA A;  3H2U A;  3EGD A;  1KU2 A;  2TMV P;  2YLD A;  4UDV A;  5JS5 A;  1M2V B;  2OG2 A;  3S0X A;  3BEH A;  1EA8 A;  5BUO A;  4DXW A;  5JSL A;  3RF3 A;  4M63 A;  2KJG A;  3VAY A;  5AGF A;  1RKC A;  5BQH A;  3LEV A;  2HV7 A;  3U5S A;  1E84 A;  1CGM E;  4O6Y A;  4XEV A;  3N24 A;  2HV6 A;  2L7A A;  3LJB A;  3ZG1 A;  2XLV A;  1LKX A;  3NMK A;  5KYY B;  2J9W A;  1CGN A;  3IPM O;  3UR3 C;  3IEE A;  4EBB A;  2HS5 A;  2VH3 A;  1M57 C;  5COG A;  4YL3 A;  4EBJ A;  3GEH A;  2Y3D A;  2G3V A;  5HV9 A;  3RW0 A;  2LIG A;  1A7V A;  4XQ1 A;  1AVO B;  3O55 A;  1LE2 A;  1G8X A;  3LNM B;  5A6K A;  1RMV A;  4XPY A;  3DAF A;  2EIL C;  4NTB A;  3ZTZ A;  2KK1 A;  2WB7 A;  4DVY P;  2PBE A;  3JYY A;  3M4C A;  1XZQ A;  3PCV A;  1WWP A;  2CGE A;  1H7I A;  4FX5 A;  2YRF A;  1D0X A;  4G0H A;  3ECS A;  1OQC A;  2QUP A;  3U3F A;  2L9J A;  3ZC4 A;  2YLG A;  3LS0 A;  3TUL A;  1J8M F;  1ORS C;  5JLI A;  2MHR A;  2HFI A;  4A4A A;  2HMZ A;  3GWN A;  1RCP A;  3OWT A;  4AL0 A;  4DRI B;  3NMJ A;  1YAU O;  2RSE B;  2YL7 A;  2L6G A;  1Z5Z A;  3U8V A;  1LIH A;  2LCH A;  2Q9C A;  3O39 A;  1YZA A;  3RQE A;  3W8H A;  2HSQ A;  1C03 A;  1JAF A;  4HFK B;  3SEO A;  3FHD A;  2XLM A;  3EFO B;  4CIP A;  3M1C B;  2CDQ A;  5E3C A;  2XM4 A;  3GOD A;  4KC9 A;  3ABM C;  2FAP B;  2EPL X;  3DM5 A;  1D1C A;  5KYU B;  1E2X A;  1OR3 A;  2CCY A;  2LP4 A;  5L0G A;  4CS9 C;  5KYX A;  3K33 A;  5KYW B;  2L6F A;  3ASN C;  3B29 A;  3TK0 A;  4OIP F;  2GDC A;  4YT2 A;  3LUT B;  1N1C A;  3DJN B;  3MX3 A;  3UMK A;  5B1B C;  2NUP B;  4XPX A;  2R7U A;  1G4U S;  5DS4 A;  4YK5 A;  5T3T A;  2IXN A;  2R7R A;  1OR2 A;  4DBQ A;  1O3U A;  2HJ3 A;  1QPU A;  1ST6 A;  3LLK A;  1R4T A;  2WZG A;  3C62 A;  2AVK A;  4YL0 A;  1JOG A;  4D4N A;  2M64 A;  3T4R A;  3QW0 A;  3SP1 A;  3C63 A;  4U5B E;  3WHN A;  4C7O A;  1T6Q A;  3DM9 B;  2IBF A;  4E7S A;  3ZTM A;  2D4U A;  3CEX A;  4JUR I;  1NSG B;  1EQ1 A;  3J06 A;  3DWW A;  1Z6A A;  1SYQ A;  1V74 B;  3AG4 C;  1L7C A;  2WZL A;  3IQ5 A;  5COM A;  3TOL A;  3W2V A;  4E0I A;  4MW3 A;  3B0P A;  2IM8 A;  3C8G B;  2L6H A;  1G5Z A;  1BR2 A;  1UFB A;  4CX9 A;  2DI3 A;  2LD6 A;  4IGG A;  3QZC A;  1A0B A;  3U3B A;  4JEB A;  2R7S A;  3TJ5 A;  2D5R B;  1SZI A;  1PD1 A;  1ZHW A;  2IXP A;  2DYR C;  2NUT B;  3EHN A;  2H8A A;  1IW7 F;  3QVY A;  3S29 A;  1LI5 A;  2P0N A;  1LI7 A;  2QTV A;  1L3P A;  2XLW A;  3AGT A;  4JCH A;  2XL6 A;  2Y3H A;  3LES A;  2KC3 A;  2MWQ A;  1OCR C;  2A0B A;  1D1B A;  1APC A;  3Q7G A;  5COF A;  3AQC A;  3EQL F;  1YYJ A;  3OA1 A;  2YWA A;  3RVZ A;  2Y39 A;  2XM0 A;  1T6I A;  1Q0G A;  1ORJ A;  4PK4 A;  4QI0 A;  3JSE O;  4PR9 A;  4DRH B;  3KH2 A;  2MYS A;  2P61 A;  2Q3T A;  2QLA A;  4LAC B;  4MVS A;  3RFY A;  4AX2 A;  4CJG A;  4N6H A;  3JRM O;  4AE4 A;  2PNO A;  1BDJ B;  2ZD9 A;  2XRH A;  4EHP A;  4E7Z A;  3W8I A;  3V7O A;  3SXY A;  5DQZ A;  3O6X A;  3CAX A;  4JVS A;  3RQG A;  1MMA A;  4JTC B;  2PX0 A;  4O7G A;  4U5F E;  2YQY A;  4J7Y A;  4RBN A;  1KNY A;  3X1O A;  1AUE A;  4DOZ A;  4WJ0 A;  4CDA A;  4N4W A;  3FXH A;  3MFN A;  5CIV A;  4JC7 A;  5DS6 A;  1RJ9 A;  2OJQ A;  4YN0 B;  2C04 A;  4B6I A;  4I1M A;  5JT4 A;  4XWJ A;  3B71 A;  3ABK C;  2J7P D;  2EIJ C;  2KW3 C;  4IRU A;  4U9D A;  1LVK A;  3VYW A;  2OQM A;  3EGD B;  4E0H A;  3RH3 A;  2YL1 A;  3C7J A;  4J7T A;  4MTF A;  4Z9I A;  3LAY A;  1TWA A;  3G4Z A;  3SZR A;  2QNL A;  3ZDL A;  3V5Y A;  2YL3 A;  1OKK A;  2NSF A;  1TWC A;  3EH2 A;  2OKU A;  3FVY A;  4OIR F;  1D0Z A;  5L0H A;  5L0F A;  3NYM A;  1TWG A;  2NPU A;  4JZA A;  2HKV A;  2LK4 A;  3T9O A;  3TJ6 A;  3WOD F;  2R7X A;  1SR2 A;  3T6J A;  1VYI A;  2GA0 A;  1EKY A;  1K04 A;  5A6A A;  4Q5S F;  1BR1 A;  1LS4 A;  2IXM A;  3L1M A;  4MTG A;  2R7Q A;  5JP7 A;  4KI2 A;  1FTS A;  3SXZ A;  4QDL A;  1JRA A;  4FWV A;  2BE5 F;  2AP3 A;  4HEA J;  3A11 A;  2HSB A;  3DI5 A;  4A2N B;  1TR2 A;  2BL2 A;  1FMW A;  5D92 A;  3GM1 A;  2V26 A;  3W2W A;  1I4Z A;  4W8P A;  4DRJ B;  4OIN F;  4DBR A;  1GGQ A;  2OEV A;  4ZLD A;  3ZWI A;  2A6H F;  4IB4 A;  4F4B A;  4CIH A;  2XLO A;  4NCQ A;  4MVU A;  3KPH A;  3SXK A;  3GEE A;  4P6I C;  4H54 A;  5F28 E;  2G3K A;  3Q6M A;  1BZ4 A;  2A1D D;  1VOM A;  3JTL O;  1ZZP A;  5CI9 A;  2Q00 A;  1OXK A;  2O9X A;  4IAQ A;  3B9Q A;  4JEA A;  3LEO A;  4KNV A;  3UNG C;  3WAQ A;  1Q0M A;  3POV A;  3S9O A;  2XL4 A;  4NC3 A;  3OEO A;  2GAQ A;  2J9U A;  3VF0 A;  4YT4 A;  4MQ9 F;  3K1I C;  2CYD A;  2P7V A;  1VTM P;  2XLD A;  1H9G A;  5KYN A;  3JCU Q;  3GM3 A;  3ZQY A;  3Q7L A;  1AEP A;  4JRZ A;  3RVY A;  1BBH A;  1R5I D;  3BRJ A;  1T01 A;  1E83 A;  1YA7 O;  2J0X A;  3K7D A;  3EPV A;  5E2Q A;  2BC5 A;  2PP4 A;  3HTK C;  5KYX B;  1XZP A;  2J7P A;  3MYF A;  1T6U A;  3FOP A;  1MNE A;  3KL4 A;  2YVK A;  3E9V A;  3GAN A;  2ZPA A;  3EJN A;  2AWY A;  4IWB A;  3B0U X;  4QI2 A;  2J9V A;  5T1D B;  3S27 A;  4U5H A;  1OXB A;  1ZYR F;  3LS1 A;  3G50 A;  4U5C E;  5L0J A;  3EZH A;  1HE1 A;  1V4A A;  5HSW A;  1GS9 A;  3O10 A;  3HJC A;  3N0T A;  4K0D A;  4WGZ A;  2W4M A;  4Z9H A;  1Z23 A;  4BEJ A;  3A9C A;  3AG3 C;  4FES A;  4AK9 A;  1JR8 A;  2R02 A;  1W2W A;  1NFN A;  3I5P A;  4HFF B;  5FZT A;  4C7O B;  2QE9 A;  2XS8 A;  2OJE D;  1CPR A;  4C3D A;  4JW1 A;  4JTA B;  2ZXP A;  5FCL A;  5T3W A;  1RKE A;  2KSF A;  3HLZ A;  1OCC C;  3AGU A;  1QZX A;  1TFO B;  1VLS A;  4HE8 D;  3ASO C;  1WN0 A;  3NKE A;  1HMO A;  2H7O A;  4CS8 A;  1JMW A;  2FFH A;  2XXA A;  2ZXR A;  1JPJ A;  1Y4C A;  5IY5 C;  3RKO F;  1CGO A;  4PAC A;  3L8J A;  4NY3 A;  1ZHZ A;  4WAB A;  1O5H A;  1HE9 A;  5AC5 A;  4NQF A;  1IZM A;  1Z3I X;  1PCX A;  4YT5 A;  2PX3 A;  3GOR A;  3HNJ A;  3I4U A;  5B3S C;  1PV3 A;  3C18 A;  2LFD A;  1ZHT A;  2WVN A;  5EHH A;  2LQG A;  4RDA A;  1CPQ A;  1MMD A;  4W8K A;  3TD7 A;  4JKV A;  4MTO A;  4EBK A;  1TQG A;  3MYI A;  4O79 A;  2F22 A;  4OD5 A;  1VB5 A;  4K1O A;  2L81 A;  3I5Q A;  4L6R A;  5DVW A;  5E33 A;  4D4X A;  1V55 C;  2OOC A;  2OU6 A;  4R32 A;  2A69 F;  1QQ3 A;  1ZU4 A;  3NMI A;  2V3C C;  3NYL A;  4ER9 A;  2DB4 A;  3F47 A;  4LER A;  2J8W A;  2J0W A;  4YWQ A;  1ZVZ A;  2EPN A;  5A6B D;  3U9J A;  1T5O A;  2IXO A;  4AE4 B;  1OW6 A;  1S05 A;  2G62 A;  3NKD A;  4BJ6 A;  4E18 A;  5D91 A;  256B A;  2HMQ A;  4JJG A;  3AJM A;  3L8I A;  5F5F A;  4NTA A;  2YL0 A;  4J32 B;  5F5H A;  3W4Y A;  3HNL A;  3PHF 2;  5TJ5 E;  3IHU A;  3K1I A;  4CJO A;  3UMI A;  3FDQ A;  2W4B A;  1WOL A;  3VM6 A;  1WAT A;  4BJT A;  3HNK A;  3HKK A;  2Y69 C;  3CSK A;  3EH1 A;  3NDB B;  1RJ9 B;  3KYJ A;  2R03 A;  4AL1 A;  2YKZ A;  3E70 C;  3K6B A;  4OIQ F;  2R7T A;  1O87 A;  4BEM J;  3ATP A;  1ZHX A;  4PFO A;  1M2O A;  2W9Y A;  1WGW A;  2ZXW C;  4P9F A;  4WGY A;  3ITF A;  4E17 A;  3TOM A;  1BR4 A;  3K66 A;  4CS8 C;  1MMG A;  1YVI A;  4CSA A;  1D1A A;  4GEH A;  2J46 A;  2WVQ A;  3ZIB A;  2KGO A;  2UUI A;  4ZLC A;  1NBB A;  2IOQ A;  1TKN A;  2VC9 A;  3DZA A;  1HW1 A;  4U9E A;  1ORY A;  2P1A A;  3EG9 A;  3KKB A;  4KBL A;  1U0B B;  1H9T A;  1Q0D A;  2WVO A;  2DYS C;  2VAS A;  3U9M A;  1YA9 A;  3JRT A;  4KNW A;  4U5D E;  1Q0F A;  1NLX A;  4I44 A;  4X0R A;  3EGX A;  3UGO A;  1DOV A;  1V54 C;  2R25 A;  3C8Z A;  2R05 A;  5DLJ A;  3CQZ A;  1GQA A;  1A7D A;  4MVO A;  4NTF A;  2A68 F;  2C03 A;  5L0C A;  2Q4F A;  3EHM A;  2A6E F;  1T9K A;  1M2V A;  1A41 A;  1HY5 A;  4RD9 A;  3K1H A;  4ULW A;  2B0H A;  3KMI A;  5DQT A;  4JE9 A;  3WG7 C;  2EIN C;  2H7V C;  1OCO C;  5JUA A;  2KYH A;  4BPM A;  1F1M A;  4H4K C;  1YJG A;  5CI8 A;  2GFH A;  3V5Z A;  5KYY A;  1HW2 A;  1NZE A;  3M79 A;  2VCC A;  4K7B A;  1QSP A;  3U2M A;  5A6B A;  3SYN A;  4U5G A;  4CBE A;  4CS7 A;  1DOW A;  1SF8 A;  2YEV A;  1TWH A;  3IQT A;  4JIO A;  4BJ6 C;  1NFO A;  3GWL A;  4EUK B;  1GM5 A;  3RIP A;  2HZ8 A;  1QKR A;  4EIY A;  1PD0 A;  2EIM C;  5A69 A;  3RQF A;  2Q7R A;  2YHS A;  3N2Z B;  5B1A C;  1KTM A;  1OW8 A;  5L0I A;  4G7Z F;  4XLP F;  1EI7 A;  1I4Y A;  3C8G D;  3QTH A;  4XEF A;  2Y3B A;  2R7O A;  2CNW D;  2I8B A;  1C17 M;  5JVE A;  2R9R B;  2R7W A;  5A6J A;  2X51 A;  3SXM A;  4G78 A;  4YT8 A;  2WZF A;  1NU9 C;  1U6H A;  3JZ0 A;  4PJJ A;  2UUH A;  1UG7 A;  1MQV A;  4XPW A;  3UGP A;  4YJW A;  1E86 A;  2XLE A;  3FOO A;  4PJL A;  1FAP B;  4BG0 A;  1MMN A;  2VB6 A;  2ICW G;  3F46 A;  1ZHY A;  2PF4 E;  5AC4 A;  4I3M A;  4LLE A;  3S90 A;  4CSA C;  3ZVR A;  1K40 A;  4OD4 A;  1YZC A;  3Q6N A;  5K0I A;  2XSE A;  3H65 A;  3US6 A;  2EIK C;  4U5E E;  4OIO F;  4MW8 A;  1MND A;  3DAG A;  2FGY A; 
#chains in the Genus database with same CATH homology
 3NYJ A;  1NG1 A;  3EFO A;  4G7O F;  4BJ5 C;  4MND A;  5KYU A;  2Q9A A;  2IYL D;  3JSZ A;  4O6M A;  5KYW A;  3EZI A;  2NUP A;  4O6N A;  2XXA B;  3L0I A;  4Q4Z F;  4C3E A;  2H7B A;  1D0Y A;  2P6V A;  3MLG A;  2LSE A;  4J30 B;  3RYL A;  3FAJ A;  1LS1 A;  1FFH A;  2E87 A;  1VMA A;  1SMY F;  3DMD A;  3UMH A;  1FFT C;  4EWC A;  5EGY A;  4IAO A;  3ABL C;  2JD3 A;  4XTK A;  3S28 A;  4BJ1 A;  4C3B A;  3SNH A;  1OCZ C;  2YZS A;  2R7V A;  3PMR A;  4DVZ A;  2Y3G A;  1OKK D;  2CNW A;  3JYH A;  4G7H F;  1NU7 D;  1QLE C;  2KNH A;  1VYK A;  4PFP A;  2OCC C;  2KQ9 A;  3QMK A;  2NUT A;  2QY9 A;  1S7Z A;  2DGJ A;  4PJM A;  3AQB A;  1ZU5 A;  3B0V C;  4JJF A;  3ZSU A;  3NRH A;  2Z15 A;  4XLN F;  3JT1 A;  4GYT A;  3L34 A;  3AG1 C;  3DJU B;  4N06 A;  2PFD A;  4LLC A;  1JPN A;  5L3Q A;  2ZXO A;  3LLI A;  3CZ6 A;  3DD7 A;  3AG2 C;  1J8Y F;  5L3V A;  3LNR A;  2WL8 A;  1FMV A;  3X2Q C;  2J45 A;  1Z63 A;  3EG9 B;  5DS5 A;  2M4E A;  4Q7C A;  2Q9B A;  2CW0 F;  3NG1 A;  4BJ5 A;  4PJN A;  1M56 C;  5E3A A;  4ANJ A;  4IJJ A;  3EGX B;  2W45 A;  1VK5 A;  2B0J A;  3T6B A;  4CS9 A;  2NG1 A;  3DXJ F;  4I1O B;  3EGD A;  1KU2 A;  1M2V B;  2OG2 A;  3S0X A;  5BUO A;  4M63 A;  2KJG A;  3VAY A;  3LEV A;  2HV7 A;  4O6Y A;  3N24 A;  2HV6 A;  3LJB A;  3ZG1 A;  1LKX A;  5KYY B;  2J9W A;  3UR3 C;  3IEE A;  4EBB A;  2VH3 A;  1M57 C;  2Y3D A;  2G3V A;  1G8X A;  3DAF A;  2EIL C;  2WB7 A;  4DVY P;  2CGE A;  4FX5 A;  4G0H A;  1D0X A;  3ECS A;  3ZC4 A;  2L9J A;  3LS0 A;  1J8M F;  3OWT A;  1Z5Z A;  2Q9C A;  3O39 A;  3W8H A;  4HFK B;  3SEO A;  3FHD A;  3EFO B;  3M1C B;  2CDQ A;  5E3C A;  3GOD A;  4KC9 A;  3ABM C;  3DM5 A;  1D1C A;  5KYU B;  5KYX A;  4CS9 C;  3K33 A;  5KYW B;  3ASN C;  4OIP F;  1N1C A;  3DJN B;  3MX3 A;  3UMK A;  5B1B C;  2NUP B;  2R7U A;  5DS4 A;  5T3T A;  2IXN A;  2R7R A;  4DBQ A;  1ST6 A;  3LLK A;  2WZG A;  3T4R A;  3SP1 A;  4U5B E;  4C7O A;  3DM9 B;  4E7S A;  4JUR I;  1Z6A A;  3AG4 C;  2WZL A;  3W2V A;  3B0P A;  1BR2 A;  3QZC A;  2R7S A;  2D5R B;  1SZI A;  1PD1 A;  1ZHW A;  2IXP A;  2DYR C;  2NUT B;  3EHN A;  1IW7 F;  3S29 A;  2QTV A;  4JCH A;  2Y3H A;  3LES A;  2MWQ A;  1OCR C;  1D1B A;  3Q7G A;  3AQC A;  3EQL F;  3OA1 A;  2Y39 A;  4PK4 A;  4QI0 A;  3KH2 A;  2MYS A;  2Q3T A;  4LAC B;  3RFY A;  4AX2 A;  4AE4 A;  2XRH A;  4E7Z A;  3W8I A;  3V7O A;  5DQZ A;  3O6X A;  4JVS A;  1MMA A;  2PX0 A;  4O7G A;  4U5F E;  4RBN A;  3X1O A;  4DOZ A;  4WJ0 A;  5DS6 A;  1RJ9 A;  4B6I A;  4YN0 B;  2C04 A;  4I1M A;  4XWJ A;  3ABK C;  2J7P D;  2EIJ C;  2KW3 C;  4IRU A;  3VYW A;  1LVK A;  3EGD B;  3RH3 A;  3LAY A;  1TWA A;  3SZR A;  1OKK A;  1TWC A;  3EH2 A;  3FVY A;  4OIR F;  1D0Z A;  3NYM A;  1TWG A;  4JZA A;  2R7X A;  3WOD F;  3T6J A;  1VYI A;  4Q5S F;  1BR1 A;  2IXM A;  2R7Q A;  4KI2 A;  1FTS A;  4QDL A;  4FWV A;  2BE5 F;  4HEA J;  4A2N B;  1TR2 A;  1FMW A;  5D92 A;  2V26 A;  3W2W A;  4OIN F;  4ZLD A;  2A6H F;  4F4B A;  4CIH A;  4P6I C;  2G3K A;  3Q6M A;  2A1D D;  1VOM A;  5CI9 A;  4DBR A;  3UNG C;  4YT2 A;  2O9X A;  3UGP A;  4KNV A;  3B9Q A;  3POV A;  2XL4 A;  3OEO A;  2J9U A;  4YT4 A;  4MQ9 F;  3K1I C;  2P7V A;  5KYN A;  3JCU Q;  3Q7L A;  3K7D A;  2J0X A;  3EPV A;  5E2Q A;  2PP4 A;  3HTK C;  5KYX B;  2J7P A;  3KL4 A;  1MNE A;  4IWB A;  3E9V A;  4QI2 A;  3GAN A;  2ZPA A;  3EJN A;  3B0U X;  2J9V A;  5T1D B;  3S27 A;  4U5H A;  3LS1 A;  1ZYR F;  4U5C E;  3EZH A;  5HSW A;  3HJC A;  3N0T A;  4K0D A;  2W4M A;  1Z23 A;  4BEJ A;  4AK9 A;  3AG3 C;  4FES A;  1W2W A;  3I5P A;  4HFF B;  4C7O B;  4C3D A;  4JW1 A;  5FCL A;  2ZXP A;  5T3W A;  3HLZ A;  1OCC C;  1QZX A;  4HE8 D;  3ASO C;  3NKE A;  2H7O A;  4CS8 A;  2FFH A;  2XXA A;  2ZXR A;  1JPJ A;  5IY5 C;  3RKO F;  4NY3 A;  1ZHZ A;  1O5H A;  1IZM A;  1Z3I X;  1PCX A;  4YT5 A;  2PX3 A;  3I4U A;  5B3S C;  1ZHT A;  2WVN A;  5EHH A;  4RDA A;  1MMD A;  4W8K A;  3TD7 A;  4O79 A;  4OD5 A;  2L81 A;  3I5Q A;  5DVW A;  5E33 A;  1V55 C;  2A69 F;  1ZU4 A;  2V3C C;  3NYL A;  3F47 A;  4LER A;  4YWQ A;  2J0W A;  2IXO A;  4AE4 B;  2G62 A;  3NKD A;  4BJ6 A;  5D91 A;  4JJG A;  5F5F A;  4J32 B;  5F5H A;  3PHF 2;  3FDQ A;  3UMI A;  2W4B A;  4BJT A;  2Y69 C;  3CSK A;  3EH1 A;  3NDB B;  1RJ9 B;  3E70 C;  3K6B A;  4OIQ F;  2R7T A;  1O87 A;  4PFO A;  1ZHX A;  1M2O A;  2W9Y A;  1WGW A;  2ZXW C;  3ITF A;  1BR4 A;  3K66 A;  4CS8 C;  1MMG A;  4CSA A;  1D1A A;  4GEH A;  2J46 A;  2WVQ A;  3ZIB A;  2KGO A;  4ZLC A;  2IOQ A;  1TKN A;  3DZA A;  3EG9 A;  3KKB A;  4KBL A;  2WVO A;  2DYS C;  2VAS A;  3JRT A;  4KNW A;  4U5D E;  4I44 A;  4X0R A;  3EGX A;  3UGO A;  1V54 C;  5DLJ A;  3CQZ A;  2A68 F;  2C03 A;  3EHM A;  2A6E F;  1M2V A;  4RD9 A;  3K1H A;  4ULW A;  3KMI A;  5DQT A;  3WG7 C;  2EIN C;  2H7V C;  1OCO C;  4H4K C;  5CI8 A;  5KYY A;  2GFH A;  1NZE A;  4K7B A;  3SYN A;  4U5G A;  4CBE A;  4CS7 A;  1SF8 A;  2YEV A;  1TWH A;  4BJ6 C;  3RIP A;  1PD0 A;  2EIM C;  2YHS A;  3N2Z B;  5B1A C;  4G7Z F;  4XLP F;  2Y3B A;  2R7O A;  2CNW D;  2I8B A;  2R7W A;  2X51 A;  4YT8 A;  2WZF A;  1NU9 C;  4PJJ A;  4YJW A;  4PJL A;  4BG0 A;  1MMN A;  2VB6 A;  3F46 A;  1ZHY A;  2PF4 E;  4CSA C;  4I3M A;  4LLE A;  3ZVR A;  4OD4 A;  3Q6N A;  2XSE A;  3H65 A;  2EIK C;  4U5E E;  4OIO F;  1MND A;  3DAG A;  2FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...