5T1DB

Crystal structure of ebv ghgl/gp42/e1d1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
99
Chain Sequence
PCCHVTQLALENISDIYLVSNQTCDGFSLASLNSPNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Envelope glycoprotein H
publication title Structural basis for Epstein-Barr virus host cell tropism mediated by gp42 and gHgL entry glycoproteins.
pubmed doi rcsb
source organism Epstein-barr virus (strain b95-8)
total genus 14
structure length 99
sequence length 109
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11108 Phage_glycop_gL Viral glycoprotein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1580 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5t1dB00
3PHF2 5T1DB
chains in the Genus database with same CATH superfamily
5K0IA 2OG2A 1Z5ZA 5BQIA 2YQYA 4WABA 2OEXA 3K6BA 3AGUA 3PDMP 2TMVP 5HSWA 1TFOB 1A7DA 2VCAA 4XEVA 1OKKA 1Q0KA 2VCBA 3ABKC 2L81A 3K33A 3LLIA 1MMAA 3WAQA 4LACB 3L8IA 3HLZA 1ZHXA 4OINF 1RKEA 3NYMA 3U9JA 1YYJA 1JPNA 1OKKD 1AEPA 2Q3TA 3C8GA 2NUTB 4ANJA 4EWCA 1GM5A 3ASOC 4LERA 3NMIA 2AU5A 2OJED 5L0DA 2FFHA 4NC3A 5DQTA 4ER9A 5L0JA 1LIHA 1CPRA 4DRJB 5EGYA 1JAFA 4P9TA 2V26A 3CZ6A 1Z23A 1VMAA 4XPWA 1YLMA 4I3MA 2Q7RA 3VYWA 1HW2A 2KYHA 2XRHA 3GODA 3PMRA 4ULWA 2XL4A 1E84A 3DKAA 3K7DA 1TFKB 1LI7A 4WJ0A 2YLGA 5JUAA 4GYTA 4O6MA 3RVZA 2PNOA 3LNRA 4IAOA 2OEVA 2HMZA 2LFDA 1BR1A 2P7VA 5JP7A 3EG9A 2BL2A 1PD1A 4HFKB 4M63A 1WASA 2LSEA 3G50A 5TJ5E 2M4EA 4DVZA 4J32B 2GFHA 3N2ZB 3K1HA 3Q7LA 2XXAB 1V74B 5L0CA 3LNMB 4NQFA 4N6HA 2B0JA 4B6IA 4G7ZF 3GEIA 1TWGA 2HS5A 3IEEA 1BZ4A 1OQCA 2PX3A 2IYLD 1JMWA 3ZC4A 3TD7A 5DLJA 4PJMA 5KYWA 3QVZA 1Q0GA 4AX2A 1VYKA 2R25A 1T01A 4LLEA 4MW3A 3TJ6A 4HEAJ 3WODF 3S0XA 2XSEA 4QI2A 3DM5A 3C8ZA 2HJ3A 4PFPA 1GQAA 3ATPA 4N4WA 4JJGA 1G4WR 4NTBA 1M57C 4G78A 2YLDA 4U5DE 4JZAA 4XQ1A 2ICWG 1BR4A 2CYDA 3V5XA 3T6BA 2MWQA 1HMOA 4U5HA 4YT4A 3H2UA 2O9XA 2ETSA 3QVYA 4OD5A 2ZXWC 3Q6NA 1A41A 5JT4A 2D4UA 3EFOA 3DZAA 2ZXRA 3AG3C 4JEAA 1OR2A 2HV7A 4OD4A 3S29A 3DM9B 1CGNA 2NSGA 1OCRC 2Q4FA 4K0DA 2XS1A 4JTDB 3EHNA 1OW6A 1OW7A 5FCLA 3MYFA 4IARA 5CIVA 4P9FA 1TKNA 1IW7F 1APCA 4JW1A 4BG0A 1JR8A 2R7UA 3RQFA 1D1CA 1T6QA 4BEJA 2R02A 3ITFA 4KNWA 3LEVA 4JIOA 1MMDA 2A69F 3E70C 3VAYA 2CGEA 2QLAA 5JLIA 3IQ5A 2JD3A 1FAPB 4ONSA 1T9KA 1L7CA 1LKXA 1M2OA 3OWTA 3SEOA 2ZXOA 3FAPB 5COFA 3B0PA 3NRHA 1Z6AA 1LS4A 1YZCA 3US6A 3LS0A 2XL8A 2QUPA 2XM0A 3POVA 2DYSC 4DBRA 1M2VB 1OCZC 1FNTc 4MTGA 2HJMA 3EZIA 5KYNA 2R03A 1KU2A 1V55C 1AVOB 4Z9HA 4DBQA 3FHDA 3LESA 3U3BA 2OQMA 4H4KC 1HW1A 1T5OA 2R9RB 2A1DD 3L1MA 4W8KA 1I4YA 2EILC 3TJ5A 2DYRC 2X0CA 2HZ8A 3WG7C 2Y39A 3I5QA 4BJ6C 1CGOA 1E2XA 3IQCA 3U8VA 2NG1A 2AVKA 2GWWA 5COGA 4EKWA 3U5SA 2XL6A 5L0FA 3L8JA 1SYQA 1QPUA 4I1OB 2XLVA 4HE8D 1LVKA 3SXKA 4CIPA 4Q5SF 1XZPA 3S27A 3X2QC 1OR3A 3EHMA 3H65A 4WGZA 1NSGB 2YL0A 3G4ZA 1QSPA 1YDIA 2WZFA 3NYLA 5BQGA 3SP1A 4CBEA 3C62A 4OIPF 2R7XA 1KTMA 5IY5C 1I4ZA 1RJ9A 4BJTA 3UMHA 2P1AA 3EJNA 3R7CA 4XWJA 2QNLA 3CSKA 256BA 1ORJA 1A7EA 2VB6A 2J9UA 4JE9A 1BDJB 3JYYA 4N6CA 1WATA 1K04A 5A69A 3AGTA 4JKVA 2HV6A 2Y3HA 3X1OA 2YLIA 2NUPA 4JCHA 2FAPB 2LCHA 3HTKC 4YL1A 5D92A 3V7OA 1TR2A 1QLEC 1YA9A 1TWCA 2D5RB 2PBEA 1PCXA 3NDBB 2W45A 4MTOA 2LP4A 5A6JA 1VB5A 3W8IA 1H7IA 2HSQA 2JPUA 1BR2A 1EI7A 2VASA 2R7VA 1O3UA 2J46A 3DE9A 4CS7A 2A6HF 1LM3B 2YL3A 3EGDA 4R32A 1OXKA 2LD6A 2EIKC 2DI3A 2R7OA 3C8GD 4P6IC 2EIJC 5CI9A 1VK5A 1EKYA 3EQLF 4FESA 4NCQA 1D0XA 1QKRA 4JTCB 3JT1A 4O6YA 2NPUA 1ZW2A 3KL4A 1H6GA 2G3KA 4A2NB 1KNYA 1YVIA 4K7BA 3DD7A 4NTFA 1TWHA 4CSAA 1FMWA 2W9YA 5T3WA 1FFTC 3LJBA 2WB7A 1ORYA 3SNHA 4C3DA 2KC3A 3ZTMA 3JRMO 3K66A 5L0GA 1YAUO 2VCCA 3KMIA 1U0BB 1GS9A 2LFFA 4MVOA 2L7AA 3FAJA 2VH3A 4U5CE 2XLEA 1RKEB 4QI0A 2EINC 5E3CA 3B71A 4IGGA 1LE4A 4YWQA 4C3EA 5B3SC 3C8GB 3B0UX 2CDQA 3F47A 3IHUA 3B9QA 3M1CB 2Z15A 3DE8A 2WVNA 2ZPAA 5BUOA 2EPLX 3AG1C 3T6GB 3JYHA 4AE4A 4YL0A 1FR0A 3EGXA 4ULVA 1CGME 1ZHZA 2J0WA 2YRFA 3JZ0A 3M4CA 2GA0A 4CS8A 2KQ9A 4CJGA 1NLXA 3R2PA 4IJJA 1D1AA 4DJ9A 4Q4ZF 2J9BA 2Y3DA 1JPJA 3C7JA 4W8PA 2HKVA 1MNEA 2ASRA 2OU6A 3I4UA 2ZXPA 3RVYA 1MQVA 5F5HA 4CS9A 2KNHA 5A6AA 3U0CA 5FZTA 1M56C 3FOOA 2Q9BA 4C3BA 1Q0DA 2PFDA 2R7QA 3LUTB 3NKEA 4PJNA 3UGPA 4MW8A 1OCCC 3VRCA 1SF8A 3DXJF 3QW1A 3SYNA 3EG9B 3Q6MA 4KNVA 3A9CA 4U9EA 5AGFA 1LPEA 2HUJA 3TK0A 2Q9AA 3DWWA 4BJ5A 4XPYA 5F28E 2G62A 1QQ3A 4YL3A 4OIRF 5DS5A 2MYSA 2G3VA 4JRZA 4JEBA 1NFNA 5T1DB 4FAPB 3B0VC 3DMDA 4PJLA 1OCOC 3BRJA 4J7YA 3TOLA 5KYWB 4D4XA 4U9DA 3S84A 1SZIA 2JX0A 4MNDA 4FWVA 3J06A 3M15A 4G7HF 1Z7Qc 2UUHA 2P6VA 3GM3A 4G7OF 2IXOA 1S7ZA 2QE9A 5COMA 1E85A 3LS1A 1DOWA 3ZTZA 5DS4A 3T6JA 4XEFA 2BC5A 3DJNB 4YK5A 4IAQA 3UGOA 3CEXA 1A0BA 3FXHA 3OEOA 3VM6A 1E83A 4KI2A 2RD9A 3HNIA 4E0IA 3U2MA 5DS6A 3KYJA 2C03A 3CQZA 1ZVZA 2VC9A 1BBHA 3TQOA 1Y4CA 5E3AA 1GGQA 2XLMA 1HE9A 3G4XA 3O39A 3CAXA 5HV9A 3DAGA 5L3QA 3EFOB 1L3PA 3NMKA 2AP3A 3W8HA 4CIHA 4XTKA 3SXYA 1M6TA 4JURI 4XPXA 3RKOF 2W4MA 4EBJA 1VOMA 3M79A 1AUEA 4E0HA 2YL1A 4I1MA 4XLNF 1RMVA 1HY5A 2A68F 1U6HA 4EUKB 1MMGA 5B1AC 3HNJA 3UMKA 4MVMA 4J30B 3MFNA 4U5EE 5BQHA 1B68A 4PJJA 1O5HA 2YWAA 3ECSA 3SXMA 1D1BA 1ZU4A 4PK4A 2H7OA 1ZYRF 4AL1A 2F22A 2R7RA 1RKCA 2AWYA 3AQCA 4RD9A 1YA7O 1WWPA 3KKBA 4MTFA 2L6HA 2XLHA 3LLKA 1C02A 4N06A 3RH3A 3FOPA 2XLDA 3C18A 2GDCA 4YN0B 2PX0A 3IPMO 2NUTA 1WOLA 2UUIA 2WVOA 3NG1A 3K1IA 4CX9A 1Y6DA 2QTVA 3LEOA 2IBFA 3QMKA 1QZXA 3L0IA 3O6XA 2M64A 3RYLA 1XZQA 3V5ZA 1LS1A 3KH2A 3GEEA 4EBBA 5L3VA 3IQ6A 3EZHA 3JSZA 2MHRA 5GPGB 4EHPA 2WVQA 4CDYA 1C03A 4C7OA 1JOGA 3S9OA 4I44A 3PCVA 1YARO 2Y69C 3E9VA 2CCYA 2I15A 4O7GA 3RW0A 3O10A 3M4BA 3MBGA 1MNDA 3U2LA 1PV3A 1G5ZA 5T3TA 1ZZPA 2H7VC 1FFHA 1HE1A 3UR3C 4O79A 3GWNA 3Q7GA 3DAFA 1DOVA 3UMIA 1RXQA 4HFFB 1FMVA 4CSAC 2FGYA 3MYIA 5EK0A 5KYYA 1RJ9B 4XEKA 3W2WA 4CDVA 4F4BA 5KYXA 4O6NA 2IXNA 1CPQA 5E33A 4AL0A 5AC4A 2A0BA 2KGOA 3B29A 1OW8A 3RQEA 1D0YA 3W4YA 4DXWA 2HMQA 5B3IA 3H2VA 3ASNC 2EPOA 3SZRA 3ZQYA 3NMJA 2P0NA 3JSEO 3KPHA 3HKKA 3ZVRA 2H8AA 3DJUB 4NTAA 1NBBA 3V5YA 3S90A 2YEVA 2NUPB 3SXZA 4LDKA 1TQGA 2R7TA 3PHF2 5F5FA 2E87A 2H7BA 2OOCA 2A6EF 2EPNA 3OA1A 5KYUA 1ORSC 1H9GA 5L0IA 3RIPA 3VF0A 4MVUA 1C17M 4C7OB 4RDAA 2KK1A 2LQGA 5EHHA 3MLGA 4MS2A 2YZSA 4JCZA 2R7WA 3L34A 2R7SA 3RQGA 4AK9A 3EGDB 4RBNA 2WZLA 1D0ZA 1FTSA 2IOQA 2WZGA 4CS8C 1S05A 3AOUA 3JRTA 4A4AA 1LE2A 5JRAA 1J8YF 1WN0A 2EIMC 2OJQA 5D91A 3JCUQ 4PFOA 2BE5F 4X0RA 4CS9C 4IB4A 1R5ID 3WHNA 3UNGC 2LIGA 2KJGA 4GEHA 3HNKA 4LDRA 5KYYB 2KSFA 5A6KA 2XS8A 2P61A 2EPKX 5KYXB 2CNWA 1F1MA 3T9OA 2AWCA 2W4BA 3A11A 3AQBA 2HSBA 2NSFA 3S28A 2A0UA 2B0HA 2WL8A 3ABLC 4K1OA 3RFYA 4BJ5C 5CI8A 1MMNA 2YKZA 3ZWIA 1E86A 2CNWD 2XLWA 1K40A 4MQ9F 1IZMA 1VLTA 4D4NA 2YHSA 4CJOA 4GQHA 4UDVA 2J7PA 1O87A 1PD0A 3QW0A 4JJFA 5KYUB 1EQ1A 4WGYA 5AC5A 4PR9A 5E2QA 3EH1A 1NU7D 1YJGA 1OXBA 1J8MF 1V4AA 2J7PD 1TWAA 2PP4A 3O55A 1NG1A 3FMSA 1M2VA 4MVZA 4PACA 2J9VA 4U5FE 3GORA 3ZDLA 1Z3IX 2L6FA 2L9JA 1LI5A 2DB4A 4MVQA 4Q7CA 4AE4B 4E18A 1I5NA 1NU9C 3EGXB 2CW0F 4KBLA 3U3FA 3W2VA 2YL7A 4Z9IA 4E7SA 3BEHA 4DRHB 1T6IA 5DVWA 3N24A 3NKDA 1R4TA 2XM4A 4BEMJ 1VYIA 2OKUA 3I5PA 4YJWA 3GM2A 1U89A 4LDQA 4DRIB 3ZIBA 1VTMP 5JS5A 1UFBA 2OCCC 4U5BE 4YT2A 3EPVA 4MVSA 4IWBA 3HJCA 3ZQVA 2J0XA 2J8WA 4YT5A 4BPMA 1RCPA 1HMDA 1YYXA 1ZU5A 2HFIA 2Q00A 2XXAA 2L6GA 1SR2A 3FVYA 5JVEA 2I8BA 3AG4C 4NY3A 3GEHA 3GWLA 3TOMA 2LK4A 3U8PA 3ZG1A 1Q0FA 2ZD9A 4YT8A 3EH2A 3NYJA 4IRUA 5A6BA 1QVXA 2IXPA 4DOZA 3RF3A 2YVKA 3FDQA 2QY9A 2V3CC 4L6RA 1YZAA 2R05A 4OIQF 1K05A 3T4RA 5A6BD 3N0TA 4U5GA 4XLPF 4DVYP 1G4US 1NZEA 3MX3A 5JSLA 1A7VA 1WGWA 4J7TA 2XLOA 5L0HA 1XWJA 4E17A 1G8XA 1Z63A 1ZHTA 4JVSA 4ZLCA 1JRAA 4H54A 1Q0MA 4QDLA 4FX5A 4KC9A 3LAYA 5DQZA 2C04A 2IXMA 1ZHWA 2GAQA 3F46A 3K1IC 3ABMC 3QTHA 3U9MA 3KYIA 2DGJA 3TULA 1VLSA 2J45A 3AG2C 4BJ1A 1H9TA 4BJ6A 4ZLDA 1ZW3A 2Q9CA 3AJMA 4JTAB 1ZHYA 2X51A 2RSEB 4OIOF 1T6UA 1WTYA 3HNLA 4LLCA 5B1BC 2KW3C 2Y3GA 3GANA 4G0HA 3GM1A 2PF4E 1NFOA 3QZCA 4E7ZA 4CDAA 4Z9JA 4EBKA 3IQTA 1W2WA 2IM8A 3JTLO 1SMYF 4JC7A 4MVRA 2EPMX 1ST6A 1EA8A 1V54C 2Y3BA 3C63A 3DI5A 2J9WA 3ZSUA 1UG7A 4EIYA 1N1CA
chains in the Genus database with same CATH topology
2OG2A 1Z5ZA 3K6BA 5HSWA 1OKKA 3LLIA 3K33A 3ABKC 2L81A 1MMAA 4LACB 3HLZA 1ZHXA 4OINF 3NYMA 1JPNA 1OKKD 2Q3TA 4EWCA 2NUTB 4ANJA 3ASOC 4LERA 2FFHA 5DQTA 5EGYA 2V26A 3CZ6A 1Z23A 1VMAA 4I3MA 3VYWA 2XRHA 3GODA 3PMRA 4ULWA 2XL4A 3K7DA 4WJ0A 4GYTA 4O6MA 4IAOA 3LNRA 2P7VA 1BR1A 3EG9A 1PD1A 4HFKB 4M63A 2LSEA 2M4EA 4DVZA 4J32B 2GFHA 3N2ZB 3K1HA 3Q7LA 2B0JA 4B6IA 4G7ZF 1TWGA 3IEEA 3ZC4A 2PX3A 5KYWA 2IYLD 3TD7A 5DLJA 4PJMA 4AX2A 1VYKA 3S0XA 4LLEA 4HEAJ 3WODF 4QI2A 2XSEA 3DM5A 4PFPA 4U5DE 4JJGA 1M57C 4JZAA 1BR4A 3T6BA 2MWQA 4U5HA 4YT4A 2O9XA 4OD5A 2ZXWC 3Q6NA 3EFOA 3DZAA 2ZXRA 3AG3C 4OD4A 2HV7A 3S29A 3DM9B 1OCRC 4K0DA 3EHNA 5FCLA 1TKNA 1IW7F 4JW1A 4BG0A 2R7UA 1D1CA 4BEJA 3ITFA 4KNWA 3LEVA 1MMDA 2A69F 3E70C 3VAYA 2CGEA 2JD3A 1LKXA 1M2OA 3OWTA 3SEOA 2ZXOA 3B0PA 3NRHA 1Z6AA 3LS0A 3POVA 2DYSC 4DBRA 1M2VB 1OCZC 3EZIA 5KYNA 1KU2A 1V55C 4DBQA 3FHDA 3LESA 4H4KC 2A1DD 4W8KA 2EILC 2DYRC 3WG7C 2Y39A 3I5QA 4BJ6C 2NG1A 4I1OB 4HE8D 1LVKA 4Q5SF 3S27A 3X2QC 3EHMA 3H65A 3NYLA 2XXAB 2WZFA 2R7XA 4CBEA 3SP1A 4OIPF 5IY5C 1RJ9A 4BJTA 3UMHA 3EJNA 4XWJA 3CSKA 2VB6A 2J9UA 2HV6A 2Y3HA 3X1OA 2NUPA 4JCHA 3V7OA 3HTKC 5D92A 1TR2A 1QLEC 1TWCA 2D5RB 1PCXA 3NDBB 2W45A 3W8IA 1BR2A 2VASA 2R7VA 2J46A 4CS7A 2A6HF 3EGDA 2EIKC 2R7OA 4P6IC 5CI9A 2EIJC 1VK5A 3EQLF 4FESA 1D0XA 3JT1A 4O6YA 3KL4A 2G3KA 4A2NB 4K7BA 3DD7A 1TWHA 4CSAA 1FMWA 2W9YA 5T3WA 1FFTC 3LJBA 2WB7A 3SNHA 4C3DA 3K66A 3KMIA 3FAJA 2VH3A 4U5CE 4QI0A 2EINC 5E3CA 4YWQA 5B3SC 4C3EA 3B0UX 2CDQA 3F47A 3B9QA 3M1CB 2Z15A 2WVNA 2ZPAA 5BUOA 3AG1C 4AE4A 3JYHA 3EGXA 1ZHZA 2J0WA 4CS8A 2KQ9A 4Q4ZF 4IJJA 1D1AA 2Y3DA 1JPJA 1MNEA 3I4UA 2ZXPA 5F5HA 4CS9A 2KNHA 1M56C 2Q9BA 4C3BA 2PFDA 2R7QA 3NKEA 4PJNA 3UGPA 1OCCC 1SF8A 3DXJF 3SYNA 3EG9B 3Q6MA 4KNVA 2Q9AA 4BJ5A 2G62A 5DS5A 4OIRF 2MYSA 2G3VA 5T1DB 3B0VC 3DMDA 4PJLA 1OCOC 5KYWB 1SZIA 4MNDA 4FWVA 4G7HF 2P6VA 4G7OF 2IXOA 1S7ZA 3LS1A 5DS4A 3T6JA 3DJNB 3UGOA 3OEOA 4KI2A 5DS6A 2C03A 3CQZA 5E3AA 3O39A 3DAGA 5L3QA 3EFOB 4CIHA 3W8HA 4XTKA 4JURI 3RKOF 2W4MA 1VOMA 4I1MA 4XLNF 2A68F 1MMGA 5B1AC 3UMKA 4U5EE 4J30B 4PJJA 1O5HA 3ECSA 1D1BA 1ZU4A 4PK4A 2H7OA 1ZYRF 2R7RA 3AQCA 4RD9A 3KKBA 3LLKA 4N06A 3RH3A 4YN0B 2PX0A 2NUTA 3NG1A 2WVOA 2QTVA 3QMKA 1QZXA 3L0IA 3O6XA 3RYLA 1LS1A 3KH2A 4EBBA 5L3VA 3EZHA 3JSZA 2WVQA 4C7OA 4I44A 2Y69C 3E9VA 4O7GA 1MNDA 5T3TA 2H7VC 1FFHA 3UR3C 4O79A 3Q7GA 3DAFA 3UMIA 4HFFB 1FMVA 4CSAC 2FGYA 5KYYA 1RJ9B 3W2WA 4F4BA 5KYXA 4O6NA 2IXNA 5E33A 2KGOA 1D0YA 3ASNC 3SZRA 3ZVRA 3DJUB 2YEVA 2NUPB 2R7TA 5F5FA 3PHF2 2E87A 2H7BA 2A6EF 3OA1A 5KYUA 3RIPA 4C7OB 4RDAA 5EHHA 3MLGA 2R7WA 2YZSA 3L34A 2R7SA 4AK9A 3EGDB 4RBNA 2WZLA 1D0ZA 1FTSA 2IOQA 2WZGA 4CS8C 3JRTA 1J8YF 2EIMC 5D91A 3JCUQ 4PFOA 2BE5F 4X0RA 4CS9C 3UNGC 2KJGA 4GEHA 5KYYB 5KYXB 2CNWA 2W4BA 3AQBA 3S28A 3ABLC 3RFYA 2WL8A 4BJ5C 5CI8A 1MMNA 2CNWD 4MQ9F 1IZMA 2YHSA 2J7PA 1O87A 1PD0A 4JJFA 5KYUB 5E2QA 3EH1A 1NU7D 1J8MF 2PP4A 2J7PD 1TWAA 1NG1A 1M2VA 2J9VA 4U5FE 1Z3IX 2L9JA 4AE4B 4Q7CA 1NU9C 3EGXB 4KBLA 2CW0F 3W2VA 4E7SA 5DVWA 3N24A 3NKDA 1VYIA 4YJWA 3I5PA 3ZIBA 2OCCC 4U5BE 4YT2A 3EPVA 4IWBA 3HJCA 2J0XA 4YT5A 1ZU5A 2XXAA 3FVYA 2I8BA 3AG4C 4NY3A 3ZG1A 4YT8A 3EH2A 3NYJA 4IRUA 2IXPA 4DOZA 3FDQA 2QY9A 2V3CC 4OIQF 3T4RA 3N0TA 4U5GA 4XLPF 4DVYP 1NZEA 3MX3A 1WGWA 1G8XA 1Z63A 1ZHTA 4JVSA 4ZLCA 4QDLA 4FX5A 4KC9A 3LAYA 5DQZA 2C04A 2IXMA 1ZHWA 3F46A 3K1IC 3ABMC 2DGJA 2J45A 3AG2C 4BJ1A 4BJ6A 4ZLDA 2Q9CA 1ZHYA 2X51A 4OIOF 4LLCA 5B1BC 2KW3C 2Y3GA 3GANA 4G0HA 2PF4E 3QZCA 4E7ZA 1W2WA 1SMYF 1ST6A 1V54C 2Y3BA 3ZSUA 2J9WA 1N1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHF 2;  5T1D B; 
#chains in the Genus database with same CATH topology
 5K0I A;  2OG2 A;  1Z5Z A;  5BQI A;  2YQY A;  4WAB A;  2OEX A;  3K6B A;  3AGU A;  3PDM P;  2TMV P;  5HSW A;  1TFO B;  1A7D A;  2VCA A;  4XEV A;  1OKK A;  1Q0K A;  2VCB A;  3ABK C;  2L81 A;  3K33 A;  3LLI A;  1MMA A;  3WAQ A;  4LAC B;  3L8I A;  3HLZ A;  1ZHX A;  4OIN F;  1RKE A;  3NYM A;  3U9J A;  1YYJ A;  1JPN A;  1OKK D;  1AEP A;  2Q3T A;  3C8G A;  2NUT B;  4ANJ A;  4EWC A;  1GM5 A;  3ASO C;  4LER A;  3NMI A;  2AU5 A;  2OJE D;  5L0D A;  2FFH A;  4NC3 A;  5DQT A;  4ER9 A;  5L0J A;  1LIH A;  1CPR A;  4DRJ B;  5EGY A;  1JAF A;  4P9T A;  2V26 A;  3CZ6 A;  1Z23 A;  1VMA A;  4XPW A;  1YLM A;  4I3M A;  2Q7R A;  3VYW A;  1HW2 A;  2KYH A;  2XRH A;  3GOD A;  3PMR A;  4ULW A;  2XL4 A;  1E84 A;  3DKA A;  3K7D A;  1TFK B;  1LI7 A;  4WJ0 A;  2YLG A;  5JUA A;  4GYT A;  4O6M A;  3RVZ A;  2PNO A;  3LNR A;  4IAO A;  2OEV A;  2HMZ A;  2LFD A;  1BR1 A;  2P7V A;  5JP7 A;  3EG9 A;  2BL2 A;  1PD1 A;  4HFK B;  4M63 A;  1WAS A;  2LSE A;  3G50 A;  5TJ5 E;  2M4E A;  4DVZ A;  4J32 B;  2GFH A;  3N2Z B;  3K1H A;  3Q7L A;  2XXA B;  1V74 B;  5L0C A;  3LNM B;  4NQF A;  4N6H A;  2B0J A;  4B6I A;  4G7Z F;  3GEI A;  1TWG A;  2HS5 A;  3IEE A;  1BZ4 A;  1OQC A;  2PX3 A;  2IYL D;  1JMW A;  3ZC4 A;  3TD7 A;  5DLJ A;  4PJM A;  5KYW A;  3QVZ A;  1Q0G A;  4AX2 A;  1VYK A;  2R25 A;  1T01 A;  4LLE A;  4MW3 A;  3TJ6 A;  4HEA J;  3WOD F;  3S0X A;  2XSE A;  4QI2 A;  3DM5 A;  3C8Z A;  2HJ3 A;  4PFP A;  1GQA A;  3ATP A;  4N4W A;  4JJG A;  1G4W R;  4NTB A;  1M57 C;  4G78 A;  2YLD A;  4U5D E;  4JZA A;  4XQ1 A;  2ICW G;  1BR4 A;  2CYD A;  3V5X A;  3T6B A;  2MWQ A;  1HMO A;  4U5H A;  4YT4 A;  3H2U A;  2O9X A;  2ETS A;  3QVY A;  4OD5 A;  2ZXW C;  3Q6N A;  1A41 A;  5JT4 A;  2D4U A;  3EFO A;  3DZA A;  2ZXR A;  3AG3 C;  4JEA A;  1OR2 A;  2HV7 A;  4OD4 A;  3S29 A;  3DM9 B;  1CGN A;  2NSG A;  1OCR C;  2Q4F A;  4K0D A;  2XS1 A;  4JTD B;  3EHN A;  1OW6 A;  1OW7 A;  5FCL A;  3MYF A;  4IAR A;  5CIV A;  4P9F A;  1TKN A;  1IW7 F;  1APC A;  4JW1 A;  4BG0 A;  1JR8 A;  2R7U A;  3RQF A;  1D1C A;  1T6Q A;  4BEJ A;  2R02 A;  3ITF A;  4KNW A;  3LEV A;  4JIO A;  1MMD A;  2A69 F;  3E70 C;  3VAY A;  2CGE A;  2QLA A;  5JLI A;  3IQ5 A;  2JD3 A;  1FAP B;  4ONS A;  1T9K A;  1L7C A;  1LKX A;  1M2O A;  3OWT A;  3SEO A;  2ZXO A;  3FAP B;  5COF A;  3B0P A;  3NRH A;  1Z6A A;  1LS4 A;  1YZC A;  3US6 A;  3LS0 A;  2XL8 A;  2QUP A;  2XM0 A;  3POV A;  2DYS C;  4DBR A;  1M2V B;  1OCZ C;  1FNT c;  4MTG A;  2HJM A;  3EZI A;  5KYN A;  2R03 A;  1KU2 A;  1V55 C;  1AVO B;  4Z9H A;  4DBQ A;  3FHD A;  3LES A;  3U3B A;  2OQM A;  4H4K C;  1HW1 A;  1T5O A;  2R9R B;  2A1D D;  3L1M A;  4W8K A;  1I4Y A;  2EIL C;  3TJ5 A;  2DYR C;  2X0C A;  2HZ8 A;  3WG7 C;  2Y39 A;  3I5Q A;  4BJ6 C;  1CGO A;  1E2X A;  3IQC A;  3U8V A;  2NG1 A;  2AVK A;  2GWW A;  5COG A;  4EKW A;  3U5S A;  2XL6 A;  5L0F A;  3L8J A;  1SYQ A;  1QPU A;  4I1O B;  2XLV A;  4HE8 D;  1LVK A;  3SXK A;  4CIP A;  4Q5S F;  1XZP A;  3S27 A;  3X2Q C;  1OR3 A;  3EHM A;  3H65 A;  4WGZ A;  1NSG B;  2YL0 A;  3G4Z A;  1QSP A;  1YDI A;  2WZF A;  3NYL A;  5BQG A;  3SP1 A;  4CBE A;  3C62 A;  4OIP F;  2R7X A;  1KTM A;  5IY5 C;  1I4Z A;  1RJ9 A;  4BJT A;  3UMH A;  2P1A A;  3EJN A;  3R7C A;  4XWJ A;  2QNL A;  3CSK A;  256B A;  1ORJ A;  1A7E A;  2VB6 A;  2J9U A;  4JE9 A;  1BDJ B;  3JYY A;  4N6C A;  1WAT A;  1K04 A;  5A69 A;  3AGT A;  4JKV A;  2HV6 A;  2Y3H A;  3X1O A;  2YLI A;  2NUP A;  4JCH A;  2FAP B;  2LCH A;  3HTK C;  4YL1 A;  5D92 A;  3V7O A;  1TR2 A;  1QLE C;  1YA9 A;  1TWC A;  2D5R B;  2PBE A;  1PCX A;  3NDB B;  2W45 A;  4MTO A;  2LP4 A;  5A6J A;  1VB5 A;  3W8I A;  1H7I A;  2HSQ A;  2JPU A;  1BR2 A;  1EI7 A;  2VAS A;  2R7V A;  1O3U A;  2J46 A;  3DE9 A;  4CS7 A;  2A6H F;  1LM3 B;  2YL3 A;  3EGD A;  4R32 A;  1OXK A;  2LD6 A;  2EIK C;  2DI3 A;  2R7O A;  3C8G D;  4P6I C;  2EIJ C;  5CI9 A;  1VK5 A;  1EKY A;  3EQL F;  4FES A;  4NCQ A;  1D0X A;  1QKR A;  4JTC B;  3JT1 A;  4O6Y A;  2NPU A;  1ZW2 A;  3KL4 A;  1H6G A;  2G3K A;  4A2N B;  1KNY A;  1YVI A;  4K7B A;  3DD7 A;  4NTF A;  1TWH A;  4CSA A;  1FMW A;  2W9Y A;  5T3W A;  1FFT C;  3LJB A;  2WB7 A;  1ORY A;  3SNH A;  4C3D A;  2KC3 A;  3ZTM A;  3JRM O;  3K66 A;  5L0G A;  1YAU O;  2VCC A;  3KMI A;  1U0B B;  1GS9 A;  2LFF A;  4MVO A;  2L7A A;  3FAJ A;  2VH3 A;  4U5C E;  2XLE A;  1RKE B;  4QI0 A;  2EIN C;  5E3C A;  3B71 A;  4IGG A;  1LE4 A;  4YWQ A;  4C3E A;  5B3S C;  3C8G B;  3B0U X;  2CDQ A;  3F47 A;  3IHU A;  3B9Q A;  3M1C B;  2Z15 A;  3DE8 A;  2WVN A;  2ZPA A;  5BUO A;  2EPL X;  3AG1 C;  3T6G B;  3JYH A;  4AE4 A;  4YL0 A;  1FR0 A;  3EGX A;  4ULV A;  1CGM E;  1ZHZ A;  2J0W A;  2YRF A;  3JZ0 A;  3M4C A;  2GA0 A;  4CS8 A;  2KQ9 A;  4CJG A;  1NLX A;  3R2P A;  4IJJ A;  1D1A A;  4DJ9 A;  4Q4Z F;  2J9B A;  2Y3D A;  1JPJ A;  3C7J A;  4W8P A;  2HKV A;  1MNE A;  2ASR A;  2OU6 A;  3I4U A;  2ZXP A;  3RVY A;  1MQV A;  5F5H A;  4CS9 A;  2KNH A;  5A6A A;  3U0C A;  5FZT A;  1M56 C;  3FOO A;  2Q9B A;  4C3B A;  1Q0D A;  2PFD A;  2R7Q A;  3LUT B;  3NKE A;  4PJN A;  3UGP A;  4MW8 A;  1OCC C;  3VRC A;  1SF8 A;  3DXJ F;  3QW1 A;  3SYN A;  3EG9 B;  3Q6M A;  4KNV A;  3A9C A;  4U9E A;  5AGF A;  1LPE A;  2HUJ A;  3TK0 A;  2Q9A A;  3DWW A;  4BJ5 A;  4XPY A;  5F28 E;  2G62 A;  1QQ3 A;  4YL3 A;  4OIR F;  5DS5 A;  2MYS A;  2G3V A;  4JRZ A;  4JEB A;  1NFN A;  5T1D B;  4FAP B;  3B0V C;  3DMD A;  4PJL A;  1OCO C;  3BRJ A;  4J7Y A;  3TOL A;  5KYW B;  4D4X A;  4U9D A;  3S84 A;  1SZI A;  2JX0 A;  4MND A;  4FWV A;  3J06 A;  3M15 A;  4G7H F;  1Z7Q c;  2UUH A;  2P6V A;  3GM3 A;  4G7O F;  2IXO A;  1S7Z A;  2QE9 A;  5COM A;  1E85 A;  3LS1 A;  1DOW A;  3ZTZ A;  5DS4 A;  3T6J A;  4XEF A;  2BC5 A;  3DJN B;  4YK5 A;  4IAQ A;  3UGO A;  3CEX A;  1A0B A;  3FXH A;  3OEO A;  3VM6 A;  1E83 A;  4KI2 A;  2RD9 A;  3HNI A;  4E0I A;  3U2M A;  5DS6 A;  3KYJ A;  2C03 A;  3CQZ A;  1ZVZ A;  2VC9 A;  1BBH A;  3TQO A;  1Y4C A;  5E3A A;  1GGQ A;  2XLM A;  1HE9 A;  3G4X A;  3O39 A;  3CAX A;  5HV9 A;  3DAG A;  5L3Q A;  3EFO B;  1L3P A;  3NMK A;  2AP3 A;  3W8H A;  4CIH A;  4XTK A;  3SXY A;  1M6T A;  4JUR I;  4XPX A;  3RKO F;  2W4M A;  4EBJ A;  1VOM A;  3M79 A;  1AUE A;  4E0H A;  2YL1 A;  4I1M A;  4XLN F;  1RMV A;  1HY5 A;  2A68 F;  1U6H A;  4EUK B;  1MMG A;  5B1A C;  3HNJ A;  3UMK A;  4MVM A;  4J30 B;  3MFN A;  4U5E E;  5BQH A;  1B68 A;  4PJJ A;  1O5H A;  2YWA A;  3ECS A;  3SXM A;  1D1B A;  1ZU4 A;  4PK4 A;  2H7O A;  1ZYR F;  4AL1 A;  2F22 A;  2R7R A;  1RKC A;  2AWY A;  3AQC A;  4RD9 A;  1YA7 O;  1WWP A;  3KKB A;  4MTF A;  2L6H A;  2XLH A;  3LLK A;  1C02 A;  4N06 A;  3RH3 A;  3FOP A;  2XLD A;  3C18 A;  2GDC A;  4YN0 B;  2PX0 A;  3IPM O;  2NUT A;  1WOL A;  2UUI A;  2WVO A;  3NG1 A;  3K1I A;  4CX9 A;  1Y6D A;  2QTV A;  3LEO A;  2IBF A;  3QMK A;  1QZX A;  3L0I A;  3O6X A;  2M64 A;  3RYL A;  1XZQ A;  3V5Z A;  1LS1 A;  3KH2 A;  3GEE A;  4EBB A;  5L3V A;  3IQ6 A;  3EZH A;  3JSZ A;  2MHR A;  5GPG B;  4EHP A;  2WVQ A;  4CDY A;  1C03 A;  4C7O A;  1JOG A;  3S9O A;  4I44 A;  3PCV A;  1YAR O;  2Y69 C;  3E9V A;  2CCY A;  2I15 A;  4O7G A;  3RW0 A;  3O10 A;  3M4B A;  3MBG A;  1MND A;  3U2L A;  1PV3 A;  1G5Z A;  5T3T A;  1ZZP A;  2H7V C;  1FFH A;  1HE1 A;  3UR3 C;  4O79 A;  3GWN A;  3Q7G A;  3DAF A;  1DOV A;  3UMI A;  1RXQ A;  4HFF B;  1FMV A;  4CSA C;  2FGY A;  3MYI A;  5EK0 A;  5KYY A;  1RJ9 B;  4XEK A;  3W2W A;  4CDV A;  4F4B A;  5KYX A;  4O6N A;  2IXN A;  1CPQ A;  5E33 A;  4AL0 A;  5AC4 A;  2A0B A;  2KGO A;  3B29 A;  1OW8 A;  3RQE A;  1D0Y A;  3W4Y A;  4DXW A;  2HMQ A;  5B3I A;  3H2V A;  3ASN C;  2EPO A;  3SZR A;  3ZQY A;  3NMJ A;  2P0N A;  3JSE O;  3KPH A;  3HKK A;  3ZVR A;  2H8A A;  3DJU B;  4NTA A;  1NBB A;  3V5Y A;  3S90 A;  2YEV A;  2NUP B;  3SXZ A;  4LDK A;  1TQG A;  2R7T A;  3PHF 2;  5F5F A;  2E87 A;  2H7B A;  2OOC A;  2A6E F;  2EPN A;  3OA1 A;  5KYU A;  1ORS C;  1H9G A;  5L0I A;  3RIP A;  3VF0 A;  4MVU A;  1C17 M;  4C7O B;  4RDA A;  2KK1 A;  2LQG A;  5EHH A;  3MLG A;  4MS2 A;  2YZS A;  4JCZ A;  2R7W A;  3L34 A;  2R7S A;  3RQG A;  4AK9 A;  3EGD B;  4RBN A;  2WZL A;  1D0Z A;  1FTS A;  2IOQ A;  2WZG A;  4CS8 C;  1S05 A;  3AOU A;  3JRT A;  4A4A A;  1LE2 A;  5JRA A;  1J8Y F;  1WN0 A;  2EIM C;  2OJQ A;  5D91 A;  3JCU Q;  4PFO A;  2BE5 F;  4X0R A;  4CS9 C;  4IB4 A;  1R5I D;  3WHN A;  3UNG C;  2LIG A;  2KJG A;  4GEH A;  3HNK A;  4LDR A;  5KYY B;  2KSF A;  5A6K A;  2XS8 A;  2P61 A;  2EPK X;  5KYX B;  2CNW A;  1F1M A;  3T9O A;  2AWC A;  2W4B A;  3A11 A;  3AQB A;  2HSB A;  2NSF A;  3S28 A;  2A0U A;  2B0H A;  2WL8 A;  3ABL C;  4K1O A;  3RFY A;  4BJ5 C;  5CI8 A;  1MMN A;  2YKZ A;  3ZWI A;  1E86 A;  2CNW D;  2XLW A;  1K40 A;  4MQ9 F;  1IZM A;  1VLT A;  4D4N A;  2YHS A;  4CJO A;  4GQH A;  4UDV A;  2J7P A;  1O87 A;  1PD0 A;  3QW0 A;  4JJF A;  5KYU B;  1EQ1 A;  4WGY A;  5AC5 A;  4PR9 A;  5E2Q A;  3EH1 A;  1NU7 D;  1YJG A;  1OXB A;  1J8M F;  1V4A A;  2J7P D;  1TWA A;  2PP4 A;  3O55 A;  1NG1 A;  3FMS A;  1M2V A;  4MVZ A;  4PAC A;  2J9V A;  4U5F E;  3GOR A;  3ZDL A;  1Z3I X;  2L6F A;  2L9J A;  1LI5 A;  2DB4 A;  4MVQ A;  4Q7C A;  4AE4 B;  4E18 A;  1I5N A;  1NU9 C;  3EGX B;  2CW0 F;  4KBL A;  3U3F A;  3W2V A;  2YL7 A;  4Z9I A;  4E7S A;  3BEH A;  4DRH B;  1T6I A;  5DVW A;  3N24 A;  3NKD A;  1R4T A;  2XM4 A;  4BEM J;  1VYI A;  2OKU A;  3I5P A;  4YJW A;  3GM2 A;  1U89 A;  4LDQ A;  4DRI B;  3ZIB A;  1VTM P;  5JS5 A;  1UFB A;  2OCC C;  4U5B E;  4YT2 A;  3EPV A;  4MVS A;  4IWB A;  3HJC A;  3ZQV A;  2J0X A;  2J8W A;  4YT5 A;  4BPM A;  1RCP A;  1HMD A;  1YYX A;  1ZU5 A;  2HFI A;  2Q00 A;  2XXA A;  2L6G A;  1SR2 A;  3FVY A;  5JVE A;  2I8B A;  3AG4 C;  4NY3 A;  3GEH A;  3GWL A;  3TOM A;  2LK4 A;  3U8P A;  3ZG1 A;  1Q0F A;  2ZD9 A;  4YT8 A;  3EH2 A;  3NYJ A;  4IRU A;  5A6B A;  1QVX A;  2IXP A;  4DOZ A;  3RF3 A;  2YVK A;  3FDQ A;  2QY9 A;  2V3C C;  4L6R A;  1YZA A;  2R05 A;  4OIQ F;  1K05 A;  3T4R A;  5A6B D;  3N0T A;  4U5G A;  4XLP F;  4DVY P;  1G4U S;  1NZE A;  3MX3 A;  5JSL A;  1A7V A;  1WGW A;  4J7T A;  2XLO A;  5L0H A;  1XWJ A;  4E17 A;  1G8X A;  1Z63 A;  1ZHT A;  4JVS A;  4ZLC A;  1JRA A;  4H54 A;  1Q0M A;  4QDL A;  4FX5 A;  4KC9 A;  3LAY A;  5DQZ A;  2C04 A;  2IXM A;  1ZHW A;  2GAQ A;  3F46 A;  3K1I C;  3ABM C;  3QTH A;  3U9M A;  3KYI A;  2DGJ A;  3TUL A;  1VLS A;  2J45 A;  3AG2 C;  4BJ1 A;  1H9T A;  4BJ6 A;  4ZLD A;  1ZW3 A;  2Q9C A;  3AJM A;  4JTA B;  1ZHY A;  2X51 A;  2RSE B;  4OIO F;  1T6U A;  1WTY A;  3HNL A;  4LLC A;  5B1B C;  2KW3 C;  2Y3G A;  3GAN A;  4G0H A;  3GM1 A;  2PF4 E;  1NFO A;  3QZC A;  4E7Z A;  4CDA A;  4Z9J A;  4EBK A;  3IQT A;  1W2W A;  2IM8 A;  3JTL O;  1SMY F;  4JC7 A;  4MVR A;  2EPM X;  1ST6 A;  1EA8 A;  1V54 C;  2Y3B A;  3C63 A;  3DI5 A;  2J9W A;  3ZSU A;  1UG7 A;  4EIY A;  1N1C A; 
#chains in the Genus database with same CATH homology
 2OG2 A;  1Z5Z A;  3K6B A;  5HSW A;  1OKK A;  3LLI A;  3K33 A;  3ABK C;  2L81 A;  1MMA A;  4LAC B;  3HLZ A;  1ZHX A;  4OIN F;  3NYM A;  1JPN A;  1OKK D;  2Q3T A;  4EWC A;  2NUT B;  4ANJ A;  3ASO C;  4LER A;  2FFH A;  5DQT A;  5EGY A;  2V26 A;  3CZ6 A;  1Z23 A;  1VMA A;  4I3M A;  3VYW A;  2XRH A;  3GOD A;  3PMR A;  4ULW A;  2XL4 A;  3K7D A;  4WJ0 A;  4GYT A;  4O6M A;  4IAO A;  3LNR A;  2P7V A;  1BR1 A;  3EG9 A;  1PD1 A;  4HFK B;  4M63 A;  2LSE A;  2M4E A;  4DVZ A;  4J32 B;  2GFH A;  3N2Z B;  3K1H A;  3Q7L A;  2B0J A;  4B6I A;  4G7Z F;  1TWG A;  3IEE A;  3ZC4 A;  2PX3 A;  5KYW A;  2IYL D;  3TD7 A;  5DLJ A;  4PJM A;  4AX2 A;  1VYK A;  3S0X A;  4LLE A;  4HEA J;  3WOD F;  4QI2 A;  2XSE A;  3DM5 A;  4PFP A;  4U5D E;  4JJG A;  1M57 C;  4JZA A;  1BR4 A;  3T6B A;  2MWQ A;  4U5H A;  4YT4 A;  2O9X A;  4OD5 A;  2ZXW C;  3Q6N A;  3EFO A;  3DZA A;  2ZXR A;  3AG3 C;  4OD4 A;  2HV7 A;  3S29 A;  3DM9 B;  1OCR C;  4K0D A;  3EHN A;  5FCL A;  1TKN A;  1IW7 F;  4JW1 A;  4BG0 A;  2R7U A;  1D1C A;  4BEJ A;  3ITF A;  4KNW A;  3LEV A;  1MMD A;  2A69 F;  3E70 C;  3VAY A;  2CGE A;  2JD3 A;  1LKX A;  1M2O A;  3OWT A;  3SEO A;  2ZXO A;  3B0P A;  3NRH A;  1Z6A A;  3LS0 A;  3POV A;  2DYS C;  4DBR A;  1M2V B;  1OCZ C;  3EZI A;  5KYN A;  1KU2 A;  1V55 C;  4DBQ A;  3FHD A;  3LES A;  4H4K C;  2A1D D;  4W8K A;  2EIL C;  2DYR C;  3WG7 C;  2Y39 A;  3I5Q A;  4BJ6 C;  2NG1 A;  4I1O B;  4HE8 D;  1LVK A;  4Q5S F;  3S27 A;  3X2Q C;  3EHM A;  3H65 A;  3NYL A;  2XXA B;  2WZF A;  2R7X A;  4CBE A;  3SP1 A;  4OIP F;  5IY5 C;  1RJ9 A;  4BJT A;  3UMH A;  3EJN A;  4XWJ A;  3CSK A;  2VB6 A;  2J9U A;  2HV6 A;  2Y3H A;  3X1O A;  2NUP A;  4JCH A;  3V7O A;  3HTK C;  5D92 A;  1TR2 A;  1QLE C;  1TWC A;  2D5R B;  1PCX A;  3NDB B;  2W45 A;  3W8I A;  1BR2 A;  2VAS A;  2R7V A;  2J46 A;  4CS7 A;  2A6H F;  3EGD A;  2EIK C;  2R7O A;  4P6I C;  5CI9 A;  2EIJ C;  1VK5 A;  3EQL F;  4FES A;  1D0X A;  3JT1 A;  4O6Y A;  3KL4 A;  2G3K A;  4A2N B;  4K7B A;  3DD7 A;  1TWH A;  4CSA A;  1FMW A;  2W9Y A;  5T3W A;  1FFT C;  3LJB A;  2WB7 A;  3SNH A;  4C3D A;  3K66 A;  3KMI A;  3FAJ A;  2VH3 A;  4U5C E;  4QI0 A;  2EIN C;  5E3C A;  4YWQ A;  5B3S C;  4C3E A;  3B0U X;  2CDQ A;  3F47 A;  3B9Q A;  3M1C B;  2Z15 A;  2WVN A;  2ZPA A;  5BUO A;  3AG1 C;  4AE4 A;  3JYH A;  3EGX A;  1ZHZ A;  2J0W A;  4CS8 A;  2KQ9 A;  4Q4Z F;  4IJJ A;  1D1A A;  2Y3D A;  1JPJ A;  1MNE A;  3I4U A;  2ZXP A;  5F5H A;  4CS9 A;  2KNH A;  1M56 C;  2Q9B A;  4C3B A;  2PFD A;  2R7Q A;  3NKE A;  4PJN A;  3UGP A;  1OCC C;  1SF8 A;  3DXJ F;  3SYN A;  3EG9 B;  3Q6M A;  4KNV A;  2Q9A A;  4BJ5 A;  2G62 A;  5DS5 A;  4OIR F;  2MYS A;  2G3V A;  5T1D B;  3B0V C;  3DMD A;  4PJL A;  1OCO C;  5KYW B;  1SZI A;  4MND A;  4FWV A;  4G7H F;  2P6V A;  4G7O F;  2IXO A;  1S7Z A;  3LS1 A;  5DS4 A;  3T6J A;  3DJN B;  3UGO A;  3OEO A;  4KI2 A;  5DS6 A;  2C03 A;  3CQZ A;  5E3A A;  3O39 A;  3DAG A;  5L3Q A;  3EFO B;  4CIH A;  3W8H A;  4XTK A;  4JUR I;  3RKO F;  2W4M A;  1VOM A;  4I1M A;  4XLN F;  2A68 F;  1MMG A;  5B1A C;  3UMK A;  4U5E E;  4J30 B;  4PJJ A;  1O5H A;  3ECS A;  1D1B A;  1ZU4 A;  4PK4 A;  2H7O A;  1ZYR F;  2R7R A;  3AQC A;  4RD9 A;  3KKB A;  3LLK A;  4N06 A;  3RH3 A;  4YN0 B;  2PX0 A;  2NUT A;  3NG1 A;  2WVO A;  2QTV A;  3QMK A;  1QZX A;  3L0I A;  3O6X A;  3RYL A;  1LS1 A;  3KH2 A;  4EBB A;  5L3V A;  3EZH A;  3JSZ A;  2WVQ A;  4C7O A;  4I44 A;  2Y69 C;  3E9V A;  4O7G A;  1MND A;  5T3T A;  2H7V C;  1FFH A;  3UR3 C;  4O79 A;  3Q7G A;  3DAF A;  3UMI A;  4HFF B;  1FMV A;  4CSA C;  2FGY A;  5KYY A;  1RJ9 B;  3W2W A;  4F4B A;  5KYX A;  4O6N A;  2IXN A;  5E33 A;  2KGO A;  1D0Y A;  3ASN C;  3SZR A;  3ZVR A;  3DJU B;  2YEV A;  2NUP B;  2R7T A;  5F5F A;  3PHF 2;  2E87 A;  2H7B A;  2A6E F;  3OA1 A;  5KYU A;  3RIP A;  4C7O B;  4RDA A;  5EHH A;  3MLG A;  2R7W A;  2YZS A;  3L34 A;  2R7S A;  4AK9 A;  3EGD B;  4RBN A;  2WZL A;  1D0Z A;  1FTS A;  2IOQ A;  2WZG A;  4CS8 C;  3JRT A;  1J8Y F;  2EIM C;  5D91 A;  3JCU Q;  4PFO A;  2BE5 F;  4X0R A;  4CS9 C;  3UNG C;  2KJG A;  4GEH A;  5KYY B;  5KYX B;  2CNW A;  2W4B A;  3AQB A;  3S28 A;  3ABL C;  3RFY A;  2WL8 A;  4BJ5 C;  5CI8 A;  1MMN A;  2CNW D;  4MQ9 F;  1IZM A;  2YHS A;  2J7P A;  1O87 A;  1PD0 A;  4JJF A;  5KYU B;  5E2Q A;  3EH1 A;  1NU7 D;  1J8M F;  2PP4 A;  2J7P D;  1TWA A;  1NG1 A;  1M2V A;  2J9V A;  4U5F E;  1Z3I X;  2L9J A;  4AE4 B;  4Q7C A;  1NU9 C;  3EGX B;  4KBL A;  2CW0 F;  3W2V A;  4E7S A;  5DVW A;  3N24 A;  3NKD A;  1VYI A;  4YJW A;  3I5P A;  3ZIB A;  2OCC C;  4U5B E;  4YT2 A;  3EPV A;  4IWB A;  3HJC A;  2J0X A;  4YT5 A;  1ZU5 A;  2XXA A;  3FVY A;  2I8B A;  3AG4 C;  4NY3 A;  3ZG1 A;  4YT8 A;  3EH2 A;  3NYJ A;  4IRU A;  2IXP A;  4DOZ A;  3FDQ A;  2QY9 A;  2V3C C;  4OIQ F;  3T4R A;  3N0T A;  4U5G A;  4XLP F;  4DVY P;  1NZE A;  3MX3 A;  1WGW A;  1G8X A;  1Z63 A;  1ZHT A;  4JVS A;  4ZLC A;  4QDL A;  4FX5 A;  4KC9 A;  3LAY A;  5DQZ A;  2C04 A;  2IXM A;  1ZHW A;  3F46 A;  3K1I C;  3ABM C;  2DGJ A;  2J45 A;  3AG2 C;  4BJ1 A;  4BJ6 A;  4ZLD A;  2Q9C A;  1ZHY A;  2X51 A;  4OIO F;  4LLC A;  5B1B C;  2KW3 C;  2Y3G A;  3GAN A;  4G0H A;  2PF4 E;  3QZC A;  4E7Z A;  1W2W A;  1SMY F;  1ST6 A;  1V54 C;  2Y3B A;  3ZSU A;  2J9W A;  1N1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...