2HJMA

Crystal structure of a singleton protein pf1176 from p. furiosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
HHHHHHMDLVEKVKELCLELEEENLAKAIERFITLTHGIEKTRGEAFAKASIYGFLEGILTTLKMKYSNEKIETLLNEVKTAREETEALLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PF1176
publication title Crystal structure of a singleton protein PF1176 from P. furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 32
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11505 DUF3216 Protein of unknown function (DUF3216)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) protein pf1176 like 2hjmA01
2HJMA
chains in the Genus database with same CATH superfamily
4DRJB 4NCQA 2L9JA 4O7GA 4AK9A 3AOUA 3MYFA 4YT2A 3S27A 3SXMA 2P0NA 1HMOA 2IXNA 2VCBA 2XLOA 4W8PA 1YZCA 3J06A 1BZ4A 1MMNA 1IZMA 2IYLD 3GEHA 4PFOA 1LE4A 2WZGA 4ULVA 1OXBA 2CNWD 2HZ8A 2VASA 2IBFA 5COGA 4O79A 3QMKA 4MVRA 3C63A 2Y69C 3AGUA 3M79A 1KNYA 1FAPB 3V7OA 3X2QC 5DS4A 3PDMP 2JX0A 4MVSA 2YLIA 1LPEA 4DRHB 1RCPA 2OOCA 1SR2A 3AJMA 5E3CA 2A68F 3TJ6A 1TKNA 3ZG1A 1T6IA 1T5OA 1XZQA 2YQYA 4FESA 2NUPB 3C8ZA 3ABLC 2W4MA 1TWGA 2YVKA 1YYJA 2XL8A 1YLMA 3U2LA 1TFKB 1BDJB 3DM9B 1RMVA 4QDLA 1E83A 4KNVA 2H8AA 4E0IA 1GM5A 3LLIA 4C3BA 1SMYF 3KMIA 4CS9A 4UDVA 4JZAA 1EKYA 3MBGA 5L3VA 2OEVA 1KU2A 2DYSC 1RJ9B 4EBBA 3JSZA 5A69A 2YWAA 4N06A 4F4BA 5DS6A 2J9WA 5B3SC 3TD7A 2L7AA 3SEOA 3UGOA 4XEKA 4H4KC 2G3KA 2YL3A 1CPQA 3U8VA 4I3MA 5A6BD 5KYNA 3W2WA 2YL7A 3DWWA 2J9VA 3VRCA 4EIYA 4FAPB 1T6QA 1RJ9A 3N2ZB 5A6JA 3UMHA 3T9OA 4P9TA 2R7WA 4XPWA 3ITFA 3NRHA 2A0UA 3EG9B 3GODA 3V5XA 5JT4A 3SXYA 2Q00A 3TK0A 1ZYRF 1D1CA 3B0PA 2MHRA 1FTSA 1MMAA 1S7ZA 2KC3A 1ZZPA 3ASNC 3EG9A 2YZSA 4YL0A 5COFA 4MS2A 3U5SA 3C62A 1ZHTA 3IQ6A 3X1OA 4CDAA 2XLMA 5BQHA 4XTKA 4BG0A 1WGWA 3MFNA 4JC7A 3SYNA 2KGOA 2RSEB 2R05A 3GEEA 1PV3A 2G3VA 3HNKA 5E2QA 2CGEA 3K1IC 4ZLDA 3L8JA 1L3PA 2Y3BA 5DS5A 1OCCC 1LI7A 2X0CA 1NFNA 2GDCA 4KNWA 3LEOA 5AGFA 2XM4A 1YAUO 5DQZA 4OIPF 1YA7O 2HJ3A 3KH2A 2MWQA 3JYHA 2J45A 4NY3A 4ER9A 2Q7RA 1FNTc 4JE9A 5L0FA 4BEMJ 1VOMA 4MW3A 2LP4A 5DLJA 3QTHA 1H6GA 3M4CA 3K1HA 3FDQA 1ZU4A 3IPMO 1FFHA 1OW6A 1VK5A 1TWAA 2J9UA 5EK0A 2QUPA 1AEPA 3PMRA 3CQZA 4JCHA 1RXQA 4B6IA 4A4AA 3LAYA 5L0JA 5L0DA 5KYWB 1E84A 5HSWA 2R7RA 2EPOA 2J0WA 4KBLA 1Y6DA 1HE9A 2WVNA 2VCAA 1V55C 3ASOC 3C8GA 4MVZA 4Q5SF 4X0RA 3L0IA 1QSPA 1A7EA 3IHUA 4JEBA 4JTAB 5KYWA 3GM1A 2XM0A 2KQ9A 3EH1A 2PX0A 1NG1A 3IEEA 2R7UA 3B29A 3M4BA 1LKXA 3B0VC 2KJGA 2QY9A 2M64A 3ZQVA 4G7HF 4MVOA 5L0IA 2D5RB 2HSQA 5A6AA 1SZIA 2CW0F 2HSBA 3Q7GA 2Q9AA 4PJLA 4PACA 5B1AC 1R4TA 1YVIA 3JCUQ 4Q4ZF 4O6NA 4JIOA 3TQOA 4JTDB 2H7BA 1CPRA 1G4WR 3CSKA 2EPNA 2EPLX 5CI8A 2R7OA 1WWPA 2AVKA 1B68A 4XQ1A 1OXKA 1PCXA 2PF4E 3H65A 4BJTA 4EHPA 1JPJA 2OU6A 2CYDA 2OJED 4AL1A 1K04A 1Q0MA 3DAGA 1H7IA 1YJGA 1V54C 2W9YA 4YL1A 2LCHA 2Y39A 1GS9A 3S0XA 2Q9BA 4DBQA 1N1CA 1YYXA 3AG4C 3QVZA 5L0GA 4O6MA 4I44A 3TOLA 2KNHA 4AL0A 3TOMA 3NG1A 4JKVA 4E17A 3HNLA 2D4UA 3T6BA 3AG2C 3O10A 1V4AA 3G4ZA 4DBRA 1UFBA 2H7OA 4MTOA 3AG1C 3CZ6A 4XPXA 2J7PA 2YKZA 3UNGC 3K33A 5F28E 1MQVA 3F47A 4G0HA 4O6YA 4GQHA 5BQIA 3AG3C 3EGDB 4E0HA 1YA9A 3AGTA 2P1AA 1O87A 3K7DA 2ZXPA 5FCLA 2YL1A 4XWJA 1R5ID 1KTMA 4CSAC 1BR1A 2XSEA 2KYHA 4N6HA 1ZHWA 1QPUA 1G4US 3WAQA 2I15A 1FR0A 2HV6A 4DRIB 3JYYA 4MVQA 2HJMA 3EGDA 4IJJA 4PR9A 2F22A 4XEVA 3SP1A 1ORYA 3RF3A 1Q0FA 4W8KA 2YLDA 4OD4A 4NTFA 3GWNA 3K1IA 3R2PA 2XLDA 2ZXOA 3JSEO 1K40A 3FVYA 4U5DE 1VTMP 1Q0GA 4EBJA 5K0IA 3QW0A 3LNRA 3ZC4A 3POVA 2A0BA 4J30B 5DQTA 5KYXB 3JTLO 3WG7C 1BBHA 3OA1A 1Z63A 2XRHA 3EPVA 3FHDA 5JUAA 3Q6MA 3K6BA 2XLWA 1H9TA 3E70C 1VB5A 2JD3A 3RIPA 2J8WA 5TJ5E 2LFFA 3VYWA 3VAYA 3F46A 5B1BC 2NUPA 1Z5ZA 4YT5A 2I8BA 5BQGA 4XLNF 4IAQA 3W8IA 4ONSA 2BE5F 1MNDA 1ORJA 1CGNA 3A9CA 1I4ZA 1VYKA 4MTGA 1J8MF 4ULWA 5KYYB 3GORA 3UGPA 3KYIA 2NSFA 4LDQA 3R7CA 1C02A 3LEVA 3ZTMA 2WVQA 2IOQA 1OCRC 3LS0A 4WJ0A 3ECSA 1D1BA 1FMVA 1C03A 2BC5A 2LFDA 2ZD9A 4YT4A 3S84A 2FAPB 1ZW2A 5AC4A 5KYYA 2TMVP 4JW1A 1ST6A 4HFKB 1H9GA 3LJBA 1AUEA 1YDIA 2OCCC 4E18A 3RVYA 3DZAA 3MX3A 3SNHA 4BJ6C 2WVOA 2CCYA 4U5CE 1SF8A 2ICWG 1TR2A 5D92A 5FZTA 4WGZA 4YT8A 3NMIA 3CEXA 3MYIA 1V74B 4YK5A 2EIJC 1DOWA 4AE4A 1APCA 3LS1A 4MW8A 4RDAA 5L0HA 3DE8A 1W2WA 2R7QA 1TWHA 1XWJA 1T9KA 4LDRA 2P7VA 2RD9A 2P61A 3IQ5A 4U9DA 2R7SA 4YL3A 1A41A 5AC5A 3EHMA 4RD9A 2G62A 3NYLA 4P6IC 1NSGB 2EIKC 1T01A 1SYQA 3DI5A 4Q7CA 2R03A 5BUOA 4OIOF 1HMDA 2YRFA 2DI3A 2YHSA 1J8YF 4GEHA 4N6CA 3DD7A 2E87A 1Z3IX 4HEAJ 3QZCA 1ZHZA 3NYJA 3DM5A 5B3IA 1A7DA 3EFOB 5L0CA 4Z9JA 2EILC 4XEFA 2IXMA 2FGYA 3RFYA 5JVEA 3FMSA 3EGXB 4CS7A 4K0DA 4DJ9A 2PNOA 4DVZA 4KI2A 2PX3A 3EZHA 1F1MA 4K7BA 3RVZA 3JT1A 4K1OA 5KYUB 3EFOA 4QI0A 5E3AA 1Z23A 1K05A 2A6EF 4JURI 3KYJA 4BEJA 4CIHA 4BJ5C 5E33A 5COMA 4CS8C 2L6FA 2V26A 4LLEA 1LE2A 1JOGA 1AVOB 2HS5A 2KW3C 2R25A 1ZHYA 4MNDA 4CSAA 1HY5A 1NU9C 1S05A 2QE9A 1DOVA 3TULA 4YWQA 2FFHA 1I5NA 3GM3A 2A1DD 2GWWA 1JPNA 2W4BA 3AQBA 3U3FA 1YARO 1A7VA 3T4RA 3NKDA 1NFOA 3NKEA 2LSEA 4KC9A 4G7ZF 2DB4A 1M2OA 4LERA 1OKKA 1JMWA 1VMAA 3ZSUA 2XL4A 2WB7A 3W8HA 3O55A 4CDYA 3LESA 3L1MA 2Q3TA 3U2MA 2AWCA 2QNLA 1U0BB 2ETSA 4MVUA 2HMQA 2ZPAA 4IGGA 1UG7A 3ABKC 1ZVZA 5L3QA 4L6RA 3FAJA 2LK4A 256BA 3A11A 2NSGA 4N4WA 2M4EA 3C8GD 4U5EE 4AX2A 4JTCB 2KSFA 5EHHA 3T6GB 3U9MA 4CBEA 4YN0B 2OKUA 1D0YA 3JRTA 2PP4A 1MNEA 2PBEA 3O6XA 3HJCA 1OR3A 4IWBA 3G4XA 3CAXA 1WATA 3OEOA 2VB6A 3K66A 5F5FA 2JPUA 2L6GA 4FX5A 1VLTA 3AQCA 4QI2A 2NUTB 1CGME 4I1MA 3KKBA 3LNMB 4BJ6A 1ZU5A 2CNWA 1WASA 2XXAB 4EBKA 2V3CC 3RQGA 3GANA 4R32A 4Z9IA 1HW1A 1T6UA 2L6HA 2HMZA 4NC3A 2XLVA 3GWLA 3DXJF 1RKEB 2LQGA 1BR4A 2UUHA 2VCCA 3FXHA 3NMJA 1QKRA 2NUTA 3T6JA 2Z15A 3W4YA 1OW7A 3N0TA 4J32B 3ZTZA 4C7OB 4PFPA 1WTYA 4MQ9F 1VYIA 3LLKA 4IARA 1QQ3A 2DGJA 2GAQA 1OCOC 3JRMO 4CDVA 1RKEA 2L81A 2LD6A 4P9FA 3H2VA 2Y3GA 5JSLA 3WHNA 3S90A 4C7OA 2XLHA 3WODF 3UMIA 3N24A 3DMDA 3M15A 3U8PA 3NYMA 4OIQF 3M1CB 2OQMA 3SXZA 4XLPF 4EUKB 2AU5A 3G50A 3QVYA 2OEXA 2J7PD 1PD1A 1MMGA 2XS1A 3ABMC 3I5QA 5A6BA 2HV7A 4MTFA 2Y3HA 5JRAA 3DJNB 2A6HF 4HE8D 1IW7F 5KYXA 4PJJA 3PHF2 1M2VB 3HLZA 2BL2A 3ZIBA 1GGQA 3QW1A 3RW0A 3ZQYA 4BJ5A 3KPHA 4DVYP 4CS8A 4A2NB 1ZW3A 2R7TA 3ZWIA 4RBNA 1Y4CA 3FAPB 3JZ0A 3LUTB 3BRJA 1NLXA 1GQAA 3C7JA 4JVSA 4LLCA 4JJFA 1NU7D 4HFFB 1M2VA 2B0HA 1LS1A 5JS5A 4IAOA 4D4NA 3DKAA 2EIMC 5DVWA 1RKCA 4WGYA 1G8XA 2DYRC 3IQCA 3ZDLA 5HV9A 1E2XA 3IQTA 2AWYA 1D0ZA 2J0XA 2ZXWC 2J46A 4OINF 2AP3A 1M56C 2MYSA 1M6TA 3HNIA 4PJMA 4PK4A 4M63A 4DXWA 4U5GA 3GEIA 2IXOA 1NZEA 2R02A 2OJQA 2XS8A 3L8IA 5T1DB 1Z7Qc 3S29A 5A6KA 1O3UA 4OD5A 3TJ5A 1ORSC 1M57C 4JEAA 1MMDA 4WABA 3I5PA 4ZLCA 2WZLA 5GPGB 3U3BA 1JAFA 3NDBB 1EQ1A 2YLGA 2YEVA 4JRZA 2ZXRA 3RYLA 1TWCA 2HFIA 1A0BA 2XLEA 3ATPA 1D1AA 2EPKX 3OWTA 5JP7A 4CIPA 1OR2A 5EGYA 4U5BE 1D0XA 1LI5A 1QVXA 3UMKA 2VC9A 1LM3B 3DJUB 4BJ1A 2Q4FA 4JCZA 1PD0A 4E7ZA 3EZIA 2C04A 3SXKA 1HW2A 1U89A 4ANJA 3UR3C 3RKOF 4PJNA 1QLEC 3GM2A 3V5ZA 4Z9HA 3EGXA 3W2VA 2EINC 2J9BA 2YL0A 3FOPA 3H2UA 4LDKA 4CJOA 2IM8A 1WOLA 5T3TA 4EKWA 1I4YA 3HKKA 4G78A 2UUIA 1E86A 3U0CA 2H7VC 2EPMX 3NMKA 5KYUA 3SZRA 2NPUA 2B0JA 5IY5C 1HE1A 1EA8A 1EI7A 4LACB 4GYTA 4CX9A 4H54A 3HNJA 4C3EA 3EH2A 1CGOA 1U6HA 3U9JA 3Q6NA 3KL4A 4E7SA 3C18A 4DOZA 3E9VA 4OIRF 5CIVA 2R9RB 3C8GB 1G5ZA 1OW8A 1WN0A 4YJWA 2KK1A 3B71A 4IRUA 1Z6AA 1Q0KA 3DE9A 1YZAA 1XZPA 3S28A 1JRAA 1FMWA 1LVKA 4U5FE 3Q7LA 2ASRA 4MVMA 4U5HA 1QZXA 3B9QA 2HUJA 2HKVA 3O39A 3S9OA 1FFTC 1OCZC 4NQFA 1ZHXA 2W45A 4XPYA 1E85A 3MLGA 2Y3DA 3HTKC 2Q9CA 2OG2A 2LIGA 4IB4A 2PFDA 3V5YA 3RQFA 3RH3A 3BEHA 4CS9C 3EQLF 3EHNA 3VF0A 2GFHA 1JR8A 3VM6A 1L7CA 2IXPA 2QTVA 3EJNA 4EWCA 4JJGA 4C3DA 2NG1A 2WZFA 2XL6A 3DAFA 4D4XA 1BR2A 1C17M 4NTAA 3PCVA 2CDQA 1NBBA 2A69F 3L34A 3RQEA 5F5HA 3US6A 4G7OF 4J7TA 2VH3A 1OKKD 5T3WA 1LS4A 3ZVRA 1TFOB 2X51A 4I1OB 2QLAA 4AE4B 1VLSA 2XXAA 2P6VA 1LIHA 3I4UA 5D91A 3B0UX 2GA0A 1OQCA 2O9XA 4BPMA 2R7XA 2WL8A 1TQGA 4CJGA 4U9EA 5JLIA 1Q0DA 2R7VA 4FWVA 4NTBA 1O5HA 2C03A 5CI9A 3FOOA 4J7YA
chains in the Genus database with same CATH topology
2HJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJM A; 
#chains in the Genus database with same CATH topology
 4DRJ B;  4NCQ A;  2L9J A;  4O7G A;  4AK9 A;  3AOU A;  3MYF A;  4YT2 A;  3S27 A;  3SXM A;  2P0N A;  1HMO A;  2IXN A;  2VCB A;  2XLO A;  4W8P A;  1YZC A;  3J06 A;  1BZ4 A;  1MMN A;  1IZM A;  2IYL D;  3GEH A;  4PFO A;  1LE4 A;  2WZG A;  4ULV A;  1OXB A;  2CNW D;  2HZ8 A;  2VAS A;  2IBF A;  5COG A;  4O79 A;  3QMK A;  4MVR A;  3C63 A;  2Y69 C;  3AGU A;  3M79 A;  1KNY A;  1FAP B;  3V7O A;  3X2Q C;  5DS4 A;  3PDM P;  2JX0 A;  4MVS A;  2YLI A;  1LPE A;  4DRH B;  1RCP A;  2OOC A;  1SR2 A;  3AJM A;  5E3C A;  2A68 F;  3TJ6 A;  1TKN A;  3ZG1 A;  1T6I A;  1T5O A;  1XZQ A;  2YQY A;  4FES A;  2NUP B;  3C8Z A;  3ABL C;  2W4M A;  1TWG A;  2YVK A;  1YYJ A;  2XL8 A;  1YLM A;  3U2L A;  1TFK B;  1BDJ B;  3DM9 B;  1RMV A;  4QDL A;  1E83 A;  4KNV A;  2H8A A;  4E0I A;  1GM5 A;  3LLI A;  4C3B A;  1SMY F;  3KMI A;  4CS9 A;  4UDV A;  4JZA A;  1EKY A;  3MBG A;  5L3V A;  2OEV A;  1KU2 A;  2DYS C;  1RJ9 B;  4EBB A;  3JSZ A;  5A69 A;  2YWA A;  4N06 A;  4F4B A;  5DS6 A;  2J9W A;  5B3S C;  3TD7 A;  2L7A A;  3SEO A;  3UGO A;  4XEK A;  4H4K C;  2G3K A;  2YL3 A;  1CPQ A;  3U8V A;  4I3M A;  5A6B D;  5KYN A;  3W2W A;  2YL7 A;  3DWW A;  2J9V A;  3VRC A;  4EIY A;  4FAP B;  1T6Q A;  1RJ9 A;  3N2Z B;  5A6J A;  3UMH A;  3T9O A;  4P9T A;  2R7W A;  4XPW A;  3ITF A;  3NRH A;  2A0U A;  3EG9 B;  3GOD A;  3V5X A;  5JT4 A;  3SXY A;  2Q00 A;  3TK0 A;  1ZYR F;  1D1C A;  3B0P A;  2MHR A;  1FTS A;  1MMA A;  1S7Z A;  2KC3 A;  1ZZP A;  3ASN C;  3EG9 A;  2YZS A;  4YL0 A;  5COF A;  4MS2 A;  3U5S A;  3C62 A;  1ZHT A;  3IQ6 A;  3X1O A;  4CDA A;  2XLM A;  5BQH A;  4XTK A;  4BG0 A;  1WGW A;  3MFN A;  4JC7 A;  3SYN A;  2KGO A;  2RSE B;  2R05 A;  3GEE A;  1PV3 A;  2G3V A;  3HNK A;  5E2Q A;  2CGE A;  3K1I C;  4ZLD A;  3L8J A;  1L3P A;  2Y3B A;  5DS5 A;  1OCC C;  1LI7 A;  2X0C A;  1NFN A;  2GDC A;  4KNW A;  3LEO A;  5AGF A;  2XM4 A;  1YAU O;  5DQZ A;  4OIP F;  1YA7 O;  2HJ3 A;  3KH2 A;  2MWQ A;  3JYH A;  2J45 A;  4NY3 A;  4ER9 A;  2Q7R A;  1FNT c;  4JE9 A;  5L0F A;  4BEM J;  1VOM A;  4MW3 A;  2LP4 A;  5DLJ A;  3QTH A;  1H6G A;  3M4C A;  3K1H A;  3FDQ A;  1ZU4 A;  3IPM O;  1FFH A;  1OW6 A;  1VK5 A;  1TWA A;  2J9U A;  5EK0 A;  2QUP A;  1AEP A;  3PMR A;  3CQZ A;  4JCH A;  1RXQ A;  4B6I A;  4A4A A;  3LAY A;  5L0J A;  5L0D A;  5KYW B;  1E84 A;  5HSW A;  2R7R A;  2EPO A;  2J0W A;  4KBL A;  1Y6D A;  1HE9 A;  2WVN A;  2VCA A;  1V55 C;  3ASO C;  3C8G A;  4MVZ A;  4Q5S F;  4X0R A;  3L0I A;  1QSP A;  1A7E A;  3IHU A;  4JEB A;  4JTA B;  5KYW A;  3GM1 A;  2XM0 A;  2KQ9 A;  3EH1 A;  2PX0 A;  1NG1 A;  3IEE A;  2R7U A;  3B29 A;  3M4B A;  1LKX A;  3B0V C;  2KJG A;  2QY9 A;  2M64 A;  3ZQV A;  4G7H F;  4MVO A;  5L0I A;  2D5R B;  2HSQ A;  5A6A A;  1SZI A;  2CW0 F;  2HSB A;  3Q7G A;  2Q9A A;  4PJL A;  4PAC A;  5B1A C;  1R4T A;  1YVI A;  3JCU Q;  4Q4Z F;  4O6N A;  4JIO A;  3TQO A;  4JTD B;  2H7B A;  1CPR A;  1G4W R;  3CSK A;  2EPN A;  2EPL X;  5CI8 A;  2R7O A;  1WWP A;  2AVK A;  1B68 A;  4XQ1 A;  1OXK A;  1PCX A;  2PF4 E;  3H65 A;  4BJT A;  4EHP A;  1JPJ A;  2OU6 A;  2CYD A;  2OJE D;  4AL1 A;  1K04 A;  1Q0M A;  3DAG A;  1H7I A;  1YJG A;  1V54 C;  2W9Y A;  4YL1 A;  2LCH A;  2Y39 A;  1GS9 A;  3S0X A;  2Q9B A;  4DBQ A;  1N1C A;  1YYX A;  3AG4 C;  3QVZ A;  5L0G A;  4O6M A;  4I44 A;  3TOL A;  2KNH A;  4AL0 A;  3TOM A;  3NG1 A;  4JKV A;  4E17 A;  3HNL A;  2D4U A;  3T6B A;  3AG2 C;  3O10 A;  1V4A A;  3G4Z A;  4DBR A;  1UFB A;  2H7O A;  4MTO A;  3AG1 C;  3CZ6 A;  4XPX A;  2J7P A;  2YKZ A;  3UNG C;  3K33 A;  5F28 E;  1MQV A;  3F47 A;  4G0H A;  4O6Y A;  4GQH A;  5BQI A;  3AG3 C;  3EGD B;  4E0H A;  1YA9 A;  3AGT A;  2P1A A;  1O87 A;  3K7D A;  2ZXP A;  5FCL A;  2YL1 A;  4XWJ A;  1R5I D;  1KTM A;  4CSA C;  1BR1 A;  2XSE A;  2KYH A;  4N6H A;  1ZHW A;  1QPU A;  1G4U S;  3WAQ A;  2I15 A;  1FR0 A;  2HV6 A;  4DRI B;  3JYY A;  4MVQ A;  2HJM A;  3EGD A;  4IJJ A;  4PR9 A;  2F22 A;  4XEV A;  3SP1 A;  1ORY A;  3RF3 A;  1Q0F A;  4W8K A;  2YLD A;  4OD4 A;  4NTF A;  3GWN A;  3K1I A;  3R2P A;  2XLD A;  2ZXO A;  3JSE O;  1K40 A;  3FVY A;  4U5D E;  1VTM P;  1Q0G A;  4EBJ A;  5K0I A;  3QW0 A;  3LNR A;  3ZC4 A;  3POV A;  2A0B A;  4J30 B;  5DQT A;  5KYX B;  3JTL O;  3WG7 C;  1BBH A;  3OA1 A;  1Z63 A;  2XRH A;  3EPV A;  3FHD A;  5JUA A;  3Q6M A;  3K6B A;  2XLW A;  1H9T A;  3E70 C;  1VB5 A;  2JD3 A;  3RIP A;  2J8W A;  5TJ5 E;  2LFF A;  3VYW A;  3VAY A;  3F46 A;  5B1B C;  2NUP A;  1Z5Z A;  4YT5 A;  2I8B A;  5BQG A;  4XLN F;  4IAQ A;  3W8I A;  4ONS A;  2BE5 F;  1MND A;  1ORJ A;  1CGN A;  3A9C A;  1I4Z A;  1VYK A;  4MTG A;  1J8M F;  4ULW A;  5KYY B;  3GOR A;  3UGP A;  3KYI A;  2NSF A;  4LDQ A;  3R7C A;  1C02 A;  3LEV A;  3ZTM A;  2WVQ A;  2IOQ A;  1OCR C;  3LS0 A;  4WJ0 A;  3ECS A;  1D1B A;  1FMV A;  1C03 A;  2BC5 A;  2LFD A;  2ZD9 A;  4YT4 A;  3S84 A;  2FAP B;  1ZW2 A;  5AC4 A;  5KYY A;  2TMV P;  4JW1 A;  1ST6 A;  4HFK B;  1H9G A;  3LJB A;  1AUE A;  1YDI A;  2OCC C;  4E18 A;  3RVY A;  3DZA A;  3MX3 A;  3SNH A;  4BJ6 C;  2WVO A;  2CCY A;  4U5C E;  1SF8 A;  2ICW G;  1TR2 A;  5D92 A;  5FZT A;  4WGZ A;  4YT8 A;  3NMI A;  3CEX A;  3MYI A;  1V74 B;  4YK5 A;  2EIJ C;  1DOW A;  4AE4 A;  1APC A;  3LS1 A;  4MW8 A;  4RDA A;  5L0H A;  3DE8 A;  1W2W A;  2R7Q A;  1TWH A;  1XWJ A;  1T9K A;  4LDR A;  2P7V A;  2RD9 A;  2P61 A;  3IQ5 A;  4U9D A;  2R7S A;  4YL3 A;  1A41 A;  5AC5 A;  3EHM A;  4RD9 A;  2G62 A;  3NYL A;  4P6I C;  1NSG B;  2EIK C;  1T01 A;  1SYQ A;  3DI5 A;  4Q7C A;  2R03 A;  5BUO A;  4OIO F;  1HMD A;  2YRF A;  2DI3 A;  2YHS A;  1J8Y F;  4GEH A;  4N6C A;  3DD7 A;  2E87 A;  1Z3I X;  4HEA J;  3QZC A;  1ZHZ A;  3NYJ A;  3DM5 A;  5B3I A;  1A7D A;  3EFO B;  5L0C A;  4Z9J A;  2EIL C;  4XEF A;  2IXM A;  2FGY A;  3RFY A;  5JVE A;  3FMS A;  3EGX B;  4CS7 A;  4K0D A;  4DJ9 A;  2PNO A;  4DVZ A;  4KI2 A;  2PX3 A;  3EZH A;  1F1M A;  4K7B A;  3RVZ A;  3JT1 A;  4K1O A;  5KYU B;  3EFO A;  4QI0 A;  5E3A A;  1Z23 A;  1K05 A;  2A6E F;  4JUR I;  3KYJ A;  4BEJ A;  4CIH A;  4BJ5 C;  5E33 A;  5COM A;  4CS8 C;  2L6F A;  2V26 A;  4LLE A;  1LE2 A;  1JOG A;  1AVO B;  2HS5 A;  2KW3 C;  2R25 A;  1ZHY A;  4MND A;  4CSA A;  1HY5 A;  1NU9 C;  1S05 A;  2QE9 A;  1DOV A;  3TUL A;  4YWQ A;  2FFH A;  1I5N A;  3GM3 A;  2A1D D;  2GWW A;  1JPN A;  2W4B A;  3AQB A;  3U3F A;  1YAR O;  1A7V A;  3T4R A;  3NKD A;  1NFO A;  3NKE A;  2LSE A;  4KC9 A;  4G7Z F;  2DB4 A;  1M2O A;  4LER A;  1OKK A;  1JMW A;  1VMA A;  3ZSU A;  2XL4 A;  2WB7 A;  3W8H A;  3O55 A;  4CDY A;  3LES A;  3L1M A;  2Q3T A;  3U2M A;  2AWC A;  2QNL A;  1U0B B;  2ETS A;  4MVU A;  2HMQ A;  2ZPA A;  4IGG A;  1UG7 A;  3ABK C;  1ZVZ A;  5L3Q A;  4L6R A;  3FAJ A;  2LK4 A;  256B A;  3A11 A;  2NSG A;  4N4W A;  2M4E A;  3C8G D;  4U5E E;  4AX2 A;  4JTC B;  2KSF A;  5EHH A;  3T6G B;  3U9M A;  4CBE A;  4YN0 B;  2OKU A;  1D0Y A;  3JRT A;  2PP4 A;  1MNE A;  2PBE A;  3O6X A;  3HJC A;  1OR3 A;  4IWB A;  3G4X A;  3CAX A;  1WAT A;  3OEO A;  2VB6 A;  3K66 A;  5F5F A;  2JPU A;  2L6G A;  4FX5 A;  1VLT A;  3AQC A;  4QI2 A;  2NUT B;  1CGM E;  4I1M A;  3KKB A;  3LNM B;  4BJ6 A;  1ZU5 A;  2CNW A;  1WAS A;  2XXA B;  4EBK A;  2V3C C;  3RQG A;  3GAN A;  4R32 A;  4Z9I A;  1HW1 A;  1T6U A;  2L6H A;  2HMZ A;  4NC3 A;  2XLV A;  3GWL A;  3DXJ F;  1RKE B;  2LQG A;  1BR4 A;  2UUH A;  2VCC A;  3FXH A;  3NMJ A;  1QKR A;  2NUT A;  3T6J A;  2Z15 A;  3W4Y A;  1OW7 A;  3N0T A;  4J32 B;  3ZTZ A;  4C7O B;  4PFP A;  1WTY A;  4MQ9 F;  1VYI A;  3LLK A;  4IAR A;  1QQ3 A;  2DGJ A;  2GAQ A;  1OCO C;  3JRM O;  4CDV A;  1RKE A;  2L81 A;  2LD6 A;  4P9F A;  3H2V A;  2Y3G A;  5JSL A;  3WHN A;  3S90 A;  4C7O A;  2XLH A;  3WOD F;  3UMI A;  3N24 A;  3DMD A;  3M15 A;  3U8P A;  3NYM A;  4OIQ F;  3M1C B;  2OQM A;  3SXZ A;  4XLP F;  4EUK B;  2AU5 A;  3G50 A;  3QVY A;  2OEX A;  2J7P D;  1PD1 A;  1MMG A;  2XS1 A;  3ABM C;  3I5Q A;  5A6B A;  2HV7 A;  4MTF A;  2Y3H A;  5JRA A;  3DJN B;  2A6H F;  4HE8 D;  1IW7 F;  5KYX A;  4PJJ A;  3PHF 2;  1M2V B;  3HLZ A;  2BL2 A;  3ZIB A;  1GGQ A;  3QW1 A;  3RW0 A;  3ZQY A;  4BJ5 A;  3KPH A;  4DVY P;  4CS8 A;  4A2N B;  1ZW3 A;  2R7T A;  3ZWI A;  4RBN A;  1Y4C A;  3FAP B;  3JZ0 A;  3LUT B;  3BRJ A;  1NLX A;  1GQA A;  3C7J A;  4JVS A;  4LLC A;  4JJF A;  1NU7 D;  4HFF B;  1M2V A;  2B0H A;  1LS1 A;  5JS5 A;  4IAO A;  4D4N A;  3DKA A;  2EIM C;  5DVW A;  1RKC A;  4WGY A;  1G8X A;  2DYR C;  3IQC A;  3ZDL A;  5HV9 A;  1E2X A;  3IQT A;  2AWY A;  1D0Z A;  2J0X A;  2ZXW C;  2J46 A;  4OIN F;  2AP3 A;  1M56 C;  2MYS A;  1M6T A;  3HNI A;  4PJM A;  4PK4 A;  4M63 A;  4DXW A;  4U5G A;  3GEI A;  2IXO A;  1NZE A;  2R02 A;  2OJQ A;  2XS8 A;  3L8I A;  5T1D B;  1Z7Q c;  3S29 A;  5A6K A;  1O3U A;  4OD5 A;  3TJ5 A;  1ORS C;  1M57 C;  4JEA A;  1MMD A;  4WAB A;  3I5P A;  4ZLC A;  2WZL A;  5GPG B;  3U3B A;  1JAF A;  3NDB B;  1EQ1 A;  2YLG A;  2YEV A;  4JRZ A;  2ZXR A;  3RYL A;  1TWC A;  2HFI A;  1A0B A;  2XLE A;  3ATP A;  1D1A A;  2EPK X;  3OWT A;  5JP7 A;  4CIP A;  1OR2 A;  5EGY A;  4U5B E;  1D0X A;  1LI5 A;  1QVX A;  3UMK A;  2VC9 A;  1LM3 B;  3DJU B;  4BJ1 A;  2Q4F A;  4JCZ A;  1PD0 A;  4E7Z A;  3EZI A;  2C04 A;  3SXK A;  1HW2 A;  1U89 A;  4ANJ A;  3UR3 C;  3RKO F;  4PJN A;  1QLE C;  3GM2 A;  3V5Z A;  4Z9H A;  3EGX A;  3W2V A;  2EIN C;  2J9B A;  2YL0 A;  3FOP A;  3H2U A;  4LDK A;  4CJO A;  2IM8 A;  1WOL A;  5T3T A;  4EKW A;  1I4Y A;  3HKK A;  4G78 A;  2UUI A;  1E86 A;  3U0C A;  2H7V C;  2EPM X;  3NMK A;  5KYU A;  3SZR A;  2NPU A;  2B0J A;  5IY5 C;  1HE1 A;  1EA8 A;  1EI7 A;  4LAC B;  4GYT A;  4CX9 A;  4H54 A;  3HNJ A;  4C3E A;  3EH2 A;  1CGO A;  1U6H A;  3U9J A;  3Q6N A;  3KL4 A;  4E7S A;  3C18 A;  4DOZ A;  3E9V A;  4OIR F;  5CIV A;  2R9R B;  3C8G B;  1G5Z A;  1OW8 A;  1WN0 A;  4YJW A;  2KK1 A;  3B71 A;  4IRU A;  1Z6A A;  1Q0K A;  3DE9 A;  1YZA A;  1XZP A;  3S28 A;  1JRA A;  1FMW A;  1LVK A;  4U5F E;  3Q7L A;  2ASR A;  4MVM A;  4U5H A;  1QZX A;  3B9Q A;  2HUJ A;  2HKV A;  3O39 A;  3S9O A;  1FFT C;  1OCZ C;  4NQF A;  1ZHX A;  2W45 A;  4XPY A;  1E85 A;  3MLG A;  2Y3D A;  3HTK C;  2Q9C A;  2OG2 A;  2LIG A;  4IB4 A;  2PFD A;  3V5Y A;  3RQF A;  3RH3 A;  3BEH A;  4CS9 C;  3EQL F;  3EHN A;  3VF0 A;  2GFH A;  1JR8 A;  3VM6 A;  1L7C A;  2IXP A;  2QTV A;  3EJN A;  4EWC A;  4JJG A;  4C3D A;  2NG1 A;  2WZF A;  2XL6 A;  3DAF A;  4D4X A;  1BR2 A;  1C17 M;  4NTA A;  3PCV A;  2CDQ A;  1NBB A;  2A69 F;  3L34 A;  3RQE A;  5F5H A;  3US6 A;  4G7O F;  4J7T A;  2VH3 A;  1OKK D;  5T3W A;  1LS4 A;  3ZVR A;  1TFO B;  2X51 A;  4I1O B;  2QLA A;  4AE4 B;  1VLS A;  2XXA A;  2P6V A;  1LIH A;  3I4U A;  5D91 A;  3B0U X;  2GA0 A;  1OQC A;  2O9X A;  4BPM A;  2R7X A;  2WL8 A;  1TQG A;  4CJG A;  4U9E A;  5JLI A;  1Q0D A;  2R7V A;  4FWV A;  4NTB A;  1O5H A;  2C03 A;  5CI9 A;  3FOO A;  4J7Y A; 
#chains in the Genus database with same CATH homology
 2HJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...