2HJMA

Crystal structure of a singleton protein pf1176 from p. furiosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
HHHHHHMDLVEKVKELCLELEEENLAKAIERFITLTHGIEKTRGEAFAKASIYGFLEGILTTLKMKYSNEKIETLLNEVKTAREETEALLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PF1176
publication title Crystal structure of a singleton protein PF1176 from P. furiosus
rcsb
source organism Pyrococcus furiosus
total genus 32
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11505 DUF3216 Protein of unknown function (DUF3216)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) protein pf1176 like 2hjmA01
2HJMA
chains in the Genus database with same CATH superfamily
2EPOA 1NFNA 3UNGC 3VM6A 3DWWA 2Q00A 3TD7A 3LUTB 2QY9A 2R7RA 4ANJA 2QLAA 2Y69C 4XPXA 1MMDA 3SXZA 4AE4B 4P9FA 1WN0A 1D0XA 1GGQA 4QI2A 5E3AA 4UDVA 4JEAA 3TJ6A 4EIYA 5JVEA 1ORSC 4KNVA 3NMIA 3DXJF 4F4BA 1J8YF 4CS8C 1N1CA 3EGDB 5A6BA 3IPMO 1CGOA 2OCCC 3EG9A 3S90A 1TKNA 4R32A 4I1MA 4Q4ZF 1OQCA 2OOCA 4H4KC 2H8AA 2XLEA 3SXYA 3B9QA 2F22A 3RW0A 2XM0A 2NUTA 1FTSA 3LS1A 4AK9A 4HEAJ 1ZHYA 3GM1A 2R02A 4DRIB 5A6BD 4BJ5A 4YK5A 4E0IA 1KTMA 2Y39A 3S27A 4FAPB 5AC5A 5A6JA 2Y3HA 3V5ZA 1M2VA 3MYIA 1U6HA 1ZZPA 3EGXA 1AVOB 4BEMJ 1APCA 2I8BA 3QW1A 1LE4A 4MVQA 3DZAA 1PCXA 2P1AA 3EFOA 3OA1A 1OR3A 2CGEA 2CNWA 1T5OA 3A9CA 3TOMA 5F5FA 2XLMA 4IGGA 4MTOA 2J9UA 3I4UA 3FXHA 2P61A 4GEHA 1YA9A 2HS5A 4OD4A 5T3WA 3UGOA 2XXAA 1PD0A 2KNHA 1YYXA 3SYNA 2EPMX 3ZDLA 3H2VA 3KMIA 3SZRA 3NRHA 3V5YA 3B0VC 1RKEA 4FX5A 4EBJA 2C04A 2YL0A 3B0PA 1YAUO 3U9JA 5A6AA 2A0UA 4PJNA 2W45A 4PFPA 1GQAA 3IQ5A 2V3CC 2WZLA 5BQHA 2NSGA 3QVYA 1BDJB 1E86A 4MVUA 4MNDA 3C8GB 1WGWA 3M1CB 4DBRA 1H9GA 2HUJA 3CZ6A 3K1HA 2Q9AA 5AC4A 1BR2A 3HNLA 1HE9A 2MHRA 5HV9A 3WG7C 1QQ3A 4IAOA 3AG4C 3S0XA 3IEEA 2NUPB 3K1IA 3SNHA 4BJ6A 4DRJB 2BE5F 3EZIA 3FAJA 3RFYA 3RF3A 2VH3A 3T4RA 4OD5A 5JUAA 1RKCA 1Z3IX 1HMDA 1R4TA 1V54C 3DAGA 5KYYB 5B3SC 1W2WA 2G62A 2OEVA 3AG3C 3K33A 2LQGA 4H54A 4JIOA 2IXOA 4C3BA 4NQFA 4XEVA 1A7EA 1AUEA 2ZPAA 3OWTA 2XM4A 1K05A 3ASOC 3V7OA 2HV7A 1U89A 1HY5A 3EHNA 1MMNA 4MQ9F 3HJCA 1LM3B 1OW8A 1VYIA 1UFBA 5JRAA 3B0UX 2OQMA 3K1IC 5JSLA 4BJ6C 4RBNA 5L0GA 1HW2A 5L0HA 3DJNB 5T3TA 2UUIA 3EH1A 2VCAA 2J9VA 4KNWA 4JC7A 1FMWA 1L7CA 1V4AA 1TWHA 2YQYA 4JW1A 4DRHB 4MW8A 1OCZC 2YWAA 2XLHA 2X51A 3VAYA 3L8IA 3ZQYA 2CCYA 5TJ5E 3TJ5A 1ST6A 2W4MA 3C62A 1VLTA 2A0BA 3S9OA 1CGME 2JD3A 1BZ4A 3ASNC 4JTDB 4MVZA 4XPYA 3R7CA 3RKOF 1GM5A 2J7PA 4OINF 2LSEA 4KI2A 3FHDA 2XLVA 3VF0A 3KL4A 1SR2A 2VCCA 1OR2A 3DD7A 2WZGA 4IJJA 2KYHA 5E3CA 5B3IA 3AOUA 1H9TA 2Q9BA 4YT2A 5E33A 1I5NA 2L6HA 4MW3A 4XLNF 4CS9A 1ZU4A 4ER9A 4C7OB 1D0YA 3FOOA 1OXBA 3UMIA 3NKEA 3G50A 5IY5C 5L0CA 4G7OF 5KYWB 2J0WA 2EPKX 2YL7A 3CSKA 4PJMA 5BQGA 4NTBA 2YLDA 2A1DD 2ICWG 3ZWIA 3NYLA 3KH2A 4BG0A 1YDIA 1A0BA 5KYXA 2Q4FA 3G4XA 2M64A 3LEVA 5D92A 3NG1A 4O7GA 1NLXA 5F28E 4CBEA 4D4NA 2IBFA 1RJ9A 3DMDA 5L3VA 1ZYRF 5L0DA 1QSPA 1VOMA 3DE9A 3GWLA 2PP4A 3ABKC 3DJUB 1B68A 4BPMA 1D1BA 2M4EA 3DE8A 3S84A 4NY3A 1VYKA 1Z5ZA 3E9VA 1C02A 2XS8A 1BR4A 1CPRA 1SMYF 2QTVA 3GEEA 3KYIA 4CS9C 2EIJC 3CQZA 2J9BA 3O6XA 1FAPB 4LLEA 1SZIA 1Z23A 3JZ0A 3W4YA 2ZD9A 2HZ8A 2V26A 5COMA 2Q7RA 1O3UA 3RQEA 4BJ1A 3SP1A 1RMVA 2XLDA 2PX3A 3U0CA 4ZLDA 4EKWA 5EHHA 1JRAA 3LLIA 3ZG1A 1ZHTA 5BQIA 1T01A 1FR0A 2R7TA 3LLKA 3MBGA 1L3PA 4RD9A 3KPHA 2XL4A 3L0IA 1TFKB 4LLCA 1SYQA 3C63A 2ZXPA 1ORJA 2P7VA 3I5PA 3JTLO 4ONSA 3B71A 2P6VA 3O39A 1VK5A 3AGUA 4WGZA 4A2NB 5JT4A 2D4UA 3TQOA 3WHNA 3M15A 1K40A 3M4BA 4A4AA 4K0DA 1T6QA 2L7AA 4AL0A 2W9YA 2GDCA 2EPNA 1ZVZA 3H2UA 2XS1A 1UG7A 2R7OA 3EJNA 3DAFA 3N24A 4OIRF 3U2MA 4YWQA 4Q5SF 5K0IA 2KGOA 4N6HA 1HW1A 3S29A 2PNOA 3CAXA 1Q0GA 2B0HA 4QI0A 3SXKA 4XPWA 4MTGA 4NCQA 1EQ1A 3KYJA 1A7VA 4MTFA 5D91A 5CIVA 1MMAA 3GEIA 1D1CA 1YYJA 256BA 2YLGA 3LESA 4GYTA 4HFKB 4U5CE 2P0NA 2OEXA 2HFIA 2Q9CA 3EHMA 3JRTA 4JRZA 3AQCA 4M63A 4BJTA 4GQHA 3GM3A 5AGFA 4C3DA 4WABA 1JAFA 2CYDA 4G78A 1G4US 1NU7D 2O9XA 3DM9B 3W8HA 4BJ5C 1V55C 2J9WA 2GAQA 1G5ZA 3F47A 3MLGA 4Z9HA 2Y3DA 3PMRA 3HLZA 4NTFA 4Q7CA 2WB7A 1ZHXA 2LFFA 4YT5A 3T9OA 3ZC4A 4EUKB 3V5XA 4J7TA 1OW6A 3MYFA 4WGYA 4BEJA 4ZLCA 1OKKA 4E17A 1I4YA 3KKBA 3U9MA 2Y3BA 1E84A 4U5HA 2KQ9A 2LP4A 4U5BE 2R25A 2W4BA 4RDAA 1WATA 5L0JA 2J45A 1ORYA 2GFHA 3U3BA 3NKDA 3TULA 1ZHWA 2R7QA 1OCCC 4P9TA 1OKKD 4O6NA 4E7ZA 2X0CA 4NC3A 1CPQA 1NU9C 1JR8A 3EPVA 5KYUA 2ZXRA 1TR2A 1YARO 4NTAA 1NBBA 3EG9B 4JCZA 1FFHA 5JS5A 2FAPB 4U5EE 4CDYA 2H7OA 4E7SA 1MQVA 1OCOC 2R05A 4JKVA 4PFOA 2YZSA 1ZU5A 4JEBA 2KK1A 1M6TA 2NUTB 1Y6DA 3AQBA 3Q7LA 1A7DA 3VRCA 1KNYA 3K66A 4I1OB 4IWBA 1D1AA 2I15A 1H7IA 3DM5A 3SXMA 4CIHA 2MYSA 4I44A 4LDQA 1C03A 1J8MF 1M2VB 3EGXB 3U2LA 5EGYA 4DXWA 2FGYA 3G4ZA 4X0RA 4U5GA 1FFTC 1WOLA 3E70C 2CDQA 4JURI 3EFOB 2AP3A 4PACA 1DOVA 3T6JA 5L0FA 3DI5A 2EIKC 2WVOA 4U9EA 4CDVA 3ZTZA 2XXAB 2HMZA 3SEOA 3NYMA 2OJQA 1Q0KA 2AVKA 4U5DE 1Z7Qc 4DOZA 1RXQA 5A69A 3QZCA 1JMWA 1CGNA 4I3MA 3AGTA 4JVSA 4EHPA 1YJGA 1RKEB 4AE4A 2IM8A 2PX0A 2DGJA 2H7VC 2PFDA 1D0ZA 1NFOA 1WASA 2AWYA 2OKUA 3EGDA 3A11A 4J32B 1ZHZA 2NG1A 1AEPA 4O6MA 2WZFA 4KBLA 2HV6A 4MVOA 2LFDA 4K7BA 2Y3GA 3LNMB 1E85A 5JP7A 1MMGA 2A6HF 2R9RB 2GWWA 3GWNA 5GPGB 3JSZA 3US6A 3NDBB 4MVSA 3U5SA 4G7ZF 2EINC 2BC5A 4CS7A 1BBHA 3L1MA 1R5ID 3W8IA 3RIPA 3RVZA 4JE9A 2HSQA 2HKVA 3NYJA 1YZCA 2PF4E 3Q6MA 3ZTMA 4JCHA 4W8PA 3FMSA 5E2QA 4YT4A 1K04A 2B0JA 1JPNA 1S7ZA 4WJ0A 4G7HF 5BUOA 4L6RA 3C8ZA 2YKZA 2YRFA 4MVMA 4XQ1A 4DBQA 1E83A 3AJMA 2NPUA 2A68F 1VTMP 1HMOA 3JT1A 1QLEC 4KC9A 4JTCB 3ZSUA 2R7UA 4EBBA 1RCPA 2L81A 1V74B 3HKKA 3WAQA 3PCVA 4HFFB 3U8VA 3BEHA 4JTAB 4LDKA 1MNEA 5EK0A 2HJ3A 1O5HA 1XWJA 4E18A 3FOPA 3ZIBA 1C17M 5L0IA 1WTYA 2QUPA 2IOQA 3C18A 2IXPA 2IYLD 3JCUQ 4DVZA 4FWVA 4CJOA 4XWJA 1QPUA 3GM2A 2H7BA 4ULVA 2OJED 5DS4A 3HNIA 3EZHA 2A69F 1E2XA 2RSEB 2R03A 1XZPA 3C8GA 1TWGA 4J30B 3IQCA 2WVQA 1EKYA 1LIHA 2HSBA 1LVKA 3MX3A 3QMKA 4K1OA 2G3VA 3JRMO 2Z15A 4CSAA 3O10A 2NUPA 2AU5A 4DJ9A 3QVZA 3BRJA 4IRUA 4OIOF 1T6IA 3C8GD 3L34A 2RD9A 1Z63A 1IZMA 4O79A 4E0HA 2LCHA 1G8XA 1LI5A 1Q0MA 3C7JA 4AL1A 2L9JA 5KYYA 2VC9A 5T1DB 3JYYA 4DVYP 5KYNA 3U3FA 2L6GA 2BL2A 4IAQA 2WL8A 5B1BC 3LJBA 1Y4CA 3N2ZB 1EA8A 2OG2A 1TWCA 4N06A 1JPJA 3GANA 1DOWA 1M2OA 1TFOB 1YA7O 3EQLF 3JSEO 2FFHA 1OXKA 1H6GA 3O55A 3Q6NA 3T6BA 5KYXB 4CSAC 3QTHA 1M57C 3RYLA 2XLWA 1LI7A 4LACB 2KC3A 1RJ9B 3UMKA 5DS6A 1HE1A 1XZQA 4JJGA 2QNLA 2QE9A 2XL6A 3PHF2 1A41A 3U8PA 2VASA 2EPLX 3GEHA 4MS2A 3X2QC 2IXNA 2JX0A 5F5HA 3M4CA 1S05A 4B6IA 1T9KA 2JPUA 4LERA 4EWCA 4OIQF 3LS0A 5DVWA 3ECSA 1OW7A 3R2PA 4C3EA 2HJMA 3I5QA 5A6KA 3N0TA 4N6CA 2TMVP 2CNWD 4LDRA 1LE2A 3F46A 2YLIA 3FAPB 3NMKA 1OCRC 4QDLA 3VYWA 2J8WA 1Q0FA 1VMAA 3NMJA 3LNRA 3UGPA 2KSFA 3X1OA 2YHSA 4OIPF 2C03A 2HMQA 2VB6A 3IHUA 1VLSA 5CI8A 5DLJA 4PJJA 1TQGA 5FCLA 4C7OA 4O6YA 2D5RB 5DQTA 1GS9A 1I4ZA 4IARA 2NSFA 3IQTA 3UMHA 1ZW3A 2DB4A 2EIMC 5KYWA 3JYHA 4XEKA 2VCBA 1LPEA 1SF8A 3QW0A 4G0HA 1ZW2A 2XSEA 3ABMC 4Z9JA 3RQGA 5HSWA 3ZQVA 2DI3A 3GODA 4ULWA 3RQFA 4CX9A 2XL8A 3AG1C 1FMVA 3FDQA 3HNKA 2E87A 5CI9A 1YLMA 3W2WA 2LIGA 3TK0A 4YL3A 3K6BA 4YT8A 1U0BB 2R7SA 4XTKA 5FZTA 1QKRA 1NSGB 2AWCA 2KJGA 4Z9IA 5DQZA 4MVRA 4U5FE 1PV3A 4PK4A 3AG2C 1NZEA 3HNJA 1Z6AA 3ITFA 4AX2A 5B1AC 4YL1A 1VB5A 3W2VA 4PR9A 4YN0B 1FNTc 5COFA 1LS4A 3M79A 3B29A 2YL1A 2L6FA 2R7XA 4XLPF 3J06A 1LKXA 2KW3C 1IW7F 2XLOA 3IQ6A 4EBKA 2MWQA 3Q7GA 2CW0F 5COGA 3WODF 2J46A 4JZAA 3K7DA 4N4WA 2R7WA 4FESA 2J0XA 4W8KA 4YL0A 5DS5A 5L3QA 1JOGA 2YEVA 1YZAA 2Q3TA 1LS1A 1YVIA 2WVNA 2YL3A 2DYSC 2ETSA 3PDMP 1WWPA 2XRHA 5KYUB 1PD1A 4CIPA 2IXMA 3POVA 2EILC 3LEOA 4CDAA 1KU2A 3UR3C 2DYRC 3ATPA 1NG1A 3DKAA 3CEXA 2A6EF 3MFNA 3TOLA 1QZXA 2ASRA 4HE8D 2PBEA 2YVKA 2LD6A 4XEFA 3HTKC 3RVYA 2OU6A 3OEOA 1TWAA 2J7PD 4J7YA 3RH3A 3ZVRA 1G4WR 2UUHA 2G3KA 3T6GB 2LK4A 3S28A 3H65A 3FVYA 3L8JA 3ABLC 1M56C 1F1MA 2R7VA 3GORA 5JLIA 4IB4A 4YJWA 1O87A 4D4XA 1QVXA 4JJFA 3EH2A 1T6UA 1Q0DA 1EI7A 4U9DA 4CS8A 2ZXWC 4PJLA 4CJGA 2GA0A 2ZXOA 1BR1A 3LAYA 4P6IC 1MNDA
chains in the Genus database with same CATH topology
2HJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJM A; 
#chains in the Genus database with same CATH topology
 2EPO A;  1NFN A;  3UNG C;  3VM6 A;  3DWW A;  2Q00 A;  3TD7 A;  3LUT B;  2QY9 A;  2R7R A;  4ANJ A;  2QLA A;  2Y69 C;  4XPX A;  1MMD A;  3SXZ A;  4AE4 B;  4P9F A;  1WN0 A;  1D0X A;  1GGQ A;  4QI2 A;  5E3A A;  4UDV A;  4JEA A;  3TJ6 A;  4EIY A;  5JVE A;  1ORS C;  4KNV A;  3NMI A;  3DXJ F;  4F4B A;  1J8Y F;  4CS8 C;  1N1C A;  3EGD B;  5A6B A;  3IPM O;  1CGO A;  2OCC C;  3EG9 A;  3S90 A;  1TKN A;  4R32 A;  4I1M A;  4Q4Z F;  1OQC A;  2OOC A;  4H4K C;  2H8A A;  2XLE A;  3SXY A;  3B9Q A;  2F22 A;  3RW0 A;  2XM0 A;  2NUT A;  1FTS A;  3LS1 A;  4AK9 A;  4HEA J;  1ZHY A;  3GM1 A;  2R02 A;  4DRI B;  5A6B D;  4BJ5 A;  4YK5 A;  4E0I A;  1KTM A;  2Y39 A;  3S27 A;  4FAP B;  5AC5 A;  5A6J A;  2Y3H A;  3V5Z A;  1M2V A;  3MYI A;  1U6H A;  1ZZP A;  3EGX A;  1AVO B;  4BEM J;  1APC A;  2I8B A;  3QW1 A;  1LE4 A;  4MVQ A;  3DZA A;  1PCX A;  2P1A A;  3EFO A;  3OA1 A;  1OR3 A;  2CGE A;  2CNW A;  1T5O A;  3A9C A;  3TOM A;  5F5F A;  2XLM A;  4IGG A;  4MTO A;  2J9U A;  3I4U A;  3FXH A;  2P61 A;  4GEH A;  1YA9 A;  2HS5 A;  4OD4 A;  5T3W A;  3UGO A;  2XXA A;  1PD0 A;  2KNH A;  1YYX A;  3SYN A;  2EPM X;  3ZDL A;  3H2V A;  3KMI A;  3SZR A;  3NRH A;  3V5Y A;  3B0V C;  1RKE A;  4FX5 A;  4EBJ A;  2C04 A;  2YL0 A;  3B0P A;  1YAU O;  3U9J A;  5A6A A;  2A0U A;  4PJN A;  2W45 A;  4PFP A;  1GQA A;  3IQ5 A;  2V3C C;  2WZL A;  5BQH A;  2NSG A;  3QVY A;  1BDJ B;  1E86 A;  4MVU A;  4MND A;  3C8G B;  1WGW A;  3M1C B;  4DBR A;  1H9G A;  2HUJ A;  3CZ6 A;  3K1H A;  2Q9A A;  5AC4 A;  1BR2 A;  3HNL A;  1HE9 A;  2MHR A;  5HV9 A;  3WG7 C;  1QQ3 A;  4IAO A;  3AG4 C;  3S0X A;  3IEE A;  2NUP B;  3K1I A;  3SNH A;  4BJ6 A;  4DRJ B;  2BE5 F;  3EZI A;  3FAJ A;  3RFY A;  3RF3 A;  2VH3 A;  3T4R A;  4OD5 A;  5JUA A;  1RKC A;  1Z3I X;  1HMD A;  1R4T A;  1V54 C;  3DAG A;  5KYY B;  5B3S C;  1W2W A;  2G62 A;  2OEV A;  3AG3 C;  3K33 A;  2LQG A;  4H54 A;  4JIO A;  2IXO A;  4C3B A;  4NQF A;  4XEV A;  1A7E A;  1AUE A;  2ZPA A;  3OWT A;  2XM4 A;  1K05 A;  3ASO C;  3V7O A;  2HV7 A;  1U89 A;  1HY5 A;  3EHN A;  1MMN A;  4MQ9 F;  3HJC A;  1LM3 B;  1OW8 A;  1VYI A;  1UFB A;  5JRA A;  3B0U X;  2OQM A;  3K1I C;  5JSL A;  4BJ6 C;  4RBN A;  5L0G A;  1HW2 A;  5L0H A;  3DJN B;  5T3T A;  2UUI A;  3EH1 A;  2VCA A;  2J9V A;  4KNW A;  4JC7 A;  1FMW A;  1L7C A;  1V4A A;  1TWH A;  2YQY A;  4JW1 A;  4DRH B;  4MW8 A;  1OCZ C;  2YWA A;  2XLH A;  2X51 A;  3VAY A;  3L8I A;  3ZQY A;  2CCY A;  5TJ5 E;  3TJ5 A;  1ST6 A;  2W4M A;  3C62 A;  1VLT A;  2A0B A;  3S9O A;  1CGM E;  2JD3 A;  1BZ4 A;  3ASN C;  4JTD B;  4MVZ A;  4XPY A;  3R7C A;  3RKO F;  1GM5 A;  2J7P A;  4OIN F;  2LSE A;  4KI2 A;  3FHD A;  2XLV A;  3VF0 A;  3KL4 A;  1SR2 A;  2VCC A;  1OR2 A;  3DD7 A;  2WZG A;  4IJJ A;  2KYH A;  5E3C A;  5B3I A;  3AOU A;  1H9T A;  2Q9B A;  4YT2 A;  5E33 A;  1I5N A;  2L6H A;  4MW3 A;  4XLN F;  4CS9 A;  1ZU4 A;  4ER9 A;  4C7O B;  1D0Y A;  3FOO A;  1OXB A;  3UMI A;  3NKE A;  3G50 A;  5IY5 C;  5L0C A;  4G7O F;  5KYW B;  2J0W A;  2EPK X;  2YL7 A;  3CSK A;  4PJM A;  5BQG A;  4NTB A;  2YLD A;  2A1D D;  2ICW G;  3ZWI A;  3NYL A;  3KH2 A;  4BG0 A;  1YDI A;  1A0B A;  5KYX A;  2Q4F A;  3G4X A;  2M64 A;  3LEV A;  5D92 A;  3NG1 A;  4O7G A;  1NLX A;  5F28 E;  4CBE A;  4D4N A;  2IBF A;  1RJ9 A;  3DMD A;  5L3V A;  1ZYR F;  5L0D A;  1QSP A;  1VOM A;  3DE9 A;  3GWL A;  2PP4 A;  3ABK C;  3DJU B;  1B68 A;  4BPM A;  1D1B A;  2M4E A;  3DE8 A;  3S84 A;  4NY3 A;  1VYK A;  1Z5Z A;  3E9V A;  1C02 A;  2XS8 A;  1BR4 A;  1CPR A;  1SMY F;  2QTV A;  3GEE A;  3KYI A;  4CS9 C;  2EIJ C;  3CQZ A;  2J9B A;  3O6X A;  1FAP B;  4LLE A;  1SZI A;  1Z23 A;  3JZ0 A;  3W4Y A;  2ZD9 A;  2HZ8 A;  2V26 A;  5COM A;  2Q7R A;  1O3U A;  3RQE A;  4BJ1 A;  3SP1 A;  1RMV A;  2XLD A;  2PX3 A;  3U0C A;  4ZLD A;  4EKW A;  5EHH A;  1JRA A;  3LLI A;  3ZG1 A;  1ZHT A;  5BQI A;  1T01 A;  1FR0 A;  2R7T A;  3LLK A;  3MBG A;  1L3P A;  4RD9 A;  3KPH A;  2XL4 A;  3L0I A;  1TFK B;  4LLC A;  1SYQ A;  3C63 A;  2ZXP A;  1ORJ A;  2P7V A;  3I5P A;  3JTL O;  4ONS A;  3B71 A;  2P6V A;  3O39 A;  1VK5 A;  3AGU A;  4WGZ A;  4A2N B;  5JT4 A;  2D4U A;  3TQO A;  3WHN A;  3M15 A;  1K40 A;  3M4B A;  4A4A A;  4K0D A;  1T6Q A;  2L7A A;  4AL0 A;  2W9Y A;  2GDC A;  2EPN A;  1ZVZ A;  3H2U A;  2XS1 A;  1UG7 A;  2R7O A;  3EJN A;  3DAF A;  3N24 A;  4OIR F;  3U2M A;  4YWQ A;  4Q5S F;  5K0I A;  2KGO A;  4N6H A;  1HW1 A;  3S29 A;  2PNO A;  3CAX A;  1Q0G A;  2B0H A;  4QI0 A;  3SXK A;  4XPW A;  4MTG A;  4NCQ A;  1EQ1 A;  3KYJ A;  1A7V A;  4MTF A;  5D91 A;  5CIV A;  1MMA A;  3GEI A;  1D1C A;  1YYJ A;  256B A;  2YLG A;  3LES A;  4GYT A;  4HFK B;  4U5C E;  2P0N A;  2OEX A;  2HFI A;  2Q9C A;  3EHM A;  3JRT A;  4JRZ A;  3AQC A;  4M63 A;  4BJT A;  4GQH A;  3GM3 A;  5AGF A;  4C3D A;  4WAB A;  1JAF A;  2CYD A;  4G78 A;  1G4U S;  1NU7 D;  2O9X A;  3DM9 B;  3W8H A;  4BJ5 C;  1V55 C;  2J9W A;  2GAQ A;  1G5Z A;  3F47 A;  3MLG A;  4Z9H A;  2Y3D A;  3PMR A;  3HLZ A;  4NTF A;  4Q7C A;  2WB7 A;  1ZHX A;  2LFF A;  4YT5 A;  3T9O A;  3ZC4 A;  4EUK B;  3V5X A;  4J7T A;  1OW6 A;  3MYF A;  4WGY A;  4BEJ A;  4ZLC A;  1OKK A;  4E17 A;  1I4Y A;  3KKB A;  3U9M A;  2Y3B A;  1E84 A;  4U5H A;  2KQ9 A;  2LP4 A;  4U5B E;  2R25 A;  2W4B A;  4RDA A;  1WAT A;  5L0J A;  2J45 A;  1ORY A;  2GFH A;  3U3B A;  3NKD A;  3TUL A;  1ZHW A;  2R7Q A;  1OCC C;  4P9T A;  1OKK D;  4O6N A;  4E7Z A;  2X0C A;  4NC3 A;  1CPQ A;  1NU9 C;  1JR8 A;  3EPV A;  5KYU A;  2ZXR A;  1TR2 A;  1YAR O;  4NTA A;  1NBB A;  3EG9 B;  4JCZ A;  1FFH A;  5JS5 A;  2FAP B;  4U5E E;  4CDY A;  2H7O A;  4E7S A;  1MQV A;  1OCO C;  2R05 A;  4JKV A;  4PFO A;  2YZS A;  1ZU5 A;  4JEB A;  2KK1 A;  1M6T A;  2NUT B;  1Y6D A;  3AQB A;  3Q7L A;  1A7D A;  3VRC A;  1KNY A;  3K66 A;  4I1O B;  4IWB A;  1D1A A;  2I15 A;  1H7I A;  3DM5 A;  3SXM A;  4CIH A;  2MYS A;  4I44 A;  4LDQ A;  1C03 A;  1J8M F;  1M2V B;  3EGX B;  3U2L A;  5EGY A;  4DXW A;  2FGY A;  3G4Z A;  4X0R A;  4U5G A;  1FFT C;  1WOL A;  3E70 C;  2CDQ A;  4JUR I;  3EFO B;  2AP3 A;  4PAC A;  1DOV A;  3T6J A;  5L0F A;  3DI5 A;  2EIK C;  2WVO A;  4U9E A;  4CDV A;  3ZTZ A;  2XXA B;  2HMZ A;  3SEO A;  3NYM A;  2OJQ A;  1Q0K A;  2AVK A;  4U5D E;  1Z7Q c;  4DOZ A;  1RXQ A;  5A69 A;  3QZC A;  1JMW A;  1CGN A;  4I3M A;  3AGT A;  4JVS A;  4EHP A;  1YJG A;  1RKE B;  4AE4 A;  2IM8 A;  2PX0 A;  2DGJ A;  2H7V C;  2PFD A;  1D0Z A;  1NFO A;  1WAS A;  2AWY A;  2OKU A;  3EGD A;  3A11 A;  4J32 B;  1ZHZ A;  2NG1 A;  1AEP A;  4O6M A;  2WZF A;  4KBL A;  2HV6 A;  4MVO A;  2LFD A;  4K7B A;  2Y3G A;  3LNM B;  1E85 A;  5JP7 A;  1MMG A;  2A6H F;  2R9R B;  2GWW A;  3GWN A;  5GPG B;  3JSZ A;  3US6 A;  3NDB B;  4MVS A;  3U5S A;  4G7Z F;  2EIN C;  2BC5 A;  4CS7 A;  1BBH A;  3L1M A;  1R5I D;  3W8I A;  3RIP A;  3RVZ A;  4JE9 A;  2HSQ A;  2HKV A;  3NYJ A;  1YZC A;  2PF4 E;  3Q6M A;  3ZTM A;  4JCH A;  4W8P A;  3FMS A;  5E2Q A;  4YT4 A;  1K04 A;  2B0J A;  1JPN A;  1S7Z A;  4WJ0 A;  4G7H F;  5BUO A;  4L6R A;  3C8Z A;  2YKZ A;  2YRF A;  4MVM A;  4XQ1 A;  4DBQ A;  1E83 A;  3AJM A;  2NPU A;  2A68 F;  1VTM P;  1HMO A;  3JT1 A;  1QLE C;  4KC9 A;  4JTC B;  3ZSU A;  2R7U A;  4EBB A;  1RCP A;  2L81 A;  1V74 B;  3HKK A;  3WAQ A;  3PCV A;  4HFF B;  3U8V A;  3BEH A;  4JTA B;  4LDK A;  1MNE A;  5EK0 A;  2HJ3 A;  1O5H A;  1XWJ A;  4E18 A;  3FOP A;  3ZIB A;  1C17 M;  5L0I A;  1WTY A;  2QUP A;  2IOQ A;  3C18 A;  2IXP A;  2IYL D;  3JCU Q;  4DVZ A;  4FWV A;  4CJO A;  4XWJ A;  1QPU A;  3GM2 A;  2H7B A;  4ULV A;  2OJE D;  5DS4 A;  3HNI A;  3EZH A;  2A69 F;  1E2X A;  2RSE B;  2R03 A;  1XZP A;  3C8G A;  1TWG A;  4J30 B;  3IQC A;  2WVQ A;  1EKY A;  1LIH A;  2HSB A;  1LVK A;  3MX3 A;  3QMK A;  4K1O A;  2G3V A;  3JRM O;  2Z15 A;  4CSA A;  3O10 A;  2NUP A;  2AU5 A;  4DJ9 A;  3QVZ A;  3BRJ A;  4IRU A;  4OIO F;  1T6I A;  3C8G D;  3L34 A;  2RD9 A;  1Z63 A;  1IZM A;  4O79 A;  4E0H A;  2LCH A;  1G8X A;  1LI5 A;  1Q0M A;  3C7J A;  4AL1 A;  2L9J A;  5KYY A;  2VC9 A;  5T1D B;  3JYY A;  4DVY P;  5KYN A;  3U3F A;  2L6G A;  2BL2 A;  4IAQ A;  2WL8 A;  5B1B C;  3LJB A;  1Y4C A;  3N2Z B;  1EA8 A;  2OG2 A;  1TWC A;  4N06 A;  1JPJ A;  3GAN A;  1DOW A;  1M2O A;  1TFO B;  1YA7 O;  3EQL F;  3JSE O;  2FFH A;  1OXK A;  1H6G A;  3O55 A;  3Q6N A;  3T6B A;  5KYX B;  4CSA C;  3QTH A;  1M57 C;  3RYL A;  2XLW A;  1LI7 A;  4LAC B;  2KC3 A;  1RJ9 B;  3UMK A;  5DS6 A;  1HE1 A;  1XZQ A;  4JJG A;  2QNL A;  2QE9 A;  2XL6 A;  3PHF 2;  1A41 A;  3U8P A;  2VAS A;  2EPL X;  3GEH A;  4MS2 A;  3X2Q C;  2IXN A;  2JX0 A;  5F5H A;  3M4C A;  1S05 A;  4B6I A;  1T9K A;  2JPU A;  4LER A;  4EWC A;  4OIQ F;  3LS0 A;  5DVW A;  3ECS A;  1OW7 A;  3R2P A;  4C3E A;  2HJM A;  3I5Q A;  5A6K A;  3N0T A;  4N6C A;  2TMV P;  2CNW D;  4LDR A;  1LE2 A;  3F46 A;  2YLI A;  3FAP B;  3NMK A;  1OCR C;  4QDL A;  3VYW A;  2J8W A;  1Q0F A;  1VMA A;  3NMJ A;  3LNR A;  3UGP A;  2KSF A;  3X1O A;  2YHS A;  4OIP F;  2C03 A;  2HMQ A;  2VB6 A;  3IHU A;  1VLS A;  5CI8 A;  5DLJ A;  4PJJ A;  1TQG A;  5FCL A;  4C7O A;  4O6Y A;  2D5R B;  5DQT A;  1GS9 A;  1I4Z A;  4IAR A;  2NSF A;  3IQT A;  3UMH A;  1ZW3 A;  2DB4 A;  2EIM C;  5KYW A;  3JYH A;  4XEK A;  2VCB A;  1LPE A;  1SF8 A;  3QW0 A;  4G0H A;  1ZW2 A;  2XSE A;  3ABM C;  4Z9J A;  3RQG A;  5HSW A;  3ZQV A;  2DI3 A;  3GOD A;  4ULW A;  3RQF A;  4CX9 A;  2XL8 A;  3AG1 C;  1FMV A;  3FDQ A;  3HNK A;  2E87 A;  5CI9 A;  1YLM A;  3W2W A;  2LIG A;  3TK0 A;  4YL3 A;  3K6B A;  4YT8 A;  1U0B B;  2R7S A;  4XTK A;  5FZT A;  1QKR A;  1NSG B;  2AWC A;  2KJG A;  4Z9I A;  5DQZ A;  4MVR A;  4U5F E;  1PV3 A;  4PK4 A;  3AG2 C;  1NZE A;  3HNJ A;  1Z6A A;  3ITF A;  4AX2 A;  5B1A C;  4YL1 A;  1VB5 A;  3W2V A;  4PR9 A;  4YN0 B;  1FNT c;  5COF A;  1LS4 A;  3M79 A;  3B29 A;  2YL1 A;  2L6F A;  2R7X A;  4XLP F;  3J06 A;  1LKX A;  2KW3 C;  1IW7 F;  2XLO A;  3IQ6 A;  4EBK A;  2MWQ A;  3Q7G A;  2CW0 F;  5COG A;  3WOD F;  2J46 A;  4JZA A;  3K7D A;  4N4W A;  2R7W A;  4FES A;  2J0X A;  4W8K A;  4YL0 A;  5DS5 A;  5L3Q A;  1JOG A;  2YEV A;  1YZA A;  2Q3T A;  1LS1 A;  1YVI A;  2WVN A;  2YL3 A;  2DYS C;  2ETS A;  3PDM P;  1WWP A;  2XRH A;  5KYU B;  1PD1 A;  4CIP A;  2IXM A;  3POV A;  2EIL C;  3LEO A;  4CDA A;  1KU2 A;  3UR3 C;  2DYR C;  3ATP A;  1NG1 A;  3DKA A;  3CEX A;  2A6E F;  3MFN A;  3TOL A;  1QZX A;  2ASR A;  4HE8 D;  2PBE A;  2YVK A;  2LD6 A;  4XEF A;  3HTK C;  3RVY A;  2OU6 A;  3OEO A;  1TWA A;  2J7P D;  4J7Y A;  3RH3 A;  3ZVR A;  1G4W R;  2UUH A;  2G3K A;  3T6G B;  2LK4 A;  3S28 A;  3H65 A;  3FVY A;  3L8J A;  3ABL C;  1M56 C;  1F1M A;  2R7V A;  3GOR A;  5JLI A;  4IB4 A;  4YJW A;  1O87 A;  4D4X A;  1QVX A;  4JJF A;  3EH2 A;  1T6U A;  1Q0D A;  1EI7 A;  4U9D A;  4CS8 A;  2ZXW C;  4PJL A;  4CJG A;  2GA0 A;  2ZXO A;  1BR1 A;  3LAY A;  4P6I C;  1MND A; 
#chains in the Genus database with same CATH homology
 2HJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...