2HJMA

Crystal structure of a singleton protein pf1176 from p. furiosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
HHHHHHMDLVEKVKELCLELEEENLAKAIERFITLTHGIEKTRGEAFAKASIYGFLEGILTTLKMKYSNEKIETLLNEVKTAREETEALLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a singleton protein PF1176 from P. furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PF1176
total genus 32
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11505 DUF3216 Protein of unknown function (DUF3216)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) protein pf1176 like 2hjmA01
2HJMA
chains in the Genus database with same CATH superfamily
1JOGA 5COGA 1E84A 2EILC 2D5RB 2LP4A 3AG4C 1L3PA 1ZHTA 1J8MF 1U6HA 2NUPB 3KPHA 4JEAA 1V4AA 2HUJA 2X0CA 1SYQA 3WAQA 3VAYA 1NBBA 5L0DA 3PHF2 4G0HA 2Q00A 1VYKA 2WVOA 3M4BA 4IB4A 3ZC4A 3EHMA 1U0BB 2DGJA 1NU9C 2R05A 3LNRA 2HSQA 2NSFA 4BJ1A 4AL1A 4U9EA 3K1IA 1D1CA 5B1BC 3I5PA 1YARO 1YDIA 2DI3A 1FFTC 2YQYA 3LJBA 1TKNA 3ZTZA 1M57C 5DVWA 5A6JA 1H6GA 1CGOA 3W8IA 3LESA 2IBFA 3MFNA 5L0CA 2VCBA 3J06A 3LEVA 3EH2A 5KYXB 2BC5A 2GDCA 2YKZA 5E3AA 3ASNC 3EGXA 3V5ZA 2FFHA 1L7CA 1T01A 3TQOA 2G62A 3M1CB 5KYWB 4U9DA 1YLMA 2YL1A 3QW1A 4ULVA 5D91A 1RJ9B 2XLWA 3ZQVA 5E33A 4JJFA 3AJMA 4CSAA 3C63A 2KC3A 3DAGA 4R32A 3GM1A 5E3CA 3N2ZB 2R7XA 3RF3A 2LK4A 3L8JA 1TFOB 2R7SA 2EIMC 3EPVA 4ZLDA 3S9OA 1Q0KA 1PV3A 3BRJA 3IEEA 1VTMP 4EIYA 2J0WA 3JRTA 5CI9A 2R25A 3QVZA 4XEVA 3U9MA 3PCVA 5F28E 1OKKA 4C3BA 4YJWA 3AG2C 1T5OA 3IQ5A 4LDKA 4DXWA 4O6NA 2CW0F 1EI7A 2EINC 1FFHA 1T6IA 4I3MA 3RYLA 1KTMA 1KU2A 1LKXA 2IXOA 4MVRA 4EHPA 4RD9A 4W8KA 5KYWA 4U5CE 1D0XA 4C3EA 2P1AA 3HTKC 1OW7A 2A69F 4AL0A 4Q5SF 1LS4A 2NG1A 4E7SA 4OINF 4E18A 4U5HA 2EPKX 4C7OA 1TWCA 1QZXA 2L7AA 2XLOA 4DVYP 3ASOC 4EBBA 1VMAA 2ZXOA 4ANJA 256BA 2ZPAA 4QI0A 4JCHA 2ETSA 5KYYA 1GQAA 2XLMA 1ORYA 2QTVA 4NQFA 1M2VB 3FVYA 3K6BA 2XLDA 1OCOC 4IRUA 4CS9C 3LLIA 4MVQA 3E9VA 1BR1A 2NPUA 4JTAB 1LI5A 4XPYA 4JIOA 2EPOA 2L81A 2IXNA 1Q0FA 2WVNA 1GM5A 1WGWA 3RVYA 3RFYA 2XS8A 2EPMX 5L0FA 3EG9A 5K0IA 3JRMO 3K1HA 2DYSC 3LLKA 4Q7CA 3JYYA 1MMDA 2W4BA 2Y3HA 4C7OB 1YZCA 2LFFA 4U5EE 1C17M 2FAPB 2QLAA 1OKKD 5A69A 4XLPF 2EPNA 3ABKC 3C18A 3H2UA 4WJ0A 3GEHA 2PNOA 1ZHYA 2LCHA 4Z9JA 2W45A 2OJQA 2VASA 5COMA 4BEMJ 3G4XA 3N24A 3M15A 1AUEA 2J9BA 1RKEB 5EK0A 4CS7A 5L0JA 1J8YF 4CX9A 1XZQA 1BR4A 2YL3A 3B9QA 3C8GD 2HV7A 3AQBA 4YL1A 3MYFA 2G3VA 4DJ9A 1JMWA 4U5GA 5AC5A 4Z9HA 4I1OB 1OCRC 3UMIA 2UUHA 1VOMA 1YA9A 1TQGA 3LAYA 3ABLC 4JE9A 1SF8A 3TD7A 1OXBA 3ZWIA 1WWPA 2WZLA 1YZAA 2D4UA 1SMYF 2NUTB 2NSGA 2Q9AA 4LLCA 4PACA 1I5NA 1I4ZA 2XXAB 4DBQA 4XPWA 3EFOA 4P6IC 2HSBA 1XZPA 4PK4A 3RQFA 2HZ8A 5AC4A 4OIPF 1QPUA 4D4XA 2XLEA 2J46A 3S28A 3GM3A 2MYSA 3C7JA 1S7ZA 2LD6A 3W8HA 4A4AA 1Z63A 3UGPA 2M64A 4B6IA 1VLTA 2Q9CA 4X0RA 2VCCA 5JS5A 1DOVA 1Z3IX 1M6TA 2YEVA 2HMZA 4AE4B 5JLIA 2QY9A 4JKVA 1JRAA 2GAQA 5KYUA 2Y3DA 2KSFA 3Q7GA 2NUTA 4EBKA 4MTOA 1WASA 1A41A 1RKEA 3O10A 4FX5A 4NCQA 3W2VA 1YYJA 4FESA 3ZVRA 1FR0A 2ZD9A 5BQGA 3KL4A 2J45A 2XRHA 3E70C 4ULWA 2HKVA 2VB6A 1V55C 2ASRA 4LDQA 1FAPB 1VYIA 1JAFA 1JR8A 2EIKC 4L6RA 1T9KA 4GYTA 4JW1A 1WOLA 2HS5A 4U5FE 2KGOA 2KW3C 2CNWA 3UNGC 3FOPA 3NYJA 3ZQYA 2V26A 3FAPB 2HFIA 1T6UA 3QTHA 1VLSA 4BJ6A 4CS8C 1F1MA 3V5XA 3ZIBA 3UMHA 1B68A 2AVKA 3AG3C 3VM6A 2VC9A 1NSGB 5IY5C 3OWTA 2KQ9A 4I44A 5JSLA 2RD9A 4AX2A 5FCLA 5L0GA 1BZ4A 3HLZA 3ZDLA 3I4UA 1LVKA 1TWHA 2Q9BA 4JTCB 3JCUQ 4N4WA 2Y69C 3CSKA 2J9WA 2L6GA 3TULA 4MVOA 3R7CA 1A7EA 2ICWG 4GEHA 3JZ0A 4YL0A 3RQEA 3WG7C 3KYIA 3T9OA 3WHNA 3M79A 1C02A 3KKBA 2OQMA 2XL4A 1NFNA 1O5HA 4BEJA 4MS2A 4G7OF 3AOUA 2QUPA 3TJ6A 3GWNA 3ZSUA 1Q0DA 3A11A 3LEOA 3HKKA 4H54A 4YN0B 3EJNA 4K7BA 1EKYA 3C8GA 1MQVA 1NLXA 2AWYA 2HV6A 3Q6MA 3U8VA 3DM9B 3VYWA 3C62A 2XM4A 4H4KC 1YVIA 3L1MA 4OD4A 4YK5A 2EIJC 3VRCA 1IW7F 3DE8A 3FAJA 4MTFA 3S90A 2MWQA 2PBEA 3NMIA 3B0PA 2CYDA 4CDAA 3B29A 3GODA 2P7VA 2H8AA 2QNLA 4KNWA 1MMNA 2LIGA 4PFOA 4WGZA 3OEOA 1Q0GA 3TK0A 3CQZA 2GA0A 3EGDA 5BQHA 2OJED 4YT2A 1A7DA 4MVZA 1UG7A 4KC9A 3C8ZA 1RCPA 5JT4A 4PJMA 3AG1C 3H2VA 3O39A 2Q7RA 5EGYA 1OCCC 4AE4A 1QVXA 4JZAA 2XL8A 5KYYB 5DS5A 3ITFA 2R7VA 1NZEA 1OXKA 1PD0A 1LS1A 3AGUA 3RIPA 3L0IA 3U8PA 2CNWD 1CGME 2R7TA 2R7WA 2WVQA 4IAOA 4NTBA 4CS9A 1M2OA 2ZXWC 3S27A 2OEVA 3TOMA 1OR2A 1GS9A 3EH1A 4XPXA 4QI2A 1R5ID 3GWLA 4W8PA 3NG1A 1OQCA 4G7ZF 4BJTA 3TOLA 1ZVZA 4DRHB 4KNVA 5CI8A 5F5FA 3IQCA 5T3TA 3H65A 4OIOF 4XEKA 3SP1A 4BPMA 1ZZPA 5B1AC 3CAXA 4JEBA 1V74B 2XL6A 2RSEB 4PJJA 2OEXA 2YLDA 3S0XA 1M56C 4ZLCA 3K7DA 1W2WA 1C03A 1UFBA 3LS0A 3GANA 3SZRA 2R7OA 4FAPB 3EFOB 2Q3TA 2YHSA 4K0DA 4JRZA 1FTSA 1LM3B 4PJNA 2C03A 2KNHA 3U9JA 5HSWA 1OCZC 4IJJA 1M2VA 5AGFA 3EQLF 2E87A 1Z6AA 2B0HA 2JPUA 2LQGA 1H7IA 2P0NA 3AGTA 1K40A 2A6EF 5JRAA 2Y3BA 4NY3A 2Z15A 3MX3A 2I15A 1PD1A 4XWJA 2YL0A 1Y4CA 4BJ6C 3Q7LA 1O3UA 3W4YA 4CS8A 3FHDA 4G7HF 1VB5A 2L9JA 2PF4E 3JSZA 4XTKA 4DVZA 4EBJA 3GORA 4QDLA 2AP3A 4MTGA 4BJ5A 4CDVA 3W2WA 4MW3A 1JPNA 3UGOA 3B0UX 1NFOA 3FDQA 3SXYA 5JVEA 4CDYA 4KBLA 4EKWA 1LPEA 3R2PA 3DKAA 3G50A 1OW8A 4E0HA 2IOQA 1QSPA 3DXJF 3MYIA 3RKOF 1FMWA 4DBRA 1K05A 2Y3GA 1ZU5A 5JP7A 2X51A 3N0TA 1LIHA 2LSEA 4MVMA 3U0CA 1RKCA 2GWWA 1HW2A 1TWAA 3F47A 1AVOB 5DS4A 5L0HA 4N6HA 1YAUO 4D4NA 5L0IA 3U3FA 1G4WR 3B71A 3B0VC 3CEXA 3DI5A 4HEAJ 4GQHA 1G5ZA 1ZU4A 1Y6DA 2VH3A 1NU7D 3DJUB 2P6VA 3KH2A 1YJGA 2G3KA 3LNMB 5TJ5E 1EQ1A 1YYXA 4DOZA 3RQGA 3IQTA 4UDVA 4A2NB 2R7RA 1HE9A 3S29A 4PR9A 3GEEA 2GFHA 4OD5A 4FWVA 2PX0A 1N1CA 3DMDA 1E83A 4OIQF 2KK1A 1HMOA 2CGEA 3IQ6A 3MLGA 1IZMA 3T6JA 1YA7O 3HNIA 2LFDA 4BG0A 2CCYA 1JPJA 1BR2A 4O7GA 1HMDA 5DQTA 4ER9A 4XEFA 2YVKA 3UR3C 3SEOA 4IWBA 4DRJB 3TJ5A 4EWCA 3U2LA 1MMGA 4E7ZA 5L3QA 1A7VA 4E0IA 3K1IC 2VCAA 1KNYA 3NMKA 1G4US 5D92A 4EUKB 5HV9A 1ZHXA 2BE5F 1ORJA 3F46A 1PCXA 3SYNA 2MHRA 2WB7A 5KYUB 1D0YA 2R9RB 4MVUA 1H9GA 1I4YA 2Q4FA 3NMJA 3KMIA 1Q0MA 1CPQA 1HY5A 2J8WA 1XWJA 4J7YA 5L3VA 2AWCA 2OKUA 3NYLA 4N6CA 3DWWA 5KYXA 3FXHA 3L34A 2XLVA 4G78A 2R02A 4XLNF 4NC3A 2EPLX 2J7PD 5A6KA 2KYHA 4YT5A 3QMKA 3V7OA 3HNKA 1NG1A 2YL7A 4MNDA 3X1OA 1D1AA 2BL2A 3L8IA 3ZTMA 5KYNA 1WATA 3C8GB 2YWAA 4JCZA 3US6A 2A6HF 5A6BD 2CDQA 1OR3A 1G8XA 2YLGA 4HFKB 3SXMA 3DZAA 2WL8A 3QVYA 3U5SA 2H7OA 1O87A 2WZGA 1H9TA 2IM8A 4NTFA 4JURI 4CIPA 3O6XA 1WN0A 1ZW3A 3DAFA 3EHNA 4E17A 3RH3A 2TMVP 4I1MA 5JUAA 1ZHWA 5DLJA 5F5HA 4KI2A 2A1DD 1LE4A 2JD3A 4IAQA 3FMSA 4JC7A 4LLEA 1TR2A 2H7VC 4WGYA 2ZXRA 2WZFA 3OA1A 4MQ9F 1SZIA 3DM5A 1FNTc 2C04A 3CZ6A 3K33A 3PDMP 5A6AA 4IARA 5CIVA 3T6BA 4BJ5C 2A0BA 3UMKA 1HW1A 4HE8D 3NRHA 4J7TA 3GEIA 5BQIA 2XSEA 1ST6A 4HFFB 2XXAA 1ZW2A 4NTAA 5COFA 2NUPA 2A68F 2O9XA 4WABA 3HNLA 5T1DB 4CJOA 1QLEC 4O6MA 2JX0A 2PX3A 3EZIA 5DQZA 5B3IA 3K66A 4Z9IA 1QKRA 3JT1A 3V5YA 4PJLA 2M4EA 1GGQA 1ZYRF 2R03A 2YRFA 4LDRA 2I8BA 2Y39A 2HJMA 4AK9A 3HJCA 1RMVA 2H7BA 1BDJB 1QQ3A 2HMQA 1RJ9A 3M4CA 3Q6NA 2AU5A 2PP4A 1MNDA 3SNHA 3GM2A 3S84A 3POVA 1FMVA 2W9YA 3QW0A 3ATPA 4O6YA 4RDAA 4IGGA 3EGXB 3WODF 2L6FA 3O55A 2DYRC 4J30B 3JTLO 3PMRA 4JVSA 3DD7A 1ORSC 4MW8A 5BUOA 3NDBB 3JSEO 5T3WA 4P9FA 4PFPA 4RBNA 3LS1A 1DOWA 3X2QC 3DJNB 4Q4ZF 1T6QA 3JYHA 1APCA 1HE1A 1R4TA 1TFKB 3A9CA 3ECSA 2XM0A 5A6BA 2V3CC 3NKEA 3EG9B 4CSAC 2A0UA 4JTDB 3EGDB 4JJGA 1ZHZA 3HNJA 3U2MA 1BBHA 3AQCA 2OU6A 4U5BE 1MMAA 1OW6A 2PFDA 4XQ1A 1E86A 4YT8A 2IYLD 3EZHA 2B0JA 2J9VA 2J0XA 3BEHA 3KYJA 3IHUA 4LERA 4P9TA 4OIRF 1Z7Qc 3ZG1A 1E85A 4O79A 2R7QA 4YWQA 1Z5ZA 3NKDA 2L6HA 3RW0A 3FOOA 1VK5A 2ZXPA 1MNEA 3I5QA 5FZTA 1AEPA 3LUTB 2HJ3A 4YT4A 3SXZA 1RXQA 3DE9A 5B3SC 4LACB 4M63A 3G4ZA 2J7PA 5E2QA 3RVZA 2KJGA 2IXPA 1U89A 3QZCA 4C3DA 4K1OA 4DRIB 4CIHA 1SR2A 2R7UA 2QE9A 2OCCC 3U3BA 3NYMA 2OG2A 4MVSA 3IPMO 1D1BA 1WTYA 2IXMA 2XS1A 4J32B 1S05A 2FGYA 2YLIA 3SXKA 1E2XA 1LI7A 2UUIA 1CGNA 1V54C 1TWGA 4ONSA 1EA8A 4U5DE 1LE2A 3ABMC 3T4RA 1D0ZA 4YL3A 5GPGB 1Z23A 3MBGA 3VF0A 2YZSA 4CJGA 2OOCA 1CPRA 4F4BA 2DB4A 2XLHA 2F22A 3T6GB 4CBEA 1K04A 2J9UA 2W4MA 5DS6A 5EHHA 4N06A 2P61A 1A0BA
chains in the Genus database with same CATH topology
2HJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJM A; 
#chains in the Genus database with same CATH topology
 1JOG A;  5COG A;  1E84 A;  2EIL C;  2D5R B;  2LP4 A;  3AG4 C;  1L3P A;  1ZHT A;  1J8M F;  1U6H A;  2NUP B;  3KPH A;  4JEA A;  1V4A A;  2HUJ A;  2X0C A;  1SYQ A;  3WAQ A;  3VAY A;  1NBB A;  5L0D A;  3PHF 2;  4G0H A;  2Q00 A;  1VYK A;  2WVO A;  3M4B A;  4IB4 A;  3ZC4 A;  3EHM A;  1U0B B;  2DGJ A;  1NU9 C;  2R05 A;  3LNR A;  2HSQ A;  2NSF A;  4BJ1 A;  4AL1 A;  4U9E A;  3K1I A;  1D1C A;  5B1B C;  3I5P A;  1YAR O;  1YDI A;  2DI3 A;  1FFT C;  2YQY A;  3LJB A;  1TKN A;  3ZTZ A;  1M57 C;  5DVW A;  5A6J A;  1H6G A;  1CGO A;  3W8I A;  3LES A;  2IBF A;  3MFN A;  5L0C A;  2VCB A;  3J06 A;  3LEV A;  3EH2 A;  5KYX B;  2BC5 A;  2GDC A;  2YKZ A;  5E3A A;  3ASN C;  3EGX A;  3V5Z A;  2FFH A;  1L7C A;  1T01 A;  3TQO A;  2G62 A;  3M1C B;  5KYW B;  4U9D A;  1YLM A;  2YL1 A;  3QW1 A;  4ULV A;  5D91 A;  1RJ9 B;  2XLW A;  3ZQV A;  5E33 A;  4JJF A;  3AJM A;  4CSA A;  3C63 A;  2KC3 A;  3DAG A;  4R32 A;  3GM1 A;  5E3C A;  3N2Z B;  2R7X A;  3RF3 A;  2LK4 A;  3L8J A;  1TFO B;  2R7S A;  2EIM C;  3EPV A;  4ZLD A;  3S9O A;  1Q0K A;  1PV3 A;  3BRJ A;  3IEE A;  1VTM P;  4EIY A;  2J0W A;  3JRT A;  5CI9 A;  2R25 A;  3QVZ A;  4XEV A;  3U9M A;  3PCV A;  5F28 E;  1OKK A;  4C3B A;  4YJW A;  3AG2 C;  1T5O A;  3IQ5 A;  4LDK A;  4DXW A;  4O6N A;  2CW0 F;  1EI7 A;  2EIN C;  1FFH A;  1T6I A;  4I3M A;  3RYL A;  1KTM A;  1KU2 A;  1LKX A;  2IXO A;  4MVR A;  4EHP A;  4RD9 A;  4W8K A;  5KYW A;  4U5C E;  1D0X A;  4C3E A;  2P1A A;  3HTK C;  1OW7 A;  2A69 F;  4AL0 A;  4Q5S F;  1LS4 A;  2NG1 A;  4E7S A;  4OIN F;  4E18 A;  4U5H A;  2EPK X;  4C7O A;  1TWC A;  1QZX A;  2L7A A;  2XLO A;  4DVY P;  3ASO C;  4EBB A;  1VMA A;  2ZXO A;  4ANJ A;  256B A;  2ZPA A;  4QI0 A;  4JCH A;  2ETS A;  5KYY A;  1GQA A;  2XLM A;  1ORY A;  2QTV A;  4NQF A;  1M2V B;  3FVY A;  3K6B A;  2XLD A;  1OCO C;  4IRU A;  4CS9 C;  3LLI A;  4MVQ A;  3E9V A;  1BR1 A;  2NPU A;  4JTA B;  1LI5 A;  4XPY A;  4JIO A;  2EPO A;  2L81 A;  2IXN A;  1Q0F A;  2WVN A;  1GM5 A;  1WGW A;  3RVY A;  3RFY A;  2XS8 A;  2EPM X;  5L0F A;  3EG9 A;  5K0I A;  3JRM O;  3K1H A;  2DYS C;  3LLK A;  4Q7C A;  3JYY A;  1MMD A;  2W4B A;  2Y3H A;  4C7O B;  1YZC A;  2LFF A;  4U5E E;  1C17 M;  2FAP B;  2QLA A;  1OKK D;  5A69 A;  4XLP F;  2EPN A;  3ABK C;  3C18 A;  3H2U A;  4WJ0 A;  3GEH A;  2PNO A;  1ZHY A;  2LCH A;  4Z9J A;  2W45 A;  2OJQ A;  2VAS A;  5COM A;  4BEM J;  3G4X A;  3N24 A;  3M15 A;  1AUE A;  2J9B A;  1RKE B;  5EK0 A;  4CS7 A;  5L0J A;  1J8Y F;  4CX9 A;  1XZQ A;  1BR4 A;  2YL3 A;  3B9Q A;  3C8G D;  2HV7 A;  3AQB A;  4YL1 A;  3MYF A;  2G3V A;  4DJ9 A;  1JMW A;  4U5G A;  5AC5 A;  4Z9H A;  4I1O B;  1OCR C;  3UMI A;  2UUH A;  1VOM A;  1YA9 A;  1TQG A;  3LAY A;  3ABL C;  4JE9 A;  1SF8 A;  3TD7 A;  1OXB A;  3ZWI A;  1WWP A;  2WZL A;  1YZA A;  2D4U A;  1SMY F;  2NUT B;  2NSG A;  2Q9A A;  4LLC A;  4PAC A;  1I5N A;  1I4Z A;  2XXA B;  4DBQ A;  4XPW A;  3EFO A;  4P6I C;  2HSB A;  1XZP A;  4PK4 A;  3RQF A;  2HZ8 A;  5AC4 A;  4OIP F;  1QPU A;  4D4X A;  2XLE A;  2J46 A;  3S28 A;  3GM3 A;  2MYS A;  3C7J A;  1S7Z A;  2LD6 A;  3W8H A;  4A4A A;  1Z63 A;  3UGP A;  2M64 A;  4B6I A;  1VLT A;  2Q9C A;  4X0R A;  2VCC A;  5JS5 A;  1DOV A;  1Z3I X;  1M6T A;  2YEV A;  2HMZ A;  4AE4 B;  5JLI A;  2QY9 A;  4JKV A;  1JRA A;  2GAQ A;  5KYU A;  2Y3D A;  2KSF A;  3Q7G A;  2NUT A;  4EBK A;  4MTO A;  1WAS A;  1A41 A;  1RKE A;  3O10 A;  4FX5 A;  4NCQ A;  3W2V A;  1YYJ A;  4FES A;  3ZVR A;  1FR0 A;  2ZD9 A;  5BQG A;  3KL4 A;  2J45 A;  2XRH A;  3E70 C;  4ULW A;  2HKV A;  2VB6 A;  1V55 C;  2ASR A;  4LDQ A;  1FAP B;  1VYI A;  1JAF A;  1JR8 A;  2EIK C;  4L6R A;  1T9K A;  4GYT A;  4JW1 A;  1WOL A;  2HS5 A;  4U5F E;  2KGO A;  2KW3 C;  2CNW A;  3UNG C;  3FOP A;  3NYJ A;  3ZQY A;  2V26 A;  3FAP B;  2HFI A;  1T6U A;  3QTH A;  1VLS A;  4BJ6 A;  4CS8 C;  1F1M A;  3V5X A;  3ZIB A;  3UMH A;  1B68 A;  2AVK A;  3AG3 C;  3VM6 A;  2VC9 A;  1NSG B;  5IY5 C;  3OWT A;  2KQ9 A;  4I44 A;  5JSL A;  2RD9 A;  4AX2 A;  5FCL A;  5L0G A;  1BZ4 A;  3HLZ A;  3ZDL A;  3I4U A;  1LVK A;  1TWH A;  2Q9B A;  4JTC B;  3JCU Q;  4N4W A;  2Y69 C;  3CSK A;  2J9W A;  2L6G A;  3TUL A;  4MVO A;  3R7C A;  1A7E A;  2ICW G;  4GEH A;  3JZ0 A;  4YL0 A;  3RQE A;  3WG7 C;  3KYI A;  3T9O A;  3WHN A;  3M79 A;  1C02 A;  3KKB A;  2OQM A;  2XL4 A;  1NFN A;  1O5H A;  4BEJ A;  4MS2 A;  4G7O F;  3AOU A;  2QUP A;  3TJ6 A;  3GWN A;  3ZSU A;  1Q0D A;  3A11 A;  3LEO A;  3HKK A;  4H54 A;  4YN0 B;  3EJN A;  4K7B A;  1EKY A;  3C8G A;  1MQV A;  1NLX A;  2AWY A;  2HV6 A;  3Q6M A;  3U8V A;  3DM9 B;  3VYW A;  3C62 A;  2XM4 A;  4H4K C;  1YVI A;  3L1M A;  4OD4 A;  4YK5 A;  2EIJ C;  3VRC A;  1IW7 F;  3DE8 A;  3FAJ A;  4MTF A;  3S90 A;  2MWQ A;  2PBE A;  3NMI A;  3B0P A;  2CYD A;  4CDA A;  3B29 A;  3GOD A;  2P7V A;  2H8A A;  2QNL A;  4KNW A;  1MMN A;  2LIG A;  4PFO A;  4WGZ A;  3OEO A;  1Q0G A;  3TK0 A;  3CQZ A;  2GA0 A;  3EGD A;  5BQH A;  2OJE D;  4YT2 A;  1A7D A;  4MVZ A;  1UG7 A;  4KC9 A;  3C8Z A;  1RCP A;  5JT4 A;  4PJM A;  3AG1 C;  3H2V A;  3O39 A;  2Q7R A;  5EGY A;  1OCC C;  4AE4 A;  1QVX A;  4JZA A;  2XL8 A;  5KYY B;  5DS5 A;  3ITF A;  2R7V A;  1NZE A;  1OXK A;  1PD0 A;  1LS1 A;  3AGU A;  3RIP A;  3L0I A;  3U8P A;  2CNW D;  1CGM E;  2R7T A;  2R7W A;  2WVQ A;  4IAO A;  4NTB A;  4CS9 A;  1M2O A;  2ZXW C;  3S27 A;  2OEV A;  3TOM A;  1OR2 A;  1GS9 A;  3EH1 A;  4XPX A;  4QI2 A;  1R5I D;  3GWL A;  4W8P A;  3NG1 A;  1OQC A;  4G7Z F;  4BJT A;  3TOL A;  1ZVZ A;  4DRH B;  4KNV A;  5CI8 A;  5F5F A;  3IQC A;  5T3T A;  3H65 A;  4OIO F;  4XEK A;  3SP1 A;  4BPM A;  1ZZP A;  5B1A C;  3CAX A;  4JEB A;  1V74 B;  2XL6 A;  2RSE B;  4PJJ A;  2OEX A;  2YLD A;  3S0X A;  1M56 C;  4ZLC A;  3K7D A;  1W2W A;  1C03 A;  1UFB A;  3LS0 A;  3GAN A;  3SZR A;  2R7O A;  4FAP B;  3EFO B;  2Q3T A;  2YHS A;  4K0D A;  4JRZ A;  1FTS A;  1LM3 B;  4PJN A;  2C03 A;  2KNH A;  3U9J A;  5HSW A;  1OCZ C;  4IJJ A;  1M2V A;  5AGF A;  3EQL F;  2E87 A;  1Z6A A;  2B0H A;  2JPU A;  2LQG A;  1H7I A;  2P0N A;  3AGT A;  1K40 A;  2A6E F;  5JRA A;  2Y3B A;  4NY3 A;  2Z15 A;  3MX3 A;  2I15 A;  1PD1 A;  4XWJ A;  2YL0 A;  1Y4C A;  4BJ6 C;  3Q7L A;  1O3U A;  3W4Y A;  4CS8 A;  3FHD A;  4G7H F;  1VB5 A;  2L9J A;  2PF4 E;  3JSZ A;  4XTK A;  4DVZ A;  4EBJ A;  3GOR A;  4QDL A;  2AP3 A;  4MTG A;  4BJ5 A;  4CDV A;  3W2W A;  4MW3 A;  1JPN A;  3UGO A;  3B0U X;  1NFO A;  3FDQ A;  3SXY A;  5JVE A;  4CDY A;  4KBL A;  4EKW A;  1LPE A;  3R2P A;  3DKA A;  3G50 A;  1OW8 A;  4E0H A;  2IOQ A;  1QSP A;  3DXJ F;  3MYI A;  3RKO F;  1FMW A;  4DBR A;  1K05 A;  2Y3G A;  1ZU5 A;  5JP7 A;  2X51 A;  3N0T A;  1LIH A;  2LSE A;  4MVM A;  3U0C A;  1RKC A;  2GWW A;  1HW2 A;  1TWA A;  3F47 A;  1AVO B;  5DS4 A;  5L0H A;  4N6H A;  1YAU O;  4D4N A;  5L0I A;  3U3F A;  1G4W R;  3B71 A;  3B0V C;  3CEX A;  3DI5 A;  4HEA J;  4GQH A;  1G5Z A;  1ZU4 A;  1Y6D A;  2VH3 A;  1NU7 D;  3DJU B;  2P6V A;  3KH2 A;  1YJG A;  2G3K A;  3LNM B;  5TJ5 E;  1EQ1 A;  1YYX A;  4DOZ A;  3RQG A;  3IQT A;  4UDV A;  4A2N B;  2R7R A;  1HE9 A;  3S29 A;  4PR9 A;  3GEE A;  2GFH A;  4OD5 A;  4FWV A;  2PX0 A;  1N1C A;  3DMD A;  1E83 A;  4OIQ F;  2KK1 A;  1HMO A;  2CGE A;  3IQ6 A;  3MLG A;  1IZM A;  3T6J A;  1YA7 O;  3HNI A;  2LFD A;  4BG0 A;  2CCY A;  1JPJ A;  1BR2 A;  4O7G A;  1HMD A;  5DQT A;  4ER9 A;  4XEF A;  2YVK A;  3UR3 C;  3SEO A;  4IWB A;  4DRJ B;  3TJ5 A;  4EWC A;  3U2L A;  1MMG A;  4E7Z A;  5L3Q A;  1A7V A;  4E0I A;  3K1I C;  2VCA A;  1KNY A;  3NMK A;  1G4U S;  5D92 A;  4EUK B;  5HV9 A;  1ZHX A;  2BE5 F;  1ORJ A;  3F46 A;  1PCX A;  3SYN A;  2MHR A;  2WB7 A;  5KYU B;  1D0Y A;  2R9R B;  4MVU A;  1H9G A;  1I4Y A;  2Q4F A;  3NMJ A;  3KMI A;  1Q0M A;  1CPQ A;  1HY5 A;  2J8W A;  1XWJ A;  4J7Y A;  5L3V A;  2AWC A;  2OKU A;  3NYL A;  4N6C A;  3DWW A;  5KYX A;  3FXH A;  3L34 A;  2XLV A;  4G78 A;  2R02 A;  4XLN F;  4NC3 A;  2EPL X;  2J7P D;  5A6K A;  2KYH A;  4YT5 A;  3QMK A;  3V7O A;  3HNK A;  1NG1 A;  2YL7 A;  4MND A;  3X1O A;  1D1A A;  2BL2 A;  3L8I A;  3ZTM A;  5KYN A;  1WAT A;  3C8G B;  2YWA A;  4JCZ A;  3US6 A;  2A6H F;  5A6B D;  2CDQ A;  1OR3 A;  1G8X A;  2YLG A;  4HFK B;  3SXM A;  3DZA A;  2WL8 A;  3QVY A;  3U5S A;  2H7O A;  1O87 A;  2WZG A;  1H9T A;  2IM8 A;  4NTF A;  4JUR I;  4CIP A;  3O6X A;  1WN0 A;  1ZW3 A;  3DAF A;  3EHN A;  4E17 A;  3RH3 A;  2TMV P;  4I1M A;  5JUA A;  1ZHW A;  5DLJ A;  5F5H A;  4KI2 A;  2A1D D;  1LE4 A;  2JD3 A;  4IAQ A;  3FMS A;  4JC7 A;  4LLE A;  1TR2 A;  2H7V C;  4WGY A;  2ZXR A;  2WZF A;  3OA1 A;  4MQ9 F;  1SZI A;  3DM5 A;  1FNT c;  2C04 A;  3CZ6 A;  3K33 A;  3PDM P;  5A6A A;  4IAR A;  5CIV A;  3T6B A;  4BJ5 C;  2A0B A;  3UMK A;  1HW1 A;  4HE8 D;  3NRH A;  4J7T A;  3GEI A;  5BQI A;  2XSE A;  1ST6 A;  4HFF B;  2XXA A;  1ZW2 A;  4NTA A;  5COF A;  2NUP A;  2A68 F;  2O9X A;  4WAB A;  3HNL A;  5T1D B;  4CJO A;  1QLE C;  4O6M A;  2JX0 A;  2PX3 A;  3EZI A;  5DQZ A;  5B3I A;  3K66 A;  4Z9I A;  1QKR A;  3JT1 A;  3V5Y A;  4PJL A;  2M4E A;  1GGQ A;  1ZYR F;  2R03 A;  2YRF A;  4LDR A;  2I8B A;  2Y39 A;  2HJM A;  4AK9 A;  3HJC A;  1RMV A;  2H7B A;  1BDJ B;  1QQ3 A;  2HMQ A;  1RJ9 A;  3M4C A;  3Q6N A;  2AU5 A;  2PP4 A;  1MND A;  3SNH A;  3GM2 A;  3S84 A;  3POV A;  1FMV A;  2W9Y A;  3QW0 A;  3ATP A;  4O6Y A;  4RDA A;  4IGG A;  3EGX B;  3WOD F;  2L6F A;  3O55 A;  2DYR C;  4J30 B;  3JTL O;  3PMR A;  4JVS A;  3DD7 A;  1ORS C;  4MW8 A;  5BUO A;  3NDB B;  3JSE O;  5T3W A;  4P9F A;  4PFP A;  4RBN A;  3LS1 A;  1DOW A;  3X2Q C;  3DJN B;  4Q4Z F;  1T6Q A;  3JYH A;  1APC A;  1HE1 A;  1R4T A;  1TFK B;  3A9C A;  3ECS A;  2XM0 A;  5A6B A;  2V3C C;  3NKE A;  3EG9 B;  4CSA C;  2A0U A;  4JTD B;  3EGD B;  4JJG A;  1ZHZ A;  3HNJ A;  3U2M A;  1BBH A;  3AQC A;  2OU6 A;  4U5B E;  1MMA A;  1OW6 A;  2PFD A;  4XQ1 A;  1E86 A;  4YT8 A;  2IYL D;  3EZH A;  2B0J A;  2J9V A;  2J0X A;  3BEH A;  3KYJ A;  3IHU A;  4LER A;  4P9T A;  4OIR F;  1Z7Q c;  3ZG1 A;  1E85 A;  4O79 A;  2R7Q A;  4YWQ A;  1Z5Z A;  3NKD A;  2L6H A;  3RW0 A;  3FOO A;  1VK5 A;  2ZXP A;  1MNE A;  3I5Q A;  5FZT A;  1AEP A;  3LUT B;  2HJ3 A;  4YT4 A;  3SXZ A;  1RXQ A;  3DE9 A;  5B3S C;  4LAC B;  4M63 A;  3G4Z A;  2J7P A;  5E2Q A;  3RVZ A;  2KJG A;  2IXP A;  1U89 A;  3QZC A;  4C3D A;  4K1O A;  4DRI B;  4CIH A;  1SR2 A;  2R7U A;  2QE9 A;  2OCC C;  3U3B A;  3NYM A;  2OG2 A;  4MVS A;  3IPM O;  1D1B A;  1WTY A;  2IXM A;  2XS1 A;  4J32 B;  1S05 A;  2FGY A;  2YLI A;  3SXK A;  1E2X A;  1LI7 A;  2UUI A;  1CGN A;  1V54 C;  1TWG A;  4ONS A;  1EA8 A;  4U5D E;  1LE2 A;  3ABM C;  3T4R A;  1D0Z A;  4YL3 A;  5GPG B;  1Z23 A;  3MBG A;  3VF0 A;  2YZS A;  4CJG A;  2OOC A;  1CPR A;  4F4B A;  2DB4 A;  2XLH A;  2F22 A;  3T6G B;  4CBE A;  1K04 A;  2J9U A;  2W4M A;  5DS6 A;  5EHH A;  4N06 A;  2P61 A;  1A0B A; 
#chains in the Genus database with same CATH homology
 2HJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...