2HJMA

Crystal structure of a singleton protein pf1176 from p. furiosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
HHHHHHMDLVEKVKELCLELEEENLAKAIERFITLTHGIEKTRGEAFAKASIYGFLEGILTTLKMKYSNEKIETLLNEVKTAREETEALLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a singleton protein PF1176 from P. furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PF1176
total genus 32
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11505 DUF3216 Protein of unknown function (DUF3216)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) protein pf1176 like 2hjmA01
2HJMA
chains in the Genus database with same CATH superfamily
3S0XA 4JURI 3ECSA 3G4ZA 3POVA 5KYWB 3DWWA 2LK4A 4O79A 2UUIA 4PK4A 2CGEA 1U89A 3TJ6A 2IBFA 4BJ5A 4YN0B 3DE9A 3RYLA 3FDQA 2AVKA 3L8IA 4BG0A 5D91A 2WVQA 2PBEA 1C03A 3KL4A 2LD6A 3RF3A 1G5ZA 1OQCA 3DKAA 2KGOA 1Q0FA 3GM2A 3ZG1A 4A2NB 5K0IA 1HW2A 2XXAA 3AOUA 3EGXB 1CGOA 3E9VA 2R7XA 4ULWA 3WG7C 3Q7GA 1V4AA 4P6IC 1FAPB 1RXQA 2RSEB 4LDKA 2YL0A 1TWGA 3IQ5A 3MFNA 2Y69C 1O5HA 2NUTA 2HSQA 1ST6A 4CS8A 2XLOA 1O87A 2EILC 3L0IA 4G7OF 2ZXOA 2Y3HA 3MLGA 4ONSA 2XLMA 2Q9BA 2R05A 4Z9HA 2KW3C 1Q0KA 3TD7A 5L0CA 1J8YF 2PNOA 3FOOA 2AWCA 5A6KA 1JRAA 4K1OA 2ZXWC 2PX3A 2I15A 4MW3A 3IPMO 3OWTA 4I3MA 3E70C 3DMDA 1V74B 2CNWD 2QLAA 2MYSA 1G8XA 2A6EF 3C18A 3UMKA 2YHSA 1QVXA 2V26A 5D92A 1ORYA 4JTAB 2A0BA 4XLPF 3OEOA 2OEVA 2HMZA 4PJLA 4U5GA 2P6VA 3U9MA 2AU5A 1GQAA 3R7CA 3MBGA 3NMJA 1BDJB 4LDRA 4K0DA 4LERA 4E7ZA 4OIRF 4D4XA 2R02A 2WL8A 3CEXA 3F47A 3ZWIA 3MX3A 4FAPB 1LI7A 1VLSA 1ZYRF 2P7VA 3V5ZA 1O3UA 4XEFA 4AE4A 1YZAA 3EJNA 1OR3A 3QW0A 4U9EA 5F5HA 1YJGA 2ZPAA 1H9TA 3ZDLA 3W2WA 1HW1A 3C63A 3GM1A 1E84A 2IYLD 2J9BA 1M56C 3DE8A 3S9OA 3RKOF 5DLJA 1ZW3A 1DOVA 1FR0A 1ZU4A 2HJ3A 3ABLC 3LNRA 3FOPA 4MTOA 4WJ0A 1TFOB 4OINF 3B0VC 1WTYA 2X51A 3DAFA 5CI8A 1M2OA 2ASRA 2WVOA 4H54A 4BJ1A 4C3DA 1SR2A 3ZTZA 5KYXA 1V54C 2KSFA 1RJ9A 3US6A 1C17M 2EPNA 3EGDB 5JVEA 5F5FA 2ETSA 5DS5A 3ASOC 1Z5ZA 5KYYA 1K04A 5KYYB 3ZC4A 3GWNA 3B9QA 3N24A 3PHF2 4U9DA 3J06A 2L9JA 3EH2A 3PCVA 1W2WA 2D5RB 1VOMA 2M64A 2JX0A 1D1CA 1YYJA 3TULA 1ZHZA 2G3VA 3AG2C 4GQHA 2L6GA 4MVQA 1E85A 1NLXA 1B68A 2LP4A 2OG2A 3B29A 4IJJA 1OKKA 3U5SA 1YA7O 2EIJC 4KNWA 3ZQVA 3V5XA 4PACA 4XPWA 2TMVP 4BJTA 2P61A 5KYUB 1FMVA 3O39A 1J8MF 4DOZA 2C04A 4F4BA 3FXHA 4IWBA 3S90A 4HFKB 1RKEA 2Q9AA 4AE4B 4NCQA 3T6JA 1NFOA 1TKNA 1SMYF 2FFHA 2Q9CA 5CIVA 1VMAA 3HLZA 4CSAA 3TK0A 3EFOB 4ZLDA 3M79A 3W4YA 2LFFA 4P9FA 3SP1A 1MMNA 4CIPA 3RFYA 1CPRA 3NYLA 3ASNC 2HKVA 1FFTC 1JOGA 4Q7CA 3S29A 1ZHWA 1EKYA 3U0CA 3JSZA 3EGXA 2VB6A 2XM4A 3GORA 1Z23A 4BJ6A 1H9GA 1QPUA 1Z7Qc 1WATA 3LLKA 2NSGA 4JTDB 1T6QA 3LJBA 3Q7LA 5L3QA 3RH3A 1MMGA 1K05A 3QTHA 3GWLA 3RVYA 1LS4A 2EPMX 4CDYA 4MVMA 2XL8A 4ULVA 4QDLA 3EZHA 1QKRA 2KC3A 4R32A 2A69F 5KYUA 4DBQA 2CYDA 2J9UA 3B0PA 3VYWA 1JPJA 3N0TA 2CNWA 1LKXA 1L3PA 1VYKA 2HS5A 2KNHA 4MNDA 2HSBA 4IARA 1UG7A 4U5FE 1OXBA 2QNLA 4H4KC 3C62A 4XPXA 1BZ4A 1CGNA 4LACB 5TJ5E 3SXYA 4CS9A 2O9XA 5JP7A 1YDIA 1Y4CA 4ANJA 2MHRA 2YL7A 3FAPB 4CX9A 4XEKA 1WN0A 3TOMA 5CI9A 2OJED 3UNGC 1U0BB 4OD4A 3HNIA 3LLIA 1GGQA 3PDMP 1MNEA 4L6RA 3HKKA 5L0FA 1FFHA 3NRHA 1LM3B 3O6XA 2Q7RA 1S7ZA 3L8JA 2YL1A 3SNHA 1YAUO 4YWQA 3TOLA 2R7VA 1U6HA 1XZPA 4DBRA 3K66A 2A0UA 3I4UA 4GEHA 1OW7A 4JCZA 3C8GD 2WVNA 2XS8A 4CDAA 1D1AA 3LUTB 4JTCB 4PJJA 4BEMJ 4XQ1A 2XRHA 3EFOA 1Q0DA 1BR1A 2J45A 2OEXA 1TWHA 3DAGA 4NTFA 2ZXRA 3FMSA 3KYJA 4YL0A 1APCA 3U8VA 3SZRA 5DQZA 3NMKA 5BUOA 2BC5A 4DXWA 1YA9A 1VTMP 3KH2A 3KMIA 3C8GA 3RVZA 4YT8A 2LSEA 2XLEA 4JC7A 2HMQA 3LAYA 3VRCA 4E0HA 3AG3C 3QMKA 1Z6AA 4EIYA 5B1AC 3CQZA 1JMWA 2C03A 3GEHA 3X2QC 4RBNA 4XTKA 4JIOA 3AG1C 4E0IA 2HV6A 1PCXA 3U2MA 1OCOC 3V7OA 4D4NA 1FMWA 1LI5A 4DRJB 4RD9A 4U5HA 4AL0A 5AC5A 1KU2A 1M6TA 4UDVA 2R7UA 4EKWA 3IQCA 4JJGA 5JLIA 4J32B 3PMRA 3AQCA 2PP4A 2YKZA 3T6BA 1LE2A 3DJNB 3WAQA 3L1MA 2KJGA 2OCCC 4KBLA 2QTVA 3H2UA 4C7OA 2AWYA 1JAFA 3U9JA 4M63A 3EZIA 3HNLA 2WZGA 3JZ0A 1AUEA 4HFFB 4O7GA 3IQ6A 1EA8A 3QW1A 2CDQA 4G78A 3JYYA 1YARO 1NSGB 2XM0A 1ZHXA 1RKEB 1A7DA 3EQLF 4J7TA 3KKBA 1ZZPA 2EIMC 5JS5A 3I5QA 4JE9A 1QSPA 4MTFA 3BRJA 4JCHA 2XXAB 1OKKD 5AC4A 3S27A 1GM5A 4W8PA 5EGYA 2V3CC 5T3WA 4IRUA 3X1OA 1R5ID 1OCCC 3LEVA 3MYFA 1CPQA 2Q3TA 3K1IC 3ZIBA 1G4US 3M15A 2EIKC 5DS6A 4O6NA 1H6GA 4XWJA 5FCLA 4N4WA 1ORSC 2M4EA 2YL3A 3I5PA 4LLCA 3LS0A 2EINC 4O6MA 5JSLA 5JT4A 1OR2A 3W2VA 3L34A 1PV3A 1VLTA 4WABA 5AGFA 2DYRC 2W4MA 3NYJA 2EPOA 2OU6A 1E2XA 1TWCA 2DI3A 2A1DD 3EPVA 3NMIA 3EH1A 4JW1A 2YLDA 2WZLA 3SYNA 5L0IA 1DOWA 2EPKX 1E86A 4I44A 3SXKA 4U5DE 2H7VC 1S05A 2ZXPA 4U5EE 3H2VA 2LFDA 3T4RA 4NQFA 1I4YA 3JCUQ 4CJGA 4G0HA 4MVRA 4YL1A 2J7PA 3C7JA 4CBEA 1LS1A 4CSAC 2XLWA 4ER9A 4NTAA 2GWWA 3DI5A 2X0CA 1NU7D 3CAXA 1OXKA 2CW0F 2KYHA 3A11A 4XEVA 3T9OA 2XLVA 2NUPA 3B71A 3QVYA 4EWCA 3S84A 3Q6NA 2F22A 3JRTA 4OD5A 2NUTB 5F28E 2Y3BA 3AQBA 3EG9B 4LLEA 1A41A 5DS4A 5A69A 1HY5A 2KQ9A 3AJMA 3A9CA 2HV7A 2J7PD 4WGZA 4MTGA 3EHNA 2L7AA 2YLGA 4MVSA 5BQIA 3JT1A 3RIPA 3WHNA 1EQ1A 2YVKA 3ZVRA 2JD3A 2E87A 2NG1A 2CCYA 2WB7A 3UGOA 2G62A 3DM9B 1HE1A 2J8WA 4YJWA 4BEJA 2YZSA 3EGDA 2Y3DA 4YT5A 2H7OA 5KYXB 2VC9A 1LE4A 3NDBB 1TQGA 4JZAA 3B0UX 2JPUA 2R7QA 1MNDA 3M4CA 3HTKC 4JEBA 1M2VB 4AK9A 4DVZA 4IAQA 2R7RA 3ITFA 3NYMA 4JEAA 4C3EA 2W4BA 5DVWA 1NZEA 3HNJA 4N6HA 3C8GB 3LS1A 1YVIA 2A68F 2VCBA 4U5BE 1RJ9B 2L6FA 2IOQA 3Q6MA 3S28A 4AL1A 1PD0A 2GFHA 5EHHA 1KNYA 1Z3IX 2Q4FA 4HEAJ 5EK0A 3ZTMA 1Z63A 3R2PA 2LIGA 2R7SA 1D0YA 3VM6A 1T9KA 4YL3A 3AGUA 3U3FA 2AP3A 2GA0A 1VK5A 2PFDA 1VYIA 3O10A 2VH3A 3BEHA 2UUHA 3V5YA 4IAOA 4BJ5C 1UFBA 4G7ZF 3AGTA 4J7YA 2XLHA 2QY9A 4NTBA 2IM8A 4MW8A 2OKUA 3DJUB 3OA1A 1ZU5A 2L6HA 2NSFA 2I8BA 4DJ9A 3K1IA 3UMIA 3CSKA 4E18A 4CDVA 1VB5A 3AG4C 3M1CB 2PX0A 1CGME 4CIHA 4YT2A 1GS9A 1MQVA 2OQMA 1FTSA 2XL6A 2B0JA 2YLIA 5IY5C 1KTMA 1JR8A 4O6YA 4NC3A 5A6AA 4Z9IA 4IB4A 3U3BA 4G7HF 4XPYA 2Y39A 1OCRC 2YQYA 2LCHA 3ABMC 1WASA 4JRZA 1LPEA 4MQ9F 256BA 2QUPA 3H65A 3RQFA 5A6BD 2H7BA 2VCCA 5E2QA 4C3BA 4P9TA 2EPLX 2J9WA 4KNVA 3UMHA 1M57C 3ZQYA 3KYIA 2XS1A 5HV9A 5B3SC 1E83A 4W8KA 1BR4A 4IGGA 3DM5A 4YK5A 1LIHA 2NUPB 3K1HA 4MVZA 1D0XA 3NKEA 4BPMA 3TQOA 1WWPA 1RKCA 4FX5A 2DB4A 5A6BA 1TR2A 3KPHA 1YZCA 2HUJA 4JVSA 1OCZC 2R7TA 1WOLA 2HZ8A 4MS2A 3ABKC 3C8ZA 4JKVA 1EI7A 5JRAA 3CZ6A 1NBBA 4FWVA 5DQTA 5KYWA 2QE9A 5L0JA 1ZW2A 4QI2A 4X0RA 2L81A 1AVOB 2DYSC 2IXMA 3GANA 4NY3A 4GYTA 5E3AA 2XLDA 2Q00A 3HJCA 4MVUA 4CS8C 1YLMA 1TWAA 2YEVA 1LVKA 2PF4E 3DZAA 2YRFA 3HNKA 3ATPA 4CS7A 3K6BA 4EUKB 5JUAA 1N1CA 1SZIA 2ICWG 1WGWA 4QI0A 4OIOF 2FAPB 3K7DA 3O55A 3T6GB 5GPGB 4JJFA 2BL2A 1Y6DA 1QZXA 4DVYP 5B3IA 1K40A 1RMVA 3LESA 4N6CA 2NPUA 5L3VA 2VASA 4OIPF 2DGJA 4LDQA 5COFA 3UGPA 1XWJA 1NU9C 1AEPA 4MVOA 1Q0MA 4PFOA 5BQHA 3W8HA 4C7OB 3NKDA 2HJMA 2Y3GA 1SYQA 2R9RB 2VCAA 1HMDA 2R7WA 3IEEA 3IQTA 5B1BC 3GODA 2XL4A 2GDCA 2YWAA 3FVYA 4A4AA 3VAYA 3TJ5A 2G3KA 1JPNA 1A7VA 1A7EA 1YYXA 3MYIA 3SEOA 5L0HA 2B0HA 3JSEO 1G4WR 4RDAA 1ZVZA 4CS9C 2HFIA 3U8PA 4J30B 4YT4A 4XLNF 5A6JA 1T5OA 2IXOA 4DRHB 4Q5SF 5E3CA 4FESA 1I5NA 5COMA 3JTLO 3WODF 5FZTA 2J0WA 1I4ZA 3GM3A 2R25A 4CJOA 1L7CA 1BBHA 1OW6A 2H8AA 2P0NA 4DRIB 2OOCA 1T6UA 4OIQF 2LQGA 2P1AA 1V55C 3RQGA 4PFPA 4KI2A 2IXPA 1IZMA 1HMOA 2RD9A 2XSEA 3F46A 3LEOA 4PJNA 3RW0A 1H7IA 1QLEC 1T01A 2WZFA 1IW7F 3JYHA 1R4TA 1M2VA 1OW8A 1TFKB 2BE5F 4I1MA 4Z9JA 5E33A 3W8IA 4EHPA 2MWQA 1T6IA 3NG1A 5L0DA 3LNMB 5T1DB 3FAJA 4E7SA 2W45A 1ORJA 2ZD9A 2J46A 2OJQA 4E17A 3U2LA 3JRMO 2KK1A 2IXNA 1D0ZA 4PR9A 2FGYA 3K33A 5KYNA 3QZCA 2J9VA 2Z15A 3VF0A 5L0GA 4AX2A 4EBJA 1MMAA 3UR3C 1ZHTA 3M4BA 5T3TA 4ZLCA 4N06A 3IHUA 3SXMA 3SXZA 1RCPA 3FHDA 4EBKA 1SF8A 1HE9A 1NFNA 1A0BA 1QQ3A 2R03A 2W9YA 3GEEA 3GEIA 4KC9A 5BQGA 3EHMA 3DD7A 3QVZA 3EG9A 1Q0GA 5HSWA 3DXJF 4WGYA 3ZSUA 1FNTc 4HE8D 4Q4ZF 4I1OB 2D4UA 1F1MA 1ZHYA 4PJMA 2A6HF 4U5CE 4B6IA 4K7BA 1MMDA 1BR2A 2GAQA 1NG1A 4EBBA 3G50A 3N2ZB 5COGA 3RQEA 1C02A 3G4XA 2J0XA 1D1BA 4BJ6C 2R7OA 1XZQA 1PD1A
chains in the Genus database with same CATH topology
2HJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJM A; 
#chains in the Genus database with same CATH topology
 3S0X A;  4JUR I;  3ECS A;  3G4Z A;  3POV A;  5KYW B;  3DWW A;  2LK4 A;  4O79 A;  2UUI A;  4PK4 A;  2CGE A;  1U89 A;  3TJ6 A;  2IBF A;  4BJ5 A;  4YN0 B;  3DE9 A;  3RYL A;  3FDQ A;  2AVK A;  3L8I A;  4BG0 A;  5D91 A;  2WVQ A;  2PBE A;  1C03 A;  3KL4 A;  2LD6 A;  3RF3 A;  1G5Z A;  1OQC A;  3DKA A;  2KGO A;  1Q0F A;  3GM2 A;  3ZG1 A;  4A2N B;  5K0I A;  1HW2 A;  2XXA A;  3AOU A;  3EGX B;  1CGO A;  3E9V A;  2R7X A;  4ULW A;  3WG7 C;  3Q7G A;  1V4A A;  4P6I C;  1FAP B;  1RXQ A;  2RSE B;  4LDK A;  2YL0 A;  1TWG A;  3IQ5 A;  3MFN A;  2Y69 C;  1O5H A;  2NUT A;  2HSQ A;  1ST6 A;  4CS8 A;  2XLO A;  1O87 A;  2EIL C;  3L0I A;  4G7O F;  2ZXO A;  2Y3H A;  3MLG A;  4ONS A;  2XLM A;  2Q9B A;  2R05 A;  4Z9H A;  2KW3 C;  1Q0K A;  3TD7 A;  5L0C A;  1J8Y F;  2PNO A;  3FOO A;  2AWC A;  5A6K A;  1JRA A;  4K1O A;  2ZXW C;  2PX3 A;  2I15 A;  4MW3 A;  3IPM O;  3OWT A;  4I3M A;  3E70 C;  3DMD A;  1V74 B;  2CNW D;  2QLA A;  2MYS A;  1G8X A;  2A6E F;  3C18 A;  3UMK A;  2YHS A;  1QVX A;  2V26 A;  5D92 A;  1ORY A;  4JTA B;  2A0B A;  4XLP F;  3OEO A;  2OEV A;  2HMZ A;  4PJL A;  4U5G A;  2P6V A;  3U9M A;  2AU5 A;  1GQA A;  3R7C A;  3MBG A;  3NMJ A;  1BDJ B;  4LDR A;  4K0D A;  4LER A;  4E7Z A;  4OIR F;  4D4X A;  2R02 A;  2WL8 A;  3CEX A;  3F47 A;  3ZWI A;  3MX3 A;  4FAP B;  1LI7 A;  1VLS A;  1ZYR F;  2P7V A;  3V5Z A;  1O3U A;  4XEF A;  4AE4 A;  1YZA A;  3EJN A;  1OR3 A;  3QW0 A;  4U9E A;  5F5H A;  1YJG A;  2ZPA A;  1H9T A;  3ZDL A;  3W2W A;  1HW1 A;  3C63 A;  3GM1 A;  1E84 A;  2IYL D;  2J9B A;  1M56 C;  3DE8 A;  3S9O A;  3RKO F;  5DLJ A;  1ZW3 A;  1DOV A;  1FR0 A;  1ZU4 A;  2HJ3 A;  3ABL C;  3LNR A;  3FOP A;  4MTO A;  4WJ0 A;  1TFO B;  4OIN F;  3B0V C;  1WTY A;  2X51 A;  3DAF A;  5CI8 A;  1M2O A;  2ASR A;  2WVO A;  4H54 A;  4BJ1 A;  4C3D A;  1SR2 A;  3ZTZ A;  5KYX A;  1V54 C;  2KSF A;  1RJ9 A;  3US6 A;  1C17 M;  2EPN A;  3EGD B;  5JVE A;  5F5F A;  2ETS A;  5DS5 A;  3ASO C;  1Z5Z A;  5KYY A;  1K04 A;  5KYY B;  3ZC4 A;  3GWN A;  3B9Q A;  3N24 A;  3PHF 2;  4U9D A;  3J06 A;  2L9J A;  3EH2 A;  3PCV A;  1W2W A;  2D5R B;  1VOM A;  2M64 A;  2JX0 A;  1D1C A;  1YYJ A;  3TUL A;  1ZHZ A;  2G3V A;  3AG2 C;  4GQH A;  2L6G A;  4MVQ A;  1E85 A;  1NLX A;  1B68 A;  2LP4 A;  2OG2 A;  3B29 A;  4IJJ A;  1OKK A;  3U5S A;  1YA7 O;  2EIJ C;  4KNW A;  3ZQV A;  3V5X A;  4PAC A;  4XPW A;  2TMV P;  4BJT A;  2P61 A;  5KYU B;  1FMV A;  3O39 A;  1J8M F;  4DOZ A;  2C04 A;  4F4B A;  3FXH A;  4IWB A;  3S90 A;  4HFK B;  1RKE A;  2Q9A A;  4AE4 B;  4NCQ A;  3T6J A;  1NFO A;  1TKN A;  1SMY F;  2FFH A;  2Q9C A;  5CIV A;  1VMA A;  3HLZ A;  4CSA A;  3TK0 A;  3EFO B;  4ZLD A;  3M79 A;  3W4Y A;  2LFF A;  4P9F A;  3SP1 A;  1MMN A;  4CIP A;  3RFY A;  1CPR A;  3NYL A;  3ASN C;  2HKV A;  1FFT C;  1JOG A;  4Q7C A;  3S29 A;  1ZHW A;  1EKY A;  3U0C A;  3JSZ A;  3EGX A;  2VB6 A;  2XM4 A;  3GOR A;  1Z23 A;  4BJ6 A;  1H9G A;  1QPU A;  1Z7Q c;  1WAT A;  3LLK A;  2NSG A;  4JTD B;  1T6Q A;  3LJB A;  3Q7L A;  5L3Q A;  3RH3 A;  1MMG A;  1K05 A;  3QTH A;  3GWL A;  3RVY A;  1LS4 A;  2EPM X;  4CDY A;  4MVM A;  2XL8 A;  4ULV A;  4QDL A;  3EZH A;  1QKR A;  2KC3 A;  4R32 A;  2A69 F;  5KYU A;  4DBQ A;  2CYD A;  2J9U A;  3B0P A;  3VYW A;  1JPJ A;  3N0T A;  2CNW A;  1LKX A;  1L3P A;  1VYK A;  2HS5 A;  2KNH A;  4MND A;  2HSB A;  4IAR A;  1UG7 A;  4U5F E;  1OXB A;  2QNL A;  4H4K C;  3C62 A;  4XPX A;  1BZ4 A;  1CGN A;  4LAC B;  5TJ5 E;  3SXY A;  4CS9 A;  2O9X A;  5JP7 A;  1YDI A;  1Y4C A;  4ANJ A;  2MHR A;  2YL7 A;  3FAP B;  4CX9 A;  4XEK A;  1WN0 A;  3TOM A;  5CI9 A;  2OJE D;  3UNG C;  1U0B B;  4OD4 A;  3HNI A;  3LLI A;  1GGQ A;  3PDM P;  1MNE A;  4L6R A;  3HKK A;  5L0F A;  1FFH A;  3NRH A;  1LM3 B;  3O6X A;  2Q7R A;  1S7Z A;  3L8J A;  2YL1 A;  3SNH A;  1YAU O;  4YWQ A;  3TOL A;  2R7V A;  1U6H A;  1XZP A;  4DBR A;  3K66 A;  2A0U A;  3I4U A;  4GEH A;  1OW7 A;  4JCZ A;  3C8G D;  2WVN A;  2XS8 A;  4CDA A;  1D1A A;  3LUT B;  4JTC B;  4PJJ A;  4BEM J;  4XQ1 A;  2XRH A;  3EFO A;  1Q0D A;  1BR1 A;  2J45 A;  2OEX A;  1TWH A;  3DAG A;  4NTF A;  2ZXR A;  3FMS A;  3KYJ A;  4YL0 A;  1APC A;  3U8V A;  3SZR A;  5DQZ A;  3NMK A;  5BUO A;  2BC5 A;  4DXW A;  1YA9 A;  1VTM P;  3KH2 A;  3KMI A;  3C8G A;  3RVZ A;  4YT8 A;  2LSE A;  2XLE A;  4JC7 A;  2HMQ A;  3LAY A;  3VRC A;  4E0H A;  3AG3 C;  3QMK A;  1Z6A A;  4EIY A;  5B1A C;  3CQZ A;  1JMW A;  2C03 A;  3GEH A;  3X2Q C;  4RBN A;  4XTK A;  4JIO A;  3AG1 C;  4E0I A;  2HV6 A;  1PCX A;  3U2M A;  1OCO C;  3V7O A;  4D4N A;  1FMW A;  1LI5 A;  4DRJ B;  4RD9 A;  4U5H A;  4AL0 A;  5AC5 A;  1KU2 A;  1M6T A;  4UDV A;  2R7U A;  4EKW A;  3IQC A;  4JJG A;  5JLI A;  4J32 B;  3PMR A;  3AQC A;  2PP4 A;  2YKZ A;  3T6B A;  1LE2 A;  3DJN B;  3WAQ A;  3L1M A;  2KJG A;  2OCC C;  4KBL A;  2QTV A;  3H2U A;  4C7O A;  2AWY A;  1JAF A;  3U9J A;  4M63 A;  3EZI A;  3HNL A;  2WZG A;  3JZ0 A;  1AUE A;  4HFF B;  4O7G A;  3IQ6 A;  1EA8 A;  3QW1 A;  2CDQ A;  4G78 A;  3JYY A;  1YAR O;  1NSG B;  2XM0 A;  1ZHX A;  1RKE B;  1A7D A;  3EQL F;  4J7T A;  3KKB A;  1ZZP A;  2EIM C;  5JS5 A;  3I5Q A;  4JE9 A;  1QSP A;  4MTF A;  3BRJ A;  4JCH A;  2XXA B;  1OKK D;  5AC4 A;  3S27 A;  1GM5 A;  4W8P A;  5EGY A;  2V3C C;  5T3W A;  4IRU A;  3X1O A;  1R5I D;  1OCC C;  3LEV A;  3MYF A;  1CPQ A;  2Q3T A;  3K1I C;  3ZIB A;  1G4U S;  3M15 A;  2EIK C;  5DS6 A;  4O6N A;  1H6G A;  4XWJ A;  5FCL A;  4N4W A;  1ORS C;  2M4E A;  2YL3 A;  3I5P A;  4LLC A;  3LS0 A;  2EIN C;  4O6M A;  5JSL A;  5JT4 A;  1OR2 A;  3W2V A;  3L34 A;  1PV3 A;  1VLT A;  4WAB A;  5AGF A;  2DYR C;  2W4M A;  3NYJ A;  2EPO A;  2OU6 A;  1E2X A;  1TWC A;  2DI3 A;  2A1D D;  3EPV A;  3NMI A;  3EH1 A;  4JW1 A;  2YLD A;  2WZL A;  3SYN A;  5L0I A;  1DOW A;  2EPK X;  1E86 A;  4I44 A;  3SXK A;  4U5D E;  2H7V C;  1S05 A;  2ZXP A;  4U5E E;  3H2V A;  2LFD A;  3T4R A;  4NQF A;  1I4Y A;  3JCU Q;  4CJG A;  4G0H A;  4MVR A;  4YL1 A;  2J7P A;  3C7J A;  4CBE A;  1LS1 A;  4CSA C;  2XLW A;  4ER9 A;  4NTA A;  2GWW A;  3DI5 A;  2X0C A;  1NU7 D;  3CAX A;  1OXK A;  2CW0 F;  2KYH A;  3A11 A;  4XEV A;  3T9O A;  2XLV A;  2NUP A;  3B71 A;  3QVY A;  4EWC A;  3S84 A;  3Q6N A;  2F22 A;  3JRT A;  4OD5 A;  2NUT B;  5F28 E;  2Y3B A;  3AQB A;  3EG9 B;  4LLE A;  1A41 A;  5DS4 A;  5A69 A;  1HY5 A;  2KQ9 A;  3AJM A;  3A9C A;  2HV7 A;  2J7P D;  4WGZ A;  4MTG A;  3EHN A;  2L7A A;  2YLG A;  4MVS A;  5BQI A;  3JT1 A;  3RIP A;  3WHN A;  1EQ1 A;  2YVK A;  3ZVR A;  2JD3 A;  2E87 A;  2NG1 A;  2CCY A;  2WB7 A;  3UGO A;  2G62 A;  3DM9 B;  1HE1 A;  2J8W A;  4YJW A;  4BEJ A;  2YZS A;  3EGD A;  2Y3D A;  4YT5 A;  2H7O A;  5KYX B;  2VC9 A;  1LE4 A;  3NDB B;  1TQG A;  4JZA A;  3B0U X;  2JPU A;  2R7Q A;  1MND A;  3M4C A;  3HTK C;  4JEB A;  1M2V B;  4AK9 A;  4DVZ A;  4IAQ A;  2R7R A;  3ITF A;  3NYM A;  4JEA A;  4C3E A;  2W4B A;  5DVW A;  1NZE A;  3HNJ A;  4N6H A;  3C8G B;  3LS1 A;  1YVI A;  2A68 F;  2VCB A;  4U5B E;  1RJ9 B;  2L6F A;  2IOQ A;  3Q6M A;  3S28 A;  4AL1 A;  1PD0 A;  2GFH A;  5EHH A;  1KNY A;  1Z3I X;  2Q4F A;  4HEA J;  5EK0 A;  3ZTM A;  1Z63 A;  3R2P A;  2LIG A;  2R7S A;  1D0Y A;  3VM6 A;  1T9K A;  4YL3 A;  3AGU A;  3U3F A;  2AP3 A;  2GA0 A;  1VK5 A;  2PFD A;  1VYI A;  3O10 A;  2VH3 A;  3BEH A;  2UUH A;  3V5Y A;  4IAO A;  4BJ5 C;  1UFB A;  4G7Z F;  3AGT A;  4J7Y A;  2XLH A;  2QY9 A;  4NTB A;  2IM8 A;  4MW8 A;  2OKU A;  3DJU B;  3OA1 A;  1ZU5 A;  2L6H A;  2NSF A;  2I8B A;  4DJ9 A;  3K1I A;  3UMI A;  3CSK A;  4E18 A;  4CDV A;  1VB5 A;  3AG4 C;  3M1C B;  2PX0 A;  1CGM E;  4CIH A;  4YT2 A;  1GS9 A;  1MQV A;  2OQM A;  1FTS A;  2XL6 A;  2B0J A;  2YLI A;  5IY5 C;  1KTM A;  1JR8 A;  4O6Y A;  4NC3 A;  5A6A A;  4Z9I A;  4IB4 A;  3U3B A;  4G7H F;  4XPY A;  2Y39 A;  1OCR C;  2YQY A;  2LCH A;  3ABM C;  1WAS A;  4JRZ A;  1LPE A;  4MQ9 F;  256B A;  2QUP A;  3H65 A;  3RQF A;  5A6B D;  2H7B A;  2VCC A;  5E2Q A;  4C3B A;  4P9T A;  2EPL X;  2J9W A;  4KNV A;  3UMH A;  1M57 C;  3ZQY A;  3KYI A;  2XS1 A;  5HV9 A;  5B3S C;  1E83 A;  4W8K A;  1BR4 A;  4IGG A;  3DM5 A;  4YK5 A;  1LIH A;  2NUP B;  3K1H A;  4MVZ A;  1D0X A;  3NKE A;  4BPM A;  3TQO A;  1WWP A;  1RKC A;  4FX5 A;  2DB4 A;  5A6B A;  1TR2 A;  3KPH A;  1YZC A;  2HUJ A;  4JVS A;  1OCZ C;  2R7T A;  1WOL A;  2HZ8 A;  4MS2 A;  3ABK C;  3C8Z A;  4JKV A;  1EI7 A;  5JRA A;  3CZ6 A;  1NBB A;  4FWV A;  5DQT A;  5KYW A;  2QE9 A;  5L0J A;  1ZW2 A;  4QI2 A;  4X0R A;  2L81 A;  1AVO B;  2DYS C;  2IXM A;  3GAN A;  4NY3 A;  4GYT A;  5E3A A;  2XLD A;  2Q00 A;  3HJC A;  4MVU A;  4CS8 C;  1YLM A;  1TWA A;  2YEV A;  1LVK A;  2PF4 E;  3DZA A;  2YRF A;  3HNK A;  3ATP A;  4CS7 A;  3K6B A;  4EUK B;  5JUA A;  1N1C A;  1SZI A;  2ICW G;  1WGW A;  4QI0 A;  4OIO F;  2FAP B;  3K7D A;  3O55 A;  3T6G B;  5GPG B;  4JJF A;  2BL2 A;  1Y6D A;  1QZX A;  4DVY P;  5B3I A;  1K40 A;  1RMV A;  3LES A;  4N6C A;  2NPU A;  5L3V A;  2VAS A;  4OIP F;  2DGJ A;  4LDQ A;  5COF A;  3UGP A;  1XWJ A;  1NU9 C;  1AEP A;  4MVO A;  1Q0M A;  4PFO A;  5BQH A;  3W8H A;  4C7O B;  3NKD A;  2HJM A;  2Y3G A;  1SYQ A;  2R9R B;  2VCA A;  1HMD A;  2R7W A;  3IEE A;  3IQT A;  5B1B C;  3GOD A;  2XL4 A;  2GDC A;  2YWA A;  3FVY A;  4A4A A;  3VAY A;  3TJ5 A;  2G3K A;  1JPN A;  1A7V A;  1A7E A;  1YYX A;  3MYI A;  3SEO A;  5L0H A;  2B0H A;  3JSE O;  1G4W R;  4RDA A;  1ZVZ A;  4CS9 C;  2HFI A;  3U8P A;  4J30 B;  4YT4 A;  4XLN F;  5A6J A;  1T5O A;  2IXO A;  4DRH B;  4Q5S F;  5E3C A;  4FES A;  1I5N A;  5COM A;  3JTL O;  3WOD F;  5FZT A;  2J0W A;  1I4Z A;  3GM3 A;  2R25 A;  4CJO A;  1L7C A;  1BBH A;  1OW6 A;  2H8A A;  2P0N A;  4DRI B;  2OOC A;  1T6U A;  4OIQ F;  2LQG A;  2P1A A;  1V55 C;  3RQG A;  4PFP A;  4KI2 A;  2IXP A;  1IZM A;  1HMO A;  2RD9 A;  2XSE A;  3F46 A;  3LEO A;  4PJN A;  3RW0 A;  1H7I A;  1QLE C;  1T01 A;  2WZF A;  1IW7 F;  3JYH A;  1R4T A;  1M2V A;  1OW8 A;  1TFK B;  2BE5 F;  4I1M A;  4Z9J A;  5E33 A;  3W8I A;  4EHP A;  2MWQ A;  1T6I A;  3NG1 A;  5L0D A;  3LNM B;  5T1D B;  3FAJ A;  4E7S A;  2W45 A;  1ORJ A;  2ZD9 A;  2J46 A;  2OJQ A;  4E17 A;  3U2L A;  3JRM O;  2KK1 A;  2IXN A;  1D0Z A;  4PR9 A;  2FGY A;  3K33 A;  5KYN A;  3QZC A;  2J9V A;  2Z15 A;  3VF0 A;  5L0G A;  4AX2 A;  4EBJ A;  1MMA A;  3UR3 C;  1ZHT A;  3M4B A;  5T3T A;  4ZLC A;  4N06 A;  3IHU A;  3SXM A;  3SXZ A;  1RCP A;  3FHD A;  4EBK A;  1SF8 A;  1HE9 A;  1NFN A;  1A0B A;  1QQ3 A;  2R03 A;  2W9Y A;  3GEE A;  3GEI A;  4KC9 A;  5BQG A;  3EHM A;  3DD7 A;  3QVZ A;  3EG9 A;  1Q0G A;  5HSW A;  3DXJ F;  4WGY A;  3ZSU A;  1FNT c;  4HE8 D;  4Q4Z F;  4I1O B;  2D4U A;  1F1M A;  1ZHY A;  4PJM A;  2A6H F;  4U5C E;  4B6I A;  4K7B A;  1MMD A;  1BR2 A;  2GAQ A;  1NG1 A;  4EBB A;  3G50 A;  3N2Z B;  5COG A;  3RQE A;  1C02 A;  3G4X A;  2J0X A;  1D1B A;  4BJ6 C;  2R7O A;  1XZQ A;  1PD1 A; 
#chains in the Genus database with same CATH homology
 2HJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...