2HJMA

Crystal structure of a singleton protein pf1176 from p. furiosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
HHHHHHMDLVEKVKELCLELEEENLAKAIERFITLTHGIEKTRGEAFAKASIYGFLEGILTTLKMKYSNEKIETLLNEVKTAREETEALLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PF1176
publication title Crystal structure of a singleton protein PF1176 from P. furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 32
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11505 DUF3216 Protein of unknown function (DUF3216)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) protein pf1176 like 2hjmA01
2HJMA
chains in the Genus database with same CATH superfamily
5A6BD 4CDVA 4IB4A 5KYNA 3NYJA 2EIMC 5F5HA 3U9JA 4XPWA 3FOOA 4Z9JA 1OKKA 2FGYA 4PR9A 3L8JA 5TJ5E 4BJ1A 3KKBA 2PX0A 1ZHZA 2EIKC 1VK5A 2J0WA 3NYMA 3RYLA 4FAPB 2ZPAA 3RFYA 3K7DA 2V26A 4JRZA 1ZVZA 1FNTc 1RKEA 3DJNB 4MVUA 3W8HA 2Z15A 2DYSC 1JRAA 3DJUB 4BG0A 1GM5A 1RMVA 3EZIA 5D92A 3I5PA 3GWNA 3UGPA 2VH3A 5AGFA 1LPEA 2C03A 3VAYA 2R25A 3ZQVA 1YYXA 2GAQA 2WVQA 3EGDB 3FXHA 3JCUQ 3K6BA 5DQZA 5L0CA 5KYUB 1T9KA 3DM9B 3B9QA 4ULVA 3TJ6A 5KYXA 3KL4A 2YWAA 3C7JA 4GYTA 1C02A 3S0XA 3N0TA 3HLZA 4IJJA 4JIOA 5DVWA 2X0CA 2ZXRA 2YLIA 4HFFB 3SXMA 1OCCC 4MVOA 1ZU5A 2ICWG 2J0XA 4D4XA 3JSEO 2YZSA 3T6GB 4RBNA 2HJMA 4ZLCA 2A68F 5DS5A 1Q0KA 1K05A 2LCHA 3DZAA 2OJQA 2OOCA 3LEOA 3QMKA 1UFBA 4JW1A 2NUTB 1U6HA 3LNMB 4I44A 4EBKA 1HW2A 4H54A 4U5HA 4LDRA 3ZQYA 3LLKA 2ZXOA 4N06A 4CS7A 1LE2A 2Y3GA 4FWVA 1TKNA 4KNWA 3ZSUA 4WJ0A 2WZFA 4E18A 4O6YA 2IBFA 3O39A 3C8GA 4MVRA 4YL1A 3IPMO 1NBBA 2E87A 1C03A 3EH1A 4MVZA 5T3WA 2PBEA 4P9FA 1Q0MA 4XWJA 3VF0A 5F5FA 4JCZA 2XLEA 3EGXB 1LI7A 4LLCA 4EIYA 3DE9A 3GEIA 1K40A 1M56C 1WOLA 1Z23A 2RD9A 1YZCA 5CI9A 2G3KA 2JPUA 2IXOA 3TK0A 3X1OA 3QW1A 1ZHYA 3NKEA 3DAFA 4Q4ZF 4AX2A 3B71A 2R7SA 1WATA 2XL6A 3IQ6A 4J7YA 2H7BA 5JVEA 2P1AA 4O79A 5B1BC 3EPVA 3EQLF 1PCXA 1EA8A 4MQ9F 3RH3A 2F22A 1VLSA 2O9XA 1OCZC 5JRAA 3E70C 4RD9A 3ECSA 4N4WA 4E7ZA 4E0HA 2QTVA 2XS1A 3FAJA 5T1DB 4U5EE 1BR4A 2J7PD 1LS4A 4JTCB 2KYHA 4I1MA 4NC3A 3ZIBA 4OD5A 3CZ6A 3AJMA 3HNLA 1NFNA 5D91A 3TOLA 3AG4C 3FVYA 1YA7O 1YDIA 2VC9A 4CIPA 1QSPA 3EFOB 3LS0A 2HV6A 2I8BA 1HY5A 1VOMA 4U5BE 3T6JA 4YT8A 4C7OA 2EPLX 1ZU4A 2GWWA 2XRHA 4NTBA 4O7GA 4EHPA 1D0YA 1Y4CA 2EPOA 4C3EA 2YHSA 1OR2A 2XLVA 1SZIA 2M4EA 2M64A 2XSEA 3U8VA 1OCOC 2OJED 3L0IA 2R7XA 1E86A 1TQGA 1NU9C 1O87A 3SXKA 3GEHA 1ORJA 1T01A 1E83A 2VB6A 5KYWA 4OIRF 4JE9A 2OU6A 4EBBA 2XLMA 1C17M 1D1AA 1FAPB 3L8IA 1ZZPA 2Q4FA 2P0NA 4YWQA 1XZPA 2GDCA 3EZHA 1FFHA 1IW7F 1TWAA 3PMRA 4PFPA 1WTYA 3HJCA 4MW8A 1KNYA 3FDQA 2L81A 4KBLA 1G8XA 4CIHA 1WGWA 4XEKA 3SZRA 3UMHA 3O55A 5KYYA 4CBEA 4G7ZF 4N6HA 2KW3C 2J9BA 2NG1A 3RQFA 2R7QA 1SMYF 2R7WA 1VLTA 1E84A 4YN0B 2A69F 2CNWA 2R03A 2W45A 1T6UA 3AGUA 2OCCC 3EJNA 2L7AA 2CCYA 3I5QA 5A69A 4BJ6A 2HV7A 3TULA 2C04A 4Z9HA 3TOMA 3DI5A 5JT4A 2HSBA 1YVIA 3W4YA 1AVOB 2XXAB 2NUPB 3K1HA 3UNGC 3V5XA 1VYIA 3UGOA 4AL1A 1M2VA 3B29A 1QVXA 2B0HA 2EPNA 2R02A 1QKRA 2D5RB 3EG9B 4PK4A 4BPMA 1N1CA 3W8IA 1R5ID 2LFDA 2LIGA 4CJGA 3IQTA 1WASA 3ASNC 3ABLC 3NMJA 3V5YA 3GODA 1CGME 4OIOF 2W4MA 3SNHA 2A6EF 3POVA 2AWYA 3UR3C 1OW7A 2EIJC 3QW0A 1VYKA 4KNVA 3W2WA 4EKWA 2J7PA 1RJ9B 4GEHA 5JP7A 1YYJA 2VCCA 3BEHA 4P6IC 3T9OA 3G50A 3L34A 2IOQA 4PJJA 2HS5A 2XLWA 4YJWA 1R4TA 4XPXA 3S9OA 3LEVA 1J8MF 3K1IC 4W8KA 3WG7C 5A6AA 5COMA 1LM3B 2KK1A 1CPQA 3JYHA 2HMZA 5BQGA 3U0CA 2CDQA 3LJBA 4C7OB 2WL8A 3HKKA 4J30B 1B68A 1FFTC 2R7OA 3Q6NA 1D0ZA 2NSGA 2YVKA 3U3FA 1ZHWA 3GM3A 2PX3A 3ASOC 1Q0GA 4GQHA 1Z6AA 4KC9A 4EUKB 5A6KA 1APCA 2PF4E 4JC7A 4Q5SF 1O3UA 3UMKA 2QUPA 2A0BA 2LK4A 3R2PA 3U3BA 1NFOA 1A41A 3HNIA 1T6QA 2DB4A 4WGYA 2J45A 2LP4A 3MYFA 1MMDA 1I4YA 2DGJA 4A4AA 3GEEA 2H8AA 2OG2A 3AG2C 3JT1A 4PACA 1QQ3A 1PD0A 3GWLA 1VTMP 1OCRC 2EPKX 1SR2A 2XLDA 5KYYB 4M63A 4MVMA 3UMIA 2J9VA 3O10A 4JJFA 3CEXA 1I4ZA 2Y69C 4E0IA 3K66A 4DBQA 1LS1A 3MBGA 2H7VC 2FAPB 2G62A 4NQFA 4KI2A 2R7RA 1S7ZA 1BDJB 1KU2A 4JVSA 3RVZA 4RDAA 1OR3A 3S29A 5A6JA 2AP3A 3AQBA 1JPNA 256BA 3ZWIA 1TWGA 1SYQA 2HKVA 3GM1A 5A6BA 3RVYA 3PHF2 1JR8A 4PJLA 2W9YA 2YKZA 2R05A 2VASA 4YL3A 2JX0A 1FMWA 4LERA 2HZ8A 5L0GA 1G4WR 4JZAA 3C8ZA 3NMKA 4CS9A 2P6VA 3NMIA 2HJ3A 3M79A 2D4UA 1V55C 3M4CA 3RQEA 3U2MA 5DS6A 3ZG1A 1BR2A 2W4BA 2XL4A 1A7EA 1AUEA 4N6CA 4CS9C 2PP4A 1Z5ZA 1RKEB 1O5HA 4H4KC 5F28E 4CDAA 2MYSA 4E7SA 4LDQA 3JSZA 5JS5A 4AE4A 2WB7A 1BR1A 3AQCA 4J32B 2EPMX 2LFFA 3QZCA 4U5DE 3ZC4A 1YLMA 2IXNA 1MMGA 2Q7RA 5AC5A 1MQVA 4DVZA 3H2UA 1I5NA 5CI8A 5EHHA 3MFNA 4MTFA 4DRJB 3B0UX 1KTMA 1IZMA 3MYIA 2R7UA 4HFKB 5KYXB 3LAYA 2YRFA 1Z3IX 3WODF 2KQ9A 1ZYRF 3IQ5A 2AU5A 3RKOF 5L3VA 4O6MA 4JKVA 4DJ9A 3CAXA 1GS9A 3HNJA 3M15A 3SP1A 2XLOA 3C18A 4R32A 3B0PA 2V3CC 4IWBA 3GORA 2YL7A 3MX3A 2Q9BA 2AWCA 4MTGA 5HV9A 2RSEB 1NG1A 1TFOB 4EWCA 2NUTA 3W2VA 1TFKB 1D1BA 1YZAA 1H9GA 1H6GA 1ZW3A 2KGOA 3KYIA 2KC3A 4A2NB 2A0UA 5DQTA 1OQCA 4X0RA 4NTFA 3U8PA 5COGA 1V4AA 1ORYA 1YAUO 4XPYA 4JEAA 2R7VA 4U9EA 3C8GB 1TWCA 3AG1C 3FMSA 1ORSC 4WGZA 3VRCA 1F1MA 4XQ1A 1M6TA 3DD7A 3HTKC 2GFHA 3GANA 4CX9A 3PDMP 1ZW2A 3ZDLA 2LD6A 3C8GD 2QE9A 1U89A 3OA1A 2IXPA 4NTAA 2IXMA 2AVKA 2XLHA 3EGXA 5GPGB 4OINF 2OKUA 3RW0A 5L3QA 5E33A 2Y3HA 1YARO 3G4ZA 4JTAB 4WABA 5L0FA 1W2WA 3JRMO 1FMVA 3M1CB 3SXYA 3S90A 4CS8C 3A9CA 2Y3DA 3FAPB 1T6IA 4HEAJ 2NSFA 4BEJA 5CIVA 1SF8A 1OW6A 2L6GA 2YLGA 3N2ZB 4ANJA 4CDYA 3DXJF 4XEFA 2J8WA 3NKDA 1V54C 2YQYA 1Z7Qc 3U9MA 1Z63A 3K1IA 1Q0DA 4NY3A 4DRIB 3EHNA 1GQAA 3DM5A 3J06A 2ZXPA 2DYRC 3C63A 3EHMA 4K0DA 1A7DA 2IM8A 3Q7LA 1MNDA 4OD4A 3QTHA 2BE5F 1LI5A 1ZHXA 1XZQA 1NZEA 3E9VA 1H7IA 1T5OA 3EFOA 2VCBA 1A7VA 2XL8A 1MMNA 5BQIA 1JPJA 1D1CA 1E2XA 3F47A 3SEOA 5BQHA 1RXQA 4IGGA 3MLGA 4MNDA 4AE4B 1ST6A 1DOVA 4MVSA 4J7TA 5L0HA 2Y3BA 1FTSA 4IAQA 5HSWA 4G7OF 1JOGA 3Q6MA 4BJ5A 2CW0F 1AEPA 2BC5A 1WWPA 4W8PA 1D0XA 4D4NA 4K1OA 1DOWA 2XM4A 1YJGA 3R7CA 2KSFA 4BJ5C 3FOPA 1NSGB 5KYWB 1K04A 4LLEA 1H9TA 2P61A 2KJGA 2VCAA 3TJ5A 2R7TA 2H7OA 4B6IA 4Z9IA 2OQMA 1JMWA 4ZLDA 3QVYA 3JTLO 4PJMA 2R9RB 3PCVA 5COFA 3T4RA 2WZLA 1QPUA 4BJTA 1Q0FA 1PV3A 2B0JA 3GM2A 1NU7D 4F4BA 2FFHA 2XS8A 1S05A 1NLXA 1QZXA 1EQ1A 4QI0A 3ZTMA 4AL0A 3Q7GA 4AK9A 4C3BA 4YK5A 2CYDA 2UUHA 1M2OA 3K33A 2J9WA 4IRUA 2X51A 3JYYA 3ABKC 3FHDA 3JRTA 3B0VC 3KPHA 4QDLA 3QVZA 2MHRA 2CNWD 2PFDA 4IAOA 5E3AA 2WZGA 3SYNA 3KYJA 1TWHA 3NYLA 2XXAA 2ZD9A 4I3MA 2MWQA 2L6FA 2EILC 4NCQA 2PNOA 1M2VB 2NUPA 3C62A 3VYWA 3HNKA 3RIPA 2XM0A 4IARA 1LIHA 3U2LA 4DXWA 2TMVP 4LACB 3EG9A 1CGOA 2QNLA 1CPRA 3KMIA 3V5ZA 4JURI 4ER9A 3IHUA 1V74B 1HE1A 3BRJA 3L1MA 4JJGA 3AGTA 4U5CE 4XTKA 4DBRA 4G78A 3NG1A 3SXZA 4CSAA 2YL3A 3VM6A 1OKKD 1L7CA 4K7BA 4FX5A 4PFOA 3ABMC 4MW3A 5B3SC 5E3CA 2LQGA 2A1DD 3TQOA 1BBHA 2ASRA 3ATPA 4CSAC 5E2QA 3AOUA 3NRHA 5JUAA 5L0IA 4P9TA 2LSEA 3TD7A 2DI3A 1RJ9A 4L6RA 3CSKA 1LKXA 5B1AC 3A11A 4ONSA 4BEMJ 3EGDA 2IYLD 3ZTZA 5KYUA 2J46A 4MVQA 3DWWA 4JCHA 1LVKA 4O6NA 5L0JA 1GGQA 1L3PA 1ZHTA 4HE8D 4DRHB 3LLIA 1UG7A 4E17A 2G3VA 2EINC 3S84A 2OEVA 3X2QC 2BL2A 1Y6DA 4XEVA 1EKYA 2YL0A 1VB5A 1YA9A 2Y39A 3AG3C 4C3DA 3EH2A 2NPUA 4MTOA 3RF3A 4JEBA 3IQCA 4XLNF 1E85A 4XLPF 2P7VA 4Q7CA 3O6XA 5DLJA 2HFIA 1J8YF 3LS1A 4YT2A 3S28A 4I1OB 3N24A 3I4UA 3WHNA 2YLDA 1OXKA 3NDBB 1M57C 1TR2A 1LE4A 5FCLA 2L6HA 4ULWA 2Q9AA 4CJOA 1PD1A 4UDVA 3DKAA 1OXBA 3JZ0A 1QLEC 4YT4A 3H2VA 5L0DA 3LESA 2CGEA 5B3IA 2HSQA 2Q9CA 2YL1A 5JLIA 2ETSA 2L9JA 1RCPA 4DOZA 3US6A 5EK0A 2QLAA 4JTDB 1VMAA 5BUOA 2WVOA 1A0BA 1MNEA 1JAFA 3G4XA 5AC4A 3OWTA 1G5ZA 3F46A 1WN0A 2J9UA 4DVYP 1FR0A 3IEEA 2KNHA 2UUIA 3ITFA 3M4BA 4LDKA 3LNRA 4CS8A 1RKCA 2GA0A 2HMQA 2OEXA 2Q3TA 1XWJA 1U0BB 4U9DA 2QY9A 4G7HF 1EI7A 5FZTA 3CQZA 1CGNA 2WVNA 3DMDA 3V7OA 3WAQA 5DS4A 4G0HA 2Q00A 4YL0A 3ZVRA 4EBJA 3U5SA 1HW1A 5EGYA 3DE8A 3RQGA 3T6BA 3DAGA 1HE9A 4U5GA 4QI2A 1G4US 1OW8A 5T3TA 1BZ4A 4YT5A 5JSLA 1HMOA 2HUJA 3OEOA 4OIPF 2ZXWC 3KH2A 1MMAA 3LUTB 4MS2A 2I15A 4FESA 3S27A 2JD3A 4BJ6C 5IY5C 4OIQF 2YEVA 5K0IA 1HMDA 2A6HF 3H65A 4PJNA 4U5FE
chains in the Genus database with same CATH topology
2HJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJM A; 
#chains in the Genus database with same CATH topology
 5A6B D;  4CDV A;  4IB4 A;  5KYN A;  3NYJ A;  2EIM C;  5F5H A;  3U9J A;  4XPW A;  3FOO A;  4Z9J A;  1OKK A;  2FGY A;  4PR9 A;  3L8J A;  5TJ5 E;  4BJ1 A;  3KKB A;  2PX0 A;  1ZHZ A;  2EIK C;  1VK5 A;  2J0W A;  3NYM A;  3RYL A;  4FAP B;  2ZPA A;  3RFY A;  3K7D A;  2V26 A;  4JRZ A;  1ZVZ A;  1FNT c;  1RKE A;  3DJN B;  4MVU A;  3W8H A;  2Z15 A;  2DYS C;  1JRA A;  3DJU B;  4BG0 A;  1GM5 A;  1RMV A;  3EZI A;  5D92 A;  3I5P A;  3GWN A;  3UGP A;  2VH3 A;  5AGF A;  1LPE A;  2C03 A;  3VAY A;  2R25 A;  3ZQV A;  1YYX A;  2GAQ A;  2WVQ A;  3EGD B;  3FXH A;  3JCU Q;  3K6B A;  5DQZ A;  5L0C A;  5KYU B;  1T9K A;  3DM9 B;  3B9Q A;  4ULV A;  3TJ6 A;  5KYX A;  3KL4 A;  2YWA A;  3C7J A;  4GYT A;  1C02 A;  3S0X A;  3N0T A;  3HLZ A;  4IJJ A;  4JIO A;  5DVW A;  2X0C A;  2ZXR A;  2YLI A;  4HFF B;  3SXM A;  1OCC C;  4MVO A;  1ZU5 A;  2ICW G;  2J0X A;  4D4X A;  3JSE O;  2YZS A;  3T6G B;  4RBN A;  2HJM A;  4ZLC A;  2A68 F;  5DS5 A;  1Q0K A;  1K05 A;  2LCH A;  3DZA A;  2OJQ A;  2OOC A;  3LEO A;  3QMK A;  1UFB A;  4JW1 A;  2NUT B;  1U6H A;  3LNM B;  4I44 A;  4EBK A;  1HW2 A;  4H54 A;  4U5H A;  4LDR A;  3ZQY A;  3LLK A;  2ZXO A;  4N06 A;  4CS7 A;  1LE2 A;  2Y3G A;  4FWV A;  1TKN A;  4KNW A;  3ZSU A;  4WJ0 A;  2WZF A;  4E18 A;  4O6Y A;  2IBF A;  3O39 A;  3C8G A;  4MVR A;  4YL1 A;  3IPM O;  1NBB A;  2E87 A;  1C03 A;  3EH1 A;  4MVZ A;  5T3W A;  2PBE A;  4P9F A;  1Q0M A;  4XWJ A;  3VF0 A;  5F5F A;  4JCZ A;  2XLE A;  3EGX B;  1LI7 A;  4LLC A;  4EIY A;  3DE9 A;  3GEI A;  1K40 A;  1M56 C;  1WOL A;  1Z23 A;  2RD9 A;  1YZC A;  5CI9 A;  2G3K A;  2JPU A;  2IXO A;  3TK0 A;  3X1O A;  3QW1 A;  1ZHY A;  3NKE A;  3DAF A;  4Q4Z F;  4AX2 A;  3B71 A;  2R7S A;  1WAT A;  2XL6 A;  3IQ6 A;  4J7Y A;  2H7B A;  5JVE A;  2P1A A;  4O79 A;  5B1B C;  3EPV A;  3EQL F;  1PCX A;  1EA8 A;  4MQ9 F;  3RH3 A;  2F22 A;  1VLS A;  2O9X A;  1OCZ C;  5JRA A;  3E70 C;  4RD9 A;  3ECS A;  4N4W A;  4E7Z A;  4E0H A;  2QTV A;  2XS1 A;  3FAJ A;  5T1D B;  4U5E E;  1BR4 A;  2J7P D;  1LS4 A;  4JTC B;  2KYH A;  4I1M A;  4NC3 A;  3ZIB A;  4OD5 A;  3CZ6 A;  3AJM A;  3HNL A;  1NFN A;  5D91 A;  3TOL A;  3AG4 C;  3FVY A;  1YA7 O;  1YDI A;  2VC9 A;  4CIP A;  1QSP A;  3EFO B;  3LS0 A;  2HV6 A;  2I8B A;  1HY5 A;  1VOM A;  4U5B E;  3T6J A;  4YT8 A;  4C7O A;  2EPL X;  1ZU4 A;  2GWW A;  2XRH A;  4NTB A;  4O7G A;  4EHP A;  1D0Y A;  1Y4C A;  2EPO A;  4C3E A;  2YHS A;  1OR2 A;  2XLV A;  1SZI A;  2M4E A;  2M64 A;  2XSE A;  3U8V A;  1OCO C;  2OJE D;  3L0I A;  2R7X A;  1E86 A;  1TQG A;  1NU9 C;  1O87 A;  3SXK A;  3GEH A;  1ORJ A;  1T01 A;  1E83 A;  2VB6 A;  5KYW A;  4OIR F;  4JE9 A;  2OU6 A;  4EBB A;  2XLM A;  1C17 M;  1D1A A;  1FAP B;  3L8I A;  1ZZP A;  2Q4F A;  2P0N A;  4YWQ A;  1XZP A;  2GDC A;  3EZH A;  1FFH A;  1IW7 F;  1TWA A;  3PMR A;  4PFP A;  1WTY A;  3HJC A;  4MW8 A;  1KNY A;  3FDQ A;  2L81 A;  4KBL A;  1G8X A;  4CIH A;  1WGW A;  4XEK A;  3SZR A;  3UMH A;  3O55 A;  5KYY A;  4CBE A;  4G7Z F;  4N6H A;  2KW3 C;  2J9B A;  2NG1 A;  3RQF A;  2R7Q A;  1SMY F;  2R7W A;  1VLT A;  1E84 A;  4YN0 B;  2A69 F;  2CNW A;  2R03 A;  2W45 A;  1T6U A;  3AGU A;  2OCC C;  3EJN A;  2L7A A;  2CCY A;  3I5Q A;  5A69 A;  4BJ6 A;  2HV7 A;  3TUL A;  2C04 A;  4Z9H A;  3TOM A;  3DI5 A;  5JT4 A;  2HSB A;  1YVI A;  3W4Y A;  1AVO B;  2XXA B;  2NUP B;  3K1H A;  3UNG C;  3V5X A;  1VYI A;  3UGO A;  4AL1 A;  1M2V A;  3B29 A;  1QVX A;  2B0H A;  2EPN A;  2R02 A;  1QKR A;  2D5R B;  3EG9 B;  4PK4 A;  4BPM A;  1N1C A;  3W8I A;  1R5I D;  2LFD A;  2LIG A;  4CJG A;  3IQT A;  1WAS A;  3ASN C;  3ABL C;  3NMJ A;  3V5Y A;  3GOD A;  1CGM E;  4OIO F;  2W4M A;  3SNH A;  2A6E F;  3POV A;  2AWY A;  3UR3 C;  1OW7 A;  2EIJ C;  3QW0 A;  1VYK A;  4KNV A;  3W2W A;  4EKW A;  2J7P A;  1RJ9 B;  4GEH A;  5JP7 A;  1YYJ A;  2VCC A;  3BEH A;  4P6I C;  3T9O A;  3G50 A;  3L34 A;  2IOQ A;  4PJJ A;  2HS5 A;  2XLW A;  4YJW A;  1R4T A;  4XPX A;  3S9O A;  3LEV A;  1J8M F;  3K1I C;  4W8K A;  3WG7 C;  5A6A A;  5COM A;  1LM3 B;  2KK1 A;  1CPQ A;  3JYH A;  2HMZ A;  5BQG A;  3U0C A;  2CDQ A;  3LJB A;  4C7O B;  2WL8 A;  3HKK A;  4J30 B;  1B68 A;  1FFT C;  2R7O A;  3Q6N A;  1D0Z A;  2NSG A;  2YVK A;  3U3F A;  1ZHW A;  3GM3 A;  2PX3 A;  3ASO C;  1Q0G A;  4GQH A;  1Z6A A;  4KC9 A;  4EUK B;  5A6K A;  1APC A;  2PF4 E;  4JC7 A;  4Q5S F;  1O3U A;  3UMK A;  2QUP A;  2A0B A;  2LK4 A;  3R2P A;  3U3B A;  1NFO A;  1A41 A;  3HNI A;  1T6Q A;  2DB4 A;  4WGY A;  2J45 A;  2LP4 A;  3MYF A;  1MMD A;  1I4Y A;  2DGJ A;  4A4A A;  3GEE A;  2H8A A;  2OG2 A;  3AG2 C;  3JT1 A;  4PAC A;  1QQ3 A;  1PD0 A;  3GWL A;  1VTM P;  1OCR C;  2EPK X;  1SR2 A;  2XLD A;  5KYY B;  4M63 A;  4MVM A;  3UMI A;  2J9V A;  3O10 A;  4JJF A;  3CEX A;  1I4Z A;  2Y69 C;  4E0I A;  3K66 A;  4DBQ A;  1LS1 A;  3MBG A;  2H7V C;  2FAP B;  2G62 A;  4NQF A;  4KI2 A;  2R7R A;  1S7Z A;  1BDJ B;  1KU2 A;  4JVS A;  3RVZ A;  4RDA A;  1OR3 A;  3S29 A;  5A6J A;  2AP3 A;  3AQB A;  1JPN A;  256B A;  3ZWI A;  1TWG A;  1SYQ A;  2HKV A;  3GM1 A;  5A6B A;  3RVY A;  3PHF 2;  1JR8 A;  4PJL A;  2W9Y A;  2YKZ A;  2R05 A;  2VAS A;  4YL3 A;  2JX0 A;  1FMW A;  4LER A;  2HZ8 A;  5L0G A;  1G4W R;  4JZA A;  3C8Z A;  3NMK A;  4CS9 A;  2P6V A;  3NMI A;  2HJ3 A;  3M79 A;  2D4U A;  1V55 C;  3M4C A;  3RQE A;  3U2M A;  5DS6 A;  3ZG1 A;  1BR2 A;  2W4B A;  2XL4 A;  1A7E A;  1AUE A;  4N6C A;  4CS9 C;  2PP4 A;  1Z5Z A;  1RKE B;  1O5H A;  4H4K C;  5F28 E;  4CDA A;  2MYS A;  4E7S A;  4LDQ A;  3JSZ A;  5JS5 A;  4AE4 A;  2WB7 A;  1BR1 A;  3AQC A;  4J32 B;  2EPM X;  2LFF A;  3QZC A;  4U5D E;  3ZC4 A;  1YLM A;  2IXN A;  1MMG A;  2Q7R A;  5AC5 A;  1MQV A;  4DVZ A;  3H2U A;  1I5N A;  5CI8 A;  5EHH A;  3MFN A;  4MTF A;  4DRJ B;  3B0U X;  1KTM A;  1IZM A;  3MYI A;  2R7U A;  4HFK B;  5KYX B;  3LAY A;  2YRF A;  1Z3I X;  3WOD F;  2KQ9 A;  1ZYR F;  3IQ5 A;  2AU5 A;  3RKO F;  5L3V A;  4O6M A;  4JKV A;  4DJ9 A;  3CAX A;  1GS9 A;  3HNJ A;  3M15 A;  3SP1 A;  2XLO A;  3C18 A;  4R32 A;  3B0P A;  2V3C C;  4IWB A;  3GOR A;  2YL7 A;  3MX3 A;  2Q9B A;  2AWC A;  4MTG A;  5HV9 A;  2RSE B;  1NG1 A;  1TFO B;  4EWC A;  2NUT A;  3W2V A;  1TFK B;  1D1B A;  1YZA A;  1H9G A;  1H6G A;  1ZW3 A;  2KGO A;  3KYI A;  2KC3 A;  4A2N B;  2A0U A;  5DQT A;  1OQC A;  4X0R A;  4NTF A;  3U8P A;  5COG A;  1V4A A;  1ORY A;  1YAU O;  4XPY A;  4JEA A;  2R7V A;  4U9E A;  3C8G B;  1TWC A;  3AG1 C;  3FMS A;  1ORS C;  4WGZ A;  3VRC A;  1F1M A;  4XQ1 A;  1M6T A;  3DD7 A;  3HTK C;  2GFH A;  3GAN A;  4CX9 A;  3PDM P;  1ZW2 A;  3ZDL A;  2LD6 A;  3C8G D;  2QE9 A;  1U89 A;  3OA1 A;  2IXP A;  4NTA A;  2IXM A;  2AVK A;  2XLH A;  3EGX A;  5GPG B;  4OIN F;  2OKU A;  3RW0 A;  5L3Q A;  5E33 A;  2Y3H A;  1YAR O;  3G4Z A;  4JTA B;  4WAB A;  5L0F A;  1W2W A;  3JRM O;  1FMV A;  3M1C B;  3SXY A;  3S90 A;  4CS8 C;  3A9C A;  2Y3D A;  3FAP B;  1T6I A;  4HEA J;  2NSF A;  4BEJ A;  5CIV A;  1SF8 A;  1OW6 A;  2L6G A;  2YLG A;  3N2Z B;  4ANJ A;  4CDY A;  3DXJ F;  4XEF A;  2J8W A;  3NKD A;  1V54 C;  2YQY A;  1Z7Q c;  3U9M A;  1Z63 A;  3K1I A;  1Q0D A;  4NY3 A;  4DRI B;  3EHN A;  1GQA A;  3DM5 A;  3J06 A;  2ZXP A;  2DYR C;  3C63 A;  3EHM A;  4K0D A;  1A7D A;  2IM8 A;  3Q7L A;  1MND A;  4OD4 A;  3QTH A;  2BE5 F;  1LI5 A;  1ZHX A;  1XZQ A;  1NZE A;  3E9V A;  1H7I A;  1T5O A;  3EFO A;  2VCB A;  1A7V A;  2XL8 A;  1MMN A;  5BQI A;  1JPJ A;  1D1C A;  1E2X A;  3F47 A;  3SEO A;  5BQH A;  1RXQ A;  4IGG A;  3MLG A;  4MND A;  4AE4 B;  1ST6 A;  1DOV A;  4MVS A;  4J7T A;  5L0H A;  2Y3B A;  1FTS A;  4IAQ A;  5HSW A;  4G7O F;  1JOG A;  3Q6M A;  4BJ5 A;  2CW0 F;  1AEP A;  2BC5 A;  1WWP A;  4W8P A;  1D0X A;  4D4N A;  4K1O A;  1DOW A;  2XM4 A;  1YJG A;  3R7C A;  2KSF A;  4BJ5 C;  3FOP A;  1NSG B;  5KYW B;  1K04 A;  4LLE A;  1H9T A;  2P61 A;  2KJG A;  2VCA A;  3TJ5 A;  2R7T A;  2H7O A;  4B6I A;  4Z9I A;  2OQM A;  1JMW A;  4ZLD A;  3QVY A;  3JTL O;  4PJM A;  2R9R B;  3PCV A;  5COF A;  3T4R A;  2WZL A;  1QPU A;  4BJT A;  1Q0F A;  1PV3 A;  2B0J A;  3GM2 A;  1NU7 D;  4F4B A;  2FFH A;  2XS8 A;  1S05 A;  1NLX A;  1QZX A;  1EQ1 A;  4QI0 A;  3ZTM A;  4AL0 A;  3Q7G A;  4AK9 A;  4C3B A;  4YK5 A;  2CYD A;  2UUH A;  1M2O A;  3K33 A;  2J9W A;  4IRU A;  2X51 A;  3JYY A;  3ABK C;  3FHD A;  3JRT A;  3B0V C;  3KPH A;  4QDL A;  3QVZ A;  2MHR A;  2CNW D;  2PFD A;  4IAO A;  5E3A A;  2WZG A;  3SYN A;  3KYJ A;  1TWH A;  3NYL A;  2XXA A;  2ZD9 A;  4I3M A;  2MWQ A;  2L6F A;  2EIL C;  4NCQ A;  2PNO A;  1M2V B;  2NUP A;  3C62 A;  3VYW A;  3HNK A;  3RIP A;  2XM0 A;  4IAR A;  1LIH A;  3U2L A;  4DXW A;  2TMV P;  4LAC B;  3EG9 A;  1CGO A;  2QNL A;  1CPR A;  3KMI A;  3V5Z A;  4JUR I;  4ER9 A;  3IHU A;  1V74 B;  1HE1 A;  3BRJ A;  3L1M A;  4JJG A;  3AGT A;  4U5C E;  4XTK A;  4DBR A;  4G78 A;  3NG1 A;  3SXZ A;  4CSA A;  2YL3 A;  3VM6 A;  1OKK D;  1L7C A;  4K7B A;  4FX5 A;  4PFO A;  3ABM C;  4MW3 A;  5B3S C;  5E3C A;  2LQG A;  2A1D D;  3TQO A;  1BBH A;  2ASR A;  3ATP A;  4CSA C;  5E2Q A;  3AOU A;  3NRH A;  5JUA A;  5L0I A;  4P9T A;  2LSE A;  3TD7 A;  2DI3 A;  1RJ9 A;  4L6R A;  3CSK A;  1LKX A;  5B1A C;  3A11 A;  4ONS A;  4BEM J;  3EGD A;  2IYL D;  3ZTZ A;  5KYU A;  2J46 A;  4MVQ A;  3DWW A;  4JCH A;  1LVK A;  4O6N A;  5L0J A;  1GGQ A;  1L3P A;  1ZHT A;  4HE8 D;  4DRH B;  3LLI A;  1UG7 A;  4E17 A;  2G3V A;  2EIN C;  3S84 A;  2OEV A;  3X2Q C;  2BL2 A;  1Y6D A;  4XEV A;  1EKY A;  2YL0 A;  1VB5 A;  1YA9 A;  2Y39 A;  3AG3 C;  4C3D A;  3EH2 A;  2NPU A;  4MTO A;  3RF3 A;  4JEB A;  3IQC A;  4XLN F;  1E85 A;  4XLP F;  2P7V A;  4Q7C A;  3O6X A;  5DLJ A;  2HFI A;  1J8Y F;  3LS1 A;  4YT2 A;  3S28 A;  4I1O B;  3N24 A;  3I4U A;  3WHN A;  2YLD A;  1OXK A;  3NDB B;  1M57 C;  1TR2 A;  1LE4 A;  5FCL A;  2L6H A;  4ULW A;  2Q9A A;  4CJO A;  1PD1 A;  4UDV A;  3DKA A;  1OXB A;  3JZ0 A;  1QLE C;  4YT4 A;  3H2V A;  5L0D A;  3LES A;  2CGE A;  5B3I A;  2HSQ A;  2Q9C A;  2YL1 A;  5JLI A;  2ETS A;  2L9J A;  1RCP A;  4DOZ A;  3US6 A;  5EK0 A;  2QLA A;  4JTD B;  1VMA A;  5BUO A;  2WVO A;  1A0B A;  1MNE A;  1JAF A;  3G4X A;  5AC4 A;  3OWT A;  1G5Z A;  3F46 A;  1WN0 A;  2J9U A;  4DVY P;  1FR0 A;  3IEE A;  2KNH A;  2UUI A;  3ITF A;  3M4B A;  4LDK A;  3LNR A;  4CS8 A;  1RKC A;  2GA0 A;  2HMQ A;  2OEX A;  2Q3T A;  1XWJ A;  1U0B B;  4U9D A;  2QY9 A;  4G7H F;  1EI7 A;  5FZT A;  3CQZ A;  1CGN A;  2WVN A;  3DMD A;  3V7O A;  3WAQ A;  5DS4 A;  4G0H A;  2Q00 A;  4YL0 A;  3ZVR A;  4EBJ A;  3U5S A;  1HW1 A;  5EGY A;  3DE8 A;  3RQG A;  3T6B A;  3DAG A;  1HE9 A;  4U5G A;  4QI2 A;  1G4U S;  1OW8 A;  5T3T A;  1BZ4 A;  4YT5 A;  5JSL A;  1HMO A;  2HUJ A;  3OEO A;  4OIP F;  2ZXW C;  3KH2 A;  1MMA A;  3LUT B;  4MS2 A;  2I15 A;  4FES A;  3S27 A;  2JD3 A;  4BJ6 C;  5IY5 C;  4OIQ F;  2YEV A;  5K0I A;  1HMD A;  2A6H F;  3H65 A;  4PJN A;  4U5F E; 
#chains in the Genus database with same CATH homology
 2HJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...