1WATA

The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
142
structure length
142
Chain Sequence
GFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor. Structural comparison to the cross-linked mutant forms and conformational changes upon ligand binding.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
total genus 58
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1watA00
4Z9IA 4Z9HA 3T9OA 3ATPA 2ASRA 1JMWA 2LIGA 2D4UA 4H54A 1VLTA 4Z9JA 1LIHA 1WASA 1WATA 1VLSA
chains in the Genus database with same CATH superfamily
4O6YA 2YL3A 2AWCA 2V3CC 1NLXA 1E85A 2JPUA 2LCHA 3AG1C 1WOLA 3QZCA 2AP3A 2OEXA 3EG9B 4JTAB 5K0IA 2IXMA 3JTLO 3ATPA 4MVSA 2MYSA 3GANA 4WGYA 3J06A 1J8MF 2B0JA 3MYIA 1FAPB 3M15A 5B3SC 2XL8A 3GM2A 3JZ0A 3KH2A 1UG7A 3I5QA 4JURI 4YL0A 3LEVA 1XZPA 3NYMA 3SZRA 1YLMA 3US6A 5KYXA 4BG0A 5DS4A 3GWNA 2EPNA 2X51A 3C62A 2ETSA 3EGDB 2AVKA 3N24A 4I1MA 3SEOA 3ABMC 4C7OB 2OQMA 4AL0A 4MTOA 3IPMO 2W4BA 3IQCA 4Q7CA 3CQZA 5T1DB 1TR2A 1JR8A 3B29A 3ZIBA 5KYNA 4ZLDA 5D92A 1K05A 3U5SA 3NKEA 4XPXA 2PX3A 1NBBA 3K66A 4U5GA 2G62A 2H7VC 3SYNA 3PMRA 3ZQVA 1N1CA 1TKNA 3U9JA 2J0WA 4KC9A 3M79A 3HJCA 2LD6A 3EH2A 2ZXPA 3H2UA 2GDCA 4XQ1A 3EFOA 2LSEA 1W2WA 5AC5A 4G0HA 3NRHA 4B6IA 1EQ1A 1BR4A 2PP4A 1VK5A 3L0IA 2P1AA 4OIRF 4IWBA 2XLVA 4CX9A 1OCZC 3WHNA 2XXAB 3TK0A 3U3FA 3PHF2 5B1AC 1VLSA 4HFKB 3S29A 2MHRA 2RD9A 3K1HA 4ANJA 2E87A 3S84A 1K40A 1ZHTA 2HKVA 3UMHA 3FOPA 3LLKA 3MX3A 2Y39A 2HV6A 4O79A 2IBFA 3EG9A 3T6JA 2BC5A 2J9UA 1D1CA 3TJ5A 2V26A 3LUTB 2JD3A 5GPGB 4JE9A 5KYWB 3G4ZA 5FZTA 2R7TA 3ASNC 5B1BC 1RKEB 2P7VA 2LIGA 5COMA 4MNDA 2OOCA 3EGDA 2R7SA 3JSEO 2QUPA 4C7OA 3Q7GA 4CBEA 3LS1A 2NSFA 4YK5A 4JTCB 1WWPA 3EPVA 4I1OB 4MW3A 4IGGA 2Y3HA 4OIQF 3TULA 5EK0A 1F1MA 4NQFA 4GEHA 4U5FE 2Y3DA 2WVOA 2A69F 2W9YA 4XEFA 5COFA 1B68A 2FAPB 4AL1A 4CIHA 3QVYA 3RQGA 4GYTA 4N4WA 3IEEA 5E3CA 1SR2A 4EWCA 3VRCA 2L6GA 3I5PA 1DOWA 1FMVA 2DB4A 2H8AA 3EGXB 3QW0A 4IARA 4LDRA 3G50A 4MVMA 4DOZA 2LQGA 3WODF 1L3PA 3TD7A 1YDIA 2XXAA 3GM3A 2ZXWC 5B3IA 1OW8A 4E18A 2TMVP 2PBEA 3AOUA 1KTMA 1Z23A 1V54C 2YKZA 1LVKA 3GODA 4MTGA 3VM6A 2YLGA 1MQVA 4BPMA 3JRTA 1SYQA 5F5HA 4JC7A 4J30B 3HTKC 4KNVA 3ZSUA 3POVA 2R7QA 2Z15A 2XLOA 5E33A 2XLEA 4JRZA 4DJ9A 3BEHA 5A6JA 2R7VA 4ONSA 2A1DD 2L9JA 5KYWA 1PD1A 2XLHA 1WGWA 4G7HF 4RDAA 1DOVA 5A6AA 3KPHA 3GEEA 1RKEA 3MYFA 5DVWA 5BQGA 2Q7RA 5L0JA 5JVEA 4EBBA 1OXBA 1HE1A 3GORA 2KQ9A 1R5ID 4C3DA 3HLZA 2VCBA 1YZCA 1ZHZA 3W2WA 4ULWA 4Q5SF 1FR0A 3DE8A 2J9BA 1EKYA 1ORJA 4P9TA 1YVIA 4MVOA 2R7RA 3W4YA 1H7IA 1LE4A 2XL6A 3RH3A 3JRMO 2FGYA 3IHUA 4KBLA 2GFHA 4PACA 1QKRA 4MVUA 4BJ6A 4XEVA 3FDQA 2A6HF 3C8GB 3EGXA 2Q3TA 3SP1A 1EA8A 4XTKA 3EJNA 3HKKA 4NTBA 2EPMX 3OEOA 3FMSA 3NDBB 4JEAA 1A7VA 1CPRA 1RCPA 4WGZA 3NG1A 5F5FA 1HMOA 3AJMA 2R03A 3C8ZA 4XPWA 2EINC 4IJJA 4CDAA 1OCOC 2WL8A 4MQ9F 4G7ZF 2OG2A 3ITFA 2KYHA 4W8KA 2YHSA 3PCVA 3U3BA 5IY5C 4JTDB 3DAFA 4DRIB 4ZLCA 4PK4A 2YLDA 1U6HA 4CSAA 1ZHWA 2EIMC 1OR3A 2WVQA 3KMIA 4N06A 1TWGA 2L6HA 3LESA 5EHHA 2I8BA 2KK1A 4ER9A 4OIOF 4OINF 1TWAA 4CDYA 4E17A 1MMDA 4EBKA 2H7OA 5AC4A 1LKXA 2IXOA 5A6BA 4BJ6C 3L8JA 3R7CA 5JS5A 4J7YA 4HE8D 2YQYA 5L3QA 3L8IA 2Q9CA 1A7DA 2YL7A 3KYIA 4JEBA 2LFDA 2A6EF 2H7BA 2XLWA 1T6UA 3F46A 3RQFA 3UNGC 2R7OA 1L7CA 4E0HA 2Y3GA 1A7EA 4PJNA 1V74B 2IXNA 3VYWA 1LI5A 3SXZA 2NUPB 4K7BA 1O5HA 4AK9A 4EHPA 2YRFA 3W8HA 4YN0B 3CEXA 2XS8A 5L3VA 3H65A 1CPQA 2AU5A 4NY3A 1YA9A 1T6QA 2L81A 3KYJA 2QE9A 1D0YA 4FX5A 1XWJA 3TQOA 4DRJB 2HZ8A 4CSAC 1CGOA 5HSWA 4PJMA 4EUKB 3C8GA 4BJ1A 3E9VA 4FESA 4HEAJ 2L7AA 3V5XA 3RKOF 1GGQA 2YL1A 4A4AA 5DS6A 1T01A 1E86A 1RMVA 2HJMA 2W4MA 1QZXA 3NMKA 4P6IC 3WAQA 5BQIA 2QY9A 2J46A 5L0CA 1JOGA 1V4AA 4QI2A 4U5CE 3EQLF 1BBHA 4PJJA 4QDLA 5E3AA 3NYLA 3UR3C 4JVSA 3UMKA 2YVKA 1E84A 2OJED 1NG1A 2XM4A 2IYLD 4ULVA 3LNMB 3V5YA 3EH1A 3O55A 2OCCC 3JSZA 2KGOA 4Z9HA 2DI3A 1YARO 3FVYA 3LJBA 2LFFA 2PX0A 2FFHA 2YL0A 4O6MA 4U9DA 4DVYP 5JLIA 2QNLA 1Q0KA 1O87A 5T3WA 3C63A 3L34A 3RF3A 2DYSC 3SNHA 1LI7A 3AG3C 1SMYF 4WABA 1Z5ZA 1S7ZA 2NUTB 3R2PA 3DI5A 4LDKA 1HE9A 3JT1A 4R32A 1SZIA 2PFDA 3K33A 4YT4A 3FHDA 3LS0A 3RVYA 1IW7F 4GQHA 4IAQA 4JCZA 5FCLA 3DAGA 4CJOA 3DWWA 2VCCA 2NUPA 2Q00A 2I15A 3S9OA 4YT5A 1OXKA 1H6GA 3QW1A 1OKKD 2KC3A 3QTHA 4E0IA 1LE2A 1VTMP 4EIYA 4QI0A 4XEKA 1MNEA 2M4EA 3DJNB 4IRUA 2HSQA 2Q9BA 3BRJA 5DLJA 4LLCA 3VF0A 3RYLA 3X1OA 3QMKA 5L0FA 1E2XA 4U5DE 3DZAA 2PF4E 3FOOA 3U2MA 2RSEB 3AQCA 1YYJA 5CIVA 1ZVZA 2P6VA 4L6RA 2R02A 1AVOB 3SXYA 3NMIA 1RXQA 2WB7A 2ASRA 2J7PD 1Q0FA 2XLMA 3O10A 1NFOA 4K1OA 4O6NA 1ZYRF 1VOMA 1QQ3A 4PFOA 1U0BB 5JUAA 2GWWA 1YJGA 1LIHA 1BDJB 3U0CA 2NSGA 4I44A 4DVZA 3HNKA 3DXJF 2EIJC 5COGA 5TJ5E 3AGUA 5A6BD 3DKAA 1GS9A 1TWHA 2VC9A 1M57C 4P9FA 1FFTC 4MVZA 3RFYA 2NUTA 1J8YF 1Z7Qc 3ZWIA 1ZHYA 3PDMP 3B71A 2OU6A 2QLAA 2IOQA 2R7UA 4MVRA 2ZPAA 3ECSA 2OJQA 4BEJA 2R7WA 2A0BA 2JX0A 4MVQA 3DD7A 1JAFA 3U8PA 3ZVRA 2HFIA 3RQEA 1FNTc 3B0VC 4U5HA 3ASOC 1MMGA 1OKKA 5E2QA 3HNJA 2J0XA 2XRHA 1NZEA 3DJUB 4DBQA 3C8GD 2CYDA 2Q4FA 4CS9C 1VYIA 2Q9AA 3U2LA 2Y69C 2OEVA 3W2VA 3ABKC 1G4US 2EIKC 4PR9A 3GEHA 3E70C 4Z9IA 5L0IA 5CI9A 3B9QA 4J7TA 4EBJA 1M2OA 2HMQA 3UGOA 1O3UA 1AEPA 2HV7A 1Y4CA 3N2ZB 1T5OA 1ZW2A 1YA7O 2HUJA 3IQTA 4YT2A 3HNIA 4OD5A 2WZGA 4K0DA 3ZG1A 2D5RB 4CS8A 2P61A 2J7PA 1U89A 2HMZA 4MW8A 1CGME 3TJ6A 2W45A 5BQHA 3DM9B 1RJ9A 4CDVA 2PNOA 2WVNA 2YLIA 1I4YA 1NSGB 4YL1A 1E83A 1ZZPA 1H9GA 2KJGA 1C17M 3H2VA 3T9OA 2VASA 4H4KC 3EZHA 2HSBA 3AG2C 3X2QC 2ZXOA 2DGJA 4U5EE 4FAPB 1H9TA 3IQ5A 4LACB 1D1BA 3SXKA 3W8IA 2EPOA 3DMDA 5EGYA 5T3TA 4I3MA 1ST6A 4C3EA 2G3VA 3B0PA 5HV9A 2UUHA 3VAYA 4JZAA 5JSLA 1GM5A 3O6XA 2R05A 5D91A 3EZIA 3GM1A 2R7XA 3AG4C 2UUIA 3ZTMA 4CS8C 2KNHA 3FAJA 1JRAA 2J9VA 3NKDA 3F47A 4E7ZA 1TWCA 1Z6AA 3OWTA 3WG7C 3S28A 4Z9JA 1LM3B 1VLTA 3ZTZA 3AGTA 3MBGA 3RIPA 2CNWA 2EPKX 4YWQA 5A69A 4MTFA 1AUEA 3V5ZA 3QVZA 1TFOB 3V7OA 1M56C 3EHNA 4PFPA 1VB5A 1VMAA 1FMWA 1JMWA 4OIPF 2CDQA 2A0UA 4C3BA 1OW6A 3KKBA 4LDQA 4BEMJ 1Z63A 4FWVA 4UDVA 3JYYA 5JP7A 4XPYA 3FXHA 3IQ6A 4JW1A 5DQZA 1TFKB 4IAOA 1JPNA 4NTAA 2D4UA 4IB4A 2BE5F 4DRHB 2IM8A 1Q0MA 3N0TA 1OR2A 1QPUA 2J9WA 2KSFA 1HW1A 1HW2A 4M63A 4AE4B 4Q4ZF 5KYYB 3C7JA 3ZC4A 1TQGA 2G3KA 1WATA 1R4TA 3U8VA 4CJGA 3MFNA 1UFBA 1OCRC 3UGPA 2BL2A 2F22A 3K7DA 4YL3A 4W8PA 4CIPA 1M2VB 4U5BE 2R9RB 3TOMA 2WZLA 2M64A 2R25A 1NU7D 3AQBA 1G5ZA 3M4CA 1OQCA 3I4UA 3K6BA 4HFFB 1Q0GA 4JKVA 4RBNA 1IZMA 2AWYA 1JPJA 3CAXA 3MLGA 4G7OF 4LERA 1EI7A 1SF8A 3S90A 4JJFA 5DQTA 1QSPA 1I4ZA 3RW0A 2A68F 3FAPB 3GWLA 2VH3A 4O7GA 1FTSA 1MMNA 3S27A 1OCCC 3L1MA 4YT8A 3JYHA 1YAUO 2HS5A 3LEOA 1Y6DA 1ZU4A 4D4NA 4AX2A 1NU9C 3A11A 4N6CA 4N6HA 1D0XA 2GA0A 2VB6A 3C18A 4U9EA 5JRAA 3G4XA 2DYRC 3OA1A 2QTVA 1RKCA 1C02A 2XS1A 4WJ0A 5F28E 4D4XA 3T6BA 2J8WA 5L0GA 5DS5A 4EKWA 1WASA 3Q7LA 1WTYA 5A6KA 5KYUB 3EHMA 4JIOA 2L6FA 4MS2A 4G78A 4PJLA 2HJ3A 4XLNF 4CS9A 4JCHA 1CGNA 2XL4A 3B0UX 2GAQA 1RJ9B 1HY5A 256BA 1Q0DA 1NFNA 2VCAA 1XZQA 2CCYA 2J45A 3KL4A 1LS1A 3O39A 2X0CA 3ZQYA 4AE4A 1K04A 2NG1A 3CSKA 2C04A 3DE9A 4NCQA 5L0HA 5KYYA 1G8XA 1A0BA 1QLEC 3DM5A 2Y3BA 5CI8A 4BJ5A 4J32B 4JJGA 3UMIA 1APCA 3S0XA 1WN0A 4XWJA 1M2VA 1D0ZA 1PCXA 1T6IA 2B0HA 1OW7A 1Z3IX 2P0NA 4H54A 3A9CA 1ORSC 4XLPF 3JCUQ 1LS4A 2EPLX 4E7SA 1ZU5A 1ORYA 2C03A 1YYXA 3LLIA 4CS7A 2CW0F 1ZW3A 2KW3C 3NMJA 1S05A 3M1CB 3ZDLA 3K1IA 5BUOA 2XSEA 2YEVA 4KI2A 1G4WR 3NYJA 4NTFA 2LP4A 1VYKA 3SXMA 3U9MA 5L0DA 1KU2A 2CNWD 5KYXB 2CGEA 1ZHXA 2WZFA 2YWAA 1BZ4A 3GEIA 1I5NA 2XM0A 3CZ6A 4NC3A 2MWQA 3ABLC 2O9XA 3M4BA 4BJ5C 5AGFA 2NPUA 1BR2A 1YZAA 2ZD9A 3LAYA 2YZSA 1QVXA 1C03A 1MNDA 1HMDA 3Q6MA 5JT4A 4YJWA 4LLEA 5KYUA 3T4RA 1M6TA 3Q6NA 2IXPA 2XLDA 3TOLA 1D1AA 1GQAA 1KNYA 2EILC 3T6GB 4X0RA 1PD0A 1A41A 2ICWG 4F4BA 1PV3A 3EFOB 3LNRA 4RD9A 4KNWA 4DXWA 4DBRA 2LK4A 1MMAA 1T9KA 3HNLA 3K1IC 2ZXRA 4OD4A 1BR1A 1FFHA 1LPEA 4A2NB 3RVZA 4BJTA 1V55C 2OKUA
chains in the Genus database with same CATH topology
4Z9IA 4Z9HA 3T9OA 3ATPA 2ASRA 1JMWA 2LIGA 2D4UA 4H54A 1VLTA 4Z9JA 1LIHA 1WASA 1WATA 1VLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9I A;  4Z9H A;  3T9O A;  3ATP A;  2ASR A;  1JMW A;  2LIG A;  2D4U A;  4H54 A;  1VLT A;  4Z9J A;  1LIH A;  1WAS A;  1WAT A;  1VLS A; 
#chains in the Genus database with same CATH topology
 4O6Y A;  2YL3 A;  2AWC A;  2V3C C;  1NLX A;  1E85 A;  2JPU A;  2LCH A;  3AG1 C;  1WOL A;  3QZC A;  2AP3 A;  2OEX A;  3EG9 B;  4JTA B;  5K0I A;  2IXM A;  3JTL O;  3ATP A;  4MVS A;  2MYS A;  3GAN A;  4WGY A;  3J06 A;  1J8M F;  2B0J A;  3MYI A;  1FAP B;  3M15 A;  5B3S C;  2XL8 A;  3GM2 A;  3JZ0 A;  3KH2 A;  1UG7 A;  3I5Q A;  4JUR I;  4YL0 A;  3LEV A;  1XZP A;  3NYM A;  3SZR A;  1YLM A;  3US6 A;  5KYX A;  4BG0 A;  5DS4 A;  3GWN A;  2EPN A;  2X51 A;  3C62 A;  2ETS A;  3EGD B;  2AVK A;  3N24 A;  4I1M A;  3SEO A;  3ABM C;  4C7O B;  2OQM A;  4AL0 A;  4MTO A;  3IPM O;  2W4B A;  3IQC A;  4Q7C A;  3CQZ A;  5T1D B;  1TR2 A;  1JR8 A;  3B29 A;  3ZIB A;  5KYN A;  4ZLD A;  5D92 A;  1K05 A;  3U5S A;  3NKE A;  4XPX A;  2PX3 A;  1NBB A;  3K66 A;  4U5G A;  2G62 A;  2H7V C;  3SYN A;  3PMR A;  3ZQV A;  1N1C A;  1TKN A;  3U9J A;  2J0W A;  4KC9 A;  3M79 A;  3HJC A;  2LD6 A;  3EH2 A;  2ZXP A;  3H2U A;  2GDC A;  4XQ1 A;  3EFO A;  2LSE A;  1W2W A;  5AC5 A;  4G0H A;  3NRH A;  4B6I A;  1EQ1 A;  1BR4 A;  2PP4 A;  1VK5 A;  3L0I A;  2P1A A;  4OIR F;  4IWB A;  2XLV A;  4CX9 A;  1OCZ C;  3WHN A;  2XXA B;  3TK0 A;  3U3F A;  3PHF 2;  5B1A C;  1VLS A;  4HFK B;  3S29 A;  2MHR A;  2RD9 A;  3K1H A;  4ANJ A;  2E87 A;  3S84 A;  1K40 A;  1ZHT A;  2HKV A;  3UMH A;  3FOP A;  3LLK A;  3MX3 A;  2Y39 A;  2HV6 A;  4O79 A;  2IBF A;  3EG9 A;  3T6J A;  2BC5 A;  2J9U A;  1D1C A;  3TJ5 A;  2V26 A;  3LUT B;  2JD3 A;  5GPG B;  4JE9 A;  5KYW B;  3G4Z A;  5FZT A;  2R7T A;  3ASN C;  5B1B C;  1RKE B;  2P7V A;  2LIG A;  5COM A;  4MND A;  2OOC A;  3EGD A;  2R7S A;  3JSE O;  2QUP A;  4C7O A;  3Q7G A;  4CBE A;  3LS1 A;  2NSF A;  4YK5 A;  4JTC B;  1WWP A;  3EPV A;  4I1O B;  4MW3 A;  4IGG A;  2Y3H A;  4OIQ F;  3TUL A;  5EK0 A;  1F1M A;  4NQF A;  4GEH A;  4U5F E;  2Y3D A;  2WVO A;  2A69 F;  2W9Y A;  4XEF A;  5COF A;  1B68 A;  2FAP B;  4AL1 A;  4CIH A;  3QVY A;  3RQG A;  4GYT A;  4N4W A;  3IEE A;  5E3C A;  1SR2 A;  4EWC A;  3VRC A;  2L6G A;  3I5P A;  1DOW A;  1FMV A;  2DB4 A;  2H8A A;  3EGX B;  3QW0 A;  4IAR A;  4LDR A;  3G50 A;  4MVM A;  4DOZ A;  2LQG A;  3WOD F;  1L3P A;  3TD7 A;  1YDI A;  2XXA A;  3GM3 A;  2ZXW C;  5B3I A;  1OW8 A;  4E18 A;  2TMV P;  2PBE A;  3AOU A;  1KTM A;  1Z23 A;  1V54 C;  2YKZ A;  1LVK A;  3GOD A;  4MTG A;  3VM6 A;  2YLG A;  1MQV A;  4BPM A;  3JRT A;  1SYQ A;  5F5H A;  4JC7 A;  4J30 B;  3HTK C;  4KNV A;  3ZSU A;  3POV A;  2R7Q A;  2Z15 A;  2XLO A;  5E33 A;  2XLE A;  4JRZ A;  4DJ9 A;  3BEH A;  5A6J A;  2R7V A;  4ONS A;  2A1D D;  2L9J A;  5KYW A;  1PD1 A;  2XLH A;  1WGW A;  4G7H F;  4RDA A;  1DOV A;  5A6A A;  3KPH A;  3GEE A;  1RKE A;  3MYF A;  5DVW A;  5BQG A;  2Q7R A;  5L0J A;  5JVE A;  4EBB A;  1OXB A;  1HE1 A;  3GOR A;  2KQ9 A;  1R5I D;  4C3D A;  3HLZ A;  2VCB A;  1YZC A;  1ZHZ A;  3W2W A;  4ULW A;  4Q5S F;  1FR0 A;  3DE8 A;  2J9B A;  1EKY A;  1ORJ A;  4P9T A;  1YVI A;  4MVO A;  2R7R A;  3W4Y A;  1H7I A;  1LE4 A;  2XL6 A;  3RH3 A;  3JRM O;  2FGY A;  3IHU A;  4KBL A;  2GFH A;  4PAC A;  1QKR A;  4MVU A;  4BJ6 A;  4XEV A;  3FDQ A;  2A6H F;  3C8G B;  3EGX A;  2Q3T A;  3SP1 A;  1EA8 A;  4XTK A;  3EJN A;  3HKK A;  4NTB A;  2EPM X;  3OEO A;  3FMS A;  3NDB B;  4JEA A;  1A7V A;  1CPR A;  1RCP A;  4WGZ A;  3NG1 A;  5F5F A;  1HMO A;  3AJM A;  2R03 A;  3C8Z A;  4XPW A;  2EIN C;  4IJJ A;  4CDA A;  1OCO C;  2WL8 A;  4MQ9 F;  4G7Z F;  2OG2 A;  3ITF A;  2KYH A;  4W8K A;  2YHS A;  3PCV A;  3U3B A;  5IY5 C;  4JTD B;  3DAF A;  4DRI B;  4ZLC A;  4PK4 A;  2YLD A;  1U6H A;  4CSA A;  1ZHW A;  2EIM C;  1OR3 A;  2WVQ A;  3KMI A;  4N06 A;  1TWG A;  2L6H A;  3LES A;  5EHH A;  2I8B A;  2KK1 A;  4ER9 A;  4OIO F;  4OIN F;  1TWA A;  4CDY A;  4E17 A;  1MMD A;  4EBK A;  2H7O A;  5AC4 A;  1LKX A;  2IXO A;  5A6B A;  4BJ6 C;  3L8J A;  3R7C A;  5JS5 A;  4J7Y A;  4HE8 D;  2YQY A;  5L3Q A;  3L8I A;  2Q9C A;  1A7D A;  2YL7 A;  3KYI A;  4JEB A;  2LFD A;  2A6E F;  2H7B A;  2XLW A;  1T6U A;  3F46 A;  3RQF A;  3UNG C;  2R7O A;  1L7C A;  4E0H A;  2Y3G A;  1A7E A;  4PJN A;  1V74 B;  2IXN A;  3VYW A;  1LI5 A;  3SXZ A;  2NUP B;  4K7B A;  1O5H A;  4AK9 A;  4EHP A;  2YRF A;  3W8H A;  4YN0 B;  3CEX A;  2XS8 A;  5L3V A;  3H65 A;  1CPQ A;  2AU5 A;  4NY3 A;  1YA9 A;  1T6Q A;  2L81 A;  3KYJ A;  2QE9 A;  1D0Y A;  4FX5 A;  1XWJ A;  3TQO A;  4DRJ B;  2HZ8 A;  4CSA C;  1CGO A;  5HSW A;  4PJM A;  4EUK B;  3C8G A;  4BJ1 A;  3E9V A;  4FES A;  4HEA J;  2L7A A;  3V5X A;  3RKO F;  1GGQ A;  2YL1 A;  4A4A A;  5DS6 A;  1T01 A;  1E86 A;  1RMV A;  2HJM A;  2W4M A;  1QZX A;  3NMK A;  4P6I C;  3WAQ A;  5BQI A;  2QY9 A;  2J46 A;  5L0C A;  1JOG A;  1V4A A;  4QI2 A;  4U5C E;  3EQL F;  1BBH A;  4PJJ A;  4QDL A;  5E3A A;  3NYL A;  3UR3 C;  4JVS A;  3UMK A;  2YVK A;  1E84 A;  2OJE D;  1NG1 A;  2XM4 A;  2IYL D;  4ULV A;  3LNM B;  3V5Y A;  3EH1 A;  3O55 A;  2OCC C;  3JSZ A;  2KGO A;  4Z9H A;  2DI3 A;  1YAR O;  3FVY A;  3LJB A;  2LFF A;  2PX0 A;  2FFH A;  2YL0 A;  4O6M A;  4U9D A;  4DVY P;  5JLI A;  2QNL A;  1Q0K A;  1O87 A;  5T3W A;  3C63 A;  3L34 A;  3RF3 A;  2DYS C;  3SNH A;  1LI7 A;  3AG3 C;  1SMY F;  4WAB A;  1Z5Z A;  1S7Z A;  2NUT B;  3R2P A;  3DI5 A;  4LDK A;  1HE9 A;  3JT1 A;  4R32 A;  1SZI A;  2PFD A;  3K33 A;  4YT4 A;  3FHD A;  3LS0 A;  3RVY A;  1IW7 F;  4GQH A;  4IAQ A;  4JCZ A;  5FCL A;  3DAG A;  4CJO A;  3DWW A;  2VCC A;  2NUP A;  2Q00 A;  2I15 A;  3S9O A;  4YT5 A;  1OXK A;  1H6G A;  3QW1 A;  1OKK D;  2KC3 A;  3QTH A;  4E0I A;  1LE2 A;  1VTM P;  4EIY A;  4QI0 A;  4XEK A;  1MNE A;  2M4E A;  3DJN B;  4IRU A;  2HSQ A;  2Q9B A;  3BRJ A;  5DLJ A;  4LLC A;  3VF0 A;  3RYL A;  3X1O A;  3QMK A;  5L0F A;  1E2X A;  4U5D E;  3DZA A;  2PF4 E;  3FOO A;  3U2M A;  2RSE B;  3AQC A;  1YYJ A;  5CIV A;  1ZVZ A;  2P6V A;  4L6R A;  2R02 A;  1AVO B;  3SXY A;  3NMI A;  1RXQ A;  2WB7 A;  2ASR A;  2J7P D;  1Q0F A;  2XLM A;  3O10 A;  1NFO A;  4K1O A;  4O6N A;  1ZYR F;  1VOM A;  1QQ3 A;  4PFO A;  1U0B B;  5JUA A;  2GWW A;  1YJG A;  1LIH A;  1BDJ B;  3U0C A;  2NSG A;  4I44 A;  4DVZ A;  3HNK A;  3DXJ F;  2EIJ C;  5COG A;  5TJ5 E;  3AGU A;  5A6B D;  3DKA A;  1GS9 A;  1TWH A;  2VC9 A;  1M57 C;  4P9F A;  1FFT C;  4MVZ A;  3RFY A;  2NUT A;  1J8Y F;  1Z7Q c;  3ZWI A;  1ZHY A;  3PDM P;  3B71 A;  2OU6 A;  2QLA A;  2IOQ A;  2R7U A;  4MVR A;  2ZPA A;  3ECS A;  2OJQ A;  4BEJ A;  2R7W A;  2A0B A;  2JX0 A;  4MVQ A;  3DD7 A;  1JAF A;  3U8P A;  3ZVR A;  2HFI A;  3RQE A;  1FNT c;  3B0V C;  4U5H A;  3ASO C;  1MMG A;  1OKK A;  5E2Q A;  3HNJ A;  2J0X A;  2XRH A;  1NZE A;  3DJU B;  4DBQ A;  3C8G D;  2CYD A;  2Q4F A;  4CS9 C;  1VYI A;  2Q9A A;  3U2L A;  2Y69 C;  2OEV A;  3W2V A;  3ABK C;  1G4U S;  2EIK C;  4PR9 A;  3GEH A;  3E70 C;  4Z9I A;  5L0I A;  5CI9 A;  3B9Q A;  4J7T A;  4EBJ A;  1M2O A;  2HMQ A;  3UGO A;  1O3U A;  1AEP A;  2HV7 A;  1Y4C A;  3N2Z B;  1T5O A;  1ZW2 A;  1YA7 O;  2HUJ A;  3IQT A;  4YT2 A;  3HNI A;  4OD5 A;  2WZG A;  4K0D A;  3ZG1 A;  2D5R B;  4CS8 A;  2P61 A;  2J7P A;  1U89 A;  2HMZ A;  4MW8 A;  1CGM E;  3TJ6 A;  2W45 A;  5BQH A;  3DM9 B;  1RJ9 A;  4CDV A;  2PNO A;  2WVN A;  2YLI A;  1I4Y A;  1NSG B;  4YL1 A;  1E83 A;  1ZZP A;  1H9G A;  2KJG A;  1C17 M;  3H2V A;  3T9O A;  2VAS A;  4H4K C;  3EZH A;  2HSB A;  3AG2 C;  3X2Q C;  2ZXO A;  2DGJ A;  4U5E E;  4FAP B;  1H9T A;  3IQ5 A;  4LAC B;  1D1B A;  3SXK A;  3W8I A;  2EPO A;  3DMD A;  5EGY A;  5T3T A;  4I3M A;  1ST6 A;  4C3E A;  2G3V A;  3B0P A;  5HV9 A;  2UUH A;  3VAY A;  4JZA A;  5JSL A;  1GM5 A;  3O6X A;  2R05 A;  5D91 A;  3EZI A;  3GM1 A;  2R7X A;  3AG4 C;  2UUI A;  3ZTM A;  4CS8 C;  2KNH A;  3FAJ A;  1JRA A;  2J9V A;  3NKD A;  3F47 A;  4E7Z A;  1TWC A;  1Z6A A;  3OWT A;  3WG7 C;  3S28 A;  4Z9J A;  1LM3 B;  1VLT A;  3ZTZ A;  3AGT A;  3MBG A;  3RIP A;  2CNW A;  2EPK X;  4YWQ A;  5A69 A;  4MTF A;  1AUE A;  3V5Z A;  3QVZ A;  1TFO B;  3V7O A;  1M56 C;  3EHN A;  4PFP A;  1VB5 A;  1VMA A;  1FMW A;  1JMW A;  4OIP F;  2CDQ A;  2A0U A;  4C3B A;  1OW6 A;  3KKB A;  4LDQ A;  4BEM J;  1Z63 A;  4FWV A;  4UDV A;  3JYY A;  5JP7 A;  4XPY A;  3FXH A;  3IQ6 A;  4JW1 A;  5DQZ A;  1TFK B;  4IAO A;  1JPN A;  4NTA A;  2D4U A;  4IB4 A;  2BE5 F;  4DRH B;  2IM8 A;  1Q0M A;  3N0T A;  1OR2 A;  1QPU A;  2J9W A;  2KSF A;  1HW1 A;  1HW2 A;  4M63 A;  4AE4 B;  4Q4Z F;  5KYY B;  3C7J A;  3ZC4 A;  1TQG A;  2G3K A;  1WAT A;  1R4T A;  3U8V A;  4CJG A;  3MFN A;  1UFB A;  1OCR C;  3UGP A;  2BL2 A;  2F22 A;  3K7D A;  4YL3 A;  4W8P A;  4CIP A;  1M2V B;  4U5B E;  2R9R B;  3TOM A;  2WZL A;  2M64 A;  2R25 A;  1NU7 D;  3AQB A;  1G5Z A;  3M4C A;  1OQC A;  3I4U A;  3K6B A;  4HFF B;  1Q0G A;  4JKV A;  4RBN A;  1IZM A;  2AWY A;  1JPJ A;  3CAX A;  3MLG A;  4G7O F;  4LER A;  1EI7 A;  1SF8 A;  3S90 A;  4JJF A;  5DQT A;  1QSP A;  1I4Z A;  3RW0 A;  2A68 F;  3FAP B;  3GWL A;  2VH3 A;  4O7G A;  1FTS A;  1MMN A;  3S27 A;  1OCC C;  3L1M A;  4YT8 A;  3JYH A;  1YAU O;  2HS5 A;  3LEO A;  1Y6D A;  1ZU4 A;  4D4N A;  4AX2 A;  1NU9 C;  3A11 A;  4N6C A;  4N6H A;  1D0X A;  2GA0 A;  2VB6 A;  3C18 A;  4U9E A;  5JRA A;  3G4X A;  2DYR C;  3OA1 A;  2QTV A;  1RKC A;  1C02 A;  2XS1 A;  4WJ0 A;  5F28 E;  4D4X A;  3T6B A;  2J8W A;  5L0G A;  5DS5 A;  4EKW A;  1WAS A;  3Q7L A;  1WTY A;  5A6K A;  5KYU B;  3EHM A;  4JIO A;  2L6F A;  4MS2 A;  4G78 A;  4PJL A;  2HJ3 A;  4XLN F;  4CS9 A;  4JCH A;  1CGN A;  2XL4 A;  3B0U X;  2GAQ A;  1RJ9 B;  1HY5 A;  256B A;  1Q0D A;  1NFN A;  2VCA A;  1XZQ A;  2CCY A;  2J45 A;  3KL4 A;  1LS1 A;  3O39 A;  2X0C A;  3ZQY A;  4AE4 A;  1K04 A;  2NG1 A;  3CSK A;  2C04 A;  3DE9 A;  4NCQ A;  5L0H A;  5KYY A;  1G8X A;  1A0B A;  1QLE C;  3DM5 A;  2Y3B A;  5CI8 A;  4BJ5 A;  4J32 B;  4JJG A;  3UMI A;  1APC A;  3S0X A;  1WN0 A;  4XWJ A;  1M2V A;  1D0Z A;  1PCX A;  1T6I A;  2B0H A;  1OW7 A;  1Z3I X;  2P0N A;  4H54 A;  3A9C A;  1ORS C;  4XLP F;  3JCU Q;  1LS4 A;  2EPL X;  4E7S A;  1ZU5 A;  1ORY A;  2C03 A;  1YYX A;  3LLI A;  4CS7 A;  2CW0 F;  1ZW3 A;  2KW3 C;  3NMJ A;  1S05 A;  3M1C B;  3ZDL A;  3K1I A;  5BUO A;  2XSE A;  2YEV A;  4KI2 A;  1G4W R;  3NYJ A;  4NTF A;  2LP4 A;  1VYK A;  3SXM A;  3U9M A;  5L0D A;  1KU2 A;  2CNW D;  5KYX B;  2CGE A;  1ZHX A;  2WZF A;  2YWA A;  1BZ4 A;  3GEI A;  1I5N A;  2XM0 A;  3CZ6 A;  4NC3 A;  2MWQ A;  3ABL C;  2O9X A;  3M4B A;  4BJ5 C;  5AGF A;  2NPU A;  1BR2 A;  1YZA A;  2ZD9 A;  3LAY A;  2YZS A;  1QVX A;  1C03 A;  1MND A;  1HMD A;  3Q6M A;  5JT4 A;  4YJW A;  4LLE A;  5KYU A;  3T4R A;  1M6T A;  3Q6N A;  2IXP A;  2XLD A;  3TOL A;  1D1A A;  1GQA A;  1KNY A;  2EIL C;  3T6G B;  4X0R A;  1PD0 A;  1A41 A;  2ICW G;  4F4B A;  1PV3 A;  3EFO B;  3LNR A;  4RD9 A;  4KNW A;  4DXW A;  4DBR A;  2LK4 A;  1MMA A;  1T9K A;  3HNL A;  3K1I C;  2ZXR A;  4OD4 A;  1BR1 A;  1FFH A;  1LPE A;  4A2N B;  3RVZ A;  4BJT A;  1V55 C;  2OKU A; 
#chains in the Genus database with same CATH homology
 4Z9I A;  4Z9H A;  3T9O A;  3ATP A;  2ASR A;  1JMW A;  2LIG A;  2D4U A;  4H54 A;  1VLT A;  4Z9J A;  1LIH A;  1WAS A;  1WAT A;  1VLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...