1WATA

The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
142
structure length
142
Chain Sequence
b'GFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor. Structural comparison to the cross-linked mutant forms and conformational changes upon ligand binding.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
total genus 58
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1watA00
1JMWA 2D4UA 1WATA 1WASA 2ASRA 4Z9JA 3T9OA 2LIGA 4Z9IA 1LIHA 4H54A 4Z9HA 1VLSA 3ATPA 1VLTA
chains in the Genus database with same CATH superfamily
2CGEA 3DKAA 2L6FA 4KC9A 4BJTA 1V55C 1L7CA 4B6IA 1D0ZA 4MTGA 5E33A 1M2VB 1H6GA 1NG1A 2R25A 1OQCA 4NY3A 3RQGA 4E18A 4YWQA 1E86A 1OW7A 1ZHWA 1JAFA 4MNDA 3B71A 2XLWA 1Z5ZA 4U5EE 3S29A 3DZAA 4CS8C 3LNRA 3G50A 1HMOA 3W2VA 4F4BA 1JPNA 4H4KC 4NTAA 1T5OA 5T3WA 3NRHA 3VF0A 3CSKA 5FCLA 3K1HA 3WAQA 3UMHA 1Z7Qc 1FR0A 3SXKA 1YYXA 4YL0A 3UMKA 5DS6A 3JSEO 4XQ1A 2YVKA 2EILC 2LD6A 2ZXOA 1Q0DA 1YA7O 4C3DA 3A9CA 3VRCA 3U0CA 1O3UA 3VYWA 5D92A 5BQHA 3T4RA 3WHNA 4HE8D 4JRZA 3AG1C 3JRTA 1A7EA 2QNLA 2EPLX 3QTHA 2QY9A 4HFFB 2HMQA 3TOLA 1RKEA 1MMNA 3LAYA 2B0HA 3FOOA 3ASOC 3LLKA 5CI9A 3EHNA 256BA 2A68F 2NSGA 3RW0A 1R4TA 2WB7A 3ABLC 3RFYA 1VB5A 4U5DE 2BE5F 4CX9A 3GWNA 1J8YF 2EPNA 3ITFA 4P9FA 1CPQA 3C8GD 3U9JA 4E7ZA 2A69F 3W8HA 4CIHA 3GWLA 5IY5C 3I4UA 3IQ5A 3QVZA 2OEVA 3ZWIA 2XRHA 5L0JA 5T3TA 1SMYF 1TFOB 3HNLA 2XS1A 3KYIA 3MX3A 4OIOF 3AG3C 4GYTA 2Q9AA 1YJGA 3MYIA 5JUAA 4KNWA 3TK0A 1WTYA 4U5GA 5DLJA 5TJ5E 2A0BA 3O39A 1G5ZA 4LLEA 3K1IA 4PFOA 2Z15A 2R7RA 3FAJA 1QSPA 3K33A 2OJQA 3ZG1A 4OIPF 2R02A 2YLDA 2IYLD 1QQ3A 4XWJA 5L3QA 1ZHYA 2V3CC 5KYXA 1BR1A 2A1DD 2M64A 4BEMJ 1LI5A 4EBKA 3VM6A 3O6XA 1KTMA 2WZFA 4KBLA 2O9XA 2XLOA 3DXJF 4P6IC 1C17M 4N6HA 2W9YA 4PFPA 1E83A 1CGME 3FXHA 1TWGA 2AU5A 3TULA 4MVOA 3EHMA 2GDCA 1AUEA 4O7GA 4EWCA 3R7CA 1E85A 1ORJA 1F1MA 1ZW3A 3DI5A 1GQAA 5DS4A 3S9OA 3T6JA 5KYYB 4ZLDA 3EGDA 3HKKA 1G4WR 4XEFA 2Y3GA 1UG7A 3DWWA 2P61A 1HY5A 3TJ6A 1RKCA 2OQMA 2XS8A 3C62A 1I4ZA 2VH3A 3MYFA 4RDAA 3U3BA 4MTFA 3N0TA 1H9GA 1TKNA 4CS8A 1T6IA 1ST6A 4ULWA 3G4ZA 4OD4A 3C8GA 3NMIA 4A4AA 4D4XA 1D1AA 4CIPA 1Z63A 1ORYA 1V54C 1XZQA 3Q6NA 2XXAB 1GGQA 2Q9BA 3ASNC 3I5QA 1AEPA 3MFNA 4M63A 2JD3A 2P1AA 4DBQA 5AC4A 1K40A 1WATA 3GEEA 4OIQF 2CYDA 3QVYA 4CS7A 1FNTc 3JCUQ 1RJ9B 4XPXA 2V26A 3EZIA 3X1OA 4CDAA 1VYKA 3DM9B 2P0NA 4NCQA 2HS5A 2FGYA 3SXZA 2L81A 1YYJA 2QLAA 4IJJA 5HSWA 2X51A 2VC9A 1APCA 3RYLA 4JCHA 4XTKA 4JVSA 4CS9A 1BDJB 2P6VA 2AWYA 2Y69C 3U8PA 1N1CA 1Y4CA 3K6BA 4G0HA 1TR2A 4MVMA 4CJGA 2XLMA 2A6EF 2NUTA 3US6A 4YT8A 1IW7F 2YKZA 1C02A 2ZXRA 5KYNA 1DOVA 2EINC 2H7OA 4I44A 4XLNF 1RMVA 3J06A 1BR4A 3E70C 2DI3A 5EHHA 2J9UA 1YVIA 3ZSUA 2OEXA 3JTLO 2DYSC 3S28A 4G7OF 3N2ZB 4PK4A 3U3FA 1OXKA 4E7SA 1OKKD 2R7TA 5DS5A 1XWJA 4Q7CA 4C7OB 2AP3A 2IXOA 2E87A 2J8WA 3GEHA 2GWWA 3LS0A 2JX0A 3ECSA 2NUPB 1R5ID 2WVNA 2VASA 3EJNA 4I1OB 4JC7A 3AG4C 4PJLA 1QKRA 1MNEA 2XL6A 4RBNA 3RKOF 2DYRC 2RSEB 3Q6MA 5F5FA 2MYSA 2OU6A 3L34A 3B29A 1Q0MA 2H7VC 1CGOA 2HSBA 2ETSA 3GORA 3O55A 1TWCA 2C03A 4PACA 2AVKA 2R7OA 3IQCA 1EA8A 3CEXA 4NTBA 2QE9A 1T6QA 2YRFA 4U5BE 4WABA 5DQTA 2F22A 2HZ8A 4IAQA 1JRAA 1KNYA 3TQOA 1M2VA 3VAYA 4BPMA 2VB6A 3TJ5A 3EFOA 3SNHA 3DMDA 1ZYRF 1RKEB 4QI0A 2WVOA 3WODF 4A2NB 5F5HA 2W45A 5COMA 3S0XA 2HV6A 1QPUA 1WOLA 2I8BA 3EZHA 3CAXA 4LLCA 3CQZA 3UGPA 2TMVP 5K0IA 1WGWA 4XEVA 2J7PD 4ANJA 2PNOA 4E17A 4CS9C 4YT4A 1FFHA 1LVKA 1FFTC 2XL8A 1LS1A 2EPKX 2Q3TA 3F46A 5JP7A 4EHPA 1OW6A 4BEJA 3M79A 2XSEA 2J9VA 1Z6AA 3LS1A 4GEHA 4X0RA 2OKUA 1OR3A 5JLIA 2HJ3A 4IB4A 2YL3A 3QMKA 3AGUA 4BJ6C 1K04A 3C18A 1H7IA 1M57C 2Y3DA 3FDQA 4MW8A 5KYUA 1UFBA 2AWCA 3KYJA 2J45A 4HEAJ 3GM1A 4JTDB 1OCZC 3M1CB 1LM3B 4JKVA 4MVSA 1LIHA 4O6NA 5COFA 1YA9A 3JRMO 3B0PA 3DAGA 2EIMC 2QUPA 3RH3A 3UMIA 4DOZA 5A6BD 3JSZA 5JS5A 1OKKA 3NYJA 1PCXA 1A7VA 5KYXB 1HW1A 2LK4A 1ZU4A 4Z9IA 2J9WA 5B1AC 3AG2C 1YZAA 4CBEA 2YL0A 1S05A 4D4NA 4LDQA 2YWAA 4MQ9F 1J8MF 3U5SA 1ZHTA 3RQFA 4AE4A 4U9EA 3EH2A 2YQYA 3AQCA 5B3IA 2ZXWC 1NZEA 2ZXPA 4ZLCA 5A69A 5A6JA 3NMJA 4Q4ZF 4KNVA 4YL3A 5GPGB 4JIOA 3FHDA 2YL7A 1NBBA 4PJMA 4QDLA 3KL4A 1I4YA 3EGDB 3L1MA 5BQIA 2ZD9A 2HV7A 2MWQA 3H2UA 5A6KA 1SYQA 1MQVA 4G7ZF 2UUIA 4LDRA 1OXBA 4LERA 3HNKA 3SXMA 2VCBA 3DJNB 2CW0F 3EQLF 2B0JA 1LI7A 3LESA 3OA1A 4P9TA 3UR3C 1E2XA 3ZC4A 2J0XA 2LSEA 3JYHA 1EQ1A 3EG9B 2W4BA 4XPWA 4I1MA 5CIVA 5KYWA 3B0UX 5L3VA 2BC5A 3V5YA 3C8GB 4DJ9A 4JEBA 5E2QA 2XLDA 1FMVA 2BL2A 3LEVA 4U5FE 3BEHA 3HLZA 2L6GA 5BUOA 3ZQYA 4W8PA 4J30B 3GM3A 1VLTA 3GANA 4J7YA 4R32A 3DE8A 5CI8A 1JR8A 1EKYA 3LEOA 2LCHA 4YT5A 2R7UA 4EBJA 1Z23A 3K7DA 3S27A 2L6HA 3H65A 1BZ4A 1OCOC 5KYYA 4CSAC 2PF4E 1C03A 1Q0FA 5A6BA 5D91A 1NFOA 1TWAA 2KK1A 1TWHA 1MMDA 2XM4A 1Q0GA 3SXYA 4N6CA 5AC5A 4EKWA 4FX5A 4JJFA 4FAPB 2VCCA 4DXWA 4EIYA 3FOPA 2NG1A 2PX0A 3ZVRA 4IWBA 1U89A 1NU7D 2XL4A 4QI2A 4G7HF 4DBRA 3C8ZA 1PD0A 4E0HA 3NKEA 1OCCC 3NYLA 1PV3A 2D5RB 3A11A 2QTVA 4JJGA 2XLEA 3ATPA 3C7JA 3H2VA 3IEEA 2XLHA 4FESA 3TOMA 4CDVA 1U0BB 1ZHZA 4K0DA 3G4XA 3DAFA 4YN0B 1ZW2A 3FVYA 4JW1A 4OD5A 3AQBA 4WGYA 4BJ6A 1RJ9A 2IBFA 3NG1A 1FAPB 3V5ZA 1JMWA 5L0IA 5L0FA 2OG2A 2R9RB 3ABMC 3MBGA 2Y39A 3KMIA 1MMGA 3JZ0A 1EI7A 3X2QC 3AJMA 3U2LA 1ZVZA 2R7XA 3KH2A 1KU2A 2NUTB 5DQZA 4BJ5C 2R03A 1BR2A 1T9KA 4LDKA 2YZSA 3OWTA 4WGZA 2GFHA 3HNIA 1CPRA 2DB4A 3S90A 2C04A 2OJED 4XEKA 4YL1A 1D1BA 1FMWA 3T6GB 1S7ZA 4Z9JA 2KQ9A 4UDVA 4OINF 3SYNA 1E84A 3UGOA 2CCYA 4YT2A 2H8AA 3EGXA 1O87A 4JE9A 4JTCB 3JYYA 2L7AA 3V5XA 3EFOB 3UNGC 1LE2A 1OW8A 1MMAA 1Q0KA 3E9VA 3LNMB 4ER9A 5A6AA 3IQ6A 5JSLA 1I5NA 3QZCA 2R7WA 3ZTMA 2WZGA 1GS9A 2UUHA 4AL1A 1WWPA 3QW1A 4PJJA 4MVQA 4ULVA 4IGGA 3EPVA 1IZMA 4O6YA 1L3PA 4EUKB 4AL0A 1O5HA 4C7OA 2M4EA 3POVA 2G3VA 5T1DB 2LQGA 4YK5A 1Y6DA 2NUPA 3K66A 3N24A 1GM5A 1SZIA 2HJMA 4XPYA 2GAQA 4GQHA 5EK0A 2J46A 3IHUA 2EPMX 1MNDA 3PMRA 4PJNA 3RQEA 2G62A 4C3EA 1A41A 5KYUB 1D0YA 2PP4A 3RVYA 4DVZA 4JCZA 3KPHA 2WZLA 2YLIA 3LLIA 2VCAA 2WVQA 2Q4FA 2R7SA 2DGJA 4BJ1A 1W2WA 3LJBA 1YARO 5L0GA 3BRJA 4MTOA 1RCPA 2CDQA 2KW3C 1D0XA 2Q00A 3DD7A 4EBBA 1OCRC 2OCCC 3T6BA 2ICWG 2PFDA 2Y3BA 4G78A 4RD9A 1LKXA 1AVOB 3O10A 2A6HF 1HE1A 4AK9A 4IAOA 4CSAA 1NLXA 1OR2A 2LFDA 5COGA 1WN0A 2RD9A 2EIJC 2YEVA 3FAPB 1A7DA 3IQTA 2KJGA 3GEIA 2A0UA 1G4US 4MS2A 3JT1A 4AE4B 2ASRA 3AGTA 5JT4A 4DVYP 2Q7RA 2W4MA 4H54A 1H9TA 3LUTB 1DOWA 4I3MA 3ABKC 4ONSA 1JOGA 4C3BA 3KKBA 4U9DA 5E3AA 4KI2A 3B9QA 4CDYA 2LFFA 4PR9A 1ZZPA 5B1BC 1K05A 3SEOA 1LS4A 2HUJA 1NU9C 1JPJA 2KYHA 4IRUA 2CNWD 4NC3A 1LPEA 3DJUB 4XLPF 1VMAA 2D4UA 1T01A 3W4YA 4DRHB 4O79A 2LIGA 4J32B 3R2PA 3M15A 1PD1A 2G3KA 3I5PA 3RVZA 2I15A 3ZDLA 5L0DA 1YAUO 4IARA 4N06A 3U8VA 5KYWB 1TFKB 2YLGA 5HV9A 1ZU5A 2J7PA 2R05A 4MVRA 2IM8A 1XZPA 4N4WA 4AX2A 3M4CA 1HE9A 2JPUA 1M2OA 1YLMA 3ZQVA 2L9JA 2IXMA 2HSQA 4MVZA 4OIRF 4NTFA 3EH1A 5L0CA 3PHF2 5EGYA 1VTMP 1YDIA 4Z9HA 1VOMA 4U5CE 4BJ5A 3T9OA 2MHRA 2WL8A 2YHSA 2PBEA 3Q7LA 3ZTZA 2NSFA 3RIPA 1QZXA 1VK5A 2FAPB 3F47A 5BQGA 1B68A 3L0IA 4BG0A 4J7TA 1ORSC 4CJOA 3S84A 3IPMO 4JTAB 4U5HA 2KGOA 1TQGA 3L8JA 5DVWA 3PDMP 1V74B 2FFHA 4O6MA 4WJ0A 3W2WA 3OEOA 1WASA 1LE4A 3PCVA 4DRJB 4W8KA 1NFNA 5JVEA 1RXQA 5AGFA 4L6RA 4K1OA 2J0WA 3DM5A 3QW0A 1SF8A 1HW2A 3Q7GA 4JZAA 2J9BA 2LP4A 3EG9A 2R7VA 3GODA 1CGNA 1FTSA 1VLSA 1YZCA 2P7VA 3NMKA 5B3SC 5E3CA 4K7BA 3AOUA 1VYIA 2EPOA 4JEAA 2XLVA 3NYMA 4JURI 2OOCA 2XXAA 4YJWA 3K1IC 3SP1A 4E0IA 3ZIBA 2GA0A 2KNHA 2ZPAA 4MW3A 1M6TA 1G8XA 1M56C 2NPUA 2EIKC 4HFKB 2HMZA 3U9MA 3W8IA 1QVXA 4MVUA 3DE9A 3HJCA 5JRAA 4FWVA 3L8IA 2X0CA 1SR2A 2H7BA 2XM0A 2CNWA 3B0VC 3NDBB 4DRIB 1NSGB 5F28E 3U2MA 2Y3HA 4Q5SF 2YL1A 3HNJA 1BBHA 2IXNA 2PX3A 1D1CA 2HFIA 2IXPA 3GM2A 4NQFA 3TD7A 1V4AA 3NKDA 3HTKC 3RF3A 2HKVA 3M4BA 1HMDA 2R7QA 3V7OA 1ZHXA 2KSFA 1T6UA 3FMSA 2Q9CA 3WG7C 1Z3IX 4LACB 3MLGA 3C63A 2KC3A 5FZTA 3SZRA 2IOQA 1A0BA 3CZ6A 3EGXB 5L0HA 1U6HA 1QLEC
chains in the Genus database with same CATH topology
1JMWA 2D4UA 1WATA 1WASA 2ASRA 4Z9JA 3T9OA 2LIGA 4Z9IA 1LIHA 4H54A 4Z9HA 1VLSA 3ATPA 1VLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMW A;  2D4U A;  1WAT A;  1WAS A;  2ASR A;  4Z9J A;  3T9O A;  2LIG A;  4Z9I A;  1LIH A;  4H54 A;  4Z9H A;  1VLS A;  3ATP A;  1VLT A; 
#chains in the Genus database with same CATH topology
 2CGE A;  3DKA A;  2L6F A;  4KC9 A;  4BJT A;  1V55 C;  1L7C A;  4B6I A;  1D0Z A;  4MTG A;  5E33 A;  1M2V B;  1H6G A;  1NG1 A;  2R25 A;  1OQC A;  4NY3 A;  3RQG A;  4E18 A;  4YWQ A;  1E86 A;  1OW7 A;  1ZHW A;  1JAF A;  4MND A;  3B71 A;  2XLW A;  1Z5Z A;  4U5E E;  3S29 A;  3DZA A;  4CS8 C;  3LNR A;  3G50 A;  1HMO A;  3W2V A;  4F4B A;  1JPN A;  4H4K C;  4NTA A;  1T5O A;  5T3W A;  3NRH A;  3VF0 A;  3CSK A;  5FCL A;  3K1H A;  3WAQ A;  3UMH A;  1Z7Q c;  1FR0 A;  3SXK A;  1YYX A;  4YL0 A;  3UMK A;  5DS6 A;  3JSE O;  4XQ1 A;  2YVK A;  2EIL C;  2LD6 A;  2ZXO A;  1Q0D A;  1YA7 O;  4C3D A;  3A9C A;  3VRC A;  3U0C A;  1O3U A;  3VYW A;  5D92 A;  5BQH A;  3T4R A;  3WHN A;  4HE8 D;  4JRZ A;  3AG1 C;  3JRT A;  1A7E A;  2QNL A;  2EPL X;  3QTH A;  2QY9 A;  4HFF B;  2HMQ A;  3TOL A;  1RKE A;  1MMN A;  3LAY A;  2B0H A;  3FOO A;  3ASO C;  3LLK A;  5CI9 A;  3EHN A;  256B A;  2A68 F;  2NSG A;  3RW0 A;  1R4T A;  2WB7 A;  3ABL C;  3RFY A;  1VB5 A;  4U5D E;  2BE5 F;  4CX9 A;  3GWN A;  1J8Y F;  2EPN A;  3ITF A;  4P9F A;  1CPQ A;  3C8G D;  3U9J A;  4E7Z A;  2A69 F;  3W8H A;  4CIH A;  3GWL A;  5IY5 C;  3I4U A;  3IQ5 A;  3QVZ A;  2OEV A;  3ZWI A;  2XRH A;  5L0J A;  5T3T A;  1SMY F;  1TFO B;  3HNL A;  2XS1 A;  3KYI A;  3MX3 A;  4OIO F;  3AG3 C;  4GYT A;  2Q9A A;  1YJG A;  3MYI A;  5JUA A;  4KNW A;  3TK0 A;  1WTY A;  4U5G A;  5DLJ A;  5TJ5 E;  2A0B A;  3O39 A;  1G5Z A;  4LLE A;  3K1I A;  4PFO A;  2Z15 A;  2R7R A;  3FAJ A;  1QSP A;  3K33 A;  2OJQ A;  3ZG1 A;  4OIP F;  2R02 A;  2YLD A;  2IYL D;  1QQ3 A;  4XWJ A;  5L3Q A;  1ZHY A;  2V3C C;  5KYX A;  1BR1 A;  2A1D D;  2M64 A;  4BEM J;  1LI5 A;  4EBK A;  3VM6 A;  3O6X A;  1KTM A;  2WZF A;  4KBL A;  2O9X A;  2XLO A;  3DXJ F;  4P6I C;  1C17 M;  4N6H A;  2W9Y A;  4PFP A;  1E83 A;  1CGM E;  3FXH A;  1TWG A;  2AU5 A;  3TUL A;  4MVO A;  3EHM A;  2GDC A;  1AUE A;  4O7G A;  4EWC A;  3R7C A;  1E85 A;  1ORJ A;  1F1M A;  1ZW3 A;  3DI5 A;  1GQA A;  5DS4 A;  3S9O A;  3T6J A;  5KYY B;  4ZLD A;  3EGD A;  3HKK A;  1G4W R;  4XEF A;  2Y3G A;  1UG7 A;  3DWW A;  2P61 A;  1HY5 A;  3TJ6 A;  1RKC A;  2OQM A;  2XS8 A;  3C62 A;  1I4Z A;  2VH3 A;  3MYF A;  4RDA A;  3U3B A;  4MTF A;  3N0T A;  1H9G A;  1TKN A;  4CS8 A;  1T6I A;  1ST6 A;  4ULW A;  3G4Z A;  4OD4 A;  3C8G A;  3NMI A;  4A4A A;  4D4X A;  1D1A A;  4CIP A;  1Z63 A;  1ORY A;  1V54 C;  1XZQ A;  3Q6N A;  2XXA B;  1GGQ A;  2Q9B A;  3ASN C;  3I5Q A;  1AEP A;  3MFN A;  4M63 A;  2JD3 A;  2P1A A;  4DBQ A;  5AC4 A;  1K40 A;  1WAT A;  3GEE A;  4OIQ F;  2CYD A;  3QVY A;  4CS7 A;  1FNT c;  3JCU Q;  1RJ9 B;  4XPX A;  2V26 A;  3EZI A;  3X1O A;  4CDA A;  1VYK A;  3DM9 B;  2P0N A;  4NCQ A;  2HS5 A;  2FGY A;  3SXZ A;  2L81 A;  1YYJ A;  2QLA A;  4IJJ A;  5HSW A;  2X51 A;  2VC9 A;  1APC A;  3RYL A;  4JCH A;  4XTK A;  4JVS A;  4CS9 A;  1BDJ B;  2P6V A;  2AWY A;  2Y69 C;  3U8P A;  1N1C A;  1Y4C A;  3K6B A;  4G0H A;  1TR2 A;  4MVM A;  4CJG A;  2XLM A;  2A6E F;  2NUT A;  3US6 A;  4YT8 A;  1IW7 F;  2YKZ A;  1C02 A;  2ZXR A;  5KYN A;  1DOV A;  2EIN C;  2H7O A;  4I44 A;  4XLN F;  1RMV A;  3J06 A;  1BR4 A;  3E70 C;  2DI3 A;  5EHH A;  2J9U A;  1YVI A;  3ZSU A;  2OEX A;  3JTL O;  2DYS C;  3S28 A;  4G7O F;  3N2Z B;  4PK4 A;  3U3F A;  1OXK A;  4E7S A;  1OKK D;  2R7T A;  5DS5 A;  1XWJ A;  4Q7C A;  4C7O B;  2AP3 A;  2IXO A;  2E87 A;  2J8W A;  3GEH A;  2GWW A;  3LS0 A;  2JX0 A;  3ECS A;  2NUP B;  1R5I D;  2WVN A;  2VAS A;  3EJN A;  4I1O B;  4JC7 A;  3AG4 C;  4PJL A;  1QKR A;  1MNE A;  2XL6 A;  4RBN A;  3RKO F;  2DYR C;  2RSE B;  3Q6M A;  5F5F A;  2MYS A;  2OU6 A;  3L34 A;  3B29 A;  1Q0M A;  2H7V C;  1CGO A;  2HSB A;  2ETS A;  3GOR A;  3O55 A;  1TWC A;  2C03 A;  4PAC A;  2AVK A;  2R7O A;  3IQC A;  1EA8 A;  3CEX A;  4NTB A;  2QE9 A;  1T6Q A;  2YRF A;  4U5B E;  4WAB A;  5DQT A;  2F22 A;  2HZ8 A;  4IAQ A;  1JRA A;  1KNY A;  3TQO A;  1M2V A;  3VAY A;  4BPM A;  2VB6 A;  3TJ5 A;  3EFO A;  3SNH A;  3DMD A;  1ZYR F;  1RKE B;  4QI0 A;  2WVO A;  3WOD F;  4A2N B;  5F5H A;  2W45 A;  5COM A;  3S0X A;  2HV6 A;  1QPU A;  1WOL A;  2I8B A;  3EZH A;  3CAX A;  4LLC A;  3CQZ A;  3UGP A;  2TMV P;  5K0I A;  1WGW A;  4XEV A;  2J7P D;  4ANJ A;  2PNO A;  4E17 A;  4CS9 C;  4YT4 A;  1FFH A;  1LVK A;  1FFT C;  2XL8 A;  1LS1 A;  2EPK X;  2Q3T A;  3F46 A;  5JP7 A;  4EHP A;  1OW6 A;  4BEJ A;  3M79 A;  2XSE A;  2J9V A;  1Z6A A;  3LS1 A;  4GEH A;  4X0R A;  2OKU A;  1OR3 A;  5JLI A;  2HJ3 A;  4IB4 A;  2YL3 A;  3QMK A;  3AGU A;  4BJ6 C;  1K04 A;  3C18 A;  1H7I A;  1M57 C;  2Y3D A;  3FDQ A;  4MW8 A;  5KYU A;  1UFB A;  2AWC A;  3KYJ A;  2J45 A;  4HEA J;  3GM1 A;  4JTD B;  1OCZ C;  3M1C B;  1LM3 B;  4JKV A;  4MVS A;  1LIH A;  4O6N A;  5COF A;  1YA9 A;  3JRM O;  3B0P A;  3DAG A;  2EIM C;  2QUP A;  3RH3 A;  3UMI A;  4DOZ A;  5A6B D;  3JSZ A;  5JS5 A;  1OKK A;  3NYJ A;  1PCX A;  1A7V A;  5KYX B;  1HW1 A;  2LK4 A;  1ZU4 A;  4Z9I A;  2J9W A;  5B1A C;  3AG2 C;  1YZA A;  4CBE A;  2YL0 A;  1S05 A;  4D4N A;  4LDQ A;  2YWA A;  4MQ9 F;  1J8M F;  3U5S A;  1ZHT A;  3RQF A;  4AE4 A;  4U9E A;  3EH2 A;  2YQY A;  3AQC A;  5B3I A;  2ZXW C;  1NZE A;  2ZXP A;  4ZLC A;  5A69 A;  5A6J A;  3NMJ A;  4Q4Z F;  4KNV A;  4YL3 A;  5GPG B;  4JIO A;  3FHD A;  2YL7 A;  1NBB A;  4PJM A;  4QDL A;  3KL4 A;  1I4Y A;  3EGD B;  3L1M A;  5BQI A;  2ZD9 A;  2HV7 A;  2MWQ A;  3H2U A;  5A6K A;  1SYQ A;  1MQV A;  4G7Z F;  2UUI A;  4LDR A;  1OXB A;  4LER A;  3HNK A;  3SXM A;  2VCB A;  3DJN B;  2CW0 F;  3EQL F;  2B0J A;  1LI7 A;  3LES A;  3OA1 A;  4P9T A;  3UR3 C;  1E2X A;  3ZC4 A;  2J0X A;  2LSE A;  3JYH A;  1EQ1 A;  3EG9 B;  2W4B A;  4XPW A;  4I1M A;  5CIV A;  5KYW A;  3B0U X;  5L3V A;  2BC5 A;  3V5Y A;  3C8G B;  4DJ9 A;  4JEB A;  5E2Q A;  2XLD A;  1FMV A;  2BL2 A;  3LEV A;  4U5F E;  3BEH A;  3HLZ A;  2L6G A;  5BUO A;  3ZQY A;  4W8P A;  4J30 B;  3GM3 A;  1VLT A;  3GAN A;  4J7Y A;  4R32 A;  3DE8 A;  5CI8 A;  1JR8 A;  1EKY A;  3LEO A;  2LCH A;  4YT5 A;  2R7U A;  4EBJ A;  1Z23 A;  3K7D A;  3S27 A;  2L6H A;  3H65 A;  1BZ4 A;  1OCO C;  5KYY A;  4CSA C;  2PF4 E;  1C03 A;  1Q0F A;  5A6B A;  5D91 A;  1NFO A;  1TWA A;  2KK1 A;  1TWH A;  1MMD A;  2XM4 A;  1Q0G A;  3SXY A;  4N6C A;  5AC5 A;  4EKW A;  4FX5 A;  4JJF A;  4FAP B;  2VCC A;  4DXW A;  4EIY A;  3FOP A;  2NG1 A;  2PX0 A;  3ZVR A;  4IWB A;  1U89 A;  1NU7 D;  2XL4 A;  4QI2 A;  4G7H F;  4DBR A;  3C8Z A;  1PD0 A;  4E0H A;  3NKE A;  1OCC C;  3NYL A;  1PV3 A;  2D5R B;  3A11 A;  2QTV A;  4JJG A;  2XLE A;  3ATP A;  3C7J A;  3H2V A;  3IEE A;  2XLH A;  4FES A;  3TOM A;  4CDV A;  1U0B B;  1ZHZ A;  4K0D A;  3G4X A;  3DAF A;  4YN0 B;  1ZW2 A;  3FVY A;  4JW1 A;  4OD5 A;  3AQB A;  4WGY A;  4BJ6 A;  1RJ9 A;  2IBF A;  3NG1 A;  1FAP B;  3V5Z A;  1JMW A;  5L0I A;  5L0F A;  2OG2 A;  2R9R B;  3ABM C;  3MBG A;  2Y39 A;  3KMI A;  1MMG A;  3JZ0 A;  1EI7 A;  3X2Q C;  3AJM A;  3U2L A;  1ZVZ A;  2R7X A;  3KH2 A;  1KU2 A;  2NUT B;  5DQZ A;  4BJ5 C;  2R03 A;  1BR2 A;  1T9K A;  4LDK A;  2YZS A;  3OWT A;  4WGZ A;  2GFH A;  3HNI A;  1CPR A;  2DB4 A;  3S90 A;  2C04 A;  2OJE D;  4XEK A;  4YL1 A;  1D1B A;  1FMW A;  3T6G B;  1S7Z A;  4Z9J A;  2KQ9 A;  4UDV A;  4OIN F;  3SYN A;  1E84 A;  3UGO A;  2CCY A;  4YT2 A;  2H8A A;  3EGX A;  1O87 A;  4JE9 A;  4JTC B;  3JYY A;  2L7A A;  3V5X A;  3EFO B;  3UNG C;  1LE2 A;  1OW8 A;  1MMA A;  1Q0K A;  3E9V A;  3LNM B;  4ER9 A;  5A6A A;  3IQ6 A;  5JSL A;  1I5N A;  3QZC A;  2R7W A;  3ZTM A;  2WZG A;  1GS9 A;  2UUH A;  4AL1 A;  1WWP A;  3QW1 A;  4PJJ A;  4MVQ A;  4ULV A;  4IGG A;  3EPV A;  1IZM A;  4O6Y A;  1L3P A;  4EUK B;  4AL0 A;  1O5H A;  4C7O A;  2M4E A;  3POV A;  2G3V A;  5T1D B;  2LQG A;  4YK5 A;  1Y6D A;  2NUP A;  3K66 A;  3N24 A;  1GM5 A;  1SZI A;  2HJM A;  4XPY A;  2GAQ A;  4GQH A;  5EK0 A;  2J46 A;  3IHU A;  2EPM X;  1MND A;  3PMR A;  4PJN A;  3RQE A;  2G62 A;  4C3E A;  1A41 A;  5KYU B;  1D0Y A;  2PP4 A;  3RVY A;  4DVZ A;  4JCZ A;  3KPH A;  2WZL A;  2YLI A;  3LLI A;  2VCA A;  2WVQ A;  2Q4F A;  2R7S A;  2DGJ A;  4BJ1 A;  1W2W A;  3LJB A;  1YAR O;  5L0G A;  3BRJ A;  4MTO A;  1RCP A;  2CDQ A;  2KW3 C;  1D0X A;  2Q00 A;  3DD7 A;  4EBB A;  1OCR C;  2OCC C;  3T6B A;  2ICW G;  2PFD A;  2Y3B A;  4G78 A;  4RD9 A;  1LKX A;  1AVO B;  3O10 A;  2A6H F;  1HE1 A;  4AK9 A;  4IAO A;  4CSA A;  1NLX A;  1OR2 A;  2LFD A;  5COG A;  1WN0 A;  2RD9 A;  2EIJ C;  2YEV A;  3FAP B;  1A7D A;  3IQT A;  2KJG A;  3GEI A;  2A0U A;  1G4U S;  4MS2 A;  3JT1 A;  4AE4 B;  2ASR A;  3AGT A;  5JT4 A;  4DVY P;  2Q7R A;  2W4M A;  4H54 A;  1H9T A;  3LUT B;  1DOW A;  4I3M A;  3ABK C;  4ONS A;  1JOG A;  4C3B A;  3KKB A;  4U9D A;  5E3A A;  4KI2 A;  3B9Q A;  4CDY A;  2LFF A;  4PR9 A;  1ZZP A;  5B1B C;  1K05 A;  3SEO A;  1LS4 A;  2HUJ A;  1NU9 C;  1JPJ A;  2KYH A;  4IRU A;  2CNW D;  4NC3 A;  1LPE A;  3DJU B;  4XLP F;  1VMA A;  2D4U A;  1T01 A;  3W4Y A;  4DRH B;  4O79 A;  2LIG A;  4J32 B;  3R2P A;  3M15 A;  1PD1 A;  2G3K A;  3I5P A;  3RVZ A;  2I15 A;  3ZDL A;  5L0D A;  1YAU O;  4IAR A;  4N06 A;  3U8V A;  5KYW B;  1TFK B;  2YLG A;  5HV9 A;  1ZU5 A;  2J7P A;  2R05 A;  4MVR A;  2IM8 A;  1XZP A;  4N4W A;  4AX2 A;  3M4C A;  1HE9 A;  2JPU A;  1M2O A;  1YLM A;  3ZQV A;  2L9J A;  2IXM A;  2HSQ A;  4MVZ A;  4OIR F;  4NTF A;  3EH1 A;  5L0C A;  3PHF 2;  5EGY A;  1VTM P;  1YDI A;  4Z9H A;  1VOM A;  4U5C E;  4BJ5 A;  3T9O A;  2MHR A;  2WL8 A;  2YHS A;  2PBE A;  3Q7L A;  3ZTZ A;  2NSF A;  3RIP A;  1QZX A;  1VK5 A;  2FAP B;  3F47 A;  5BQG A;  1B68 A;  3L0I A;  4BG0 A;  4J7T A;  1ORS C;  4CJO A;  3S84 A;  3IPM O;  4JTA B;  4U5H A;  2KGO A;  1TQG A;  3L8J A;  5DVW A;  3PDM P;  1V74 B;  2FFH A;  4O6M A;  4WJ0 A;  3W2W A;  3OEO A;  1WAS A;  1LE4 A;  3PCV A;  4DRJ B;  4W8K A;  1NFN A;  5JVE A;  1RXQ A;  5AGF A;  4L6R A;  4K1O A;  2J0W A;  3DM5 A;  3QW0 A;  1SF8 A;  1HW2 A;  3Q7G A;  4JZA A;  2J9B A;  2LP4 A;  3EG9 A;  2R7V A;  3GOD A;  1CGN A;  1FTS A;  1VLS A;  1YZC A;  2P7V A;  3NMK A;  5B3S C;  5E3C A;  4K7B A;  3AOU A;  1VYI A;  2EPO A;  4JEA A;  2XLV A;  3NYM A;  4JUR I;  2OOC A;  2XXA A;  4YJW A;  3K1I C;  3SP1 A;  4E0I A;  3ZIB A;  2GA0 A;  2KNH A;  2ZPA A;  4MW3 A;  1M6T A;  1G8X A;  1M56 C;  2NPU A;  2EIK C;  4HFK B;  2HMZ A;  3U9M A;  3W8I A;  1QVX A;  4MVU A;  3DE9 A;  3HJC A;  5JRA A;  4FWV A;  3L8I A;  2X0C A;  1SR2 A;  2H7B A;  2XM0 A;  2CNW A;  3B0V C;  3NDB B;  4DRI B;  1NSG B;  5F28 E;  3U2M A;  2Y3H A;  4Q5S F;  2YL1 A;  3HNJ A;  1BBH A;  2IXN A;  2PX3 A;  1D1C A;  2HFI A;  2IXP A;  3GM2 A;  4NQF A;  3TD7 A;  1V4A A;  3NKD A;  3HTK C;  3RF3 A;  2HKV A;  3M4B A;  1HMD A;  2R7Q A;  3V7O A;  1ZHX A;  2KSF A;  1T6U A;  3FMS A;  2Q9C A;  3WG7 C;  1Z3I X;  4LAC B;  3MLG A;  3C63 A;  2KC3 A;  5FZT A;  3SZR A;  2IOQ A;  1A0B A;  3CZ6 A;  3EGX B;  5L0H A;  1U6H A;  1QLE C; 
#chains in the Genus database with same CATH homology
 1JMW A;  2D4U A;  1WAT A;  1WAS A;  2ASR A;  4Z9J A;  3T9O A;  2LIG A;  4Z9I A;  1LIH A;  4H54 A;  4Z9H A;  1VLS A;  3ATP A;  1VLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...