1WATA

The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
142
structure length
142
Chain Sequence
GFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor. Structural comparison to the cross-linked mutant forms and conformational changes upon ligand binding.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
molecule keywords ASPARTATE RECEPTOR
total genus 58
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1watA00
1WASA 4Z9IA 1VLSA 4Z9HA 1WATA 4H54A 4Z9JA 1LIHA 2ASRA 2LIGA 1VLTA 2D4UA 3T9OA 1JMWA 3ATPA
chains in the Genus database with same CATH superfamily
1A7VA 2L6HA 3L34A 4OIPF 1D1CA 1WOLA 4I3MA 1R5ID 5F5HA 4R32A 5KYWB 2EPMX 4RDAA 2KQ9A 3WODF 1VYKA 1YA9A 2G62A 2FFHA 2YZSA 3E9VA 1YARO 1E85A 4IAQA 4N4WA 1VYIA 3C7JA 1O87A 4MVOA 4OD4A 4LLCA 3JYHA 1SR2A 4P9TA 3RQGA 1K04A 2HMQA 2YL1A 2R7VA 2ZXRA 3AGTA 3I5QA 4LDQA 1FTSA 5JT4A 5DQTA 4E0IA 1C02A 1MMNA 4LDRA 1DOWA 2OJQA 1ZHWA 3L8JA 5T1DB 4BPMA 1D1AA 1Q0FA 1RCPA 3LAYA 4JKVA 4ANJA 1ZU4A 2FAPB 4PJLA 1D0YA 2BE5F 2Q7RA 2A69F 1A41A 3DJNB 1YVIA 3L0IA 1U6HA 3MFNA 1JPJA 1SZIA 2YL0A 3GEHA 4Q4ZF 1LE4A 5CI9A 4YJWA 2MYSA 4EBKA 1VOMA 1A7EA 3KL4A 2V3CC 3IQ6A 4MTFA 2DYRC 2KK1A 2NUTA 4AL1A 2YL3A 2B0HA 5KYYA 2PP4A 2OQMA 3FVYA 1NSGB 4I44A 4O6MA 4XPWA 4RBNA 3HNKA 2F22A 1NBBA 4JURI 4CX9A 1Q0KA 2XRHA 4NCQA 2CYDA 2ZPAA 2J9VA 1OW6A 5B1BC 1Z7Qc 1ZYRF 2GDCA 1G4WR 2LCHA 4A2NB 3KKBA 3R2PA 3M79A 4M63A 5KYUB 1IZMA 4IWBA 4N6HA 1WATA 1TWHA 5E2QA 3EQLF 1MNEA 3JSZA 2PNOA 1MNDA 3DXJF 4XEKA 2EPNA 4W8PA 2EINC 4CDVA 4NTBA 1T01A 3KYJA 4XLNF 3WAQA 5COMA 2KGOA 2NPUA 2KSFA 3TJ6A 2J45A 3WHNA 1ZHZA 4KBLA 3EFOA 1WTYA 2EPOA 1G4US 2DGJA 4JIOA 3EGDA 4K0DA 4PR9A 2LFDA 3ZQYA 3S0XA 2KYHA 5HSWA 3NDBB 3F47A 2VC9A 2M64A 4OIQF 1PD0A 1ZVZA 2LQGA 5D92A 1JMWA 3ATPA 4F4BA 3DAGA 1E84A 1W2WA 3SXKA 3U8VA 3UNGC 4GQHA 1H7IA 2HV6A 2QNLA 3S9OA 4BJ1A 2IXNA 3AQBA 4NTAA 2WVQA 4UDVA 4U9EA 2CCYA 1OR2A 2XLDA 2HV7A 2P0NA 3EHMA 3K6BA 3M4BA 3I4UA 3FOOA 1OR3A 2QUPA 1E2XA 1FNTc 1CGNA 2W9YA 3UGPA 2R02A 4XPXA 3BRJA 2CNWA 2IXOA 3GANA 2XLMA 2Y3DA 2VCCA 2R7OA 3EZIA 1M57C 4BJ6A 2TMVP 2FGYA 2OCCC 4JVSA 4JW1A 3V7OA 2DYSC 2OEVA 3X1OA 3ZSUA 3TOLA 2C03A 2XLHA 2Q4FA 5GPGB 3DM5A 2R7UA 3CZ6A 4B6IA 1T6IA 5B1AC 2KC3A 2HFIA 1BZ4A 1S05A 4BJ5A 3I5PA 5KYUA 2J9WA 4O7GA 3ZIBA 2WZLA 3SP1A 1H9GA 1KTMA 1TWAA 3W2WA 2YVKA 1E83A 4ZLDA 4E17A 5DVWA 1HMOA 3ZG1A 3AG3C 3B9QA 2XL6A 4HE8D 2Q9BA 1VK5A 3N0TA 5DS5A 2XLEA 5A6JA 4JJFA 3MYFA 4MTOA 1ZHYA 1CPQA 3QW1A 3AG4C 4J7YA 256BA 3JT1A 4FX5A 5EK0A 1RJ9B 5DLJA 4JEBA 1BR2A 1OCCC 2L7AA 4CS8A 5KYYB 1MMGA 3C8GA 3A9CA 2Q00A 2NUPB 3GEIA 1FMVA 1Y4CA 3U2LA 5FCLA 4U5BE 1KNYA 4LLEA 2LFFA 4CIPA 3K7DA 2I15A 3IHUA 4JTAB 4EHPA 1TFKB 1LPEA 5HV9A 3Q7GA 2YQYA 1BDJB 4YL1A 3UMKA 3S29A 4AE4B 2R05A 4KNWA 4IRUA 2NUPA 1FFTC 5CI8A 3N2ZB 2XS1A 4XWJA 3T6GB 3SXZA 3T6BA 2CW0F 1Z3IX 1K40A 4G78A 2HKVA 3U8PA 2EILC 4FWVA 2VB6A 4CDAA 5AC5A 1RMVA 4NQFA 2A1DD 3OEOA 2YLIA 4Q7CA 4NC3A 5T3TA 4LDKA 3NMKA 2VCBA 4JTDB 4EBJA 4O6YA 3HNLA 2W4BA 1GS9A 4K1OA 4DRIB 4EUKB 3QZCA 1CGOA 3NRHA 3HLZA 4PFOA 2L9JA 3SNHA 2YL7A 5BQHA 2W4MA 3W2VA 3UGOA 3O39A 1RKEA 2J8WA 4CS7A 1U89A 3C63A 1JRAA 2EIKC 3DJUB 1HE1A 4OIRF 3ABKC 5A6BD 3LNRA 3MLGA 3K66A 3U0CA 3GEEA 1LVKA 4MW3A 3O55A 5BQGA 3GM2A 3DAFA 3JSEO 1B68A 2R9RB 2A6EF 3MX3A 4GYTA 3VM6A 4BJ6C 5B3IA 2KNHA 5L3VA 4G7HF 2R7XA 2PFDA 2Y39A 3CSKA 1R4TA 3K1IC 1OKKA 2JPUA 3GM3A 3KMIA 1I4ZA 3ASOC 3RIPA 1ZHXA 3JZ0A 1J8MF 4DBRA 4PJJA 4DXWA 2DB4A 2WB7A 4K7BA 1QVXA 3GWLA 3H65A 3M4CA 3NKDA 3QW0A 4U9DA 4XTKA 4D4NA 3J06A 4ONSA 3ZDLA 4QDLA 3RF3A 1PV3A 5EGYA 1SYQA 1U0BB 2R7RA 4NY3A 4U5FE 1GM5A 3AG2C 1OCOC 2HS5A 5BQIA 2P1AA 3EGDB 3V5YA 2A6HF 3GWNA 4D4XA 3LJBA 3KYIA 3LLIA 2RSEB 3EFOB 4HFFB 4Q5SF 2ETSA 4CS9A 4J30B 1OCRC 2GAQA 3V5ZA 3W8HA 3W4YA 1YZAA 3GORA 1OQCA 3ITFA 2Y3GA 5JS5A 3SZRA 1ORJA 2PX0A 4EBBA 2HJ3A 2LK4A 2YRFA 2YLGA 1HW1A 3W8IA 3ZTZA 5DS6A 1T5OA 4XQ1A 3K33A 1V55C 4U5DE 2GA0A 4MNDA 3S27A 1OXBA 4J32B 2X0CA 2LSEA 4AK9A 3UMIA 3PHF2 1WGWA 1LKXA 1LM3B 4P6IC 2YHSA 3RVZA 1ZU5A 2KW3C 4U5GA 1Q0DA 1QZXA 2AVKA 2YLDA 2AU5A 4X0RA 3TJ5A 3B0UX 3RYLA 1HW2A 1VLSA 2PF4E 1K05A 1IW7F 1OCZC 2UUHA 2DI3A 4HEAJ 4WGYA 4XEFA 5T3WA 4C3EA 5EHHA 1EKYA 1EI7A 3DMDA 4IGGA 4JC7A 1A7DA 2J46A 3SEOA 4BEMJ 3C18A 3CEXA 1O3UA 1Z63A 3FOPA 3GODA 4CS9C 1ZHTA 1LS4A 2NUTB 3ABLC 1MMDA 2G3VA 5KYNA 1C03A 1APCA 1VB5A 3HNJA 1M56C 3CQZA 3CAXA 2Q3TA 3B71A 3JRTA 5COFA 5BUOA 4IB4A 1AUEA 3AGUA 1KU2A 1T6QA 4JEAA 3AQCA 1QKRA 3S28A 1G5ZA 5L0DA 1HE9A 2NSGA 2XLVA 4OD5A 1A0BA 1NU7D 2B0JA 4O6NA 1N1CA 2L6GA 2YEVA 1D1BA 4RD9A 4YT8A 3EPVA 5CIVA 1YDIA 1FAPB 4CDYA 3RKOF 2WZGA 3EG9B 3X2QC 1QSPA 1CGME 1EA8A 2J7PA 1ORSC 2R7SA 4CBEA 2ZXOA 1SF8A 2PX3A 2HSQA 3ZC4A 1G8XA 2HMZA 3NYMA 1Z6AA 1T9KA 3PMRA 3NYLA 4G0HA 1M2VA 3UMHA 1JOGA 4E7SA 3LS0A 1Y6DA 4PJMA 3EG9A 5F28E 3O6XA 1ZZPA 3H2VA 4I1OB 4N06A 4YT4A 3DE8A 5KYWA 2HJMA 4JJGA 3ABMC 3U3BA 3UR3C 4CSAA 3LESA 3JRMO 2IM8A 5AGFA 3QVZA 2WVNA 3PCVA 1HMDA 2KJGA 4H4KC 2EPLX 3NMIA 2ZXPA 4BG0A 2A68F 3AG1C 3DE9A 3FAJA 1V4AA 4O79A 5JUAA 4MVZA 4P9FA 2CGEA 3LS1A 1TQGA 3AOUA 3O10A 3QMKA 4PFPA 3EH2A 2H7BA 3TQOA 5JSLA 1RKEB 1VTMP 1F1MA 2YKZA 1I4YA 1FMWA 1XZPA 1YJGA 1UFBA 4G7OF 4LERA 1XWJA 2V26A 4PJNA 2NSFA 4Z9JA 5E3CA 2W45A 2J0WA 4GEHA 2JX0A 1H9TA 3DD7A 2D5RB 5B3SC 2Z15A 3C62A 2I8BA 3G4XA 3POVA 1V74B 3GM1A 3KH2A 3ASNC 3C8GD 3OWTA 4IJJA 4YL0A 3SXMA 4YWQA 5L0JA 1QPUA 2WL8A 2AP3A 3H2UA 5E33A 1JR8A 1ST6A 2L81A 3T6JA 4CSAC 2QY9A 2OU6A 4WABA 4YN0B 3TOMA 4XEVA 4CS8C 1OKKD 1TKNA 1V54C 3VF0A 3QTHA 2OG2A 2NG1A 4AE4A 2GWWA 3FMSA 3KPHA 2J7PD 2HZ8A 3HKKA 4MTGA 4W8KA 4E18A 2MHRA 3RFYA 4KC9A 1Z23A 2R7QA 2MWQA 3U2MA 3DKAA 2R7TA 3EZHA 2LP4A 3OA1A 5JLIA 1S7ZA 4YK5A 4AX2A 5L0IA 4L6RA 1VMAA 4QI2A 2BC5A 4HFKB 4Z9IA 5FZTA 1LI7A 3C8GB 3B0VC 4BJ5C 5KYXB 4FESA 4KI2A 3S84A 5L0FA 1AVOB 2XL8A 3EH1A 3N24A 3EJNA 4OIOF 3TULA 1LE2A 2RD9A 2E87A 5DS4A 2XM4A 1D0ZA 1TWGA 2HSBA 4MVSA 3DZAA 1Z5ZA 3IPMO 3IEEA 4MVQA 3TD7A 1D0XA 3M15A 5COGA 1YYXA 4NTFA 2WZFA 1YLMA 5A6KA 3C8ZA 4DRJB 2R25A 2P7VA 2OJED 4JZAA 4ULWA 3LEOA 2CNWD 3BEHA 3AJMA 4E7ZA 3NMJA 3PDMP 4LACB 5F5FA 1BR1A 2ZXWC 2VH3A 4XPYA 1CPRA 1DOVA 1PCXA 3IQTA 3VYWA 2XXAB 2G3KA 4Z9HA 4E0HA 2LD6A 3F46A 5JVEA 1Q0GA 3EGXA 3FXHA 1BBHA 1C17M 1L3PA 2D4UA 2M4EA 4EIYA 1BR4A 1RXQA 2IYLD 3IQCA 3QVYA 4YT2A 5L0CA 2IBFA 3U5SA 2QE9A 1OW7A 4XLPF 1NZEA 4ULVA 2ASRA 2L6FA 4C7OA 2HUJA 1J8YF 2UUIA 5K0IA 4JRZA 3RVYA 1YAUO 5JRAA 4U5CE 5IY5C 2J0XA 1FR0A 1M2OA 4IARA 3G4ZA 1M2VB 3T4RA 5L0HA 2H7OA 4OINF 2AWCA 3ZWIA 2IXPA 3DI5A 4I1MA 3DWWA 4MVRA 2YWAA 2IXMA 4N6CA 1Q0MA 3HTKC 2PBEA 2BL2A 2XLOA 3U3FA 2Y69C 1M6TA 3SXYA 3ECSA 2J9BA 1QLEC 2R03A 3FHDA 3RH3A 1NG1A 2XLWA 4CJGA 4J7TA 4JE9A 2ZD9A 3Q7LA 4DVZA 3S90A 2OKUA 2X51A 2C04A 4DRHB 2XL4A 2GFHA 4U5EE 3EGXB 3HJCA 1TFOB 5AC4A 2VASA 3M1CB 3A11A 4BEJA 1YYJA 5D91A 1GQAA 2XXAA 1GGQA 1WWPA 4DBQA 2QLAA 4AL0A 1UG7A 3G50A 2EIJC 3IQ5A 3SYNA 3LEVA 5L3QA 1ZW2A 1MQVA 2CDQA 1LI5A 1T6UA 3K1IA 3VRCA 2EIMC 3B0PA 3JCUQ 5TJ5E 1AEPA 1LS1A 2R7WA 4PACA 4KNVA 4DOZA 2J9UA 4MVMA 1EQ1A 2OEXA 2AWYA 4JCHA 1LIHA 3TK0A 1NFOA 5E3AA 4CJOA 4ER9A 4ZLCA 5KYXA 4IAOA 4QI0A 2XM0A 5JP7A 3RQFA 1TWCA 4JTCB 3HNIA 1ORYA 3WG7C 1VLTA 4WGZA 4FAPB 2ICWG 5A69A 2P6VA 3VAYA 3LLKA 3U9JA 2EPKX 3FAPB 1L7CA 1RKCA 3NKEA 4JCZA 1PD1A 3U9MA 4EKWA 1H6GA 4MW8A 3NYJA 3EHNA 1NU9C 3B29A 2A0BA 3ZVRA 1JAFA 1O5HA 5DQZA 4A4AA 4C3DA 2WVOA 5A6BA 3Q6NA 3L8IA 2VCAA 2XS8A 1SMYF 2QTVA 1E86A 3FDQA 2A0UA 1TR2A 2Y3HA 4DJ9A 1FFHA 1RJ9A 1YZCA 3ZQVA 4C3BA 5L0GA 2P61A 4MVUA 4U5HA 3DM9B 2OOCA 3E70C 2IOQA 2LIGA 3T9OA 4PK4A 3LUTB 1ZW3A 1I5NA 2Q9CA 1MMAA 1WASA 3MBGA 1XZQA 3RW0A 4YL3A 3JTLO 3RQEA 3K1HA 1NLXA 4H54A 2Y3BA 4DVYP 4G7ZF 3R7CA 1OXKA 1HY5A 1JPNA 2JD3A 4CIHA 5A6AA 4YT5A 4C7OB 1YA7O 1WN0A 4EWCA 3MYIA 2H7VC 4MQ9F 2H8AA 3L1MA 2XSEA 3Q6MA 1QQ3A 4WJ0A 2Q9AA 4MS2A 3US6A 3JYYA 4BJTA 3ZTMA 3V5XA 3LNMB 1OW8A 3NG1A 1NFNA 2O9XA
chains in the Genus database with same CATH topology
1WASA 4Z9IA 1VLSA 4Z9HA 1WATA 4H54A 4Z9JA 1LIHA 2ASRA 2LIGA 1VLTA 2D4UA 3T9OA 1JMWA 3ATPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAS A;  4Z9I A;  1VLS A;  4Z9H A;  1WAT A;  4H54 A;  4Z9J A;  1LIH A;  2ASR A;  2LIG A;  1VLT A;  2D4U A;  3T9O A;  1JMW A;  3ATP A; 
#chains in the Genus database with same CATH topology
 1A7V A;  2L6H A;  3L34 A;  4OIP F;  1D1C A;  1WOL A;  4I3M A;  1R5I D;  5F5H A;  4R32 A;  5KYW B;  2EPM X;  4RDA A;  2KQ9 A;  3WOD F;  1VYK A;  1YA9 A;  2G62 A;  2FFH A;  2YZS A;  3E9V A;  1YAR O;  1E85 A;  4IAQ A;  4N4W A;  1VYI A;  3C7J A;  1O87 A;  4MVO A;  4OD4 A;  4LLC A;  3JYH A;  1SR2 A;  4P9T A;  3RQG A;  1K04 A;  2HMQ A;  2YL1 A;  2R7V A;  2ZXR A;  3AGT A;  3I5Q A;  4LDQ A;  1FTS A;  5JT4 A;  5DQT A;  4E0I A;  1C02 A;  1MMN A;  4LDR A;  1DOW A;  2OJQ A;  1ZHW A;  3L8J A;  5T1D B;  4BPM A;  1D1A A;  1Q0F A;  1RCP A;  3LAY A;  4JKV A;  4ANJ A;  1ZU4 A;  2FAP B;  4PJL A;  1D0Y A;  2BE5 F;  2Q7R A;  2A69 F;  1A41 A;  3DJN B;  1YVI A;  3L0I A;  1U6H A;  3MFN A;  1JPJ A;  1SZI A;  2YL0 A;  3GEH A;  4Q4Z F;  1LE4 A;  5CI9 A;  4YJW A;  2MYS A;  4EBK A;  1VOM A;  1A7E A;  3KL4 A;  2V3C C;  3IQ6 A;  4MTF A;  2DYR C;  2KK1 A;  2NUT A;  4AL1 A;  2YL3 A;  2B0H A;  5KYY A;  2PP4 A;  2OQM A;  3FVY A;  1NSG B;  4I44 A;  4O6M A;  4XPW A;  4RBN A;  3HNK A;  2F22 A;  1NBB A;  4JUR I;  4CX9 A;  1Q0K A;  2XRH A;  4NCQ A;  2CYD A;  2ZPA A;  2J9V A;  1OW6 A;  5B1B C;  1Z7Q c;  1ZYR F;  2GDC A;  1G4W R;  2LCH A;  4A2N B;  3KKB A;  3R2P A;  3M79 A;  4M63 A;  5KYU B;  1IZM A;  4IWB A;  4N6H A;  1WAT A;  1TWH A;  5E2Q A;  3EQL F;  1MNE A;  3JSZ A;  2PNO A;  1MND A;  3DXJ F;  4XEK A;  2EPN A;  4W8P A;  2EIN C;  4CDV A;  4NTB A;  1T01 A;  3KYJ A;  4XLN F;  3WAQ A;  5COM A;  2KGO A;  2NPU A;  2KSF A;  3TJ6 A;  2J45 A;  3WHN A;  1ZHZ A;  4KBL A;  3EFO A;  1WTY A;  2EPO A;  1G4U S;  2DGJ A;  4JIO A;  3EGD A;  4K0D A;  4PR9 A;  2LFD A;  3ZQY A;  3S0X A;  2KYH A;  5HSW A;  3NDB B;  3F47 A;  2VC9 A;  2M64 A;  4OIQ F;  1PD0 A;  1ZVZ A;  2LQG A;  5D92 A;  1JMW A;  3ATP A;  4F4B A;  3DAG A;  1E84 A;  1W2W A;  3SXK A;  3U8V A;  3UNG C;  4GQH A;  1H7I A;  2HV6 A;  2QNL A;  3S9O A;  4BJ1 A;  2IXN A;  3AQB A;  4NTA A;  2WVQ A;  4UDV A;  4U9E A;  2CCY A;  1OR2 A;  2XLD A;  2HV7 A;  2P0N A;  3EHM A;  3K6B A;  3M4B A;  3I4U A;  3FOO A;  1OR3 A;  2QUP A;  1E2X A;  1FNT c;  1CGN A;  2W9Y A;  3UGP A;  2R02 A;  4XPX A;  3BRJ A;  2CNW A;  2IXO A;  3GAN A;  2XLM A;  2Y3D A;  2VCC A;  2R7O A;  3EZI A;  1M57 C;  4BJ6 A;  2TMV P;  2FGY A;  2OCC C;  4JVS A;  4JW1 A;  3V7O A;  2DYS C;  2OEV A;  3X1O A;  3ZSU A;  3TOL A;  2C03 A;  2XLH A;  2Q4F A;  5GPG B;  3DM5 A;  2R7U A;  3CZ6 A;  4B6I A;  1T6I A;  5B1A C;  2KC3 A;  2HFI A;  1BZ4 A;  1S05 A;  4BJ5 A;  3I5P A;  5KYU A;  2J9W A;  4O7G A;  3ZIB A;  2WZL A;  3SP1 A;  1H9G A;  1KTM A;  1TWA A;  3W2W A;  2YVK A;  1E83 A;  4ZLD A;  4E17 A;  5DVW A;  1HMO A;  3ZG1 A;  3AG3 C;  3B9Q A;  2XL6 A;  4HE8 D;  2Q9B A;  1VK5 A;  3N0T A;  5DS5 A;  2XLE A;  5A6J A;  4JJF A;  3MYF A;  4MTO A;  1ZHY A;  1CPQ A;  3QW1 A;  3AG4 C;  4J7Y A;  256B A;  3JT1 A;  4FX5 A;  5EK0 A;  1RJ9 B;  5DLJ A;  4JEB A;  1BR2 A;  1OCC C;  2L7A A;  4CS8 A;  5KYY B;  1MMG A;  3C8G A;  3A9C A;  2Q00 A;  2NUP B;  3GEI A;  1FMV A;  1Y4C A;  3U2L A;  5FCL A;  4U5B E;  1KNY A;  4LLE A;  2LFF A;  4CIP A;  3K7D A;  2I15 A;  3IHU A;  4JTA B;  4EHP A;  1TFK B;  1LPE A;  5HV9 A;  3Q7G A;  2YQY A;  1BDJ B;  4YL1 A;  3UMK A;  3S29 A;  4AE4 B;  2R05 A;  4KNW A;  4IRU A;  2NUP A;  1FFT C;  5CI8 A;  3N2Z B;  2XS1 A;  4XWJ A;  3T6G B;  3SXZ A;  3T6B A;  2CW0 F;  1Z3I X;  1K40 A;  4G78 A;  2HKV A;  3U8P A;  2EIL C;  4FWV A;  2VB6 A;  4CDA A;  5AC5 A;  1RMV A;  4NQF A;  2A1D D;  3OEO A;  2YLI A;  4Q7C A;  4NC3 A;  5T3T A;  4LDK A;  3NMK A;  2VCB A;  4JTD B;  4EBJ A;  4O6Y A;  3HNL A;  2W4B A;  1GS9 A;  4K1O A;  4DRI B;  4EUK B;  3QZC A;  1CGO A;  3NRH A;  3HLZ A;  4PFO A;  2L9J A;  3SNH A;  2YL7 A;  5BQH A;  2W4M A;  3W2V A;  3UGO A;  3O39 A;  1RKE A;  2J8W A;  4CS7 A;  1U89 A;  3C63 A;  1JRA A;  2EIK C;  3DJU B;  1HE1 A;  4OIR F;  3ABK C;  5A6B D;  3LNR A;  3MLG A;  3K66 A;  3U0C A;  3GEE A;  1LVK A;  4MW3 A;  3O55 A;  5BQG A;  3GM2 A;  3DAF A;  3JSE O;  1B68 A;  2R9R B;  2A6E F;  3MX3 A;  4GYT A;  3VM6 A;  4BJ6 C;  5B3I A;  2KNH A;  5L3V A;  4G7H F;  2R7X A;  2PFD A;  2Y39 A;  3CSK A;  1R4T A;  3K1I C;  1OKK A;  2JPU A;  3GM3 A;  3KMI A;  1I4Z A;  3ASO C;  3RIP A;  1ZHX A;  3JZ0 A;  1J8M F;  4DBR A;  4PJJ A;  4DXW A;  2DB4 A;  2WB7 A;  4K7B A;  1QVX A;  3GWL A;  3H65 A;  3M4C A;  3NKD A;  3QW0 A;  4U9D A;  4XTK A;  4D4N A;  3J06 A;  4ONS A;  3ZDL A;  4QDL A;  3RF3 A;  1PV3 A;  5EGY A;  1SYQ A;  1U0B B;  2R7R A;  4NY3 A;  4U5F E;  1GM5 A;  3AG2 C;  1OCO C;  2HS5 A;  5BQI A;  2P1A A;  3EGD B;  3V5Y A;  2A6H F;  3GWN A;  4D4X A;  3LJB A;  3KYI A;  3LLI A;  2RSE B;  3EFO B;  4HFF B;  4Q5S F;  2ETS A;  4CS9 A;  4J30 B;  1OCR C;  2GAQ A;  3V5Z A;  3W8H A;  3W4Y A;  1YZA A;  3GOR A;  1OQC A;  3ITF A;  2Y3G A;  5JS5 A;  3SZR A;  1ORJ A;  2PX0 A;  4EBB A;  2HJ3 A;  2LK4 A;  2YRF A;  2YLG A;  1HW1 A;  3W8I A;  3ZTZ A;  5DS6 A;  1T5O A;  4XQ1 A;  3K33 A;  1V55 C;  4U5D E;  2GA0 A;  4MND A;  3S27 A;  1OXB A;  4J32 B;  2X0C A;  2LSE A;  4AK9 A;  3UMI A;  3PHF 2;  1WGW A;  1LKX A;  1LM3 B;  4P6I C;  2YHS A;  3RVZ A;  1ZU5 A;  2KW3 C;  4U5G A;  1Q0D A;  1QZX A;  2AVK A;  2YLD A;  2AU5 A;  4X0R A;  3TJ5 A;  3B0U X;  3RYL A;  1HW2 A;  1VLS A;  2PF4 E;  1K05 A;  1IW7 F;  1OCZ C;  2UUH A;  2DI3 A;  4HEA J;  4WGY A;  4XEF A;  5T3W A;  4C3E A;  5EHH A;  1EKY A;  1EI7 A;  3DMD A;  4IGG A;  4JC7 A;  1A7D A;  2J46 A;  3SEO A;  4BEM J;  3C18 A;  3CEX A;  1O3U A;  1Z63 A;  3FOP A;  3GOD A;  4CS9 C;  1ZHT A;  1LS4 A;  2NUT B;  3ABL C;  1MMD A;  2G3V A;  5KYN A;  1C03 A;  1APC A;  1VB5 A;  3HNJ A;  1M56 C;  3CQZ A;  3CAX A;  2Q3T A;  3B71 A;  3JRT A;  5COF A;  5BUO A;  4IB4 A;  1AUE A;  3AGU A;  1KU2 A;  1T6Q A;  4JEA A;  3AQC A;  1QKR A;  3S28 A;  1G5Z A;  5L0D A;  1HE9 A;  2NSG A;  2XLV A;  4OD5 A;  1A0B A;  1NU7 D;  2B0J A;  4O6N A;  1N1C A;  2L6G A;  2YEV A;  1D1B A;  4RD9 A;  4YT8 A;  3EPV A;  5CIV A;  1YDI A;  1FAP B;  4CDY A;  3RKO F;  2WZG A;  3EG9 B;  3X2Q C;  1QSP A;  1CGM E;  1EA8 A;  2J7P A;  1ORS C;  2R7S A;  4CBE A;  2ZXO A;  1SF8 A;  2PX3 A;  2HSQ A;  3ZC4 A;  1G8X A;  2HMZ A;  3NYM A;  1Z6A A;  1T9K A;  3PMR A;  3NYL A;  4G0H A;  1M2V A;  3UMH A;  1JOG A;  4E7S A;  3LS0 A;  1Y6D A;  4PJM A;  3EG9 A;  5F28 E;  3O6X A;  1ZZP A;  3H2V A;  4I1O B;  4N06 A;  4YT4 A;  3DE8 A;  5KYW A;  2HJM A;  4JJG A;  3ABM C;  3U3B A;  3UR3 C;  4CSA A;  3LES A;  3JRM O;  2IM8 A;  5AGF A;  3QVZ A;  2WVN A;  3PCV A;  1HMD A;  2KJG A;  4H4K C;  2EPL X;  3NMI A;  2ZXP A;  4BG0 A;  2A68 F;  3AG1 C;  3DE9 A;  3FAJ A;  1V4A A;  4O79 A;  5JUA A;  4MVZ A;  4P9F A;  2CGE A;  3LS1 A;  1TQG A;  3AOU A;  3O10 A;  3QMK A;  4PFP A;  3EH2 A;  2H7B A;  3TQO A;  5JSL A;  1RKE B;  1VTM P;  1F1M A;  2YKZ A;  1I4Y A;  1FMW A;  1XZP A;  1YJG A;  1UFB A;  4G7O F;  4LER A;  1XWJ A;  2V26 A;  4PJN A;  2NSF A;  4Z9J A;  5E3C A;  2W45 A;  2J0W A;  4GEH A;  2JX0 A;  1H9T A;  3DD7 A;  2D5R B;  5B3S C;  2Z15 A;  3C62 A;  2I8B A;  3G4X A;  3POV A;  1V74 B;  3GM1 A;  3KH2 A;  3ASN C;  3C8G D;  3OWT A;  4IJJ A;  4YL0 A;  3SXM A;  4YWQ A;  5L0J A;  1QPU A;  2WL8 A;  2AP3 A;  3H2U A;  5E33 A;  1JR8 A;  1ST6 A;  2L81 A;  3T6J A;  4CSA C;  2QY9 A;  2OU6 A;  4WAB A;  4YN0 B;  3TOM A;  4XEV A;  4CS8 C;  1OKK D;  1TKN A;  1V54 C;  3VF0 A;  3QTH A;  2OG2 A;  2NG1 A;  4AE4 A;  2GWW A;  3FMS A;  3KPH A;  2J7P D;  2HZ8 A;  3HKK A;  4MTG A;  4W8K A;  4E18 A;  2MHR A;  3RFY A;  4KC9 A;  1Z23 A;  2R7Q A;  2MWQ A;  3U2M A;  3DKA A;  2R7T A;  3EZH A;  2LP4 A;  3OA1 A;  5JLI A;  1S7Z A;  4YK5 A;  4AX2 A;  5L0I A;  4L6R A;  1VMA A;  4QI2 A;  2BC5 A;  4HFK B;  4Z9I A;  5FZT A;  1LI7 A;  3C8G B;  3B0V C;  4BJ5 C;  5KYX B;  4FES A;  4KI2 A;  3S84 A;  5L0F A;  1AVO B;  2XL8 A;  3EH1 A;  3N24 A;  3EJN A;  4OIO F;  3TUL A;  1LE2 A;  2RD9 A;  2E87 A;  5DS4 A;  2XM4 A;  1D0Z A;  1TWG A;  2HSB A;  4MVS A;  3DZA A;  1Z5Z A;  3IPM O;  3IEE A;  4MVQ A;  3TD7 A;  1D0X A;  3M15 A;  5COG A;  1YYX A;  4NTF A;  2WZF A;  1YLM A;  5A6K A;  3C8Z A;  4DRJ B;  2R25 A;  2P7V A;  2OJE D;  4JZA A;  4ULW A;  3LEO A;  2CNW D;  3BEH A;  3AJM A;  4E7Z A;  3NMJ A;  3PDM P;  4LAC B;  5F5F A;  1BR1 A;  2ZXW C;  2VH3 A;  4XPY A;  1CPR A;  1DOV A;  1PCX A;  3IQT A;  3VYW A;  2XXA B;  2G3K A;  4Z9H A;  4E0H A;  2LD6 A;  3F46 A;  5JVE A;  1Q0G A;  3EGX A;  3FXH A;  1BBH A;  1C17 M;  1L3P A;  2D4U A;  2M4E A;  4EIY A;  1BR4 A;  1RXQ A;  2IYL D;  3IQC A;  3QVY A;  4YT2 A;  5L0C A;  2IBF A;  3U5S A;  2QE9 A;  1OW7 A;  4XLP F;  1NZE A;  4ULV A;  2ASR A;  2L6F A;  4C7O A;  2HUJ A;  1J8Y F;  2UUI A;  5K0I A;  4JRZ A;  3RVY A;  1YAU O;  5JRA A;  4U5C E;  5IY5 C;  2J0X A;  1FR0 A;  1M2O A;  4IAR A;  3G4Z A;  1M2V B;  3T4R A;  5L0H A;  2H7O A;  4OIN F;  2AWC A;  3ZWI A;  2IXP A;  3DI5 A;  4I1M A;  3DWW A;  4MVR A;  2YWA A;  2IXM A;  4N6C A;  1Q0M A;  3HTK C;  2PBE A;  2BL2 A;  2XLO A;  3U3F A;  2Y69 C;  1M6T A;  3SXY A;  3ECS A;  2J9B A;  1QLE C;  2R03 A;  3FHD A;  3RH3 A;  1NG1 A;  2XLW A;  4CJG A;  4J7T A;  4JE9 A;  2ZD9 A;  3Q7L A;  4DVZ A;  3S90 A;  2OKU A;  2X51 A;  2C04 A;  4DRH B;  2XL4 A;  2GFH A;  4U5E E;  3EGX B;  3HJC A;  1TFO B;  5AC4 A;  2VAS A;  3M1C B;  3A11 A;  4BEJ A;  1YYJ A;  5D91 A;  1GQA A;  2XXA A;  1GGQ A;  1WWP A;  4DBQ A;  2QLA A;  4AL0 A;  1UG7 A;  3G50 A;  2EIJ C;  3IQ5 A;  3SYN A;  3LEV A;  5L3Q A;  1ZW2 A;  1MQV A;  2CDQ A;  1LI5 A;  1T6U A;  3K1I A;  3VRC A;  2EIM C;  3B0P A;  3JCU Q;  5TJ5 E;  1AEP A;  1LS1 A;  2R7W A;  4PAC A;  4KNV A;  4DOZ A;  2J9U A;  4MVM A;  1EQ1 A;  2OEX A;  2AWY A;  4JCH A;  1LIH A;  3TK0 A;  1NFO A;  5E3A A;  4CJO A;  4ER9 A;  4ZLC A;  5KYX A;  4IAO A;  4QI0 A;  2XM0 A;  5JP7 A;  3RQF A;  1TWC A;  4JTC B;  3HNI A;  1ORY A;  3WG7 C;  1VLT A;  4WGZ A;  4FAP B;  2ICW G;  5A69 A;  2P6V A;  3VAY A;  3LLK A;  3U9J A;  2EPK X;  3FAP B;  1L7C A;  1RKC A;  3NKE A;  4JCZ A;  1PD1 A;  3U9M A;  4EKW A;  1H6G A;  4MW8 A;  3NYJ A;  3EHN A;  1NU9 C;  3B29 A;  2A0B A;  3ZVR A;  1JAF A;  1O5H A;  5DQZ A;  4A4A A;  4C3D A;  2WVO A;  5A6B A;  3Q6N A;  3L8I A;  2VCA A;  2XS8 A;  1SMY F;  2QTV A;  1E86 A;  3FDQ A;  2A0U A;  1TR2 A;  2Y3H A;  4DJ9 A;  1FFH A;  1RJ9 A;  1YZC A;  3ZQV A;  4C3B A;  5L0G A;  2P61 A;  4MVU A;  4U5H A;  3DM9 B;  2OOC A;  3E70 C;  2IOQ A;  2LIG A;  3T9O A;  4PK4 A;  3LUT B;  1ZW3 A;  1I5N A;  2Q9C A;  1MMA A;  1WAS A;  3MBG A;  1XZQ A;  3RW0 A;  4YL3 A;  3JTL O;  3RQE A;  3K1H A;  1NLX A;  4H54 A;  2Y3B A;  4DVY P;  4G7Z F;  3R7C A;  1OXK A;  1HY5 A;  1JPN A;  2JD3 A;  4CIH A;  5A6A A;  4YT5 A;  4C7O B;  1YA7 O;  1WN0 A;  4EWC A;  3MYI A;  2H7V C;  4MQ9 F;  2H8A A;  3L1M A;  2XSE A;  3Q6M A;  1QQ3 A;  4WJ0 A;  2Q9A A;  4MS2 A;  3US6 A;  3JYY A;  4BJT A;  3ZTM A;  3V5X A;  3LNM B;  1OW8 A;  3NG1 A;  1NFN A;  2O9X A; 
#chains in the Genus database with same CATH homology
 1WAS A;  4Z9I A;  1VLS A;  4Z9H A;  1WAT A;  4H54 A;  4Z9J A;  1LIH A;  2ASR A;  2LIG A;  1VLT A;  2D4U A;  3T9O A;  1JMW A;  3ATP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...