1WATA

The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
142
structure length
142
Chain Sequence
GFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemotaxis
molecule keywords ASPARTATE RECEPTOR
publication title The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor. Structural comparison to the cross-linked mutant forms and conformational changes upon ligand binding.
pubmed rcsb
source organism Salmonella typhimurium
total genus 58
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1watA00
1JMWA 3ATPA 2LIGA 1LIHA 4Z9HA 1WATA 4Z9IA 3T9OA 4H54A 1VLSA 4Z9JA 1WASA 1VLTA 2ASRA 2D4UA
chains in the Genus database with same CATH superfamily
4FAPB 3WAQA 1LIHA 2HUJA 2EIMC 4RBNA 1ST6A 1QQ3A 2OEVA 3V5XA 3F46A 2ASRA 4LDRA 2PX0A 3EJNA 1Z63A 4IB4A 1ZW2A 1A41A 1HE1A 4KNVA 1QPUA 3HNJA 4CDAA 2YRFA 2B0JA 1JOGA 2A69F 2R05A 3RVZA 3SP1A 4B6IA 2ETSA 3RYLA 3FHDA 1BR1A 1BR2A 1OR2A 1PCXA 3GM2A 4XWJA 5CI8A 1ZW3A 4YT4A 3JSZA 4J32B 3W4YA 4FESA 4FWVA 4FX5A 3HLZA 3GEIA 4ULVA 5E33A 4AE4B 4I1OB 3B0PA 3JRMO 5HV9A 1VYKA 2HMZA 5F5HA 2YWAA 4E0IA 1FMWA 2R7OA 2OEXA 1C02A 4YL1A 3HNIA 1BBHA 3DM9B 3V5YA 1OQCA 3NYMA 1IW7F 4BJTA 3LS1A 3AG1C 1ZU4A 4Z9IA 2HV7A 2YLIA 2W4BA 1HMOA 5KYUA 2VCAA 3GORA 5E3AA 4DRIB 2LCHA 3PDMP 3I5PA 4CSAA 3RKOF 3C18A 5FCLA 5JRAA 1D1CA 4P9FA 4GEHA 3ZIBA 1JPNA 1O3UA 4G7ZF 2E87A 3MLGA 2J9VA 3VYWA 4BJ5C 2KJGA 4JCZA 3SXMA 2A0UA 1RCPA 4ULWA 5KYWB 3DE9A 3S28A 5COMA 4DJ9A 4H54A 4NTFA 3SZRA 5CIVA 5A69A 1H7IA 2VCCA 2XXAB 3AGUA 1TWHA 3LEVA 4YL0A 4P6IC 1TWAA 4OD5A 3B0VC 3RQEA 4YT2A 3EFOB 3QW1A 1JRAA 1KU2A 2EPOA 5KYYA 5L3QA 2J7PD 2EINC 2B0HA 4K1OA 2P1AA 2R25A 2HMQA 3L8IA 1EA8A 3VRCA 2BC5A 2EIJC 2Y39A 3NMIA 4JC7A 3W8IA 1W2WA 2ZD9A 4PJNA 2QE9A 2RD9A 2V3CC 1L7CA 4K7BA 1CGNA 1ZYRF 2Z15A 3WHNA 3ASNC 4G78A 1WTYA 1L3PA 1PV3A 3ZG1A 4XPXA 4EBKA 4MVRA 2HJMA 2DI3A 3LAYA 1YA9A 2J0WA 3K33A 4YL3A 4AL0A 4BJ6A 2AU5A 1T9KA 3JZ0A 3ZQYA 4CS8A 1LE2A 4RDAA 2XLVA 1NU9C 1YYXA 3U0CA 2NUTA 1I4ZA 3C8GD 1K40A 1D1BA 1NG1A 2GA0A 3NYJA 3IEEA 4MW3A 1UG7A 1E85A 1QVXA 3PHF2 4QDLA 2OKUA 1T6QA 2R7UA 4I1MA 5DVWA 1I5NA 3BEHA 3NDBB 1T01A 3AG2C 2ZXPA 3Q7GA 4CIHA 3ABLC 3FXHA 3KPHA 1NLXA 1M2OA 1G5ZA 1SZIA 3VM6A 5KYXB 3UMIA 1ZU5A 2LK4A 1RJ9B 4R32A 2CDQA 4G0HA 1GM5A 1WWPA 2Q9BA 3SEOA 2HS5A 4BJ5A 2WZLA 3L1MA 4JVSA 1A7EA 1H6GA 3ABKC 3EGXB 4O6MA 3T6GB 3EZIA 2UUIA 3A11A 1TR2A 1HW1A 1D0YA 2ICWG 3S84A 4OIQF 2IXOA 5DS6A 2Y69C 4CSAC 3S27A 3G4XA 4MVOA 1RKEB 2KNHA 4YN0B 4HEAJ 1U0BB 3PCVA 5L0FA 1WOLA 1NZEA 2JD3A 4OIRF 5DS4A 3KKBA 1V54C 1E86A 1K05A 4CJGA 3EG9B 3S29A 3EH1A 3U2MA 5HSWA 1CPRA 2KQ9A 2ZXWC 1YJGA 1APCA 1GS9A 3M4BA 4IARA 4EKWA 3HNLA 3M79A 3TJ6A 2R03A 4MW8A 4BEJA 2CNWA 3L34A 2AWYA 3JRTA 3TJ5A 5IY5C 4AE4A 2Y3BA 3B9QA 5DLJA 2NG1A 4LLCA 1YZCA 2R7TA 1O5HA 3UMKA 1D0XA 1H9GA 1QSPA 2KSFA 2NSGA 1OCOC 2A6HF 3IPMO 2G3KA 3O39A 4P9TA 3V5ZA 4MVSA 3Q6MA 2CYDA 3U5SA 2H7BA 2LFDA 2MWQA 4IAQA 3NKEA 3EHMA 3U2LA 3UGOA 2J9UA 4C7OB 1WN0A 2Y3GA 1C03A 1LS4A 3ATPA 3C8GB 3C7JA 5A6BA 4JJFA 3X1OA 3UMHA 4JW1A 3A9CA 1F1MA 3L0IA 4J7TA 5L0HA 2YKZA 1VLSA 1LI5A 3E70C 2YHSA 3QMKA 4BJ6C 4U9EA 3GM3A 4CS8C 4EIYA 1CGME 5B3IA 4MS2A 1NSGB 3QZCA 4HFKB 1YDIA 1LI7A 3O55A 1E2XA 3OEOA 5A6JA 2W4MA 5L0IA 1FFTC 4CJOA 1HW2A 1ORJA 1V74B 2WZGA 1MNEA 1ZHXA 1OKKD 3UR3C 4KI2A 2KC3A 2XXAA 4EBBA 3RIPA 3O10A 4DVYP 1R4TA 2HFIA 3FOPA 5JUAA 4KBLA 4MVMA 3LESA 2AP3A 2OQMA 3EFOA 1JAFA 3Q6NA 2BE5F 1Z7Qc 2R7SA 4IJJA 4Q4ZF 3LUTB 2XLMA 2IXPA 1VLTA 3FAPB 3DAFA 2YL1A 4U5GA 3SXYA 3H2VA 3U3FA 3AQCA 4KNWA 1D0ZA 4C3BA 2EPLX 2EILC 1M6TA 4JEBA 2GFHA 1M2VA 2PFDA 1G4US 1NBBA 3N24A 3RVYA 2XLDA 1OW8A 5D92A 3SXKA 1HY5A 3SYNA 3N2ZB 4LACB 1G8XA 1MQVA 1Q0GA 1RKCA 2KYHA 3AG4C 4CDYA 5AGFA 5EHHA 1MNDA 1XZQA 2P61A 5L0CA 4IGGA 2I8BA 3W8HA 2DGJA 2HSBA 4O6YA 2YL3A 1XZPA 2H8AA 1KTMA 3I4UA 3NKDA 4WGZA 2Q7RA 4MNDA 1SF8A 2A68F 4C3EA 1RXQA 3CEXA 3H2UA 2YL0A 4Q5SF 4BEMJ 2IM8A 1BZ4A 3FAJA 5GPGB 3DD7A 4YWQA 1V55C 2XM0A 4IWBA 1BR4A 3FMSA 4U5DE 3ZVRA 1G4WR 2UUHA 1ZHZA 1HE9A 3DE8A 1TWGA 2IYLD 5JVEA 1SYQA 1YARO 1IZMA 1U6HA 2L6HA 4MTGA 4O6NA 3KL4A 3LJBA 3US6A 2YVKA 3WG7C 4NTBA 1OW6A 2L9JA 1ORSC 3GEEA 3ZQVA 2W9YA 1YLMA 4PR9A 4XTKA 3RF3A 4DVZA 2YZSA 1VK5A 3KYJA 3MYFA 2XLHA 4IAOA 4A2NB 3T6JA 2PNOA 3JYYA 1RJ9A 2CGEA 5BQGA 2LP4A 3PMRA 5KYUB 2GAQA 4BG0A 1S7ZA 5EGYA 2W45A 4RD9A 1WASA 5T1DB 2OOCA 3EH2A 4LDKA 4NCQA 3ZC4A 5AC5A 4XLPF 4PK4A 1JMWA 2NUPA 2R02A 3OA1A 2NPUA 1LS1A 3EGXA 3DI5A 4U9DA 2BL2A 4WGYA 4YJWA 1EKYA 4XLNF 1GQAA 1LVKA 2CW0F 4J7YA 3DAGA 5K0IA 2RSEB 1OW7A 2EIKC 5L3VA 4LDQA 1Q0MA 2G3VA 3FVYA 1RKEA 3M15A 1OCZC 4CS7A 3SNHA 2VASA 3ABMC 2XM4A 3TOMA 3RFYA 3LLIA 4DOZA 4EWCA 2J7PA 1MMAA 3W2WA 4YT8A 2QTVA 4Z9JA 1OXBA 2XLWA 3MYIA 4H4KC 3VAYA 5DS5A 1ZVZA 2MHRA 1T6IA 2WVQA 3WODF 2LIGA 1QKRA 3EGDB 2XL8A 4LLEA 4O7GA 2VC9A 2WZFA 3F47A 2KGOA 3T6BA 1Q0DA 2M64A 2Y3DA 1FFHA 1YA7O 3JYHA 2G62A 4KC9A 4PFPA 3DXJF 2PP4A 3T9OA 3RQGA 4CDVA 5BQHA 1A0BA 3HNKA 2M4EA 4QI0A 4JEAA 3CAXA 1DOWA 5L0JA 3SXZA 3EZHA 1B68A 1SMYF 1ZHTA 3MFNA 1J8YF 3J06A 1Q0KA 5F28E 3C8GA 3IQ6A 1O87A 3TQOA 4M63A 2GDCA 3NMKA 2CCYA 2R7XA 256BA 1ZHWA 2EPMX 3LNMB 1Z5ZA 4JTAB 3POVA 1VTMP 1OCRC 5JS5A 1ORYA 2YQYA 3ZSUA 5A6AA 4PFOA 2Q9AA 3U9JA 3CSKA 4JKVA 4NQFA 1MMNA 2HZ8A 4PJMA 2XL4A 3L8JA 2A6EF 4QI2A 3TK0A 1J8MF 1TQGA 1PD0A 1VYIA 3CQZA 3NRHA 5COGA 4BPMA 5KYNA 2Q4FA 4OIPF 4XPYA 3T4RA 3C62A 3R2PA 5JSLA 2L7AA 4XEVA 3VF0A 2EPNA 4ER9A 1LM3B 1Z3IX 4JTDB 2C03A 3HKKA 3FDQA 2R7VA 2PF4E 2QUPA 2J0XA 2QNLA 1E83A 1VB5A 4OD4A 1DOVA 4U5BE 3UGPA 4MVUA 2J9BA 1MMGA 4E0HA 1EQ1A 4CS9A 3GANA 1ZZPA 1TFKB 4N6HA 4JTCB 1YZAA 2QLAA 2XLEA 3AQBA 1ZHYA 3DZAA 3DMDA 3U9MA 2X0CA 5FZTA 5KYWA 2XS1A 2YL7A 4L6RA 1GGQA 4XEKA 4GYTA 4AK9A 1JR8A 2VH3A 3U8VA 3KMIA 3U8PA 2JPUA 2WVOA 1OCCC 1R5ID 4OIOF 1OR3A 1C17M 1SR2A 4ZLCA 2C04A 4PJLA 4GQHA 5DQTA 1XWJA 4W8PA 4DRHB 4D4XA 4MVQA 5TJ5E 2WL8A 2D5RB 2DYRC 2IBFA 2Q3TA 3IQ5A 3G4ZA 3OWTA 3X2QC 5L0DA 1YYJA 4MTFA 5BUOA 1EI7A 5T3TA 3B71A 3BRJA 1QLEC 3B0UX 3IHUA 4WABA 4E7SA 2AWCA 2H7VC 4MTOA 1S05A 1WGWA 2FGYA 2Q00A 3DWWA 4AL1A 4ONSA 4NTAA 5AC4A 3Q7LA 4LERA 3GM1A 2JX0A 2Q9CA 1AEPA 4XPWA 4E7ZA 2L6FA 4WJ0A 1RMVA 2L81A 2HKVA 3G50A 2R7QA 5L0GA 2XSEA 3ASOC 3EQLF 2OJQA 1A7DA 2J9WA 2OJED 4OINF 2PX3A 5JLIA 4CBEA 2J8WA 4I44A 1MMDA 4YK5A 5E2QA 1UFBA 2YLDA 2ZPAA 1OKKA 3ZTMA 2LD6A 4ZLDA 3ZWIA 2OCCC 4Q7CA 3ZTZA 3MBGA 1NFOA 4E17A 3UNGC 1FMVA 5EK0A 4JCHA 4HE8D 4W8KA 5COFA 4ANJA 4NY3A 1FR0A 4XQ1A 1N1CA 3QW0A 1VMAA 3C8ZA 4DRJB 2TMVP 1OXKA 2LSEA 2MYSA 2YLGA 1AUEA 2XS8A 3NMJA 2A1DD 2GWWA 3QVZA 5CI9A 3CZ6A 3FOOA 3K1IA 2IXMA 3EGDA 3TD7A 1M2VB 2OU6A 4JJGA 3MX3A 2NSFA 4U5FE 1FNTc 3EPVA 2P0NA 3RH3A 3GODA 5B1AC 1T6UA 2P7VA 4G7OF 1E84A 1KNYA 2F22A 3RW0A 4BJ1A 1K04A 2WVNA 3DJNB 4CS9C 1H9TA 1M56C 2HV6A 3QTHA 4E18A 3I5QA 1PD1A 4MQ9F 2PBEA 3EG9A 2R9RB 1LKXA 2IXNA 3W2VA 2I15A 2L6GA 2FFHA 2YEVA 4JRZA 3JSEO 3QVYA 5A6KA 5KYYB 3S90A 2ZXRA 3AJMA 3GEHA 1M57C 2XL6A 2WB7A 2KK1A 2J45A 4JE9A 4PJJA 4U5HA 5DQZA 3AGTA 5B3SC 1TFOB 5JP7A 3EHNA 1Y4CA 2ZXOA 2LFFA 1NU7D 4J30B 3S9OA 1AVOB 3KYIA 3LEOA 4CX9A 4Z9HA 3AG3C 1U89A 4I3MA 1Q0FA 3JT1A 3M4CA 2CNWD 3O6XA 1V4AA 1NFNA 4X0RA 3KH2A 3LLKA 2KW3C 1FTSA 1YVIA 3H65A 1WATA 2XRHA 2A0BA 2HSQA 1FAPB 4C7OA 1LE4A 4DBQA 2H7OA 3K6BA 3JCUQ 4F4BA 5T3WA 2QY9A 1QZXA 3DKAA 1A7VA 4IRUA 4A4AA 5B1BC 2V26A 3IQTA 3K1HA 5F5FA 2NUTB 4D4NA 3K66A 4JZAA 5A6BD 2IOQA 2NUPB 1TKNA 3ECSA 3TOLA 3C63A 3E9VA 3K7DA 5E3CA 4AX2A 4EUKB 3GWLA 1CPQA 3R7CA 2HJ3A 4CIPA 2AVKA 4EHPA 4JIOA 4EBJA 1Y6DA 2Y3HA 3JTLO 5JT4A 5D91A 3V7OA 3S0XA 2O9XA 1LPEA 2J46A 1YAUO 2LQGA 1I4YA 2XLOA 2DYSC 2X51A 4JURI 4MVZA 4NC3A 3RQFA 3M1CB 2R7RA 1BDJB 2VB6A 3N0TA 2R7WA 1Z23A 4DXWA 2P6VA 3NG1A 4XEFA 1HMDA 1TWCA 4K0DA 4U5EE 1CGOA 2OG2A 5BQIA 3LS0A 4YT5A 2D4UA 4U5CE 4O79A 3TULA 2FAPB 1VOMA 4N6CA 3HTKC 1JPJA 4C3DA 3B29A 2EPKX 4N06A 3HJCA 4PACA 1T5OA 4N4WA 1Z6AA 3ZDLA 1D1AA 3NYLA 3AOUA 3K1IC 3LNRA 4HFFB 3GWNA 3ITFA 3DM5A 3U3BA 2DB4A 4DBRA 4UDVA 4G7HF 3DJUB 5KYXA 3IQCA 2VCBA
chains in the Genus database with same CATH topology
1JMWA 3ATPA 2LIGA 1LIHA 4Z9HA 1WATA 4Z9IA 3T9OA 4H54A 1VLSA 4Z9JA 1WASA 1VLTA 2ASRA 2D4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMW A;  3ATP A;  2LIG A;  1LIH A;  4Z9H A;  1WAT A;  4Z9I A;  3T9O A;  4H54 A;  1VLS A;  4Z9J A;  1WAS A;  1VLT A;  2ASR A;  2D4U A; 
#chains in the Genus database with same CATH topology
 4FAP B;  3WAQ A;  1LIH A;  2HUJ A;  2EIM C;  4RBN A;  1ST6 A;  1QQ3 A;  2OEV A;  3V5X A;  3F46 A;  2ASR A;  4LDR A;  2PX0 A;  3EJN A;  1Z63 A;  4IB4 A;  1ZW2 A;  1A41 A;  1HE1 A;  4KNV A;  1QPU A;  3HNJ A;  4CDA A;  2YRF A;  2B0J A;  1JOG A;  2A69 F;  2R05 A;  3RVZ A;  3SP1 A;  4B6I A;  2ETS A;  3RYL A;  3FHD A;  1BR1 A;  1BR2 A;  1OR2 A;  1PCX A;  3GM2 A;  4XWJ A;  5CI8 A;  1ZW3 A;  4YT4 A;  3JSZ A;  4J32 B;  3W4Y A;  4FES A;  4FWV A;  4FX5 A;  3HLZ A;  3GEI A;  4ULV A;  5E33 A;  4AE4 B;  4I1O B;  3B0P A;  3JRM O;  5HV9 A;  1VYK A;  2HMZ A;  5F5H A;  2YWA A;  4E0I A;  1FMW A;  2R7O A;  2OEX A;  1C02 A;  4YL1 A;  3HNI A;  1BBH A;  3DM9 B;  3V5Y A;  1OQC A;  3NYM A;  1IW7 F;  4BJT A;  3LS1 A;  3AG1 C;  1ZU4 A;  4Z9I A;  2HV7 A;  2YLI A;  2W4B A;  1HMO A;  5KYU A;  2VCA A;  3GOR A;  5E3A A;  4DRI B;  2LCH A;  3PDM P;  3I5P A;  4CSA A;  3RKO F;  3C18 A;  5FCL A;  5JRA A;  1D1C A;  4P9F A;  4GEH A;  3ZIB A;  1JPN A;  1O3U A;  4G7Z F;  2E87 A;  3MLG A;  2J9V A;  3VYW A;  4BJ5 C;  2KJG A;  4JCZ A;  3SXM A;  2A0U A;  1RCP A;  4ULW A;  5KYW B;  3DE9 A;  3S28 A;  5COM A;  4DJ9 A;  4H54 A;  4NTF A;  3SZR A;  5CIV A;  5A69 A;  1H7I A;  2VCC A;  2XXA B;  3AGU A;  1TWH A;  3LEV A;  4YL0 A;  4P6I C;  1TWA A;  4OD5 A;  3B0V C;  3RQE A;  4YT2 A;  3EFO B;  3QW1 A;  1JRA A;  1KU2 A;  2EPO A;  5KYY A;  5L3Q A;  2J7P D;  2EIN C;  2B0H A;  4K1O A;  2P1A A;  2R25 A;  2HMQ A;  3L8I A;  1EA8 A;  3VRC A;  2BC5 A;  2EIJ C;  2Y39 A;  3NMI A;  4JC7 A;  3W8I A;  1W2W A;  2ZD9 A;  4PJN A;  2QE9 A;  2RD9 A;  2V3C C;  1L7C A;  4K7B A;  1CGN A;  1ZYR F;  2Z15 A;  3WHN A;  3ASN C;  4G78 A;  1WTY A;  1L3P A;  1PV3 A;  3ZG1 A;  4XPX A;  4EBK A;  4MVR A;  2HJM A;  2DI3 A;  3LAY A;  1YA9 A;  2J0W A;  3K33 A;  4YL3 A;  4AL0 A;  4BJ6 A;  2AU5 A;  1T9K A;  3JZ0 A;  3ZQY A;  4CS8 A;  1LE2 A;  4RDA A;  2XLV A;  1NU9 C;  1YYX A;  3U0C A;  2NUT A;  1I4Z A;  3C8G D;  1K40 A;  1D1B A;  1NG1 A;  2GA0 A;  3NYJ A;  3IEE A;  4MW3 A;  1UG7 A;  1E85 A;  1QVX A;  3PHF 2;  4QDL A;  2OKU A;  1T6Q A;  2R7U A;  4I1M A;  5DVW A;  1I5N A;  3BEH A;  3NDB B;  1T01 A;  3AG2 C;  2ZXP A;  3Q7G A;  4CIH A;  3ABL C;  3FXH A;  3KPH A;  1NLX A;  1M2O A;  1G5Z A;  1SZI A;  3VM6 A;  5KYX B;  3UMI A;  1ZU5 A;  2LK4 A;  1RJ9 B;  4R32 A;  2CDQ A;  4G0H A;  1GM5 A;  1WWP A;  2Q9B A;  3SEO A;  2HS5 A;  4BJ5 A;  2WZL A;  3L1M A;  4JVS A;  1A7E A;  1H6G A;  3ABK C;  3EGX B;  4O6M A;  3T6G B;  3EZI A;  2UUI A;  3A11 A;  1TR2 A;  1HW1 A;  1D0Y A;  2ICW G;  3S84 A;  4OIQ F;  2IXO A;  5DS6 A;  2Y69 C;  4CSA C;  3S27 A;  3G4X A;  4MVO A;  1RKE B;  2KNH A;  4YN0 B;  4HEA J;  1U0B B;  3PCV A;  5L0F A;  1WOL A;  1NZE A;  2JD3 A;  4OIR F;  5DS4 A;  3KKB A;  1V54 C;  1E86 A;  1K05 A;  4CJG A;  3EG9 B;  3S29 A;  3EH1 A;  3U2M A;  5HSW A;  1CPR A;  2KQ9 A;  2ZXW C;  1YJG A;  1APC A;  1GS9 A;  3M4B A;  4IAR A;  4EKW A;  3HNL A;  3M79 A;  3TJ6 A;  2R03 A;  4MW8 A;  4BEJ A;  2CNW A;  3L34 A;  2AWY A;  3JRT A;  3TJ5 A;  5IY5 C;  4AE4 A;  2Y3B A;  3B9Q A;  5DLJ A;  2NG1 A;  4LLC A;  1YZC A;  2R7T A;  1O5H A;  3UMK A;  1D0X A;  1H9G A;  1QSP A;  2KSF A;  2NSG A;  1OCO C;  2A6H F;  3IPM O;  2G3K A;  3O39 A;  4P9T A;  3V5Z A;  4MVS A;  3Q6M A;  2CYD A;  3U5S A;  2H7B A;  2LFD A;  2MWQ A;  4IAQ A;  3NKE A;  3EHM A;  3U2L A;  3UGO A;  2J9U A;  4C7O B;  1WN0 A;  2Y3G A;  1C03 A;  1LS4 A;  3ATP A;  3C8G B;  3C7J A;  5A6B A;  4JJF A;  3X1O A;  3UMH A;  4JW1 A;  3A9C A;  1F1M A;  3L0I A;  4J7T A;  5L0H A;  2YKZ A;  1VLS A;  1LI5 A;  3E70 C;  2YHS A;  3QMK A;  4BJ6 C;  4U9E A;  3GM3 A;  4CS8 C;  4EIY A;  1CGM E;  5B3I A;  4MS2 A;  1NSG B;  3QZC A;  4HFK B;  1YDI A;  1LI7 A;  3O55 A;  1E2X A;  3OEO A;  5A6J A;  2W4M A;  5L0I A;  1FFT C;  4CJO A;  1HW2 A;  1ORJ A;  1V74 B;  2WZG A;  1MNE A;  1ZHX A;  1OKK D;  3UR3 C;  4KI2 A;  2KC3 A;  2XXA A;  4EBB A;  3RIP A;  3O10 A;  4DVY P;  1R4T A;  2HFI A;  3FOP A;  5JUA A;  4KBL A;  4MVM A;  3LES A;  2AP3 A;  2OQM A;  3EFO A;  1JAF A;  3Q6N A;  2BE5 F;  1Z7Q c;  2R7S A;  4IJJ A;  4Q4Z F;  3LUT B;  2XLM A;  2IXP A;  1VLT A;  3FAP B;  3DAF A;  2YL1 A;  4U5G A;  3SXY A;  3H2V A;  3U3F A;  3AQC A;  4KNW A;  1D0Z A;  4C3B A;  2EPL X;  2EIL C;  1M6T A;  4JEB A;  2GFH A;  1M2V A;  2PFD A;  1G4U S;  1NBB A;  3N24 A;  3RVY A;  2XLD A;  1OW8 A;  5D92 A;  3SXK A;  1HY5 A;  3SYN A;  3N2Z B;  4LAC B;  1G8X A;  1MQV A;  1Q0G A;  1RKC A;  2KYH A;  3AG4 C;  4CDY A;  5AGF A;  5EHH A;  1MND A;  1XZQ A;  2P61 A;  5L0C A;  4IGG A;  2I8B A;  3W8H A;  2DGJ A;  2HSB A;  4O6Y A;  2YL3 A;  1XZP A;  2H8A A;  1KTM A;  3I4U A;  3NKD A;  4WGZ A;  2Q7R A;  4MND A;  1SF8 A;  2A68 F;  4C3E A;  1RXQ A;  3CEX A;  3H2U A;  2YL0 A;  4Q5S F;  4BEM J;  2IM8 A;  1BZ4 A;  3FAJ A;  5GPG B;  3DD7 A;  4YWQ A;  1V55 C;  2XM0 A;  4IWB A;  1BR4 A;  3FMS A;  4U5D E;  3ZVR A;  1G4W R;  2UUH A;  1ZHZ A;  1HE9 A;  3DE8 A;  1TWG A;  2IYL D;  5JVE A;  1SYQ A;  1YAR O;  1IZM A;  1U6H A;  2L6H A;  4MTG A;  4O6N A;  3KL4 A;  3LJB A;  3US6 A;  2YVK A;  3WG7 C;  4NTB A;  1OW6 A;  2L9J A;  1ORS C;  3GEE A;  3ZQV A;  2W9Y A;  1YLM A;  4PR9 A;  4XTK A;  3RF3 A;  4DVZ A;  2YZS A;  1VK5 A;  3KYJ A;  3MYF A;  2XLH A;  4IAO A;  4A2N B;  3T6J A;  2PNO A;  3JYY A;  1RJ9 A;  2CGE A;  5BQG A;  2LP4 A;  3PMR A;  5KYU B;  2GAQ A;  4BG0 A;  1S7Z A;  5EGY A;  2W45 A;  4RD9 A;  1WAS A;  5T1D B;  2OOC A;  3EH2 A;  4LDK A;  4NCQ A;  3ZC4 A;  5AC5 A;  4XLP F;  4PK4 A;  1JMW A;  2NUP A;  2R02 A;  3OA1 A;  2NPU A;  1LS1 A;  3EGX A;  3DI5 A;  4U9D A;  2BL2 A;  4WGY A;  4YJW A;  1EKY A;  4XLN F;  1GQA A;  1LVK A;  2CW0 F;  4J7Y A;  3DAG A;  5K0I A;  2RSE B;  1OW7 A;  2EIK C;  5L3V A;  4LDQ A;  1Q0M A;  2G3V A;  3FVY A;  1RKE A;  3M15 A;  1OCZ C;  4CS7 A;  3SNH A;  2VAS A;  3ABM C;  2XM4 A;  3TOM A;  3RFY A;  3LLI A;  4DOZ A;  4EWC A;  2J7P A;  1MMA A;  3W2W A;  4YT8 A;  2QTV A;  4Z9J A;  1OXB A;  2XLW A;  3MYI A;  4H4K C;  3VAY A;  5DS5 A;  1ZVZ A;  2MHR A;  1T6I A;  2WVQ A;  3WOD F;  2LIG A;  1QKR A;  3EGD B;  2XL8 A;  4LLE A;  4O7G A;  2VC9 A;  2WZF A;  3F47 A;  2KGO A;  3T6B A;  1Q0D A;  2M64 A;  2Y3D A;  1FFH A;  1YA7 O;  3JYH A;  2G62 A;  4KC9 A;  4PFP A;  3DXJ F;  2PP4 A;  3T9O A;  3RQG A;  4CDV A;  5BQH A;  1A0B A;  3HNK A;  2M4E A;  4QI0 A;  4JEA A;  3CAX A;  1DOW A;  5L0J A;  3SXZ A;  3EZH A;  1B68 A;  1SMY F;  1ZHT A;  3MFN A;  1J8Y F;  3J06 A;  1Q0K A;  5F28 E;  3C8G A;  3IQ6 A;  1O87 A;  3TQO A;  4M63 A;  2GDC A;  3NMK A;  2CCY A;  2R7X A;  256B A;  1ZHW A;  2EPM X;  3LNM B;  1Z5Z A;  4JTA B;  3POV A;  1VTM P;  1OCR C;  5JS5 A;  1ORY A;  2YQY A;  3ZSU A;  5A6A A;  4PFO A;  2Q9A A;  3U9J A;  3CSK A;  4JKV A;  4NQF A;  1MMN A;  2HZ8 A;  4PJM A;  2XL4 A;  3L8J A;  2A6E F;  4QI2 A;  3TK0 A;  1J8M F;  1TQG A;  1PD0 A;  1VYI A;  3CQZ A;  3NRH A;  5COG A;  4BPM A;  5KYN A;  2Q4F A;  4OIP F;  4XPY A;  3T4R A;  3C62 A;  3R2P A;  5JSL A;  2L7A A;  4XEV A;  3VF0 A;  2EPN A;  4ER9 A;  1LM3 B;  1Z3I X;  4JTD B;  2C03 A;  3HKK A;  3FDQ A;  2R7V A;  2PF4 E;  2QUP A;  2J0X A;  2QNL A;  1E83 A;  1VB5 A;  4OD4 A;  1DOV A;  4U5B E;  3UGP A;  4MVU A;  2J9B A;  1MMG A;  4E0H A;  1EQ1 A;  4CS9 A;  3GAN A;  1ZZP A;  1TFK B;  4N6H A;  4JTC B;  1YZA A;  2QLA A;  2XLE A;  3AQB A;  1ZHY A;  3DZA A;  3DMD A;  3U9M A;  2X0C A;  5FZT A;  5KYW A;  2XS1 A;  2YL7 A;  4L6R A;  1GGQ A;  4XEK A;  4GYT A;  4AK9 A;  1JR8 A;  2VH3 A;  3U8V A;  3KMI A;  3U8P A;  2JPU A;  2WVO A;  1OCC C;  1R5I D;  4OIO F;  1OR3 A;  1C17 M;  1SR2 A;  4ZLC A;  2C04 A;  4PJL A;  4GQH A;  5DQT A;  1XWJ A;  4W8P A;  4DRH B;  4D4X A;  4MVQ A;  5TJ5 E;  2WL8 A;  2D5R B;  2DYR C;  2IBF A;  2Q3T A;  3IQ5 A;  3G4Z A;  3OWT A;  3X2Q C;  5L0D A;  1YYJ A;  4MTF A;  5BUO A;  1EI7 A;  5T3T A;  3B71 A;  3BRJ A;  1QLE C;  3B0U X;  3IHU A;  4WAB A;  4E7S A;  2AWC A;  2H7V C;  4MTO A;  1S05 A;  1WGW A;  2FGY A;  2Q00 A;  3DWW A;  4AL1 A;  4ONS A;  4NTA A;  5AC4 A;  3Q7L A;  4LER A;  3GM1 A;  2JX0 A;  2Q9C A;  1AEP A;  4XPW A;  4E7Z A;  2L6F A;  4WJ0 A;  1RMV A;  2L81 A;  2HKV A;  3G50 A;  2R7Q A;  5L0G A;  2XSE A;  3ASO C;  3EQL F;  2OJQ A;  1A7D A;  2J9W A;  2OJE D;  4OIN F;  2PX3 A;  5JLI A;  4CBE A;  2J8W A;  4I44 A;  1MMD A;  4YK5 A;  5E2Q A;  1UFB A;  2YLD A;  2ZPA A;  1OKK A;  3ZTM A;  2LD6 A;  4ZLD A;  3ZWI A;  2OCC C;  4Q7C A;  3ZTZ A;  3MBG A;  1NFO A;  4E17 A;  3UNG C;  1FMV A;  5EK0 A;  4JCH A;  4HE8 D;  4W8K A;  5COF A;  4ANJ A;  4NY3 A;  1FR0 A;  4XQ1 A;  1N1C A;  3QW0 A;  1VMA A;  3C8Z A;  4DRJ B;  2TMV P;  1OXK A;  2LSE A;  2MYS A;  2YLG A;  1AUE A;  2XS8 A;  3NMJ A;  2A1D D;  2GWW A;  3QVZ A;  5CI9 A;  3CZ6 A;  3FOO A;  3K1I A;  2IXM A;  3EGD A;  3TD7 A;  1M2V B;  2OU6 A;  4JJG A;  3MX3 A;  2NSF A;  4U5F E;  1FNT c;  3EPV A;  2P0N A;  3RH3 A;  3GOD A;  5B1A C;  1T6U A;  2P7V A;  4G7O F;  1E84 A;  1KNY A;  2F22 A;  3RW0 A;  4BJ1 A;  1K04 A;  2WVN A;  3DJN B;  4CS9 C;  1H9T A;  1M56 C;  2HV6 A;  3QTH A;  4E18 A;  3I5Q A;  1PD1 A;  4MQ9 F;  2PBE A;  3EG9 A;  2R9R B;  1LKX A;  2IXN A;  3W2V A;  2I15 A;  2L6G A;  2FFH A;  2YEV A;  4JRZ A;  3JSE O;  3QVY A;  5A6K A;  5KYY B;  3S90 A;  2ZXR A;  3AJM A;  3GEH A;  1M57 C;  2XL6 A;  2WB7 A;  2KK1 A;  2J45 A;  4JE9 A;  4PJJ A;  4U5H A;  5DQZ A;  3AGT A;  5B3S C;  1TFO B;  5JP7 A;  3EHN A;  1Y4C A;  2ZXO A;  2LFF A;  1NU7 D;  4J30 B;  3S9O A;  1AVO B;  3KYI A;  3LEO A;  4CX9 A;  4Z9H A;  3AG3 C;  1U89 A;  4I3M A;  1Q0F A;  3JT1 A;  3M4C A;  2CNW D;  3O6X A;  1V4A A;  1NFN A;  4X0R A;  3KH2 A;  3LLK A;  2KW3 C;  1FTS A;  1YVI A;  3H65 A;  1WAT A;  2XRH A;  2A0B A;  2HSQ A;  1FAP B;  4C7O A;  1LE4 A;  4DBQ A;  2H7O A;  3K6B A;  3JCU Q;  4F4B A;  5T3W A;  2QY9 A;  1QZX A;  3DKA A;  1A7V A;  4IRU A;  4A4A A;  5B1B C;  2V26 A;  3IQT A;  3K1H A;  5F5F A;  2NUT B;  4D4N A;  3K66 A;  4JZA A;  5A6B D;  2IOQ A;  2NUP B;  1TKN A;  3ECS A;  3TOL A;  3C63 A;  3E9V A;  3K7D A;  5E3C A;  4AX2 A;  4EUK B;  3GWL A;  1CPQ A;  3R7C A;  2HJ3 A;  4CIP A;  2AVK A;  4EHP A;  4JIO A;  4EBJ A;  1Y6D A;  2Y3H A;  3JTL O;  5JT4 A;  5D91 A;  3V7O A;  3S0X A;  2O9X A;  1LPE A;  2J46 A;  1YAU O;  2LQG A;  1I4Y A;  2XLO A;  2DYS C;  2X51 A;  4JUR I;  4MVZ A;  4NC3 A;  3RQF A;  3M1C B;  2R7R A;  1BDJ B;  2VB6 A;  3N0T A;  2R7W A;  1Z23 A;  4DXW A;  2P6V A;  3NG1 A;  4XEF A;  1HMD A;  1TWC A;  4K0D A;  4U5E E;  1CGO A;  2OG2 A;  5BQI A;  3LS0 A;  4YT5 A;  2D4U A;  4U5C E;  4O79 A;  3TUL A;  2FAP B;  1VOM A;  4N6C A;  3HTK C;  1JPJ A;  4C3D A;  3B29 A;  2EPK X;  4N06 A;  3HJC A;  4PAC A;  1T5O A;  4N4W A;  1Z6A A;  3ZDL A;  1D1A A;  3NYL A;  3AOU A;  3K1I C;  3LNR A;  4HFF B;  3GWN A;  3ITF A;  3DM5 A;  3U3B A;  2DB4 A;  4DBR A;  4UDV A;  4G7H F;  3DJU B;  5KYX A;  3IQC A;  2VCB A; 
#chains in the Genus database with same CATH homology
 1JMW A;  3ATP A;  2LIG A;  1LIH A;  4Z9H A;  1WAT A;  4Z9I A;  3T9O A;  4H54 A;  1VLS A;  4Z9J A;  1WAS A;  1VLT A;  2ASR A;  2D4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...