4O6YA

Crystal structure of cytochrome b561
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
210
structure length
210
Chain Sequence
PIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVFLGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILILGGFVILGVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable transmembrane ascorbate ferrireductase 2
publication title Structure and mechanism of a eukaryotic transmembrane ascorbate-dependent oxidoreductase
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 92
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 7.2.1.3: Ascorbate ferrireductase (transmembrane).
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4o6yA00
4O7GA 4O6YA 4O79A
chains in the Genus database with same CATH superfamily
2WZGA 1JRAA 3C62A 3RVZA 3EGXA 3S28A 4IJJA 4BJ5C 2A0BA 1F1MA 5HSWA 3EGDA 3B0VC 1TWAA 4IRUA 2Q7RA 2NUPB 1H9GA 1WWPA 2GAQA 2VASA 2YVKA 4CDVA 1EQ1A 3UMIA 4IAOA 4DXWA 2HMZA 3CEXA 3U3BA 1KNYA 4KNVA 4I1MA 1ZW2A 1T6QA 1K40A 1I4YA 2X0CA 1H7IA 1BZ4A 2Y3BA 2R7QA 2YL3A 2AWYA 2LSEA 5B1BC 2LFFA 4YWQA 5HV9A 5KYWA 3K6BA 4PACA 3VM6A 1Z63A 1D0YA 4CJGA 1JOGA 3DAFA 4XWJA 3LEOA 3EZIA 1AEPA 2DB4A 4OIRF 2YL0A 2H7VC 2XLEA 5D91A 2D5RB 3GEEA 2H7BA 3FDQA 5L0JA 1FFTC 1O5HA 3TD7A 5JUAA 3F47A 5B1AC 5BQGA 4G0HA 5TJ5E 3AG4C 2VB6A 1OCZC 2EINC 1MMAA 2YLIA 1LPEA 1RKEB 4G78A 3T9OA 3NMIA 2YKZA 1OCOC 1R5ID 4JCZA 4Q7CA 2CW0F 4WGYA 5T1DB 4Z9IA 4CSAC 2ZXRA 2CYDA 3GM3A 1SR2A 1FR0A 1YYJA 1NSGB 2ZD9A 4K1OA 1QZXA 2HV6A 4G7OF 1RCPA 3JSEO 2JX0A 4N6CA 3ZWIA 1FTSA 1TR2A 1A7VA 1HW1A 1NFOA 3C8ZA 2GFHA 4A4AA 5F5FA 2EIMC 3Q7GA 4MTOA 2V3CC 3F46A 2YEVA 3QZCA 4JEBA 3HNJA 3KKBA 2C03A 2HSQA 3M1CB 4JURI 2Y39A 2EPLX 4Z9JA 1Q0MA 3CQZA 3SXYA 2XLDA 3UMHA 5A6AA 3FAPB 4R32A 4PFPA 3E9VA 1VOMA 1NLXA 2PP4A 3I5QA 2J0XA 3AJMA 4I44A 3S29A 4N4WA 1TFKB 1WTYA 3IQ5A 5CI8A 1Q0DA 4Q5SF 4ZLDA 5L0DA 2OG2A 1IW7F 3CZ6A 4RBNA 4BEMJ 1JPJA 4YT5A 4B6IA 2RD9A 5EHHA 3B71A 3K1HA 1AVOB 1KTMA 1J8MF 2L9JA 1D0ZA 3HNKA 4W8PA 3B29A 5L0HA 2KK1A 3AGTA 4GYTA 4CS8A 3ZG1A 5KYYA 1ZHXA 3CAXA 3HLZA 3RIPA 4LLEA 3W2VA 1OW7A 4ANJA 3VF0A 3U5SA 1LI5A 2W9YA 3SZRA 1SYQA 3WODF 1MMNA 4XLNF 4JKVA 2TMVP 4JTDB 2PFDA 4PJMA 3UMKA 2R7WA 1MMDA 2IXPA 2KSFA 1OCCC 3NYLA 3QTHA 4U5GA 4W8KA 3ZTMA 2G62A 3ZQYA 5DQZA 1ZU4A 1OR3A 1LVKA 1RJ9A 3HTKC 3KH2A 3QMKA 1ORJA 4O7GA 3T6GB 4YN0B 1SZIA 4XPWA 2IOQA 4OINF 3FAJA 4YK5A 4EKWA 3BRJA 3M15A 3RVYA 5F28E 1RJ9B 1CPQA 4FWVA 2R25A 2L7AA 4XQ1A 4XLPF 1NFNA 3EPVA 5T3TA 4MVMA 4D4XA 4EHPA 2H7OA 2OJED 3EHMA 4CJOA 3MX3A 4RD9A 1DOVA 3QW1A 1ZU5A 1TWHA 1GS9A 3LUTB 3L1MA 3OWTA 5B3SC 3G4XA 2OKUA 3HKKA 5L0CA 3DWWA 1ZZPA 1WATA 4CDAA 4ONSA 5JVEA 1CGNA 2DGJA 2OQMA 1D1CA 2UUIA 3U2MA 2R7XA 1VMAA 4MVQA 4IAQA 3TOLA 3ZVRA 2R7RA 2CDQA 4QI0A 1CGME 2A0UA 4BJ6A 4KBLA 3ZSUA 3I4UA 1GQAA 2J8WA 5L0FA 4DJ9A 3EG9A 2J9UA 2QE9A 4DRIB 3OA1A 3H2UA 2QTVA 3ABMC 3RF3A 3HJCA 3DJNB 3K66A 1D1AA 1JMWA 2OJQA 1G8XA 2ZXPA 3EH2A 2NUTA 2DYRC 4CS9A 3ZC4A 4GEHA 5L3VA 2EILC 2DYSC 2HMQA 2NUTB 3IPMO 4N6HA 4YJWA 2A69F 3SXZA 4BEJA 2C04A 3M4CA 2R7SA 2Q9BA 5DVWA 4DOZA 3W8IA 5GPGB 5BQIA 3PDMP 3R2PA 2VCAA 4AX2A 3KYJA 2WZFA 3TJ6A 5KYXA 4BJ5A 1LKXA 2CGEA 2L6FA 3TK0A 1LI7A 4YT8A 1ORYA 4CS9C 1EKYA 3DJUB 2Z15A 2G3KA 2Q4FA 5KYXB 3KYIA 1MMGA 1T01A 1QVXA 2RSEB 1YJGA 4HE8D 1N1CA 1U6HA 1L3PA 2PBEA 4KNWA 3V5XA 3ABLC 3NYJA 4WJ0A 2BE5F 3C8GA 4JRZA 5A6KA 1G4US 3IQCA 1YLMA 4OD4A 1OW6A 4JW1A 3KPHA 3ABKC 2EPOA 3C8GB 2L6HA 4LACB 1Z6AA 4O6NA 3VRCA 4NTFA 1KU2A 1Y6DA 1PD0A 4JJGA 4AL1A 2A1DD 3GEIA 4CBEA 1QQ3A 3FVYA 2XM0A 3FOOA 2KW3C 2Q9AA 1QLEC 2ASRA 5FZTA 4MVRA 3C63A 1C02A 2QY9A 1FMWA 2V26A 4YL3A 5EK0A 4MTGA 5CI9A 1V4AA 2FFHA 1LM3B 4MTFA 2XXAB 3UR3C 1RKEA 3SXKA 4CIPA 1YA7O 3UGPA 3O55A 4XEVA 3MBGA 2NPUA 2IM8A 2YRFA 3IEEA 4BJ1A 2LP4A 3RQEA 3H2VA 4CSAA 2XSEA 1LE2A 4K7BA 4EIYA 1OW8A 2YLDA 4YL1A 5EGYA 2WZLA 4MVSA 2BL2A 3M79A 3U0CA 2O9XA 1UG7A 3B0PA 2ZXWC 4U5HA 1YYXA 2PX3A 1NU7D 4RDAA 3GWNA 4LDKA 4FX5A 2Y69C 3X2QC 1OQCA 3JSZA 3LEVA 4JC7A 3SP1A 3W2WA 4Z9HA 4AL0A 3V5YA 5JRAA 3ZQVA 2PF4E 2Y3GA 4JTAB 5A6BD 4G7ZF 4M63A 5K0IA 3DZAA 2R7TA 4OIQF 1VB5A 4KC9A 1NBBA 4PJJA 4P9FA 4DRHB 2FGYA 1XWJA 3AQCA 3IHUA 1Q0KA 4MVOA 1G4WR 3SNHA 2AU5A 3T6JA 4NY3A 5AC4A 2XM4A 1O87A 4LERA 5A6BA 4OIPF 4MNDA 1H6GA 3JYHA 2KGOA 3PMRA 1HMDA 3NMJA 2J0WA 3QVZA 1TQGA 2VCBA 5A6JA 2XLMA 2UUHA 1TWCA 1MNEA 5FCLA 1TKNA 3NRHA 4O6YA 4DVZA 3BEHA 3GORA 2JPUA 2L81A 2HFIA 2AWCA 1XZPA 3O10A 3QVYA 4WABA 4XEKA 3LNMB 1Z3IX 1A0BA 3FOPA 2HV7A 1A7EA 3MYIA 4J7YA 5L3QA 4AK9A 1C17M 2P0NA 1M2OA 3C7JA 4MQ9F 2EPKX 4ZLCA 4PJNA 4MW3A 1M2VB 4JZAA 4E7ZA 1T6IA 3GODA 2R9RB 3VYWA 4HFFB 3ASOC 4NCQA 3Q7LA 3U9MA 4E17A 3EZHA 3O6XA 2KYHA 2Y3HA 4U5EE 3S27A 2WB7A 3AG2C 3NMKA 3EFOB 3US6A 3H65A 5JLIA 2P6VA 3JZ0A 256BA 4NC3A 1LE4A 2R7OA 4LDRA 2J7PD 1VLTA 3DI5A 2J9BA 2ICWG 1NU9C 4EBBA 4CX9A 1YZAA 4C7OA 2XS1A 4IARA 2F22A 4A2NB 5DQTA 2ZPAA 2YZSA 1U0BB 1ZYRF 1Z7Qc 2BC5A 3LLIA 1U89A 1YDIA 1ZHWA 2J7PA 2VCCA 1ZHZA 2KJGA 1OCRC 4UDVA 1NZEA 3RYLA 1ZHTA 2A68F 4PFOA 4E7SA 2AVKA 4J32B 4FAPB 1NG1A 1BR1A 2VC9A 3ITFA 5B3IA 2NG1A 3K7DA 1O3UA 1ZHYA 4XPXA 2HS5A 1C03A 3DM5A 4LLCA 3N2ZB 3DE9A 1GGQA 3EJNA 3U3FA 1Q0FA 4JE9A 3V5ZA 1R4TA 1HY5A 2IXOA 4H54A 3S0XA 3TOMA 4DRJB 2A6HF 3LESA 1EA8A 5KYUB 5KYNA 3CSKA 3ZIBA 3ZDLA 4EBKA 4XTKA 2HJMA 3L34A 2WVQA 3HNIA 2IXMA 1BBHA 3E70C 2HZ8A 5JSLA 4CIHA 3C8GD 3JCUQ 4ULVA 5CIVA 4F4BA 4MS2A 1QSPA 2Q9CA 2YL7A 1Q0GA 3JYYA 4JCHA 4ER9A 1T6UA 5F5HA 3TQOA 2HKVA 3QW0A 2LIGA 3L8JA 3RQFA 3W8HA 1VK5A 4K0DA 4EBJA 3LLKA 3S9OA 5IY5C 3SXMA 3GANA 4HFKB 3U8PA 4MVUA 2HUJA 4Q4ZF 4DBQA 1V54C 4KI2A 1RKCA 1PD1A 4EUKB 2XLHA 1DOWA 1E86A 2DI3A 3ATPA 4NQFA 1TWGA 3M4BA 2J45A 3AG1C 4O79A 2YQYA 4U5DE 1T5OA 2ETSA 2W4BA 1OKKD 2R02A 1ZVZA 1TFOB 4GQHA 3ECSA 3WG7C 1YVIA 2Q3TA 3MFNA 4XEFA 1W2WA 2XXAA 1A7DA 1HE1A 3EH1A 2IBFA 3GEHA 1MNDA 1PV3A 3EGXB 1OKKA 1Y4CA 2A6EF 1XZQA 3EGDB 2J9WA 2XLWA 4ULWA 2I8BA 4J7TA 3R7CA 1JR8A 2P61A 5BUOA 2M64A 3Q6MA 3JRTA 5L0IA 1YARO 1VLSA 2EPMX 1PCXA 4PJLA 4BG0A 1ST6A 1HW2A 3FHDA 3DD7A 3MYFA 5AGFA 1APCA 4H4KC 4JTCB 2EIJC 4OIOF 1K05A 3LS1A 3PCVA 4MVZA 4DVYP 3AG3C 2GA0A 3B0UX 2R7VA 3K33A 4YL0A 1E85A 3UGOA 3K1IA 3RH3A 3IQ6A 2HJ3A 2XRHA 3V7OA 1CGOA 1LS1A 3HNLA 4U5BE 3WAQA 5L0GA 5KYWB 3K1IC 2VH3A 4JVSA 3DKAA 3W4YA 2J9VA 1YAUO 3JT1A 1GM5A 3G50A 1YZCA 4NTAA 3L0IA 2M4EA 2WVOA 3LJBA 3TULA 4QI2A 2G3VA 4G7HF 4N06A 4IB4A 4C3EA 1FNTc 3JTLO 3ASNC 4O6MA 2Y3DA 4CS7A 2ZXOA 3PHF2 4PK4A 3S84A 1E83A 3DM9B 1M56C 2XS8A 1K04A 1WOLA 2P7VA 4U9DA 2MHRA 2W45A 2LCHA 1FFHA 2YWAA 3NYMA 4X0RA 1T9KA 1BR4A 1SF8A 4E0IA 1WN0A 3EQLF 2IYLD 5COGA 5DS5A 4AE4A 3DXJF 4JEAA 1JPNA 1HE9A 1VYKA 1LS4A 1YA9A 4HEAJ 2KC3A 4AE4B 3Q6NA 1BR2A 1H9TA 3RW0A 3SYNA 1OXBA 1ORSC 2XLVA 3RKOF 2WVNA 5E3CA 2XL4A 2P1AA 3FXHA 3ZTZA 1D1BA 3GWLA 1VTMP 3DAGA 4P9TA 4PR9A 1M2VA 2R05A 2KNHA 1D0XA 3UNGC 5COFA 1OR2A 4I3MA 3VAYA 2YHSA 1FAPB 2LQGA 2PNOA 3JRMO 2QUPA 2QNLA 3G4ZA 4YT4A 2CNWD 1E84A 4LDQA 3EFOA 5JP7A 2D4UA 2JD3A 4BPMA 3TJ5A 3X1OA 2LK4A 1B68A 3T4RA 2PX0A 4FESA 1HMOA 3AGUA 3A9CA 2MWQA 5E2QA 2Q00A 1IZMA 4BJTA 4EWCA 3NDBB 3MLGA 4NTBA 4D4NA 2CNWA 2R7UA 1RMVA 4WGZA 4C3BA 2EIKC 4OD5A 1LIHA 2MYSA 3DMDA 3NKDA 2L6GA 3FMSA 5D92A 3NG1A 2NSFA 3N0TA 4CS8C 1VYIA 1WGWA 2OEVA 3LAYA 5KYYB 1G5ZA 3U2LA 2B0HA 4CDYA 3AQBA 2FAPB 3IQTA 4U5CE 3EHNA 2OU6A 1M57C 4E18A 1I4ZA 2OCCC 2QLAA 2X51A 5E33A 1Z23A 5DS4A 1OXKA 5DS6A 4C7OB 1SMYF 1Z5ZA 4IGGA 1CPRA 1ZW3A 2HSBA 3L8IA 2R03A 4MW8A 5COMA 1A41A 3NKEA 3KL4A 3O39A 2CCYA 1RXQA 5A69A 3GM2A 3LNRA 3U9JA 1QKRA 4XPYA 1MQVA 3RQGA 1BDJB 1V55C 2GWWA 2OEXA 5KYUA 3OEOA 4P6IC 2WL8A 2EPNA 3WHNA 4C3DA 1FMVA 2B0JA 2J46A 4E0HA 2W4MA 3AOUA 2LFDA 3S90A 3T6BA 2AP3A 4JIOA 3RFYA 5JS5A 3GM1A 3POVA 2I15A 3N24A 4I1OB 2KQ9A 4DBRA 1QPUA 4U9EA 3A11A 4JJFA 5BQHA 5E3AA 4J30B 4BJ6C 4U5FE 1EI7A 4YT2A 2H8AA 3KMIA 5JT4A 2YLGA 3J06A 3C18A 1J8YF 1WASA 3I5PA 3EG9B 1M6TA 2NSGA 5T3WA 2OOCA 2IXNA 5AC5A 2E87A 1S7ZA 3B9QA 2YL1A 5DLJA 1JAFA 4L6RA 1AUEA 1I5NA 2LD6A 1L7CA 3DE8A 2XL8A 2XLOA 4QDLA 1V74B 3LS0A 2GDCA 3SEOA 1UFBA 1E2XA 1S05A 3U8VA 4IWBA 2XL6A 2NUPA
chains in the Genus database with same CATH topology
2WZGA 4BJ5C 3EGXA 3S28A 4IJJA 5HSWA 3EGDA 3B0VC 1TWAA 4IRUA 2NUPB 2VASA 3UMIA 4IAOA 4KNVA 4I1MA 2Y3BA 2R7QA 5B1BC 2LSEA 4YWQA 5KYWA 1Z63A 3K6BA 1D0YA 3DAFA 4XWJA 3EZIA 4OIRF 2H7VC 5D91A 2D5RB 2H7BA 3FDQA 1FFTC 1O5HA 3TD7A 3F47A 5B1AC 4G0HA 3AG4C 2VB6A 1OCZC 2EINC 1MMAA 4Q7CA 1OCOC 2CW0F 5T1DB 4CSAC 2ZXRA 1QZXA 2HV6A 4G7OF 1FTSA 1TR2A 2GFHA 5F5FA 2EIMC 3Q7GA 2V3CC 3F46A 2YEVA 3QZCA 3KKBA 2C03A 3M1CB 4JURI 2Y39A 3UMHA 3CQZA 4PFPA 3E9VA 1VOMA 2PP4A 3I5QA 3S29A 2J0XA 4I44A 5CI8A 4ZLDA 4Q5SF 2OG2A 1IW7F 3CZ6A 4RBNA 1JPJA 4YT5A 4B6IA 5EHHA 3K1HA 1J8MF 2L9JA 1D0ZA 4GYTA 4CS8A 3ZG1A 5KYYA 1ZHXA 3HLZA 3RIPA 4LLEA 3W2VA 4ANJA 2W9YA 3SZRA 3WODF 1MMNA 4XLNF 2PFDA 4PJMA 3UMKA 2R7WA 1MMDA 2IXPA 3NYLA 1OCCC 4U5GA 4W8KA 2G62A 5DQZA 1ZU4A 3QMKA 1LVKA 1RJ9A 3HTKC 3KH2A 4O7GA 4YN0B 1SZIA 2IOQA 4OINF 3FAJA 1RJ9B 4FWVA 4XLPF 3EPVA 5T3TA 2H7OA 3EHMA 3MX3A 4RD9A 1ZU5A 1TWHA 4Q4ZF 3OWTA 5B3SC 2DGJA 1D1CA 2R7XA 1VMAA 4C7OB 2R7RA 3ZVRA 2CDQA 4QI0A 4BJ6A 4KBLA 3ZSUA 3I4UA 3EG9A 2J9UA 3OA1A 2QTVA 3ABMC 3HJCA 3DJNB 3K66A 1D1AA 3EH2A 2ZXPA 1G8XA 2NUTA 2DYRC 4CS9A 3ZC4A 4GEHA 5L3VA 2EILC 2DYSC 2NUTB 4CS9C 4YJWA 4BEJA 2A69F 2C04A 2R7SA 2Q9BA 5DVWA 4DOZA 3W8IA 4AX2A 2WZFA 5KYXA 4BJ5A 1LKXA 2CGEA 4YT8A 3DJUB 2Z15A 2G3KA 5KYXB 1MMGA 4HE8D 1N1CA 4KNWA 3ABLC 3NYJA 4WJ0A 2BE5F 4OD4A 4JW1A 3ABKC 4O6NA 4LACB 1Z6AA 1KU2A 1PD0A 4JJGA 2A1DD 4CBEA 3FVYA 2KW3C 2Q9AA 1QLEC 2QY9A 1FMWA 2V26A 5CI9A 2FFHA 2XXAB 3UR3C 3UGPA 4BJ1A 3IEEA 4CSAA 2XSEA 4K7BA 5EGYA 2WZLA 2O9XA 3B0PA 2ZXWC 4U5HA 2PX3A 1NU7D 4RDAA 4FX5A 2Y69C 3X2QC 3JSZA 3LEVA 3SP1A 3W2WA 2PF4E 2Y3GA 4G7ZF 4M63A 3DZAA 4OIQF 4KC9A 4PJJA 2FGYA 3AQCA 3T6JA 3SNHA 4NY3A 4LERA 1O87A 4OIPF 4MNDA 3JYHA 2KGOA 3PMRA 2J0WA 1TWCA 1MNEA 5FCLA 1TKNA 3NRHA 4O6YA 4DVZA 2L81A 1Z3IX 2HV7A 5L3QA 4AK9A 4MQ9F 1M2OA 4ZLCA 4PJNA 1M2VB 4JZAA 4E7ZA 3GODA 3VYWA 4HFFB 3ASOC 3Q7LA 3EZHA 3O6XA 4U5EE 2Y3HA 3S27A 2WB7A 3AG2C 3EFOB 3H65A 2P6VA 2R7OA 2J7PD 1NU9C 4EBBA 4C7OA 4A2NB 5DQTA 2ZPAA 2YZSA 1ZYRF 3LLIA 2J7PA 1ZHWA 1ZHZA 2KJGA 1OCRC 1NZEA 3RYLA 1ZHTA 2A68F 4PFOA 4E7SA 4J32B 1NG1A 1BR1A 3ITFA 2NG1A 3K7DA 1ZHYA 3DM5A 4LLCA 3N2ZB 3EJNA 3S0XA 2IXOA 2A6HF 3LESA 5KYUB 5KYNA 3CSKA 3ZIBA 4XTKA 3L34A 2WVQA 2IXMA 3E70C 4CIHA 3JCUQ 4F4BA 2Q9CA 4JCHA 5F5HA 3W8HA 1VK5A 4K0DA 3LLKA 5IY5C 3GANA 4HFKB 4DBQA 1V54C 4KI2A 1PD1A 1TWGA 4O79A 2J45A 3AG1C 4U5DE 2W4BA 1OKKD 3ECSA 3WG7C 2Q3TA 1W2WA 2XXAA 3EH1A 1MNDA 3EGXB 1OKKA 2A6EF 3EGDB 2J9WA 4ULWA 2I8BA 5BUOA 3Q6MA 3JRTA 1PCXA 4PJLA 4BG0A 1ST6A 3FHDA 3DD7A 4H4KC 4OIOF 2EIJC 3LS1A 4DVYP 3AG3C 3B0UX 2R7VA 3K33A 3UGOA 3RH3A 3V7OA 2XRHA 5KYWB 2R7TA 1LS1A 4U5BE 3K1IC 2VH3A 4JVSA 2J9VA 3JT1A 3L0IA 3LJBA 2WVOA 2M4EA 4QI2A 2G3VA 4G7HF 4N06A 4C3EA 3ASNC 4O6MA 2Y3DA 4CS7A 2ZXOA 3PHF2 4PK4A 3DM9B 1M56C 2P7VA 2W45A 1FFHA 3NYMA 4X0RA 1BR4A 1SF8A 3EQLF 2IYLD 5DS5A 4AE4A 3DXJF 1JPNA 1VYKA 4HEAJ 4AE4B 3Q6NA 1BR2A 3SYNA 3RKOF 2WVNA 5E3CA 2XL4A 1D1BA 3DAGA 1M2VA 3UNGC 2KNHA 1D0XA 4I3MA 3VAYA 2YHSA 4YT4A 2CNWD 3EFOA 2JD3A 3X1OA 3T4RA 2PX0A 4FESA 2MWQA 5E2QA 1IZMA 4BJTA 4EWCA 3NDBB 3MLGA 2CNWA 2R7UA 4C3BA 2EIKC 4OD5A 2MYSA 3DMDA 3NKDA 5D92A 4CS8C 3NG1A 3N0TA 1VYIA 1WGWA 3LAYA 5KYYB 3AQBA 4U5CE 3EHNA 1M57C 2OCCC 2X51A 5E33A 5DS6A 1Z23A 5DS4A 1SMYF 1Z5ZA 3NKEA 3KL4A 3O39A 3LNRA 1V55C 5KYUA 3OEOA 4P6IC 2WL8A 4C3DA 1FMVA 2B0JA 2J46A 2W4MA 3T6BA 3RFYA 3POVA 3N24A 4I1OB 2KQ9A 4DBRA 4JJFA 5E3AA 4J30B 4BJ6C 4U5FE 4YT2A 3KMIA 1J8YF 3I5PA 3EG9B 5T3WA 2IXNA 2E87A 1S7ZA 3B9QA 5DLJA 4QDLA 3LS0A 3SEOA 4IWBA 2NUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7G A;  4O6Y A;  4O79 A; 
#chains in the Genus database with same CATH topology
 2WZG A;  1JRA A;  3C62 A;  3RVZ A;  3EGX A;  3S28 A;  4IJJ A;  4BJ5 C;  2A0B A;  1F1M A;  5HSW A;  3EGD A;  3B0V C;  1TWA A;  4IRU A;  2Q7R A;  2NUP B;  1H9G A;  1WWP A;  2GAQ A;  2VAS A;  2YVK A;  4CDV A;  1EQ1 A;  3UMI A;  4IAO A;  4DXW A;  2HMZ A;  3CEX A;  3U3B A;  1KNY A;  4KNV A;  4I1M A;  1ZW2 A;  1T6Q A;  1K40 A;  1I4Y A;  2X0C A;  1H7I A;  1BZ4 A;  2Y3B A;  2R7Q A;  2YL3 A;  2AWY A;  2LSE A;  5B1B C;  2LFF A;  4YWQ A;  5HV9 A;  5KYW A;  3K6B A;  4PAC A;  3VM6 A;  1Z63 A;  1D0Y A;  4CJG A;  1JOG A;  3DAF A;  4XWJ A;  3LEO A;  3EZI A;  1AEP A;  2DB4 A;  4OIR F;  2YL0 A;  2H7V C;  2XLE A;  5D91 A;  2D5R B;  3GEE A;  2H7B A;  3FDQ A;  5L0J A;  1FFT C;  1O5H A;  3TD7 A;  5JUA A;  3F47 A;  5B1A C;  5BQG A;  4G0H A;  5TJ5 E;  3AG4 C;  2VB6 A;  1OCZ C;  2EIN C;  1MMA A;  2YLI A;  1LPE A;  1RKE B;  4G78 A;  3T9O A;  3NMI A;  2YKZ A;  1OCO C;  1R5I D;  4JCZ A;  4Q7C A;  2CW0 F;  4WGY A;  5T1D B;  4Z9I A;  4CSA C;  2ZXR A;  2CYD A;  3GM3 A;  1SR2 A;  1FR0 A;  1YYJ A;  1NSG B;  2ZD9 A;  4K1O A;  1QZX A;  2HV6 A;  4G7O F;  1RCP A;  3JSE O;  2JX0 A;  4N6C A;  3ZWI A;  1FTS A;  1TR2 A;  1A7V A;  1HW1 A;  1NFO A;  3C8Z A;  2GFH A;  4A4A A;  5F5F A;  2EIM C;  3Q7G A;  4MTO A;  2V3C C;  3F46 A;  2YEV A;  3QZC A;  4JEB A;  3HNJ A;  3KKB A;  2C03 A;  2HSQ A;  3M1C B;  4JUR I;  2Y39 A;  2EPL X;  4Z9J A;  1Q0M A;  3CQZ A;  3SXY A;  2XLD A;  3UMH A;  5A6A A;  3FAP B;  4R32 A;  4PFP A;  3E9V A;  1VOM A;  1NLX A;  2PP4 A;  3I5Q A;  2J0X A;  3AJM A;  4I44 A;  3S29 A;  4N4W A;  1TFK B;  1WTY A;  3IQ5 A;  5CI8 A;  1Q0D A;  4Q5S F;  4ZLD A;  5L0D A;  2OG2 A;  1IW7 F;  3CZ6 A;  4RBN A;  4BEM J;  1JPJ A;  4YT5 A;  4B6I A;  2RD9 A;  5EHH A;  3B71 A;  3K1H A;  1AVO B;  1KTM A;  1J8M F;  2L9J A;  1D0Z A;  3HNK A;  4W8P A;  3B29 A;  5L0H A;  2KK1 A;  3AGT A;  4GYT A;  4CS8 A;  3ZG1 A;  5KYY A;  1ZHX A;  3CAX A;  3HLZ A;  3RIP A;  4LLE A;  3W2V A;  1OW7 A;  4ANJ A;  3VF0 A;  3U5S A;  1LI5 A;  2W9Y A;  3SZR A;  1SYQ A;  3WOD F;  1MMN A;  4XLN F;  4JKV A;  2TMV P;  4JTD B;  2PFD A;  4PJM A;  3UMK A;  2R7W A;  1MMD A;  2IXP A;  2KSF A;  1OCC C;  3NYL A;  3QTH A;  4U5G A;  4W8K A;  3ZTM A;  2G62 A;  3ZQY A;  5DQZ A;  1ZU4 A;  1OR3 A;  1LVK A;  1RJ9 A;  3HTK C;  3KH2 A;  3QMK A;  1ORJ A;  4O7G A;  3T6G B;  4YN0 B;  1SZI A;  4XPW A;  2IOQ A;  4OIN F;  3FAJ A;  4YK5 A;  4EKW A;  3BRJ A;  3M15 A;  3RVY A;  5F28 E;  1RJ9 B;  1CPQ A;  4FWV A;  2R25 A;  2L7A A;  4XQ1 A;  4XLP F;  1NFN A;  3EPV A;  5T3T A;  4MVM A;  4D4X A;  4EHP A;  2H7O A;  2OJE D;  3EHM A;  4CJO A;  3MX3 A;  4RD9 A;  1DOV A;  3QW1 A;  1ZU5 A;  1TWH A;  1GS9 A;  3LUT B;  3L1M A;  3OWT A;  5B3S C;  3G4X A;  2OKU A;  3HKK A;  5L0C A;  3DWW A;  1ZZP A;  1WAT A;  4CDA A;  4ONS A;  5JVE A;  1CGN A;  2DGJ A;  2OQM A;  1D1C A;  2UUI A;  3U2M A;  2R7X A;  1VMA A;  4MVQ A;  4IAQ A;  3TOL A;  3ZVR A;  2R7R A;  2CDQ A;  4QI0 A;  1CGM E;  2A0U A;  4BJ6 A;  4KBL A;  3ZSU A;  3I4U A;  1GQA A;  2J8W A;  5L0F A;  4DJ9 A;  3EG9 A;  2J9U A;  2QE9 A;  4DRI B;  3OA1 A;  3H2U A;  2QTV A;  3ABM C;  3RF3 A;  3HJC A;  3DJN B;  3K66 A;  1D1A A;  1JMW A;  2OJQ A;  1G8X A;  2ZXP A;  3EH2 A;  2NUT A;  2DYR C;  4CS9 A;  3ZC4 A;  4GEH A;  5L3V A;  2EIL C;  2DYS C;  2HMQ A;  2NUT B;  3IPM O;  4N6H A;  4YJW A;  2A69 F;  3SXZ A;  4BEJ A;  2C04 A;  3M4C A;  2R7S A;  2Q9B A;  5DVW A;  4DOZ A;  3W8I A;  5GPG B;  5BQI A;  3PDM P;  3R2P A;  2VCA A;  4AX2 A;  3KYJ A;  2WZF A;  3TJ6 A;  5KYX A;  4BJ5 A;  1LKX A;  2CGE A;  2L6F A;  3TK0 A;  1LI7 A;  4YT8 A;  1ORY A;  4CS9 C;  1EKY A;  3DJU B;  2Z15 A;  2G3K A;  2Q4F A;  5KYX B;  3KYI A;  1MMG A;  1T01 A;  1QVX A;  2RSE B;  1YJG A;  4HE8 D;  1N1C A;  1U6H A;  1L3P A;  2PBE A;  4KNW A;  3V5X A;  3ABL C;  3NYJ A;  4WJ0 A;  2BE5 F;  3C8G A;  4JRZ A;  5A6K A;  1G4U S;  3IQC A;  1YLM A;  4OD4 A;  1OW6 A;  4JW1 A;  3KPH A;  3ABK C;  2EPO A;  3C8G B;  2L6H A;  4LAC B;  1Z6A A;  4O6N A;  3VRC A;  4NTF A;  1KU2 A;  1Y6D A;  1PD0 A;  4JJG A;  4AL1 A;  2A1D D;  3GEI A;  4CBE A;  1QQ3 A;  3FVY A;  2XM0 A;  3FOO A;  2KW3 C;  2Q9A A;  1QLE C;  2ASR A;  5FZT A;  4MVR A;  3C63 A;  1C02 A;  2QY9 A;  1FMW A;  2V26 A;  4YL3 A;  5EK0 A;  4MTG A;  5CI9 A;  1V4A A;  2FFH A;  1LM3 B;  4MTF A;  2XXA B;  3UR3 C;  1RKE A;  3SXK A;  4CIP A;  1YA7 O;  3UGP A;  3O55 A;  4XEV A;  3MBG A;  2NPU A;  2IM8 A;  2YRF A;  3IEE A;  4BJ1 A;  2LP4 A;  3RQE A;  3H2V A;  4CSA A;  2XSE A;  1LE2 A;  4K7B A;  4EIY A;  1OW8 A;  2YLD A;  4YL1 A;  5EGY A;  2WZL A;  4MVS A;  2BL2 A;  3M79 A;  3U0C A;  2O9X A;  1UG7 A;  3B0P A;  2ZXW C;  4U5H A;  1YYX A;  2PX3 A;  1NU7 D;  4RDA A;  3GWN A;  4LDK A;  4FX5 A;  2Y69 C;  3X2Q C;  1OQC A;  3JSZ A;  3LEV A;  4JC7 A;  3SP1 A;  3W2W A;  4Z9H A;  4AL0 A;  3V5Y A;  5JRA A;  3ZQV A;  2PF4 E;  2Y3G A;  4JTA B;  5A6B D;  4G7Z F;  4M63 A;  5K0I A;  3DZA A;  2R7T A;  4OIQ F;  1VB5 A;  4KC9 A;  1NBB A;  4PJJ A;  4P9F A;  4DRH B;  2FGY A;  1XWJ A;  3AQC A;  3IHU A;  1Q0K A;  4MVO A;  1G4W R;  3SNH A;  2AU5 A;  3T6J A;  4NY3 A;  5AC4 A;  2XM4 A;  1O87 A;  4LER A;  5A6B A;  4OIP F;  4MND A;  1H6G A;  3JYH A;  2KGO A;  3PMR A;  1HMD A;  3NMJ A;  2J0W A;  3QVZ A;  1TQG A;  2VCB A;  5A6J A;  2XLM A;  2UUH A;  1TWC A;  1MNE A;  5FCL A;  1TKN A;  3NRH A;  4O6Y A;  4DVZ A;  3BEH A;  3GOR A;  2JPU A;  2L81 A;  2HFI A;  2AWC A;  1XZP A;  3O10 A;  3QVY A;  4WAB A;  4XEK A;  3LNM B;  1Z3I X;  1A0B A;  3FOP A;  2HV7 A;  1A7E A;  3MYI A;  4J7Y A;  5L3Q A;  4AK9 A;  1C17 M;  2P0N A;  1M2O A;  3C7J A;  4MQ9 F;  2EPK X;  4ZLC A;  4PJN A;  4MW3 A;  1M2V B;  4JZA A;  4E7Z A;  1T6I A;  3GOD A;  2R9R B;  3VYW A;  4HFF B;  3ASO C;  4NCQ A;  3Q7L A;  3U9M A;  4E17 A;  3EZH A;  3O6X A;  2KYH A;  2Y3H A;  4U5E E;  3S27 A;  2WB7 A;  3AG2 C;  3NMK A;  3EFO B;  3US6 A;  3H65 A;  5JLI A;  2P6V A;  3JZ0 A;  256B A;  4NC3 A;  1LE4 A;  2R7O A;  4LDR A;  2J7P D;  1VLT A;  3DI5 A;  2J9B A;  2ICW G;  1NU9 C;  4EBB A;  4CX9 A;  1YZA A;  4C7O A;  2XS1 A;  4IAR A;  2F22 A;  4A2N B;  5DQT A;  2ZPA A;  2YZS A;  1U0B B;  1ZYR F;  1Z7Q c;  2BC5 A;  3LLI A;  1U89 A;  1YDI A;  1ZHW A;  2J7P A;  2VCC A;  1ZHZ A;  2KJG A;  1OCR C;  4UDV A;  1NZE A;  3RYL A;  1ZHT A;  2A68 F;  4PFO A;  4E7S A;  2AVK A;  4J32 B;  4FAP B;  1NG1 A;  1BR1 A;  2VC9 A;  3ITF A;  5B3I A;  2NG1 A;  3K7D A;  1O3U A;  1ZHY A;  4XPX A;  2HS5 A;  1C03 A;  3DM5 A;  4LLC A;  3N2Z B;  3DE9 A;  1GGQ A;  3EJN A;  3U3F A;  1Q0F A;  4JE9 A;  3V5Z A;  1R4T A;  1HY5 A;  2IXO A;  4H54 A;  3S0X A;  3TOM A;  4DRJ B;  2A6H F;  3LES A;  1EA8 A;  5KYU B;  5KYN A;  3CSK A;  3ZIB A;  3ZDL A;  4EBK A;  4XTK A;  2HJM A;  3L34 A;  2WVQ A;  3HNI A;  2IXM A;  1BBH A;  3E70 C;  2HZ8 A;  5JSL A;  4CIH A;  3C8G D;  3JCU Q;  4ULV A;  5CIV A;  4F4B A;  4MS2 A;  1QSP A;  2Q9C A;  2YL7 A;  1Q0G A;  3JYY A;  4JCH A;  4ER9 A;  1T6U A;  5F5H A;  3TQO A;  2HKV A;  3QW0 A;  2LIG A;  3L8J A;  3RQF A;  3W8H A;  1VK5 A;  4K0D A;  4EBJ A;  3LLK A;  3S9O A;  5IY5 C;  3SXM A;  3GAN A;  4HFK B;  3U8P A;  4MVU A;  2HUJ A;  4Q4Z F;  4DBQ A;  1V54 C;  4KI2 A;  1RKC A;  1PD1 A;  4EUK B;  2XLH A;  1DOW A;  1E86 A;  2DI3 A;  3ATP A;  4NQF A;  1TWG A;  3M4B A;  2J45 A;  3AG1 C;  4O79 A;  2YQY A;  4U5D E;  1T5O A;  2ETS A;  2W4B A;  1OKK D;  2R02 A;  1ZVZ A;  1TFO B;  4GQH A;  3ECS A;  3WG7 C;  1YVI A;  2Q3T A;  3MFN A;  4XEF A;  1W2W A;  2XXA A;  1A7D A;  1HE1 A;  3EH1 A;  2IBF A;  3GEH A;  1MND A;  1PV3 A;  3EGX B;  1OKK A;  1Y4C A;  2A6E F;  1XZQ A;  3EGD B;  2J9W A;  2XLW A;  4ULW A;  2I8B A;  4J7T A;  3R7C A;  1JR8 A;  2P61 A;  5BUO A;  2M64 A;  3Q6M A;  3JRT A;  5L0I A;  1YAR O;  1VLS A;  2EPM X;  1PCX A;  4PJL A;  4BG0 A;  1ST6 A;  1HW2 A;  3FHD A;  3DD7 A;  3MYF A;  5AGF A;  1APC A;  4H4K C;  4JTC B;  2EIJ C;  4OIO F;  1K05 A;  3LS1 A;  3PCV A;  4MVZ A;  4DVY P;  3AG3 C;  2GA0 A;  3B0U X;  2R7V A;  3K33 A;  4YL0 A;  1E85 A;  3UGO A;  3K1I A;  3RH3 A;  3IQ6 A;  2HJ3 A;  2XRH A;  3V7O A;  1CGO A;  1LS1 A;  3HNL A;  4U5B E;  3WAQ A;  5L0G A;  5KYW B;  3K1I C;  2VH3 A;  4JVS A;  3DKA A;  3W4Y A;  2J9V A;  1YAU O;  3JT1 A;  1GM5 A;  3G50 A;  1YZC A;  4NTA A;  3L0I A;  2M4E A;  2WVO A;  3LJB A;  3TUL A;  4QI2 A;  2G3V A;  4G7H F;  4N06 A;  4IB4 A;  4C3E A;  1FNT c;  3JTL O;  3ASN C;  4O6M A;  2Y3D A;  4CS7 A;  2ZXO A;  3PHF 2;  4PK4 A;  3S84 A;  1E83 A;  3DM9 B;  1M56 C;  2XS8 A;  1K04 A;  1WOL A;  2P7V A;  4U9D A;  2MHR A;  2W45 A;  2LCH A;  1FFH A;  2YWA A;  3NYM A;  4X0R A;  1T9K A;  1BR4 A;  1SF8 A;  4E0I A;  1WN0 A;  3EQL F;  2IYL D;  5COG A;  5DS5 A;  4AE4 A;  3DXJ F;  4JEA A;  1JPN A;  1HE9 A;  1VYK A;  1LS4 A;  1YA9 A;  4HEA J;  2KC3 A;  4AE4 B;  3Q6N A;  1BR2 A;  1H9T A;  3RW0 A;  3SYN A;  1OXB A;  1ORS C;  2XLV A;  3RKO F;  2WVN A;  5E3C A;  2XL4 A;  2P1A A;  3FXH A;  3ZTZ A;  1D1B A;  3GWL A;  1VTM P;  3DAG A;  4P9T A;  4PR9 A;  1M2V A;  2R05 A;  2KNH A;  1D0X A;  3UNG C;  5COF A;  1OR2 A;  4I3M A;  3VAY A;  2YHS A;  1FAP B;  2LQG A;  2PNO A;  3JRM O;  2QUP A;  2QNL A;  3G4Z A;  4YT4 A;  2CNW D;  1E84 A;  4LDQ A;  3EFO A;  5JP7 A;  2D4U A;  2JD3 A;  4BPM A;  3TJ5 A;  3X1O A;  2LK4 A;  1B68 A;  3T4R A;  2PX0 A;  4FES A;  1HMO A;  3AGU A;  3A9C A;  2MWQ A;  5E2Q A;  2Q00 A;  1IZM A;  4BJT A;  4EWC A;  3NDB B;  3MLG A;  4NTB A;  4D4N A;  2CNW A;  2R7U A;  1RMV A;  4WGZ A;  4C3B A;  2EIK C;  4OD5 A;  1LIH A;  2MYS A;  3DMD A;  3NKD A;  2L6G A;  3FMS A;  5D92 A;  3NG1 A;  2NSF A;  3N0T A;  4CS8 C;  1VYI A;  1WGW A;  2OEV A;  3LAY A;  5KYY B;  1G5Z A;  3U2L A;  2B0H A;  4CDY A;  3AQB A;  2FAP B;  3IQT A;  4U5C E;  3EHN A;  2OU6 A;  1M57 C;  4E18 A;  1I4Z A;  2OCC C;  2QLA A;  2X51 A;  5E33 A;  1Z23 A;  5DS4 A;  1OXK A;  5DS6 A;  4C7O B;  1SMY F;  1Z5Z A;  4IGG A;  1CPR A;  1ZW3 A;  2HSB A;  3L8I A;  2R03 A;  4MW8 A;  5COM A;  1A41 A;  3NKE A;  3KL4 A;  3O39 A;  2CCY A;  1RXQ A;  5A69 A;  3GM2 A;  3LNR A;  3U9J A;  1QKR A;  4XPY A;  1MQV A;  3RQG A;  1BDJ B;  1V55 C;  2GWW A;  2OEX A;  5KYU A;  3OEO A;  4P6I C;  2WL8 A;  2EPN A;  3WHN A;  4C3D A;  1FMV A;  2B0J A;  2J46 A;  4E0H A;  2W4M A;  3AOU A;  2LFD A;  3S90 A;  3T6B A;  2AP3 A;  4JIO A;  3RFY A;  5JS5 A;  3GM1 A;  3POV A;  2I15 A;  3N24 A;  4I1O B;  2KQ9 A;  4DBR A;  1QPU A;  4U9E A;  3A11 A;  4JJF A;  5BQH A;  5E3A A;  4J30 B;  4BJ6 C;  4U5F E;  1EI7 A;  4YT2 A;  2H8A A;  3KMI A;  5JT4 A;  2YLG A;  3J06 A;  3C18 A;  1J8Y F;  1WAS A;  3I5P A;  3EG9 B;  1M6T A;  2NSG A;  5T3W A;  2OOC A;  2IXN A;  5AC5 A;  2E87 A;  1S7Z A;  3B9Q A;  2YL1 A;  5DLJ A;  1JAF A;  4L6R A;  1AUE A;  1I5N A;  2LD6 A;  1L7C A;  3DE8 A;  2XL8 A;  2XLO A;  4QDL A;  1V74 B;  3LS0 A;  2GDC A;  3SEO A;  1UFB A;  1E2X A;  1S05 A;  3U8V A;  4IWB A;  2XL6 A;  2NUP A; 
#chains in the Genus database with same CATH homology
 2WZG A;  4BJ5 C;  3EGX A;  3S28 A;  4IJJ A;  5HSW A;  3EGD A;  3B0V C;  1TWA A;  4IRU A;  2NUP B;  2VAS A;  3UMI A;  4IAO A;  4KNV A;  4I1M A;  2Y3B A;  2R7Q A;  5B1B C;  2LSE A;  4YWQ A;  5KYW A;  1Z63 A;  3K6B A;  1D0Y A;  3DAF A;  4XWJ A;  3EZI A;  4OIR F;  2H7V C;  5D91 A;  2D5R B;  2H7B A;  3FDQ A;  1FFT C;  1O5H A;  3TD7 A;  3F47 A;  5B1A C;  4G0H A;  3AG4 C;  2VB6 A;  1OCZ C;  2EIN C;  1MMA A;  4Q7C A;  1OCO C;  2CW0 F;  5T1D B;  4CSA C;  2ZXR A;  1QZX A;  2HV6 A;  4G7O F;  1FTS A;  1TR2 A;  2GFH A;  5F5F A;  2EIM C;  3Q7G A;  2V3C C;  3F46 A;  2YEV A;  3QZC A;  3KKB A;  2C03 A;  3M1C B;  4JUR I;  2Y39 A;  3UMH A;  3CQZ A;  4PFP A;  3E9V A;  1VOM A;  2PP4 A;  3I5Q A;  3S29 A;  2J0X A;  4I44 A;  5CI8 A;  4ZLD A;  4Q5S F;  2OG2 A;  1IW7 F;  3CZ6 A;  4RBN A;  1JPJ A;  4YT5 A;  4B6I A;  5EHH A;  3K1H A;  1J8M F;  2L9J A;  1D0Z A;  4GYT A;  4CS8 A;  3ZG1 A;  5KYY A;  1ZHX A;  3HLZ A;  3RIP A;  4LLE A;  3W2V A;  4ANJ A;  2W9Y A;  3SZR A;  3WOD F;  1MMN A;  4XLN F;  2PFD A;  4PJM A;  3UMK A;  2R7W A;  1MMD A;  2IXP A;  3NYL A;  1OCC C;  4U5G A;  4W8K A;  2G62 A;  5DQZ A;  1ZU4 A;  3QMK A;  1LVK A;  1RJ9 A;  3HTK C;  3KH2 A;  4O7G A;  4YN0 B;  1SZI A;  2IOQ A;  4OIN F;  3FAJ A;  1RJ9 B;  4FWV A;  4XLP F;  3EPV A;  5T3T A;  2H7O A;  3EHM A;  3MX3 A;  4RD9 A;  1ZU5 A;  1TWH A;  4Q4Z F;  3OWT A;  5B3S C;  2DGJ A;  1D1C A;  2R7X A;  1VMA A;  4C7O B;  2R7R A;  3ZVR A;  2CDQ A;  4QI0 A;  4BJ6 A;  4KBL A;  3ZSU A;  3I4U A;  3EG9 A;  2J9U A;  3OA1 A;  2QTV A;  3ABM C;  3HJC A;  3DJN B;  3K66 A;  1D1A A;  3EH2 A;  2ZXP A;  1G8X A;  2NUT A;  2DYR C;  4CS9 A;  3ZC4 A;  4GEH A;  5L3V A;  2EIL C;  2DYS C;  2NUT B;  4CS9 C;  4YJW A;  4BEJ A;  2A69 F;  2C04 A;  2R7S A;  2Q9B A;  5DVW A;  4DOZ A;  3W8I A;  4AX2 A;  2WZF A;  5KYX A;  4BJ5 A;  1LKX A;  2CGE A;  4YT8 A;  3DJU B;  2Z15 A;  2G3K A;  5KYX B;  1MMG A;  4HE8 D;  1N1C A;  4KNW A;  3ABL C;  3NYJ A;  4WJ0 A;  2BE5 F;  4OD4 A;  4JW1 A;  3ABK C;  4O6N A;  4LAC B;  1Z6A A;  1KU2 A;  1PD0 A;  4JJG A;  2A1D D;  4CBE A;  3FVY A;  2KW3 C;  2Q9A A;  1QLE C;  2QY9 A;  1FMW A;  2V26 A;  5CI9 A;  2FFH A;  2XXA B;  3UR3 C;  3UGP A;  4BJ1 A;  3IEE A;  4CSA A;  2XSE A;  4K7B A;  5EGY A;  2WZL A;  2O9X A;  3B0P A;  2ZXW C;  4U5H A;  2PX3 A;  1NU7 D;  4RDA A;  4FX5 A;  2Y69 C;  3X2Q C;  3JSZ A;  3LEV A;  3SP1 A;  3W2W A;  2PF4 E;  2Y3G A;  4G7Z F;  4M63 A;  3DZA A;  4OIQ F;  4KC9 A;  4PJJ A;  2FGY A;  3AQC A;  3T6J A;  3SNH A;  4NY3 A;  4LER A;  1O87 A;  4OIP F;  4MND A;  3JYH A;  2KGO A;  3PMR A;  2J0W A;  1TWC A;  1MNE A;  5FCL A;  1TKN A;  3NRH A;  4O6Y A;  4DVZ A;  2L81 A;  1Z3I X;  2HV7 A;  5L3Q A;  4AK9 A;  4MQ9 F;  1M2O A;  4ZLC A;  4PJN A;  1M2V B;  4JZA A;  4E7Z A;  3GOD A;  3VYW A;  4HFF B;  3ASO C;  3Q7L A;  3EZH A;  3O6X A;  4U5E E;  2Y3H A;  3S27 A;  2WB7 A;  3AG2 C;  3EFO B;  3H65 A;  2P6V A;  2R7O A;  2J7P D;  1NU9 C;  4EBB A;  4C7O A;  4A2N B;  5DQT A;  2ZPA A;  2YZS A;  1ZYR F;  3LLI A;  2J7P A;  1ZHW A;  1ZHZ A;  2KJG A;  1OCR C;  1NZE A;  3RYL A;  1ZHT A;  2A68 F;  4PFO A;  4E7S A;  4J32 B;  1NG1 A;  1BR1 A;  3ITF A;  2NG1 A;  3K7D A;  1ZHY A;  3DM5 A;  4LLC A;  3N2Z B;  3EJN A;  3S0X A;  2IXO A;  2A6H F;  3LES A;  5KYU B;  5KYN A;  3CSK A;  3ZIB A;  4XTK A;  3L34 A;  2WVQ A;  2IXM A;  3E70 C;  4CIH A;  3JCU Q;  4F4B A;  2Q9C A;  4JCH A;  5F5H A;  3W8H A;  1VK5 A;  4K0D A;  3LLK A;  5IY5 C;  3GAN A;  4HFK B;  4DBQ A;  1V54 C;  4KI2 A;  1PD1 A;  1TWG A;  4O79 A;  2J45 A;  3AG1 C;  4U5D E;  2W4B A;  1OKK D;  3ECS A;  3WG7 C;  2Q3T A;  1W2W A;  2XXA A;  3EH1 A;  1MND A;  3EGX B;  1OKK A;  2A6E F;  3EGD B;  2J9W A;  4ULW A;  2I8B A;  5BUO A;  3Q6M A;  3JRT A;  1PCX A;  4PJL A;  4BG0 A;  1ST6 A;  3FHD A;  3DD7 A;  4H4K C;  4OIO F;  2EIJ C;  3LS1 A;  4DVY P;  3AG3 C;  3B0U X;  2R7V A;  3K33 A;  3UGO A;  3RH3 A;  3V7O A;  2XRH A;  5KYW B;  2R7T A;  1LS1 A;  4U5B E;  3K1I C;  2VH3 A;  4JVS A;  2J9V A;  3JT1 A;  3L0I A;  3LJB A;  2WVO A;  2M4E A;  4QI2 A;  2G3V A;  4G7H F;  4N06 A;  4C3E A;  3ASN C;  4O6M A;  2Y3D A;  4CS7 A;  2ZXO A;  3PHF 2;  4PK4 A;  3DM9 B;  1M56 C;  2P7V A;  2W45 A;  1FFH A;  3NYM A;  4X0R A;  1BR4 A;  1SF8 A;  3EQL F;  2IYL D;  5DS5 A;  4AE4 A;  3DXJ F;  1JPN A;  1VYK A;  4HEA J;  4AE4 B;  3Q6N A;  1BR2 A;  3SYN A;  3RKO F;  2WVN A;  5E3C A;  2XL4 A;  1D1B A;  3DAG A;  1M2V A;  3UNG C;  2KNH A;  1D0X A;  4I3M A;  3VAY A;  2YHS A;  4YT4 A;  2CNW D;  3EFO A;  2JD3 A;  3X1O A;  3T4R A;  2PX0 A;  4FES A;  2MWQ A;  5E2Q A;  1IZM A;  4BJT A;  4EWC A;  3NDB B;  3MLG A;  2CNW A;  2R7U A;  4C3B A;  2EIK C;  4OD5 A;  2MYS A;  3DMD A;  3NKD A;  5D92 A;  4CS8 C;  3NG1 A;  3N0T A;  1VYI A;  1WGW A;  3LAY A;  5KYY B;  3AQB A;  4U5C E;  3EHN A;  1M57 C;  2OCC C;  2X51 A;  5E33 A;  5DS6 A;  1Z23 A;  5DS4 A;  1SMY F;  1Z5Z A;  3NKE A;  3KL4 A;  3O39 A;  3LNR A;  1V55 C;  5KYU A;  3OEO A;  4P6I C;  2WL8 A;  4C3D A;  1FMV A;  2B0J A;  2J46 A;  2W4M A;  3T6B A;  3RFY A;  3POV A;  3N24 A;  4I1O B;  2KQ9 A;  4DBR A;  4JJF A;  5E3A A;  4J30 B;  4BJ6 C;  4U5F E;  4YT2 A;  3KMI A;  1J8Y F;  3I5P A;  3EG9 B;  5T3W A;  2IXN A;  2E87 A;  1S7Z A;  3B9Q A;  5DLJ A;  4QDL A;  3LS0 A;  3SEO A;  4IWB A;  2NUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...