4O6YA

Crystal structure of cytochrome b561
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
210
structure length
210
Chain Sequence
PIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVFLGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILILGGFVILGVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable transmembrane ascorbate ferrireductase 2
publication title Structure and mechanism of a eukaryotic transmembrane ascorbate-dependent oxidoreductase
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 92
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 7.2.1.3: Ascorbate ferrireductase (transmembrane).
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4o6yA00
4O79A 4O6YA 4O7GA
chains in the Genus database with same CATH superfamily
2IM8A 3I5QA 1LM3B 1E2XA 5BQIA 4J30B 4JTAB 5CI8A 2WL8A 4U5GA 2LD6A 2YKZA 4I44A 3ZG1A 2Q9BA 2AVKA 5KYUA 3B0VC 5A6BD 1OW6A 2J0WA 2Y3BA 4KNWA 3FAPB 3JRTA 3TJ5A 4E0HA 256BA 4FAPB 2X51A 4KI2A 1ORJA 5AC4A 3MBGA 3ABLC 3SXYA 4Z9IA 1RJ9B 3L8JA 1MMNA 2ICWG 2HMQA 3H2UA 1W2WA 5B1AC 3S27A 4AL1A 4IAQA 1ZHXA 3SXMA 2EILC 4H54A 1YARO 1D1AA 1HE1A 1LVKA 2HKVA 1JAFA 2VH3A 1C02A 3N0TA 1YAUO 4C3EA 2FGYA 4M63A 4PJNA 3AGTA 1WGWA 4G7ZF 2JPUA 4ULWA 4EBJA 3EGXB 3DI5A 2YQYA 1XZQA 3S9OA 4PR9A 4DBRA 2J8WA 1OR2A 2A6HF 2JX0A 4O6YA 1D1BA 4AE4B 2OQMA 3NYJA 4OIPF 3PDMP 2FFHA 4IJJA 4PFPA 3KH2A 2IOQA 1NFOA 3NYLA 2KC3A 2WZLA 4OIOF 2GFHA 3AQCA 1YLMA 4JJFA 2CCYA 2AWYA 1NU9C 4MW3A 4B6IA 4BJ1A 4KBLA 2WZFA 3FAJA 2I15A 4LDQA 1G4WR 1T9KA 1ST6A 3JSEO 3PCVA 1HW1A 1LPEA 4LLEA 5GPGB 2B0HA 3RFYA 3U9MA 4K1OA 4OIRF 3T9OA 2XS8A 3M1CB 4DBQA 3ZTZA 1Q0FA 1V74B 2A68F 4IWBA 1VOMA 3LLIA 4I1OB 3RKOF 1DOWA 4CIPA 5KYWB 2Q4FA 3CQZA 1K40A 1NU7D 1QZXA 2W9YA 1F1MA 2Z15A 3VAYA 5A6BA 1S7ZA 1ZHWA 4NY3A 4Z9HA 4CDVA 1WATA 3C18A 3HNLA 3NKDA 2DYRC 3U2LA 2IYLD 4FWVA 4YJWA 2WB7A 1Z3IX 1ZW3A 3GM2A 2C03A 3PMRA 3GM1A 1G8XA 2A0BA 2R9RB 3MFNA 3I4UA 4MVSA 2KK1A 4JCHA 2EIKC 3B71A 3T6BA 3DXJF 1R4TA 3S28A 1BDJB 2A1DD 3UNGC 5KYUB 3NDBB 3LNMB 5B1BC 1LE2A 4OINF 4MTGA 4BJ6A 4YWQA 2Q7RA 5DS5A 1RKCA 2OEXA 5KYXB 1H9TA 3V5YA 1VLSA 2KGOA 2YLGA 3QW1A 4LDKA 4MVMA 3RVZA 2P6VA 2XLWA 3KMIA 2V26A 3AGUA 3W4YA 1Q0GA 2ZD9A 1YYXA 4J7YA 1HE9A 3DE9A 3JYHA 1ZZPA 2TMVP 4IARA 1OCCC 3LEOA 3H65A 2J9VA 5DS4A 3DZAA 5L0FA 3TD7A 2QY9A 1RJ9A 3VRCA 3MLGA 3U2MA 3AG3C 4LDRA 3GM3A 3J06A 3K1IA 5DVWA 1A41A 1CPRA 1M2VA 1TWCA 3ZQVA 4ZLDA 2LP4A 1TWGA 5JRAA 5JVEA 2XLOA 1LE4A 5KYNA 3K1IC 3KYIA 3UR3C 3U0CA 4JW1A 2OCCC 4EWCA 4G78A 2EPLX 2HUJA 1Y6DA 3CEXA 3EH2A 1YJGA 3JYYA 2YRFA 3LNRA 2OEVA 3W2WA 4AE4A 1H6GA 4BJTA 2HJ3A 3C8GB 1APCA 2YL3A 1VYKA 3O55A 3DAGA 3RYLA 2XLHA 1JRAA 3TJ6A 3S84A 2LSEA 3KKBA 2UUHA 1QSPA 2C04A 2P7VA 1TQGA 1RMVA 3IHUA 4PJMA 3JSZA 1N1CA 4EUKB 4MW8A 2M64A 1Z63A 1YA9A 4Q4ZF 5BQGA 2AP3A 3U3BA 3RQGA 3EG9B 4MQ9F 4CJOA 3EGDB 5L0CA 1E86A 3LS1A 5T1DB 2W4BA 3SEOA 5KYYB 2HMZA 2W45A 1Z7Qc 3ASOC 2CNWD 4X0RA 5B3IA 1WOLA 3K7DA 2XM4A 3QMKA 3L1MA 2R7OA 1B68A 4XLNF 2L7AA 3WHNA 4BPMA 3C8GD 5JP7A 4CDAA 2HSBA 3NMKA 3HNIA 1I5NA 1JR8A 5COFA 3O39A 3UGOA 1EQ1A 1T6IA 3UGPA 1QLEC 3I5PA 3W2VA 1TWHA 3ATPA 5E3AA 1MNEA 4D4NA 1Q0KA 4QDLA 4O6MA 3RIPA 3WG7C 5L0GA 1A0BA 3R7CA 4CS8A 3DM9B 3AG4C 1BR4A 1KTMA 3A11A 1PD0A 4CSAC 2V3CC 3ZIBA 4GQHA 4IB4A 2H7VC 2B0JA 4L6RA 4E7SA 1ZHYA 4CS8C 3JT1A 2R02A 3VYWA 2EINC 2HFIA 3H2VA 2IXMA 3A9CA 2YVKA 3DAFA 4JRZA 2Q9AA 1KNYA 3T6JA 5KYXA 1LIHA 1SYQA 1AVOB 1T6QA 5E33A 1LS4A 4LACB 2Y3GA 2R7XA 1D1CA 3AJMA 4NTFA 4XPXA 2Y69C 3U5SA 2KNHA 1M2VB 4CJGA 2QE9A 3MYIA 1BZ4A 1SR2A 2Q9CA 2VCBA 4YL1A 4YK5A 5DQTA 2YEVA 5L3QA 2G3KA 3Q7GA 3EHNA 1MQVA 2IXPA 2WVQA 3EPVA 2NUTB 3GEHA 4XLPF 2XS1A 3HKKA 5T3TA 2EPOA 2O9XA 4JC7A 1CPQA 4DVYP 5HSWA 1FR0A 4E18A 3F47A 3L8IA 2G3VA 3VM6A 3LESA 2L81A 4JIOA 4JTDB 2ASRA 1J8MF 2CNWA 3EHMA 4WGZA 2XLDA 1SF8A 1OW7A 3NG1A 4MVQA 4U9EA 1T01A 1TFKB 1UFBA 2EIJC 3AQBA 3C8GA 3IQCA 3ZWIA 3F46A 3B0PA 4EKWA 5IY5C 1NLXA 3N24A 1RCPA 2W4MA 1GGQA 3SXZA 2XLMA 2ZXOA 4WABA 4NQFA 5EK0A 2G62A 4NTBA 5BUOA 2WZGA 3ABMC 3GORA 1NSGB 4XEKA 3ZVRA 3TOMA 3G50A 5L0DA 3DJUB 1C03A 3EG9A 4W8KA 3EGDA 2VASA 3LAYA 4E7ZA 5KYYA 3C7JA 4CS9A 4G7OF 3ZDLA 3ASNC 3IQ6A 2EPMX 5COMA 2LFDA 2J9WA 4ZLCA 3FOPA 4JJGA 4XPYA 4CS9C 1IW7F 3KL4A 4U5DE 2MHRA 3RVYA 3TULA 4DJ9A 2MYSA 3O6XA 2LIGA 3GEIA 2IXOA 2L6FA 5JSLA 3RH3A 2XRHA 2ZXRA 4IAOA 3JCUQ 3R2PA 1NBBA 3U3FA 2HV6A 1QVXA 1PCXA 2P0NA 4MVUA 5A69A 4P9FA 1FNTc 1EI7A 5D92A 4BJ6C 4FX5A 1ORYA 3AG1C 3IQTA 3NMIA 4QI2A 3JTLO 4RD9A 4YT5A 5DS6A 1WN0A 3BRJA 3RW0A 1ZYRF 4DOZA 4JEBA 1E85A 1Z23A 4IRUA 1HMDA 2Q00A 3V5ZA 4MNDA 4CS7A 2XLEA 2HJMA 4E17A 1KU2A 1UG7A 5F5HA 4BJ5A 1SZIA 4CBEA 4HEAJ 2XXAA 3OEOA 2OOCA 2OU6A 1CGME 4P9TA 2P1AA 1QPUA 1ZHTA 2NSFA 2XM0A 4O6NA 1ORSC 3LJBA 2YLIA 3O10A 5E2QA 4BJ5C 4BEMJ 4IGGA 1YA7O 2BC5A 3TOLA 2NUTA 3NRHA 1V4AA 5JLIA 1L3PA 4JEAA 5B3SC 2A69F 1FFHA 3Q7LA 3GEEA 2XLVA 2Q3TA 2R05A 1TKNA 1OXKA 1GS9A 2J7PD 4RDAA 4N06A 3SP1A 4CIHA 4NC3A 5EGYA 5L0JA 4UDVA 5K0IA 1PD1A 3N2ZB 2D5RB 3TK0A 1YDIA 2NSGA 2IXNA 3CAXA 4RBNA 1ZW2A 4N6CA 1SMYF 1Z5ZA 5E3CA 2GDCA 3US6A 2JD3A 2UUIA 3B9QA 3DKAA 4PK4A 2DGJA 1E83A 1Z6AA 4EBKA 1WWPA 4HE8D 3Q6NA 1OW8A 2QLAA 1G5ZA 4E0IA 4LLCA 1HMOA 1WASA 2HZ8A 3EZIA 3IQ5A 1FMVA 5F28E 1TR2A 1R5ID 3KPHA 3SYNA 1D0YA 3ZTMA 2A0UA 1CGOA 2HV7A 4DRIB 2I8BA 4Z9JA 1S05A 5A6JA 2H7OA 1D0ZA 3G4ZA 4U9DA 4PJLA 1OCRC 1ZU5A 3V7OA 1VB5A 4NCQA 4XTKA 2CW0F 3EJNA 1C17M 3NMJA 4JTCB 3RF3A 3W8HA 5L0HA 1OXBA 4YN0B 1CGNA 2OJQA 2F22A 3GANA 2DI3A 3BEHA 2NG1A 4ONSA 4U5BE 3RQEA 1H7IA 5A6KA 4ER9A 4D4XA 4XEFA 1OQCA 3E9VA 3QTHA 2AU5A 2CDQA 2CGEA 2R7SA 4A2NB 4DRHB 1A7VA 4I1MA 1BBHA 3WAQA 1V55C 3W8IA 3FOOA 3K66A 4HFFB 3SZRA 4KNVA 3QZCA 3K1HA 3QW0A 2X0CA 4XQ1A 1MNDA 2XXAB 2J7PA 1LKXA 4MTFA 4N4WA 4YT4A 4OIQF 1D0XA 1YVIA 4U5CE 4JCZA 4XEVA 5BQHA 3Q6MA 2NUPA 1O87A 3S29A 1DOVA 3IPMO 2LFFA 5EHHA 2R25A 4CSAA 1M2OA 2XL6A 5TJ5E 5CIVA 1Y4CA 2OJED 3DJNB 3DMDA 1YYJA 1VK5A 2YL7A 3UMKA 1EA8A 1LS1A 4J7TA 1M57C 1AEPA 3LUTB 1QKRA 2YZSA 3EH1A 3U8PA 4F4BA 3HLZA 2Y39A 2WVOA 3GODA 4AX2A 3LS0A 4YT2A 3KYJA 1HW2A 2J0XA 1T5OA 1XWJA 4Q5SF 4MTOA 2R7VA 2KQ9A 1RKEB 4MVRA 2GAQA 2ZPAA 4U5EE 2XSEA 4FESA 4JZAA 1ZU4A 4P6IC 1J8YF 4C3DA 3M4CA 5HV9A 1LI5A 4O79A 5FZTA 2PBEA 2QUPA 3DM5A 1H9GA 3SXKA 1K05A 4OD4A 1TWAA 1PV3A 2L6HA 3FHDA 3HNJA 2CYDA 4JVSA 4K0DA 1OKKD 5A6AA 3ABKC 4ANJA 1K04A 3GWNA 3T6GB 3EFOA 5AC5A 3ZSUA 3C8ZA 3HNKA 2R03A 4I3MA 5JS5A 1O5HA 2ETSA 2VB6A 1AUEA 3OA1A 2L6GA 2FAPB 2LCHA 4XPWA 1ZHZA 1JMWA 1Q0MA 2YL1A 4MS2A 3FMSA 1JPNA 2VC9A 3X2QC 1U0BB 4BG0A 1JOGA 5L0IA 3B29A 4N6HA 1E84A 2XL8A 1O3UA 3U8VA 4BEJA 4Q7CA 2P61A 5AGFA 5JT4A 3DWWA 2HSQA 2R7WA 2PP4A 2KJGA 4EBBA 3OWTA 2H8AA 3CZ6A 4A4AA 1T6UA 4GYTA 5L3VA 3L34A 1Q0DA 1BR1A 2DYSC 3JZ0A 2HS5A 4GEHA 3X1OA 4OD5A 4R32A 4WGYA 2KSFA 2Y3HA 2AWCA 2OG2A 2PF4E 1FFTC 2M4EA 1ZVZA 2RD9A 4MVZA 3UMIA 5T3WA 3NKEA 3VF0A 4AL0A 3PHF2 3GWLA 1A7DA 4PFOA 1RXQA 3FVYA 1TFOB 4O7GA 2ZXPA 2J46A 1I4ZA 3HTKC 4JKVA 1YZCA 3M79A 2BL2A 1FTSA 1XZPA 4C7OA 1MMDA 2NUPB 2VCAA 4H4KC 3G4XA 1NG1A 1L7CA 4YL3A 2DB4A 3EQLF 3T4RA 3C62A 2YLDA 2OKUA 3DE8A 3NYMA 1GM5A 1FMWA 3U9JA 2GWWA 3POVA 1OKKA 2XL4A 3ZC4A 3HJCA 2QNLA 2ZXWC 2GA0A 4C3BA 1MMGA 2LK4A 2Y3DA 3ECSA 2E87A 2J9BA 3QVZA 3AG2C 4DXWA 1WTYA 4EHPA 3FDQA 1VTMP 2J45A 4JE9A 1HY5A 4PACA 3RQFA 1I4YA 2YHSA 2R7QA 3E70C 1LI7A 1OCOC 5D91A 1U6HA 1OR3A 4K7BA 3UMHA 1RKEA 4YT8A 2R7UA 2D4UA 3EFOB 1YZAA 2LQGA 3C63A 3QVYA 1M56C 5CI9A 2PNOA 2R7TA 5JUAA 1U89A 4ULVA 2VCCA 3SNHA 3EGXA 3K33A 2PX0A 5F5FA 2L9JA 1BR2A 2EPKX 3MX3A 3S90A 1JPJA 3LEVA 3MYFA 1EKYA 1G4US 1GQAA 1NFNA 3DD7A 5COGA 1IZMA 5DLJA 1VLTA 3V5XA 2H7BA 4LERA 4XWJA 2EPNA 4C7OB 4CDYA 2A6EF 4QI0A 3IEEA 2J9UA 2BE5F 2YWAA 3LLKA 1V54C 4J32B 1NZEA 4DRJB 3L0IA 2PX3A 3EZHA 5DQZA 2R7RA 4G0HA 1OCZC 2YL0A 4KC9A 4W8PA 2IBFA 2WVNA 3ZQYA 4CX9A 1MMAA 4YL0A 3B0UX 2KYHA 3CSKA 4U5FE 4WJ0A 2KW3C 1A7EA 1FAPB 1QQ3A 3JRMO 5KYWA 4G7HF 1VYIA 4U5HA 3TQOA 3AOUA 2QTVA 4JURI 4HFKB 1M6TA 3M4BA 3M15A 2MWQA 4AK9A 4DVZA 2EIMC 4NTAA 1VMAA 3WODF 4PJJA 5FCLA 3K6BA 2RSEB 4EIYA 3S0XA 3ITFA 2NPUA 2PFDA 4MVOA 3FXHA
chains in the Genus database with same CATH topology
3I5QA 4J30B 5CI8A 2WL8A 4U5GA 3ZG1A 4I44A 2Q9BA 5KYUA 3B0VC 2J0WA 2Y3BA 4KNWA 3JRTA 2X51A 4KI2A 3ABLC 1RJ9B 1MMNA 5B1AC 3S27A 1W2WA 1ZHXA 2EILC 1D1AA 1LVKA 3N0TA 2VH3A 4C3EA 2FGYA 4M63A 4PJNA 4G7ZF 1WGWA 4ULWA 3EGXB 4DBRA 2A6HF 4O6YA 1D1BA 4AE4B 3NYJA 4OIPF 2FFHA 4IJJA 4PFPA 3KH2A 2IOQA 3NYLA 2WZLA 4OIOF 2GFHA 3AQCA 4JJFA 1NU9C 4B6IA 4BJ1A 4KBLA 2WZFA 3FAJA 1ST6A 4LLEA 3RFYA 4C7OA 4OIRF 4DBQA 3M1CB 2A68F 4IWBA 1VOMA 3LLIA 4I1OB 3RKOF 5KYWB 3CQZA 1NU7D 1QZXA 2W9YA 2Z15A 3VAYA 1S7ZA 1ZHWA 4NY3A 3NKDA 2DYRC 2IYLD 4FWVA 4YJWA 2WB7A 1Z3IX 2C03A 3PMRA 1G8XA 3I4UA 4JCHA 2EIKC 3FDQA 3T6BA 3DXJF 3S28A 2A1DD 3UNGC 5KYUB 3NDBB 5B1BC 4OINF 4YWQA 4BJ6A 5DS5A 5KYXB 2KGOA 2P6VA 3KMIA 2V26A 3JYHA 1OCCC 3H65A 2J9VA 5DS4A 3DZAA 3TD7A 2QY9A 1RJ9A 3MLGA 3AG3C 5DVWA 4ZLDA 1M2VA 1TWCA 1TWGA 5KYNA 3K1IC 3UR3C 4JW1A 2OCCC 4EWCA 3EH2A 3LNRA 3W2WA 4AE4A 4BJTA 3RYLA 1VYKA 3DAGA 2LSEA 3KKBA 2C04A 2P7VA 4PJMA 3JSZA 1N1CA 1Z63A 4Q4ZF 3EG9B 4MQ9F 3EGDB 3LS1A 5T1DB 2W4BA 3SEOA 5KYYB 2W45A 3ASOC 2CNWD 4X0RA 3K7DA 3QMKA 2R7OA 4XLNF 3O39A 3UGOA 3UGPA 1QLEC 3I5PA 3W2VA 1TWHA 5E3AA 1MNEA 4QDLA 4O6MA 3RIPA 3WG7C 4CS8A 3DM9B 3AG4C 1BR4A 1PD0A 2V3CC 3ZIBA 2H7VC 2B0JA 4E7SA 1ZHYA 4CS8C 3JT1A 3VYWA 2EINC 2IXMA 3DAFA 3T6JA 5KYXA 2Q9AA 5E33A 4LACB 2Y3GA 2R7XA 1D1CA 2Y69C 2KNHA 1M2VB 2Q9CA 5DQTA 2YEVA 5L3QA 2G3KA 3Q7GA 3EHNA 4XLPF 2IXPA 2WVQA 3EPVA 2NUTB 5T3TA 2O9XA 4DVYP 5HSWA 3F47A 2G3VA 3LESA 2L81A 1J8MF 2CNWA 3EHMA 1SF8A 3NG1A 2EIJC 3AQBA 3F46A 3B0PA 5IY5C 3N24A 2W4MA 2ZXOA 5BUOA 2G62A 2WZGA 3ABMC 3ZVRA 3DJUB 4W8KA 3EG9A 3EGDA 2VASA 3LAYA 4E7ZA 5KYYA 4CS9A 4G7OF 3ASNC 2J9WA 4ZLCA 4JJGA 4CS9C 1IW7F 3KL4A 4U5DE 2MYSA 3O6XA 2IXOA 3RH3A 2XRHA 2ZXRA 4IAOA 3JCUQ 2HV6A 1PCXA 5D92A 4BJ6C 4FX5A 3AG1C 4QI2A 4RD9A 5DS6A 4YT5A 4DOZA 1ZYRF 1Z23A 4IRUA 4MNDA 4CS7A 1KU2A 5F5HA 4BJ5A 1SZIA 4CBEA 4HEAJ 2XXAA 3OEOA 1ZHTA 4BJ5C 4O6NA 3LJBA 5E2QA 2NUTA 3NRHA 5B3SC 2A69F 1FFHA 3Q7LA 2Q3TA 4CIHA 1TKNA 3SP1A 2J7PD 4RDAA 4N06A 5EGYA 1PD1A 3N2ZB 2D5RB 2IXNA 4RBNA 5E3CA 1SMYF 1Z5ZA 2JD3A 3B9QA 4PK4A 2DGJA 1Z6AA 4HE8D 3Q6NA 4LLCA 3EZIA 1FMVA 1TR2A 3SYNA 1D0YA 2HV7A 2I8BA 2H7OA 1D0ZA 4PJLA 1OCRC 1ZU5A 3V7OA 4XTKA 2CW0F 3EJNA 3W8HA 4YN0B 3GANA 2NG1A 4U5BE 3E9VA 2CDQA 2CGEA 4A2NB 4I1MA 1V55C 3W8IA 3K66A 4HFFB 3SZRA 4KNVA 3QZCA 3K1HA 2XXAB 1MNDA 2J7PA 1LKXA 4YT4A 4OIQF 1D0XA 4U5CE 3Q6MA 2NUPA 1O87A 3S29A 5EHHA 4CSAA 1M2OA 3DJNB 3DMDA 4CSAC 1VK5A 3UMKA 1LS1A 1M57C 4F4BA 2YZSA 3EH1A 3HLZA 2Y39A 2WVOA 3GODA 4AX2A 3LS0A 4YT2A 2J0XA 4Q5SF 2R7VA 2KQ9A 2ZPAA 4U5EE 2XSEA 4FESA 4JZAA 1ZU4A 4P6IC 1J8YF 4C3DA 4O79A 3DM5A 4OD4A 1TWAA 3FHDA 4JVSA 4K0DA 1OKKD 3ABKC 4ANJA 3EFOA 3ZSUA 4I3MA 1O5HA 2VB6A 3OA1A 1ZHZA 1JPNA 3X2QC 4BG0A 4BEJA 4Q7CA 2R7WA 2PP4A 2KJGA 4EBBA 3OWTA 3CZ6A 4GYTA 5L3VA 3L34A 1BR1A 2DYSC 4GEHA 3X1OA 4OD5A 2Y3HA 2OG2A 2PF4E 1FFTC 2M4EA 3PHF2 3UMIA 5T3WA 3NKEA 4PFOA 3FVYA 4O7GA 2ZXPA 2J46A 3HTKC 1FTSA 1MMDA 2NUPB 4H4KC 1NG1A 3EQLF 3T4RA 3NYMA 1FMWA 3POVA 1OKKA 2XL4A 3ZC4A 3HJCA 2ZXWC 4C3BA 1MMGA 3ECSA 2Y3DA 2E87A 3AG2C 2J45A 2YHSA 3E70C 2R7QA 1OCOC 5D91A 4K7BA 3UMHA 4YT8A 2R7UA 3EFOB 1M56C 5CI9A 2R7TA 3SNHA 3EGXA 3K33A 2PX0A 5F5FA 2L9JA 1BR2A 3MX3A 1JPJA 3LEVA 3DD7A 1IZMA 5DLJA 2H7BA 4LERA 4XWJA 4C7OB 2A6EF 4QI0A 3IEEA 2J9UA 2BE5F 3LLKA 4J32B 1V54C 1NZEA 3L0IA 2PX3A 3EZHA 5DQZA 2R7RA 4G0HA 1OCZC 4KC9A 2WVNA 1MMAA 3B0UX 3CSKA 4U5FE 4WJ0A 2KW3C 5KYWA 4G7HF 1VYIA 4U5HA 4JURI 2QTVA 4HFKB 2MWQA 4AK9A 4DVZA 2EIMC 1VMAA 3WODF 4PJJA 5FCLA 3K6BA 3S0XA 3ITFA 2PFDA 2R7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O79 A;  4O6Y A;  4O7G A; 
#chains in the Genus database with same CATH topology
 2IM8 A;  3I5Q A;  1LM3 B;  1E2X A;  5BQI A;  4J30 B;  4JTA B;  5CI8 A;  2WL8 A;  4U5G A;  2LD6 A;  2YKZ A;  4I44 A;  3ZG1 A;  2Q9B A;  2AVK A;  5KYU A;  3B0V C;  5A6B D;  1OW6 A;  2J0W A;  2Y3B A;  4KNW A;  3FAP B;  3JRT A;  3TJ5 A;  4E0H A;  256B A;  4FAP B;  2X51 A;  4KI2 A;  1ORJ A;  5AC4 A;  3MBG A;  3ABL C;  3SXY A;  4Z9I A;  1RJ9 B;  3L8J A;  1MMN A;  2ICW G;  2HMQ A;  3H2U A;  1W2W A;  5B1A C;  3S27 A;  4AL1 A;  4IAQ A;  1ZHX A;  3SXM A;  2EIL C;  4H54 A;  1YAR O;  1D1A A;  1HE1 A;  1LVK A;  2HKV A;  1JAF A;  2VH3 A;  1C02 A;  3N0T A;  1YAU O;  4C3E A;  2FGY A;  4M63 A;  4PJN A;  3AGT A;  1WGW A;  4G7Z F;  2JPU A;  4ULW A;  4EBJ A;  3EGX B;  3DI5 A;  2YQY A;  1XZQ A;  3S9O A;  4PR9 A;  4DBR A;  2J8W A;  1OR2 A;  2A6H F;  2JX0 A;  4O6Y A;  1D1B A;  4AE4 B;  2OQM A;  3NYJ A;  4OIP F;  3PDM P;  2FFH A;  4IJJ A;  4PFP A;  3KH2 A;  2IOQ A;  1NFO A;  3NYL A;  2KC3 A;  2WZL A;  4OIO F;  2GFH A;  3AQC A;  1YLM A;  4JJF A;  2CCY A;  2AWY A;  1NU9 C;  4MW3 A;  4B6I A;  4BJ1 A;  4KBL A;  2WZF A;  3FAJ A;  2I15 A;  4LDQ A;  1G4W R;  1T9K A;  1ST6 A;  3JSE O;  3PCV A;  1HW1 A;  1LPE A;  4LLE A;  5GPG B;  2B0H A;  3RFY A;  3U9M A;  4K1O A;  4OIR F;  3T9O A;  2XS8 A;  3M1C B;  4DBQ A;  3ZTZ A;  1Q0F A;  1V74 B;  2A68 F;  4IWB A;  1VOM A;  3LLI A;  4I1O B;  3RKO F;  1DOW A;  4CIP A;  5KYW B;  2Q4F A;  3CQZ A;  1K40 A;  1NU7 D;  1QZX A;  2W9Y A;  1F1M A;  2Z15 A;  3VAY A;  5A6B A;  1S7Z A;  1ZHW A;  4NY3 A;  4Z9H A;  4CDV A;  1WAT A;  3C18 A;  3HNL A;  3NKD A;  2DYR C;  3U2L A;  2IYL D;  4FWV A;  4YJW A;  2WB7 A;  1Z3I X;  1ZW3 A;  3GM2 A;  2C03 A;  3PMR A;  3GM1 A;  1G8X A;  2A0B A;  2R9R B;  3MFN A;  3I4U A;  4MVS A;  2KK1 A;  4JCH A;  2EIK C;  3B71 A;  3T6B A;  3DXJ F;  1R4T A;  3S28 A;  1BDJ B;  2A1D D;  3UNG C;  5KYU B;  3NDB B;  3LNM B;  5B1B C;  1LE2 A;  4OIN F;  4MTG A;  4BJ6 A;  4YWQ A;  2Q7R A;  5DS5 A;  1RKC A;  2OEX A;  5KYX B;  1H9T A;  3V5Y A;  1VLS A;  2KGO A;  2YLG A;  3QW1 A;  4LDK A;  4MVM A;  3RVZ A;  2P6V A;  2XLW A;  3KMI A;  2V26 A;  3AGU A;  3W4Y A;  1Q0G A;  2ZD9 A;  1YYX A;  4J7Y A;  1HE9 A;  3DE9 A;  3JYH A;  1ZZP A;  2TMV P;  4IAR A;  1OCC C;  3LEO A;  3H65 A;  2J9V A;  5DS4 A;  3DZA A;  5L0F A;  3TD7 A;  2QY9 A;  1RJ9 A;  3VRC A;  3MLG A;  3U2M A;  3AG3 C;  4LDR A;  3GM3 A;  3J06 A;  3K1I A;  5DVW A;  1A41 A;  1CPR A;  1M2V A;  1TWC A;  3ZQV A;  4ZLD A;  2LP4 A;  1TWG A;  5JRA A;  5JVE A;  2XLO A;  1LE4 A;  5KYN A;  3K1I C;  3KYI A;  3UR3 C;  3U0C A;  4JW1 A;  2OCC C;  4EWC A;  4G78 A;  2EPL X;  2HUJ A;  1Y6D A;  3CEX A;  3EH2 A;  1YJG A;  3JYY A;  2YRF A;  3LNR A;  2OEV A;  3W2W A;  4AE4 A;  1H6G A;  4BJT A;  2HJ3 A;  3C8G B;  1APC A;  2YL3 A;  1VYK A;  3O55 A;  3DAG A;  3RYL A;  2XLH A;  1JRA A;  3TJ6 A;  3S84 A;  2LSE A;  3KKB A;  2UUH A;  1QSP A;  2C04 A;  2P7V A;  1TQG A;  1RMV A;  3IHU A;  4PJM A;  3JSZ A;  1N1C A;  4EUK B;  4MW8 A;  2M64 A;  1Z63 A;  1YA9 A;  4Q4Z F;  5BQG A;  2AP3 A;  3U3B A;  3RQG A;  3EG9 B;  4MQ9 F;  4CJO A;  3EGD B;  5L0C A;  1E86 A;  3LS1 A;  5T1D B;  2W4B A;  3SEO A;  5KYY B;  2HMZ A;  2W45 A;  1Z7Q c;  3ASO C;  2CNW D;  4X0R A;  5B3I A;  1WOL A;  3K7D A;  2XM4 A;  3QMK A;  3L1M A;  2R7O A;  1B68 A;  4XLN F;  2L7A A;  3WHN A;  4BPM A;  3C8G D;  5JP7 A;  4CDA A;  2HSB A;  3NMK A;  3HNI A;  1I5N A;  1JR8 A;  5COF A;  3O39 A;  3UGO A;  1EQ1 A;  1T6I A;  3UGP A;  1QLE C;  3I5P A;  3W2V A;  1TWH A;  3ATP A;  5E3A A;  1MNE A;  4D4N A;  1Q0K A;  4QDL A;  4O6M A;  3RIP A;  3WG7 C;  5L0G A;  1A0B A;  3R7C A;  4CS8 A;  3DM9 B;  3AG4 C;  1BR4 A;  1KTM A;  3A11 A;  1PD0 A;  4CSA C;  2V3C C;  3ZIB A;  4GQH A;  4IB4 A;  2H7V C;  2B0J A;  4L6R A;  4E7S A;  1ZHY A;  4CS8 C;  3JT1 A;  2R02 A;  3VYW A;  2EIN C;  2HFI A;  3H2V A;  2IXM A;  3A9C A;  2YVK A;  3DAF A;  4JRZ A;  2Q9A A;  1KNY A;  3T6J A;  5KYX A;  1LIH A;  1SYQ A;  1AVO B;  1T6Q A;  5E33 A;  1LS4 A;  4LAC B;  2Y3G A;  2R7X A;  1D1C A;  3AJM A;  4NTF A;  4XPX A;  2Y69 C;  3U5S A;  2KNH A;  1M2V B;  4CJG A;  2QE9 A;  3MYI A;  1BZ4 A;  1SR2 A;  2Q9C A;  2VCB A;  4YL1 A;  4YK5 A;  5DQT A;  2YEV A;  5L3Q A;  2G3K A;  3Q7G A;  3EHN A;  1MQV A;  2IXP A;  2WVQ A;  3EPV A;  2NUT B;  3GEH A;  4XLP F;  2XS1 A;  3HKK A;  5T3T A;  2EPO A;  2O9X A;  4JC7 A;  1CPQ A;  4DVY P;  5HSW A;  1FR0 A;  4E18 A;  3F47 A;  3L8I A;  2G3V A;  3VM6 A;  3LES A;  2L81 A;  4JIO A;  4JTD B;  2ASR A;  1J8M F;  2CNW A;  3EHM A;  4WGZ A;  2XLD A;  1SF8 A;  1OW7 A;  3NG1 A;  4MVQ A;  4U9E A;  1T01 A;  1TFK B;  1UFB A;  2EIJ C;  3AQB A;  3C8G A;  3IQC A;  3ZWI A;  3F46 A;  3B0P A;  4EKW A;  5IY5 C;  1NLX A;  3N24 A;  1RCP A;  2W4M A;  1GGQ A;  3SXZ A;  2XLM A;  2ZXO A;  4WAB A;  4NQF A;  5EK0 A;  2G62 A;  4NTB A;  5BUO A;  2WZG A;  3ABM C;  3GOR A;  1NSG B;  4XEK A;  3ZVR A;  3TOM A;  3G50 A;  5L0D A;  3DJU B;  1C03 A;  3EG9 A;  4W8K A;  3EGD A;  2VAS A;  3LAY A;  4E7Z A;  5KYY A;  3C7J A;  4CS9 A;  4G7O F;  3ZDL A;  3ASN C;  3IQ6 A;  2EPM X;  5COM A;  2LFD A;  2J9W A;  4ZLC A;  3FOP A;  4JJG A;  4XPY A;  4CS9 C;  1IW7 F;  3KL4 A;  4U5D E;  2MHR A;  3RVY A;  3TUL A;  4DJ9 A;  2MYS A;  3O6X A;  2LIG A;  3GEI A;  2IXO A;  2L6F A;  5JSL A;  3RH3 A;  2XRH A;  2ZXR A;  4IAO A;  3JCU Q;  3R2P A;  1NBB A;  3U3F A;  2HV6 A;  1QVX A;  1PCX A;  2P0N A;  4MVU A;  5A69 A;  4P9F A;  1FNT c;  1EI7 A;  5D92 A;  4BJ6 C;  4FX5 A;  1ORY A;  3AG1 C;  3IQT A;  3NMI A;  4QI2 A;  3JTL O;  4RD9 A;  4YT5 A;  5DS6 A;  1WN0 A;  3BRJ A;  3RW0 A;  1ZYR F;  4DOZ A;  4JEB A;  1E85 A;  1Z23 A;  4IRU A;  1HMD A;  2Q00 A;  3V5Z A;  4MND A;  4CS7 A;  2XLE A;  2HJM A;  4E17 A;  1KU2 A;  1UG7 A;  5F5H A;  4BJ5 A;  1SZI A;  4CBE A;  4HEA J;  2XXA A;  3OEO A;  2OOC A;  2OU6 A;  1CGM E;  4P9T A;  2P1A A;  1QPU A;  1ZHT A;  2NSF A;  2XM0 A;  4O6N A;  1ORS C;  3LJB A;  2YLI A;  3O10 A;  5E2Q A;  4BJ5 C;  4BEM J;  4IGG A;  1YA7 O;  2BC5 A;  3TOL A;  2NUT A;  3NRH A;  1V4A A;  5JLI A;  1L3P A;  4JEA A;  5B3S C;  2A69 F;  1FFH A;  3Q7L A;  3GEE A;  2XLV A;  2Q3T A;  2R05 A;  1TKN A;  1OXK A;  1GS9 A;  2J7P D;  4RDA A;  4N06 A;  3SP1 A;  4CIH A;  4NC3 A;  5EGY A;  5L0J A;  4UDV A;  5K0I A;  1PD1 A;  3N2Z B;  2D5R B;  3TK0 A;  1YDI A;  2NSG A;  2IXN A;  3CAX A;  4RBN A;  1ZW2 A;  4N6C A;  1SMY F;  1Z5Z A;  5E3C A;  2GDC A;  3US6 A;  2JD3 A;  2UUI A;  3B9Q A;  3DKA A;  4PK4 A;  2DGJ A;  1E83 A;  1Z6A A;  4EBK A;  1WWP A;  4HE8 D;  3Q6N A;  1OW8 A;  2QLA A;  1G5Z A;  4E0I A;  4LLC A;  1HMO A;  1WAS A;  2HZ8 A;  3EZI A;  3IQ5 A;  1FMV A;  5F28 E;  1TR2 A;  1R5I D;  3KPH A;  3SYN A;  1D0Y A;  3ZTM A;  2A0U A;  1CGO A;  2HV7 A;  4DRI B;  2I8B A;  4Z9J A;  1S05 A;  5A6J A;  2H7O A;  1D0Z A;  3G4Z A;  4U9D A;  4PJL A;  1OCR C;  1ZU5 A;  3V7O A;  1VB5 A;  4NCQ A;  4XTK A;  2CW0 F;  3EJN A;  1C17 M;  3NMJ A;  4JTC B;  3RF3 A;  3W8H A;  5L0H A;  1OXB A;  4YN0 B;  1CGN A;  2OJQ A;  2F22 A;  3GAN A;  2DI3 A;  3BEH A;  2NG1 A;  4ONS A;  4U5B E;  3RQE A;  1H7I A;  5A6K A;  4ER9 A;  4D4X A;  4XEF A;  1OQC A;  3E9V A;  3QTH A;  2AU5 A;  2CDQ A;  2CGE A;  2R7S A;  4A2N B;  4DRH B;  1A7V A;  4I1M A;  1BBH A;  3WAQ A;  1V55 C;  3W8I A;  3FOO A;  3K66 A;  4HFF B;  3SZR A;  4KNV A;  3QZC A;  3K1H A;  3QW0 A;  2X0C A;  4XQ1 A;  1MND A;  2XXA B;  2J7P A;  1LKX A;  4MTF A;  4N4W A;  4YT4 A;  4OIQ F;  1D0X A;  1YVI A;  4U5C E;  4JCZ A;  4XEV A;  5BQH A;  3Q6M A;  2NUP A;  1O87 A;  3S29 A;  1DOV A;  3IPM O;  2LFF A;  5EHH A;  2R25 A;  4CSA A;  1M2O A;  2XL6 A;  5TJ5 E;  5CIV A;  1Y4C A;  2OJE D;  3DJN B;  3DMD A;  1YYJ A;  1VK5 A;  2YL7 A;  3UMK A;  1EA8 A;  1LS1 A;  4J7T A;  1M57 C;  1AEP A;  3LUT B;  1QKR A;  2YZS A;  3EH1 A;  3U8P A;  4F4B A;  3HLZ A;  2Y39 A;  2WVO A;  3GOD A;  4AX2 A;  3LS0 A;  4YT2 A;  3KYJ A;  1HW2 A;  2J0X A;  1T5O A;  1XWJ A;  4Q5S F;  4MTO A;  2R7V A;  2KQ9 A;  1RKE B;  4MVR A;  2GAQ A;  2ZPA A;  4U5E E;  2XSE A;  4FES A;  4JZA A;  1ZU4 A;  4P6I C;  1J8Y F;  4C3D A;  3M4C A;  5HV9 A;  1LI5 A;  4O79 A;  5FZT A;  2PBE A;  2QUP A;  3DM5 A;  1H9G A;  3SXK A;  1K05 A;  4OD4 A;  1TWA A;  1PV3 A;  2L6H A;  3FHD A;  3HNJ A;  2CYD A;  4JVS A;  4K0D A;  1OKK D;  5A6A A;  3ABK C;  4ANJ A;  1K04 A;  3GWN A;  3T6G B;  3EFO A;  5AC5 A;  3ZSU A;  3C8Z A;  3HNK A;  2R03 A;  4I3M A;  5JS5 A;  1O5H A;  2ETS A;  2VB6 A;  1AUE A;  3OA1 A;  2L6G A;  2FAP B;  2LCH A;  4XPW A;  1ZHZ A;  1JMW A;  1Q0M A;  2YL1 A;  4MS2 A;  3FMS A;  1JPN A;  2VC9 A;  3X2Q C;  1U0B B;  4BG0 A;  1JOG A;  5L0I A;  3B29 A;  4N6H A;  1E84 A;  2XL8 A;  1O3U A;  3U8V A;  4BEJ A;  4Q7C A;  2P61 A;  5AGF A;  5JT4 A;  3DWW A;  2HSQ A;  2R7W A;  2PP4 A;  2KJG A;  4EBB A;  3OWT A;  2H8A A;  3CZ6 A;  4A4A A;  1T6U A;  4GYT A;  5L3V A;  3L34 A;  1Q0D A;  1BR1 A;  2DYS C;  3JZ0 A;  2HS5 A;  4GEH A;  3X1O A;  4OD5 A;  4R32 A;  4WGY A;  2KSF A;  2Y3H A;  2AWC A;  2OG2 A;  2PF4 E;  1FFT C;  2M4E A;  1ZVZ A;  2RD9 A;  4MVZ A;  3UMI A;  5T3W A;  3NKE A;  3VF0 A;  4AL0 A;  3PHF 2;  3GWL A;  1A7D A;  4PFO A;  1RXQ A;  3FVY A;  1TFO B;  4O7G A;  2ZXP A;  2J46 A;  1I4Z A;  3HTK C;  4JKV A;  1YZC A;  3M79 A;  2BL2 A;  1FTS A;  1XZP A;  4C7O A;  1MMD A;  2NUP B;  2VCA A;  4H4K C;  3G4X A;  1NG1 A;  1L7C A;  4YL3 A;  2DB4 A;  3EQL F;  3T4R A;  3C62 A;  2YLD A;  2OKU A;  3DE8 A;  3NYM A;  1GM5 A;  1FMW A;  3U9J A;  2GWW A;  3POV A;  1OKK A;  2XL4 A;  3ZC4 A;  3HJC A;  2QNL A;  2ZXW C;  2GA0 A;  4C3B A;  1MMG A;  2LK4 A;  2Y3D A;  3ECS A;  2E87 A;  2J9B A;  3QVZ A;  3AG2 C;  4DXW A;  1WTY A;  4EHP A;  3FDQ A;  1VTM P;  2J45 A;  4JE9 A;  1HY5 A;  4PAC A;  3RQF A;  1I4Y A;  2YHS A;  2R7Q A;  3E70 C;  1LI7 A;  1OCO C;  5D91 A;  1U6H A;  1OR3 A;  4K7B A;  3UMH A;  1RKE A;  4YT8 A;  2R7U A;  2D4U A;  3EFO B;  1YZA A;  2LQG A;  3C63 A;  3QVY A;  1M56 C;  5CI9 A;  2PNO A;  2R7T A;  5JUA A;  1U89 A;  4ULV A;  2VCC A;  3SNH A;  3EGX A;  3K33 A;  2PX0 A;  5F5F A;  2L9J A;  1BR2 A;  2EPK X;  3MX3 A;  3S90 A;  1JPJ A;  3LEV A;  3MYF A;  1EKY A;  1G4U S;  1GQA A;  1NFN A;  3DD7 A;  5COG A;  1IZM A;  5DLJ A;  1VLT A;  3V5X A;  2H7B A;  4LER A;  4XWJ A;  2EPN A;  4C7O B;  4CDY A;  2A6E F;  4QI0 A;  3IEE A;  2J9U A;  2BE5 F;  2YWA A;  3LLK A;  1V54 C;  4J32 B;  1NZE A;  4DRJ B;  3L0I A;  2PX3 A;  3EZH A;  5DQZ A;  2R7R A;  4G0H A;  1OCZ C;  2YL0 A;  4KC9 A;  4W8P A;  2IBF A;  2WVN A;  3ZQY A;  4CX9 A;  1MMA A;  4YL0 A;  3B0U X;  2KYH A;  3CSK A;  4U5F E;  4WJ0 A;  2KW3 C;  1A7E A;  1FAP B;  1QQ3 A;  3JRM O;  5KYW A;  4G7H F;  1VYI A;  4U5H A;  3TQO A;  3AOU A;  2QTV A;  4JUR I;  4HFK B;  1M6T A;  3M4B A;  3M15 A;  2MWQ A;  4AK9 A;  4DVZ A;  2EIM C;  4NTA A;  1VMA A;  3WOD F;  4PJJ A;  5FCL A;  3K6B A;  2RSE B;  4EIY A;  3S0X A;  3ITF A;  2NPU A;  2PFD A;  4MVO A;  3FXH A; 
#chains in the Genus database with same CATH homology
 3I5Q A;  4J30 B;  5CI8 A;  2WL8 A;  4U5G A;  3ZG1 A;  4I44 A;  2Q9B A;  5KYU A;  3B0V C;  2J0W A;  2Y3B A;  4KNW A;  3JRT A;  2X51 A;  4KI2 A;  3ABL C;  1RJ9 B;  1MMN A;  5B1A C;  3S27 A;  1W2W A;  1ZHX A;  2EIL C;  1D1A A;  1LVK A;  3N0T A;  2VH3 A;  4C3E A;  2FGY A;  4M63 A;  4PJN A;  4G7Z F;  1WGW A;  4ULW A;  3EGX B;  4DBR A;  2A6H F;  4O6Y A;  1D1B A;  4AE4 B;  3NYJ A;  4OIP F;  2FFH A;  4IJJ A;  4PFP A;  3KH2 A;  2IOQ A;  3NYL A;  2WZL A;  4OIO F;  2GFH A;  3AQC A;  4JJF A;  1NU9 C;  4B6I A;  4BJ1 A;  4KBL A;  2WZF A;  3FAJ A;  1ST6 A;  4LLE A;  3RFY A;  4C7O A;  4OIR F;  4DBQ A;  3M1C B;  2A68 F;  4IWB A;  1VOM A;  3LLI A;  4I1O B;  3RKO F;  5KYW B;  3CQZ A;  1NU7 D;  1QZX A;  2W9Y A;  2Z15 A;  3VAY A;  1S7Z A;  1ZHW A;  4NY3 A;  3NKD A;  2DYR C;  2IYL D;  4FWV A;  4YJW A;  2WB7 A;  1Z3I X;  2C03 A;  3PMR A;  1G8X A;  3I4U A;  4JCH A;  2EIK C;  3FDQ A;  3T6B A;  3DXJ F;  3S28 A;  2A1D D;  3UNG C;  5KYU B;  3NDB B;  5B1B C;  4OIN F;  4YWQ A;  4BJ6 A;  5DS5 A;  5KYX B;  2KGO A;  2P6V A;  3KMI A;  2V26 A;  3JYH A;  1OCC C;  3H65 A;  2J9V A;  5DS4 A;  3DZA A;  3TD7 A;  2QY9 A;  1RJ9 A;  3MLG A;  3AG3 C;  5DVW A;  4ZLD A;  1M2V A;  1TWC A;  1TWG A;  5KYN A;  3K1I C;  3UR3 C;  4JW1 A;  2OCC C;  4EWC A;  3EH2 A;  3LNR A;  3W2W A;  4AE4 A;  4BJT A;  3RYL A;  1VYK A;  3DAG A;  2LSE A;  3KKB A;  2C04 A;  2P7V A;  4PJM A;  3JSZ A;  1N1C A;  1Z63 A;  4Q4Z F;  3EG9 B;  4MQ9 F;  3EGD B;  3LS1 A;  5T1D B;  2W4B A;  3SEO A;  5KYY B;  2W45 A;  3ASO C;  2CNW D;  4X0R A;  3K7D A;  3QMK A;  2R7O A;  4XLN F;  3O39 A;  3UGO A;  3UGP A;  1QLE C;  3I5P A;  3W2V A;  1TWH A;  5E3A A;  1MNE A;  4QDL A;  4O6M A;  3RIP A;  3WG7 C;  4CS8 A;  3DM9 B;  3AG4 C;  1BR4 A;  1PD0 A;  2V3C C;  3ZIB A;  2H7V C;  2B0J A;  4E7S A;  1ZHY A;  4CS8 C;  3JT1 A;  3VYW A;  2EIN C;  2IXM A;  3DAF A;  3T6J A;  5KYX A;  2Q9A A;  5E33 A;  4LAC B;  2Y3G A;  2R7X A;  1D1C A;  2Y69 C;  2KNH A;  1M2V B;  2Q9C A;  5DQT A;  2YEV A;  5L3Q A;  2G3K A;  3Q7G A;  3EHN A;  4XLP F;  2IXP A;  2WVQ A;  3EPV A;  2NUT B;  5T3T A;  2O9X A;  4DVY P;  5HSW A;  3F47 A;  2G3V A;  3LES A;  2L81 A;  1J8M F;  2CNW A;  3EHM A;  1SF8 A;  3NG1 A;  2EIJ C;  3AQB A;  3F46 A;  3B0P A;  5IY5 C;  3N24 A;  2W4M A;  2ZXO A;  5BUO A;  2G62 A;  2WZG A;  3ABM C;  3ZVR A;  3DJU B;  4W8K A;  3EG9 A;  3EGD A;  2VAS A;  3LAY A;  4E7Z A;  5KYY A;  4CS9 A;  4G7O F;  3ASN C;  2J9W A;  4ZLC A;  4JJG A;  4CS9 C;  1IW7 F;  3KL4 A;  4U5D E;  2MYS A;  3O6X A;  2IXO A;  3RH3 A;  2XRH A;  2ZXR A;  4IAO A;  3JCU Q;  2HV6 A;  1PCX A;  5D92 A;  4BJ6 C;  4FX5 A;  3AG1 C;  4QI2 A;  4RD9 A;  5DS6 A;  4YT5 A;  4DOZ A;  1ZYR F;  1Z23 A;  4IRU A;  4MND A;  4CS7 A;  1KU2 A;  5F5H A;  4BJ5 A;  1SZI A;  4CBE A;  4HEA J;  2XXA A;  3OEO A;  1ZHT A;  4BJ5 C;  4O6N A;  3LJB A;  5E2Q A;  2NUT A;  3NRH A;  5B3S C;  2A69 F;  1FFH A;  3Q7L A;  2Q3T A;  4CIH A;  1TKN A;  3SP1 A;  2J7P D;  4RDA A;  4N06 A;  5EGY A;  1PD1 A;  3N2Z B;  2D5R B;  2IXN A;  4RBN A;  5E3C A;  1SMY F;  1Z5Z A;  2JD3 A;  3B9Q A;  4PK4 A;  2DGJ A;  1Z6A A;  4HE8 D;  3Q6N A;  4LLC A;  3EZI A;  1FMV A;  1TR2 A;  3SYN A;  1D0Y A;  2HV7 A;  2I8B A;  2H7O A;  1D0Z A;  4PJL A;  1OCR C;  1ZU5 A;  3V7O A;  4XTK A;  2CW0 F;  3EJN A;  3W8H A;  4YN0 B;  3GAN A;  2NG1 A;  4U5B E;  3E9V A;  2CDQ A;  2CGE A;  4A2N B;  4I1M A;  1V55 C;  3W8I A;  3K66 A;  4HFF B;  3SZR A;  4KNV A;  3QZC A;  3K1H A;  2XXA B;  1MND A;  2J7P A;  1LKX A;  4YT4 A;  4OIQ F;  1D0X A;  4U5C E;  3Q6M A;  2NUP A;  1O87 A;  3S29 A;  5EHH A;  4CSA A;  1M2O A;  3DJN B;  3DMD A;  4CSA C;  1VK5 A;  3UMK A;  1LS1 A;  1M57 C;  4F4B A;  2YZS A;  3EH1 A;  3HLZ A;  2Y39 A;  2WVO A;  3GOD A;  4AX2 A;  3LS0 A;  4YT2 A;  2J0X A;  4Q5S F;  2R7V A;  2KQ9 A;  2ZPA A;  4U5E E;  2XSE A;  4FES A;  4JZA A;  1ZU4 A;  4P6I C;  1J8Y F;  4C3D A;  4O79 A;  3DM5 A;  4OD4 A;  1TWA A;  3FHD A;  4JVS A;  4K0D A;  1OKK D;  3ABK C;  4ANJ A;  3EFO A;  3ZSU A;  4I3M A;  1O5H A;  2VB6 A;  3OA1 A;  1ZHZ A;  1JPN A;  3X2Q C;  4BG0 A;  4BEJ A;  4Q7C A;  2R7W A;  2PP4 A;  2KJG A;  4EBB A;  3OWT A;  3CZ6 A;  4GYT A;  5L3V A;  3L34 A;  1BR1 A;  2DYS C;  4GEH A;  3X1O A;  4OD5 A;  2Y3H A;  2OG2 A;  2PF4 E;  1FFT C;  2M4E A;  3PHF 2;  3UMI A;  5T3W A;  3NKE A;  4PFO A;  3FVY A;  4O7G A;  2ZXP A;  2J46 A;  3HTK C;  1FTS A;  1MMD A;  2NUP B;  4H4K C;  1NG1 A;  3EQL F;  3T4R A;  3NYM A;  1FMW A;  3POV A;  1OKK A;  2XL4 A;  3ZC4 A;  3HJC A;  2ZXW C;  4C3B A;  1MMG A;  3ECS A;  2Y3D A;  2E87 A;  3AG2 C;  2J45 A;  2YHS A;  3E70 C;  2R7Q A;  1OCO C;  5D91 A;  4K7B A;  3UMH A;  4YT8 A;  2R7U A;  3EFO B;  1M56 C;  5CI9 A;  2R7T A;  3SNH A;  3EGX A;  3K33 A;  2PX0 A;  5F5F A;  2L9J A;  1BR2 A;  3MX3 A;  1JPJ A;  3LEV A;  3DD7 A;  1IZM A;  5DLJ A;  2H7B A;  4LER A;  4XWJ A;  4C7O B;  2A6E F;  4QI0 A;  3IEE A;  2J9U A;  2BE5 F;  3LLK A;  4J32 B;  1V54 C;  1NZE A;  3L0I A;  2PX3 A;  3EZH A;  5DQZ A;  2R7R A;  4G0H A;  1OCZ C;  4KC9 A;  2WVN A;  1MMA A;  3B0U X;  3CSK A;  4U5F E;  4WJ0 A;  2KW3 C;  5KYW A;  4G7H F;  1VYI A;  4U5H A;  4JUR I;  2QTV A;  4HFK B;  2MWQ A;  4AK9 A;  4DVZ A;  2EIM C;  1VMA A;  3WOD F;  4PJJ A;  5FCL A;  3K6B A;  3S0X A;  3ITF A;  2PFD A;  2R7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...