4AK9A

Structure of chloroplast ftsy from physcomitrella patens
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
308
structure length
302
Chain Sequence
b'SQDPDIQLLFSGFSKTRENLAVVDELLTYWNLDESESILDELEEVLLVSDFGPKTALKIVDTIRKDILAGRLKSGPQIKEALKKNIFKLLTERVTTTELQLGNSRPAVLMIVGVNGGGKTTTLGKLANRFKKEGVKVLMAAGDTAAAGEQLEVWAQRTGSEIVMAPRPAAVLSQAVRRAVEEDFDVVLCDTSGRLHTNYNLMEELRGCKRAVSKALSSAPNEVLLVLDGTTGLNMLAQAREFNQVIGVTGFILTKLDGTARGGCVVSVVDELSIPVKFVGVGEGIDDLQPFDAQSFVDALFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CPFTSY
publication title Evolution from the Prokaryotic to the Higher Plant Chloroplast Signal Recognition Particle: The Signal Recognition Particle RNA is Conserved in Plastids of a Wide Range of Photosynthetic Organisms.
pubmed doi rcsb
source organism Physcomitrella patens
molecule tags Protein transport
total genus 119
structure length 302
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ak9A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ak9A02
3LLMA 2WWWA 2V8OA 2HT1A 4FMDF 1FW6A 3T5DA 2XNSA 2YWEA 1XMJA 3UKDA 1NI3A 4GFDA 1H8ED 3QBTA 4M9XA 4HZUB 4NCJA 4LYHA 1D2MA 1E0AA 1COWD 4FI3C 1YZNA 4NONA 5GVSA 3CPEA 2J45A 2QL6A 3PEYA 2O8CA 2P2LA 3FFBA 6Q21A 2NMVA 5EE0A 4Q7MB 3Q85A 2VRWA 1JJVA 3AUYA 2KWIA 3Q7QA 5LDDC 2QY9A 8OHMA 4PFSA 3ZVLA 1DELA 4IJMA 1YRAA 1GRQA 4KU4A 3OE7D 4PHGA 2PZEA 1C4OA 2YC4C 4MKGA 3SC3A 4MUBA 1ZYUA 1YRBA 3GMTA 1E1RA 2X19A 4YMWA 2HJGA 3GCGA 4RVCA 2FGKA 3OFND 2VP6A 1PUJA 5KUTA 4L9SA 2VP9A 4V0NA 2BMFA 1DAEA 3RWMB 3WNDA 5AUNB 621PA 2WWXA 2ANBA 3Q3JB 5E7MA 2ZANA 2V1XA 5G41A 1IY1A 3VMFA 2HJVA 3LX8A 3GFOA 4TZ0A 2FH5B 2QM7A 3TUIC 5D3MA 1SVWA 2BBTA 2ZS9A 3PEUA 5EP1A 2XEXA 1N5JA 1Z6YA 4HUTA 3WBKA 4QGHA 1UAAA 5F9HA 2FE4A 4Z8XA 1OYYA 2P6NA 2GCPA 5L3SA 1L2TA 2IF2A 4IOJA 1G17A 4G5QA 1H8EA 4Q7KA 2QMHA 2QT0A 4ZO4A 3GP8A 4MDEA 4OI0A 4QXAA 1Z28A 1EFUA 1I2DA 4URYR 1KI2A 5CB8A 1COWA 3CRMA 2A5YB 1Z8FA 1PUIA 4UJ5A 4A0GA 3I72A 4PSAA 4WAUA 3VQTA 2ORIA 2IWRA 1UDWA 3TJZA 3Q5EA 4KXFB 1E1QD 2IL1A 1IHUA 1U90A 3MCAA 5EE1A 1DAGA 3CM0A 1S2MA 4PR0A 5EE9A 2AWNA 1WBDA 1G7SA 1QVAA 3PVSA 4W7SA 5DN6A 1DE0A 1UKZA 1KSFX 3B1VA 3EA5A 4KV9A 4OJKA 1QG4A 5FL7D 1FP7A 1EFRD 1Z0FA 2YOGA 3SR0A 3X1YA 4BFVA 2Q21A 3Q5DA 5EUMA 1KO8A 1ZJ6A 1N25A 1OT3A 1G7CA 1MO6A 3EAQA 3OFNA 4HB2A 1E9BA 4BEBA 1MH1A 1ZIPA 1PLJA 1LB1B 2GWHA 1UBFA 3P27A 4R71A 1JPNA 2AR7A 1TEXA 2WWGA 2Q3HA 1MKYA 1WBBA 1XD9A 3IHLA 4BUJA 4ASUA 2ZE8A 1NLZA 2HDNB 2YOHA 3VR2A 1KY3A 4FW9A 4OI1A 4YMTA 5HZHA 5KSZA 4XWOA 5FTKA 4HLUC 2UZIR 2WMNB 1LF0A 2ZAMA 2H8KA 3I62A 1RW4A 2J3EA 2D2FA 2ZVPX 1WB9A 1W1WA 3MGCA 4EJSA 4ZIRB 1SULA 1WF3A 1NVVQ 3JZMA 4TMZA 2GXQA 1XBTA 2AXPA 3OHMA 4C30A 3ADCA 1XEXB 2G6BA 4Q02A 4DC9A 4A8JA 1N3BA 5IDVA 4CF7A 3LA6A 2O8DB 4ACBA 1G1MA 1E1QA 3NC0C 4A9AA 3B1ZA 1QHYA 4DSUA 5JJKA 2GVDC 2C96A 2YNMA 4HSEA 1P2VA 1SHKA 4TTRA 4B3BA 4BLPA 4X8LA 1KO5A 1KKLA 3DOEA 1SXJC 3EC2A 4MGYR 3EIQA 5FL7A 4C0JA 3OIUA 2NTYC 1OYWA 1EX6A 1EFRA 1CTQA 1Q1QA 2BHRA 3TUZC 1E0JA 1XZPA 3F3YA 3GJ3A 2PEYA 1DO2A 1H8HD 5FL3A 2FA9A 1LS1A 2V7QD 3LQRA 4IOLA 3SFVA 5KDOA 1QDEA 1E2MA 1M7BA 4NYMQ 1R7RA 2ZE7A 3UMSA 3SHFA 4DB2A 5BN3A 1X6VA 4DLWA 1JR6A 4LUCA 1OIVA 1LV7A 1E2LA 2ZJ8A 2JLXA 4DLYA 1QZXA 2ORWA 1E2DA 3QJYA 4ZI3A 5FI0B 1WCV1 2ZYTX 1Z07A 3FE2A 4Q1DA 2PX0A 4JBXA 2CLCX 3K53A 3L82B 5KDDA 1NSFA 1AIPA 3THWA 1ZVQA 3SDZA 1OH5A 2QSZA 2GEVA 2MSCB 3P26A 2BCJQ 3I73A 2OESA 3IPXA 2JAQA 3QXXA 5C4GB 2UKDA 5EP3A 2XJ9A 3U7FB 4LBYA 2O8CB 5KPDA 3L2OB 3THXA 1G4AE 3GEIA 5DGXA 3ADDA 4FN5A 5J4VA 1ZRHA 3UG7A 2CJWA 1UKEA 4KSCA 3BRWD 3V9PA 4NBSA 4BLSA 1UFQA 4I1OA 2FF7A 4LV6A 5BQ5A 2YV5A 2ZUCA 5L3VA 1QHSA 4OYHA 5J4YA 1HA3A 3B1XA 1LW7A 4M9QA 2CXXA 2FFAA 1UBEA 3SNHA 5FR1A 2RGEA 1P9WA 2RMKA 4OK5A 4TLDA 2C99A 1XNJA 1AS2A 4WXPA 1RYFA 2X2EA 3HR8A 3VR4A 3PUWA 4TMVA 1U0JA 5SZIA 2V7QA 3MWJA 4PANA 1FZQA 3AUXA 3AVYA 2J5XA 4E5UA 1KO1A 2IEYA 5C46F 2O8EA 4ZKEA 2GZAA 4WOPA 1Q44A 4HATA 3K0SA 1PLLA 2BEKA 3LO5A 1TL7C 2JA1A 4CEHA 1LFDB 1EXMA 3DM5A 1CJKC 5D3MB 4QJ3A 3NBFA 5AJXA 1NF3A 4ILEA 2YWGA 4AG6A 1TF7A 3NDPA 4UNPA 3RAPR 3EZ6A 2HF9A 1EFHA 5F9FA 1G16A 1SGWA 3IQWA 3Q72A 1ZM7A 4UXHA 3R9IA 3LVRE 2VHUA 4CW7A 1NP6A 4LDJA 3K70C 1WE2A 3QE0A 4MUAA 5J47A 4IVPA 1CBUA 1N2CE 3T35A 4GMXA 4KVGA 3KKNA 4TN1A 1MABA 1IJEA 3RRNA 4DBLC 2CBZA 1EG7A 2MSDB 1N5IA 1VG9B 2C9OA 5C4MA 4HI0E 4GP7A 2KSQA 2RGBA 3CH4B 3WP1B 2OILA 1VECA 2I1VB 3QVVA 2HXSA 4G01B 1GFIA 2IYZA 2YJTD 1E2QA 4E07A 2WM9B 1PLKA 4U7DA 1XD8A 2XB2A 3FMFA 1UBGA 1R0ZA 4UXJA 4B32A 4BLTA 2R8RA 1JEDA 1WDTA 3R9XA 5H70A 3VR3A 1J70A 2J0UA 4QHSA 2IS6A 3L43A 5FPKA 1NG1A 1NKSA 3GPLA 1G41A 1WXQA 2NO6A 4LPKA 3VHLB 4M1MA 3ZVRA 2I1QA 2BC9A 2C98A 2OXCA 4EIWA 3ZIAD 2P6RA 4B3CA 5A0FA 4TYYA 4LYFA 3T1VA 4TMKA 4Q1EA 2QE7A 3RHFA 5CITA 4U00A 3FHTA 1CLUA 5KSPA 2O8BA 4BE7B 4HDCA 2X1VA 3NEJA 2CCGA 4BFYA 1E4VA 5LB4A 2ZRCA 3EA0A 1GNPA 4M1OA 4TYWA 2OSBA 1ESNA 2QPTA 3KB1A 5FTLA 1T5LA 1UM8A 2ODNA 3LBIA 4JLOA 4QL3A 4Q01A 3W9YA 3ZYCA 3ZQ6A 2ZRNA 3UK6A 4OHXA 1HUQA 3AKCA 1WRBA 221PA 3S1AA 4EKDA 2IS1A 1U8AA 1KZ7B 1US8A 5L8VA 4LWZA 3HP1A 4DEYA 3BOSA 4V0OA 4NH0A 1KJZA 1L4UA 2UZ3A 3DOFA 4R98A 4RY2A 1FTSA 2NG1A 2CL0X 2ZUBA 2QORA 1F48A 3KUDA 1YR6A 4MDFA 1KDTA 4KSBA 1G7TA 3SS8A 5B57C 1P61B 2F9MA 2EFCB 1RZ3A 3C5HA 3QPWA 2PLRA 4Q4LA 2WTUA 1EX7A 1G3QA 4IKEA 4FCVA 4J0QA 1PZNA 1W0JD 5CM9C 4RFSA 1KGDA 1Z08A 2REBA 3TBKA 1Q20A 2ZRFA 3DHWC 2AHOA 2AD5A 1QHIA 1AGPA 1KDOA 4H9GA 4PQRA 4DCSA 2W2XA 2GBLC 3FPAA 2ATVA 1XJQA 2B7BA 2PH1A 3KXKA 3C4JA 2CLSA 3N70A 1S3SA 3WHLA 3BB3A 1SXJE 4NYIQ 4MYUA 4LX0A 4JJKA 4A0HA 1P2TA 3AVUA 1OIWA 4AKGA 3RANA 2GCOA 2Z5FA 1JEEA 4NCHA 1X8KA 3U5ZB 2W2TA 3D7MA 2H17A 1CF4A 3THWB 2GNOA 2OCBA 1YQTA 3PUVA 5CJ2A 2J41A 3VU9A 3V4FA 2QA5A 4XWAA 3NH9A 1WP9A 2BWJA 4BFSA 5B2ZA 4EDHA 2QENA 2HUPA 3THXB 4E09A 4UNRA 5FI1B 2XXAA 2MMCA 2CJWB 3BWDD 4IVQA 1XEWX 4LHWA 4FMDB 1R4AA 1ONBA 1ZM3A 1J90A 1W7AA 3FHOA 1JALA 4RSGA 4Q9HA 4KFTA 2O5VA 1W2HA 4JBYA 2J46A 3CWQA 1PVOA 4BGDA 2VEDA 1VKJA 4GDFA 1YZGA 2NGRA 1W0JA 2G9NA 2VHQA 5K8UA 1E3MA 3REFA 3IDQA 5C2JB 2GK7A 5JI3E 4CEJA 1UJ2A 2QNRA 4AD8A 4HAZA 2VHTA 2CLDX 2GHIA 3OIYA 4B44A 1OPXA 2YWHA 4MGKR 4LK2A 4PHHA 3I61A 1OKKD 2RGAA 1W36D 4V02A 1E2GA 3AVXA 4ZCIA 2QU8A 3NHAA 1WA5A 1QHGA 4CEHB 2O0KA 3VX3A 2GILA 2PZGA 1VG8A 1QHXA 3CBQA 3W3ZB 1II0A 1XX6A 4KLZA 3X1DA 2XB4A 2AD1A 2BV3A 1QG2A 5G3ZA 5JI2E 3C14C 2ZJOA 2ZS7A 4Z8YA 421PA 1CR0A 4Z54A 4W5JA 4I81A 2XX3A 3B60A 2BMJA 2D2EA 1VCMA 1E32A 4A36A 2KI5A 1G20E 1P3JA 4PPQA 3WY9A 1KI4A 4MITA 2VP0A 1MABB 4HUQA 5JJIA 1OSNA 1E9RA 3RC8A 3RNLA 3PR1A 1Q1BA 5LBIA 3W5JA 3I92A 3WMGA 4DIDA 1TF2A 4JMPA 3TGPA 1T8TA 2J7PA 1MO5A 3WYAA 2OUKA 4PHTA 4D26A 1CEEA 3NBYC 2PZFA 1ZIOA 3M1IA 2W6JD 1DG3A 3MLEA 1Z6TA 2QMEA 3ZDQA 4G1UC 1I4LD 2J0UB 3ZS9A 4NE2A 1NJGA 2ZU6A 4WZ6A 2O8FA 1F5NA 1U99A 4DSTA 1OV4A 4BECA 3GLFE 2O52A 4D6PA 4US1R 4RZ2A 4JLNA 3GLFA 1OXSC 4NKRA 2ZETA 4MRPA 3WRXC 1W4CA 3LX5A 4M21A 2J87A 2TMKA 4BEJA 4HEJA 4M1TA 1VCIA 1A1VA 3FKSA 1IN5A 2W83A 3DMNA 2O8BB 4AKEA 1ZP6A 1KI6A 4PC2A 5C1BA 3MMPA 1QHHA 2G3YA 1R0XA 1JECA 3BGWA 3H86A 4F4IA 4RCYA 5P21A 3UPUA 3P4YA 4XVUA 1B23P 4B3GA 1GNRA 2L0XA 4BASA 4BZPA 1UPTA 4TLEA 4BQSA 1N6NA 1ZM2A 3ZH9B 3TW8B 2XZLA 2GF0A 1WQ1R 1US8B 3AF3A 1KOFA 5JWRA 2W00A 4KLNA 3VKGA 4TL6A 3BH6A 2OCPA 2FEOA 1NBMD 4WBSA 3LLUA 3WRYC 3T15A 2QAGC 5KPJA 1J2JA 4F7WA 5B64A 1NY6A 1R0WA 5LD2B 4MKIA 1VG1A 4LHYA 2W6JA 4DLUA 4RFSB 2VH5R 2DWOA 2JIZA 4ZDIA 4DLTA 1XMSA 1N6KA 3PQCA 1RJ9A 4C7OB 1D5CA 3C15C 1BO6A 4ON9A 4BFZA 1VCOA 4KJZA 5AJVB 1KHTA 1G8FA 4QJ5A 1OB2A 4O25A 3NH6A 3O47A 1T6NA 1CJVC 1F2UA 4B2PA 3QI2A 3QSYA 2NO9A 1YHNA 2IYLD 1XEXA 4A2PA 2W0MA 1SXJB 4YMVA 1N6RA 3U7GA 2F7SA 1L8QA 3M0EA 4QBGB 2QTFA 3PUYA 4ZKDA 4OI4A 4EPTA 2GCOB 4DCTA 4O2LA 2NPFA 3B85A 2X8AA 1KAOA 3CNOA 3DKPA 3GFPA 4ZI2A 4DXAA 1T0JB 3CX8A 2I3BA 3EWSA 3VU9B 2ZSDA 3BAFA 1OFTA 4YMUA 1XD2A 3CNNA 2HCBA 3HDTA 1T9HA 4QJ4A 5EJEA 4L9WA 5JRJA 1HV8A 1MO4A 2XXAB 3EARA 4CVNA 3AB3A 1V43A 2D4HA 1NBMA 2GJSA 5DYGA 4BRUA 5FBQB 4B71A 4M4SA 4IW3B 4KBGA 5F2EA 2A3RA 2VSOA 4M9ZA 4CIDA 3Q8XB 4LBVA 1E79A 3TMKA 1G4UR 3U3JA 4OHZA 3L0OA 2Z6VA 4I1SA 3A36A 5AUPB 4S2EA 1DPFA 1AM4D 4QNRA 3SJCA 2QROA 3TAHA 1QHNA 5JCPA 1NRJB 1XJCA 4CEJB 1E9DA 3L0PA 4DDWA 3A1WA 4IDOA 2V6IA 3A8TA 2I4IA 2ZXUA 4B33A 2F55A 4GOXA 4JL6A 1ANKA 3OEED 3O8RA 1T3SA 1KNQA 2JLRA 3QF7A 4QRHA 4C3ZA 1N6LA 2O0JA 2C03A 3QVUA 2WJYA 1II9A 5FH9A 5CB6A 2ZITA 4Q4JA 4D4LA 2RGGA 5DN6D 1KSGA 4F91B 3H2YA 3ADKA 5A5GA 2C77A 5AJYA 1W5SA 1WMSA 4KYIB 2JJ8A 4D2IA 2BKUA 2R62A 1AJEA 4X8MA 5KSYA 1CIPA 2IXFA 4KVAA 2FG5A 3P32A 1X8LA 1C9KA 4LBZA 1Q1EA 5FUXA 3RS5A 1G3MA 4IOKA 1XEFA 3I5YA 4HUQB 1BS1A 3AKEA 5JEDA 1G5RA 2BBOA 4Q1BA 4QFMA 1E98A 4K81B 4ABYA 3TNFA 2QZ4A 3SJAA 2ZTSA 2VP5A 3R7WA 2IS4A 1P4SA 5B58C 2AK2A 3ETLA 4ASUD 1DAKA 2IUUA 1JQLB 1IJFA 1G8GA 3SI7A 1M7HA 4AK9A 5FPSA 1T5IA 2OFWA 3ZQJA 3D3QA 5K8IA 1ZD1A 3UIEA 1Q3TA 1KAGA 1GL9B 4LHXA 3HR7A 2X77A 5BYJA 3B9QA 2DYKA 4RZUA 1XXHE 3A1UA 3SEAA 2O8FB 1FX0B 1HT2E 4FCTA 1FL9A 3IHWA 3AF1A 1XXHA 4LBWA 5LB2A 3GLFB 1RFLA 2YOFA 3G5UA 1EWRA 3BORA 2DPXA 3QG5A 4MRRA 2W2VA 3OEEA 3VAAA 5FPTA 1X1SA 1XB2A 2NIPA 3GEEA 4KODA 4DB4A 4I4LA 5EQTA 2FFHA 2CE7A 1KI6B 4M0LA 1QHHB 3ICEA 4DEXA 4MKFA 1M34E 2ZE5A 2CVHA 4P0TA 2P3SA 4A0RA 5DLQC 1TEVA 4IOMA 4QHTA 2F3RA 2R6GA 2XZOA 1P7CA 2OEPA 4EPYA 5GJWC 3CR7A 3SYNA 5J4HA 4OHWA 2ZR0A 4YONB 4FWTA 2Q0HA 3EZ2A 3QUSA 3B6EA 3TVTA 1NVUQ 2ZRAA 3N5CA 1CKEA 4LYJA 4NZYA 4BFWA 4B76A 2IW3A 1U0LA 3NWJA 5E7IA 3RC3A 1IXRC 4RFVA 2ZSFA 1HQYE 3RSOA 5E95A 2KE5A 3EG5A 1U9IC 3EZ9A 1ETUA 4IVRA 3WYGA 4L4UA 4C0AC 4DJTA 1E99A 4MYHA 5AWFC 3KKOA 3LBNA 3LWNA 5KNBA 2D7DA 4EUNA 1QRAA 2OFOA 2Z4SA 4NP6A 4EJSC 4Q66C 4RD1A 1F6BA 1HURA 3NXSA 4M1WA 5GJCA 3SHWA 3K09C 2PMKA 1RJ9B 1GIAA 3ADBA 1GP2A 1JJ7A 2ZSAA 4KFSA 4TQAA 2ODBA 3KFXA 1OXTA 1GZSA 3QPVA 4JBWA 1IXSB 4HAUA 4DZZA 2QG6A 3SE0A 1F2UB 2ZYWX 1RVDA 721PA 3I5XA 3VR5A 1IN4A 1GTVA 1KKMA 4DUGD 1R10A 3LW7A 4MRSA 3CZPA 4KAXA 4PQFA 3KDSE 3N2EA 3LY5A 4CT5A 5JLJA 1ZUIA 4MH0R 1IN7A 4M9SA 1NIPA 2XJ4A 3M6AA 2WAYA 3PCRB 4URUR 5DNYB 1N5KA 5EP2A 1EK0A 4LJAA 1ZCBA 4AYWA 1TQDA 1XWIA 2ZJZA 1XD2B 3F5FA 2CCKA 4TTQA 4PAMA 2A30A 4P4SA 5JS7A 3IO5A 3IO3A 1D2NA 1P2SA 4QGFA 3AF0A 1IY0A 4DLRA 2G88A 4EQ6A 2WV9A 1OJLA 4QM7A 3U44A 5FTMA 5M04A 4FCWA 3A1VA 4BZXA 2ZRLA 1JNYA 1Q57A 1Q1ZA 1AS3A 1A5TA 2H57A 4YQFA 5TY0A 2XTMA 3FOZA 5KHOC 4ESVA 2XNDD 1T0HB 5JJLA 4Q4AA 5KTYA 4PC7A 2GXAA 2CL7X 4UNNA 2B8TA 1GITA 4N0EA 3K1JA 4OQXA 5BWMA 1XEWY 3DZ8A 4LV8B 1GL6A 2WOOA 3D8BA 2NOAA 1W48A 2PEZA 4HAXA 4MA4A 3QPUA 2C9YA 4EPXA 2GETA 1E94E 1K5GA 1MT0A 2QPAA 3CIOA 2OXRA 3QF4A 2FMXA 1GKIA 1QVRA 4A2WA 3SQXA 3BERA 1E2HA 2C5LA 1HE8B 2ZJ2A 4RD2A 4RKFA 4YC7A 2ZI7A 4PC1A 5DE3A 5JECA 5E4FA 3QENA 4BZQA 3IGFA 3LXRA 2FNAA 2QP9X 3HU2A 4PO9A 3PENA 3RRYA 1IOZA 2ZYUX 4DUGA 3B7GA 4WVFA 4CEIA 1LVGA 1A2BA 1G9XA 3MJHA 4PHFA 4HDQB 4Q4JB 3BJIC 3K0FA 2IS2A 5HE9A 5EP4A 4EPRA 1CXZA 1D9XA 1JAHA 3HU1A 4IHQA 1ZU4A 1DOAA 4RKEA 5FR2A 1YZQA 5KDLA 4QBFA 5CK4A 4TMTA 2ZSBA 4EFNA 3K9NA 5SZHB 2ZPTX 1XTIA 2A9KA 4R2IA 4Q9IA 4EAQA 1Z6GA 3ND9A 4WIAA 4Q9KA 5J4KA 1Z22A 4Q1CA 3GEHA 3GD7A 1CJUC 2Z4RA 4HB3A 3RWOA 5JCZA 3PEVA 3R8FA 2BM0A 4TMWA 3ZLJA 2VYFA 1S4QA 3U6BA 4PPGA 3R7WB 4D4MA 5EXSA 1O87A 2FFBA 1GUAA 3W5IA 2Q6TA 3A58B 2XNDA 1ZD8A 3EC1A 2QE7D 2BMEA 1DARA 2D74A 2JLVA 1XDBA 2F1IA 4HZIA 5DHAA 1KI7A 4V0KA 2B21A 2IT1A 4JYCA 1YZKA 2ZRJA 1W36B 3LW8A 1MR3F 3EXAA 2XTZA 4PTLA 1R2QA 1GRNA 2DFKB 3K9HA 3KQHA 4XWKA 4MGIR 3QXJA 2FSHA 1XXHB 1BIFA 1TU4A 1FOEB 1X3SA 2EWVA 1S8FA 2QAJA 1RRPA 2HYIC 3UWKA 3U61B 3IPYA 1R5NA 4KBFA 4ITRC 2V54A 4KCGA 4XJXA 4D4KA 2ERYA 3W6OA 1FPMA 1SKYE 3AGPA 2DB3A 3FMOB 3MAAC 2XTNA 3JVUA 4M1SA 4JLAA 3KQKA 1GG2A 4TWZA 3EASA 1CU1A 5AK0A 4ZCLA 5EZ5A 3KB2A 3SBDA 4V0ME 4RJLA 2AX4A 1G6OA 1KDRA 1CJTC 2QGZA 3AGQA 2RCNA 2IYRA 2Y8EA 1ESMA 1VIAA 4I1UA 4XSHA 4GZLA 3BIFA 4AURA 5IRCD 5JFGA 4IDHA 3DKVA 3FYHA 5BN4A 3DL0A 1XMIA 1W47A 1OB5A 3THOA 1W46A 2GA8A 1KY2A 2PL3A 4JT2A 4TLAA 4AYXA 2ZJAA 2NO1A 1L4YA 4JL8A 4PZLA 5GJVC 1GOTA 1SXJD 3IBYA 3E1SA 4HB4A 3NEYA 1XCPA 4UXIA 4LSGA 1OFHA 4JSYA 5KOYA 2Z43A 1AKYA 4HLQB 3GQBA 1OH8A 4E03A 3B9PA 4DRZA 4B47A 3DM9B 4Q1AA 3T12A 1FQJA 3AF2A 2EW1A 3IBGA 1E6CA 3SJZA 3EIEA 2DFTA 3CB4A 4WZBE 4LJ6A 2JLYA 4UJ3A 5FPYA 1Z0IA 4DCUA 2IYXA 1VHLA 1Z0DA 2CMKA 3O8DA 4QC2A 4TYQA 1RKBA 2YC2C 1E69A 1II8A 4JKYA 3AP3A 4AKIA 1OXVA 2C9CA 3Q7PA 4ERNA 4Z51A 1VIYA 1YJ5A 1HEIA 3QOFA 2AXNA 4JLMA 1CRPA 4UQOA 2ERXA 3DPUA 4HLUA 5DSZA 3WNCA 1AZTA 821PA 2GK6A 1PV4A 3PXGA 3GLHE 4P4SB 2WWHA 5IT5A 1E0SA 1OFIA 5CJPA 5FTJA 3GLHA 4C7OA 4EQ6B 1NN3A 2ZREA 3CKLA 3H4MA 3U4QA 3NHBA 3U44B 1SVLA 2EWWA 3NBXX 4HYYA 3CRRA 3I8XA 3KXLA 4G5GA 1X1RA 1F60A 4PZYA 4Q4AB 4DSNA 4XIGS 5TXGA 2CK3A 4HB0A 1MRNA 4V03A 1SXJA 1O3YA 2OBMA 3C7KA 2FGJA 1K6MA 4URZR 4DT1A 4C2TA 2SHKA 3AVWA 3ZZTA 4D25A 1XRJA 2QMUA 2HV8A 4LRWA 2JJ1A 1ZCAA 4OK6A 3QF4B 5UKDA 1FNMA 1LF5A 2FU5C 1EESA 3UMRA 1LS6A 2H5EA 4IFEA 2ONKA 4JLPA 5DI9A 1VYTA 2P0EA 3F8TA 3P20A 2ZS8A 4LV5B 1IAQA 3MSXA 1NMYA 4A82A 2J7KA 3IILA 1W49A 4B35A 1I2MA 4ACAA 2AFHE 3OZXA 5L3QA 2ZUDA 4HAYA 1XU4A 4U5XA 4C0HA 1R5OA 2ZROA 4CEIB 2P65A 1E96A 1TU3A 2EYUA 2PT5A 2J7PD 3K0FB 1E2IA 3KUCA 1CJMA 2ZAOA 3I3SR 5HPYB 3SOPA 1GWNA 4XTRA 1E2EA 1DTSA 2HEIA 3X1WA 2A2ZA 3CUEF 2WICA 2YYZA 4PPFA 4HDOB 1FMLA 3TUJC 3K70D 3D6TB 2B8WA 4Q7JB 2Q9CA 1UKVY 3CRW1 5H68A 3LVQE 3DVLA 5HTKA 4C2UA 1G8HA 1Q3HA 4LY6A 1IQPA 3IKJA 4P31A 5JMTA 2E9SA 1JB1A 2R65A 3IIMA 3IIKA 1UEIA 2W58A 2WWYA 3K0CC 3BE4A 1T4GA 4WA7A 4JLJA 2VA8A 2C8VA 3FKSD 1SVMA 5FOUA 1I4TD 2NO0A 3U3RA 1ZINA 1U8YA 4G3XA 1K5DA 2IUSA 1CP2A 1HY3A 5J5CA 4KITB 3MRSA 1NKTA 3HU3A 1J8YF 1MO3A 3AEZA 4O2RA 2G83A 3SYLA 1NN5A 1S96A 3B2EA 2ZRDA 3BBPA 5CDFE 2B7CA 3I8SA 3ICQB 3CNLA 2VHJA 2ASEA 4Y0AA 3FTQA 1KI8A 1U0HC 2ZVQX 4P32A 3TRFA 2HT6A 1HYQA 3SQWA 2OCYC 4RCZA 4A4DA 4QHYA 4RD6A 2BVNA 4GNKA 2JEOA 4BFTA 3ZVMA 4JJZA 2JJ2A 2FSFA 2RGCA 5CIQA 3AV0B 1GDDA 1TF5A 4OK3A 2ODEA 1G3IA 5KU1A 1SKYB 1IM2A 3ECCA 3W90A 2GTPA 2N42A 5IF9A 1M7GA 2UVQA 3KKPA 5JBQA 2JIZD 2K5UA 2P5TB 2V4ZA 2YVUA 3OF5A 2KBEA 2ZI9A 3PUXA 4IDPA 3QG1A 2G77B 4C0KA 1TAGA 4TT3A 1U8ZA 1E9SA 1TX4B 3U60B 4DSOA 1FX0A 1DAMA 3B13B 3H0KA 4BLRA 1HTWA 3X1XA 4TSFD 3BK7A 4LI0A 2CHVA 2F3TA 3MWLA 1J99A 4O3MA 1KO4A 4RD3A 5JRZA 3BFVA 3UXMA 2QRNA 1SVOA 2CVFA 1YZLA 5HKKA 1NVWQ 5AR1A 1G3RA 5BYKA 2BDTA 1DEKA 3B78A 5HZKA 4RZXA 4LOAA 2QP3A 4Q9LA 1AK2A 1RRGA 5TB5A 5TDHA 1OH6A 1G7RA 3O8CA 1A82A 2H18A 5AJWA 3WMFA 2EYQA 3RS0A 1TADA 2FPKA 5CYOA 5DI3A 4Q18A 3TSOA 1JXMA 1ZBDA 3RRMA 2IYUA 3N2IA 1II8B 3V4RA 2WIBA 4OJQA 2IYYA 4AYTA 1OF1A 1KDPA 4B6EA 1ZM4A 4Q7LA 4A15A 2XZPA 3FKQA 2QP4A 2WKQA 2RB4A 2P6UA 3K0AB 1F3OA 2DY1A 5FOVA 1U94A 5CYPA 1E79D 2JLWA 3O8BA 2B6HA 1AGRA 2EU8A 4AIIA 1F2TA 3R8CA 1MV5A 1D9ZA 3L0IB 3GJ0A 1LY1A 3AF4A 5GJBA 2KJQA 5JS8A 5TARA 2KBFA 2ZI4A 1VDZA 2CNWD 2OAQ1 2PCLA 4FD2A 3GLHB 3THYA 1YZTA 4GBMA 4ZDJA 3EPHA 4OBEA 1W0KD 2HF8A 4LHVA 1BKDR 3KKMA 4YLGA 3U4QB 3F0TA 2XSZD 3CF0A 3TW4A 1P60A 1D2EA 2AFIE 3BC1A 4TL7A 3LXXA 3QXHA 4GI7A 4JKIA 4TSFA 1YR9A 1OW3B 4A8JC 4N0DA 4U02A 4Q1FA 2JGNA 1AQUA 1XTRA 4AI6A 4HLDA 4ZDKA 5IK2A 1J7KA 5FOTA 3TR0A 1GRRA 4PXAA 4QM6A 1ZNZA 1EGAA 4DT1B 4FXPA 4Q48A 1NMXA 3FVQA 3KKQA 2G0NA 2D3WA 2GXSA 1G64A 3VFDA 4NYJQ 2BIFA 2G1JA 4US2R 1KZGB 2QSYA 3GJ5A 1P73A 2QRZA 4D81A 2GBLA 4TQ9A 1XCGB 5F98A 2GJKA 2ZM5A 4M8NE 4OL0A 4N3NA 3LRPA 3A1SA 1A7JA 3HJNA 1W4RA 2WJGA 1Q21A 1VYUA 3ZVNA 4AG5A 5L3QB 1K8RA 3BH7A 2OLJA 3UG6A 4DDVA 1ZMXA 1NN0A 5EE3A 3AH8A 4LC1A 1AN0A 1Q0UA 2F1JA 4PC3A 2IC5A 3SJBA 4CYMA 3FGNA 3GJ7A 4DVGA 1R0YA 2WSSD 3T1QA 1TQ6A 2GJAA 3LV8A 3W8RA 2GAOA 2Q9AA 2FV8A 3GFTA 4GPTA 4WXRA 3T5GA 2QQEA 2G1KA 2QN6A 1HQCA 2Z83A 1RIFA 1CS4C 3T1TA 3OIVA 4Y0VA 3HYRA 2CNWA 1GSIA 2HLDD 2WJIA 1BYIA 2C2HA 1W0KA 3AKDA 1S9HA 1DAFA 4B43A 2XSZA 2ZEJA 4BLOA 1NL3A 2EFDB 3VX4A 3SU8A 1IXZA 1SKQA 1Z6XA 2QEQA 3L0SA 4LCBA 3SBEA 2VF8A 1GKUB 1T3LA 4HLCA 2GXUA 3TAUA 2IX3A 4BPBA 5AUQA 5EXTA 1KMQA 3U3MA 2VLIA 3U6KA 3GLIE 4B3FX 1S3GA 3V00A 5C18A 1V5WA 2QTVB 3CR8A 2RGXA 4FWIB 3GLIA 4D0GA 5FOWA 3KL4A 5HCNA 4FIDA 3SYKA 2JCSA 5FBLB 3NG1A 2CCJA 2EQBA 4JS0A 1DAHA 3WNBA 1FP6A 2NQ2C 1UBCA 1NLYA 1E2FA 1XJ0A 4KO8A 3K0CA 1G5PA 2FJUA 4XOIA 5FTNA 2C04A 1WGWA 1W44A 4PZZA 1KIMA 4UNQA 4LJ4A 1D8TA 2FZLA 2NO7A 1VMAA 2IXGA 1NG9A 4F4CA 5KYKA 4NTZA 2V6JA 2IUTA 3MFYA 1KMHA 1T91A 3L8YA 4B34A 2WSSA 2EFHB 2RGNC 4B3XA 2VL7A 3BH0A 3PJRA 3RYTC 4DIEA 2FEMA 1M74A 1X86B 4W5HA 1D6JA 2PBRA 3CW2A 3K70B 1N6PA 2BEJA 4NDZA 1Z83A 2ANCA 2R6AA 2WHXA 5EXXA 2HLDA 2B92A 2WBLC 2WWIA 2IYTA 3QKSA 2NPIA 1KI1A 5JSZA 4TQUS 2R9VA 2ZRGA 3OEHD 1CR1A 3KXIA 2WIAA 2FSIA 2VP2A 4GOKA 5D3QA 4YMSA 4P3YA 2PJRA 3LDAA 2ZU0C 1XMVA 4LJ8A 1UADA 4XVQA 2A5FA 2VHCA 4MRNA 3UANA 1BH2A 4HAVA 1ELOA 2RHMA 3I32A 2EFEB 1E9CA 4Q4HA 2GKSA 4XD7D 2QUZA 3OESA 3TSZA 2IBMA 1FFHA 4DDUA 2JASA 2VQSA 3TK1A 1M6NA 5CK5A 2ZRPA 5DI3B 5HCIA 3EPJA 2DR3A 4AWXA 1KI3A 2ZRKA 4JVNA 3BFXA 1G19A 3QKRA 4M22A 1N6OA 1UF9A 5HE8A 4JLBA 2CE2X 3QXCA 1NIJA 2GAAA 4JVLA 4RD4A 2OV2A 4PQYA 4G5SA 4DCNA 5BXQC 1E2PA 4JVSB 1GAJA 1P6XA 5G3YA 2ZRHA 2BMDA 2ONJA 5A4JA 3A4LA 5TV2A 2ZR9A 5BW8A 2A78A 3OE7A 4PO8A 1SQ5A 1KK0A 3EX7C 2GJ8A 3PG5A 2N46A 1DADA 4MQBA 2IHYA 1IN8A 3GJ8A 2OLKA 3CPJB 4Z1MD 1F2TB 2J0SA 3LD9A 3RDPA 3W8NA 4F38A 3AVQA 3FWYA 3P4XA 1RPZA 3G82C 2IYSA 4M1YA 3RS3A 1XPUA 2QI9C 1KJYA 1NVVR 5GADl 3THYB 2QM8A 3J81k 2WJHA 4FMBB 4GMDA 1SHZA 1ZNWA 1PJRA 1ZC4A 4LPSA 4Q47A 1VTKA 4JSTA 4F93B 3U7HB 2WMOB 1DBSA 3UWOA 2QPOA 2J1LA 2EFGA 1Z29A 2IWHA 4G0NA 4PAOA 2LKDA 2QAGA 3OEHA 1GVNB 2FX3A 4GSYA 3CRVA 1EFTA 2JATA 1GNQA 4B73A 1NLFA 3W6PA 3C16C 3U2QA 2BBWA 1FUKA 2FDCA 2V55B 2NZ8A 4M2LA 3QEJA 4TMXA 4TL9A 3RABA 2ZE6A 1U98A 3QQ5A 4KI0A 5EE5B 4WZAE 5FUWA 5LD2C 3AVTA 3B1WA 4GP6A 1EFCA 3JVVA 1ZAKA 3NBZC 3TKLA 4XD7A 1KK1A 5FFMA 1Y63A 1KK3A 2ZYVX 3OIWA 1ZW6A 4QG7A 4DHEA 4EFMA 1XCMA 4NYMR 1TQ4A 3B82A 3U7EB 1HH4A 3BS4A 4E22A 3K0EA 1X8JA 2A7QA 2R2AA 1XTKA 2BJWA 2Q3FA 2ZSEA 2YINC 4P33A 1DVRA 2VSXA 2VO1A 4EPWA 1M8PA 4A92A 4DCVA 2A5GA 2C78A 4EPVA 4BFXA 1NN1A 4G5OA 1Q12A 1Q22A 2GDJA 2VBCA 3FDIA 1E9EA 2BBSA 3K9LA 4X8HA 2EVWX 4Z1MA 1A4RA 1E4YA 2FSGA 1AKEA 1I4DD 3W34A 3TSWA 4TLCA 1G3UA 4A0FA 3ONWA 4KFRA 1RC8A 1U81A 4S35A 1LTQA 4ZCMA 1IN6A 4BRWA 2ATXA 2E87A 2DBYA 3NIBA 2OFXA 1SVSA 4XSGA 1E0KA 1LNZA 2LCFA 2QMOA 4TYPA 4TYNA 4URWR 1P9RA 2BCGY 2ZJYA 4R7ZA 2QQ0A 4M53A 1W5TA 1Z0AA 2OZEA 5K8TA 2A5DA 1YR8A 3B1YA 4B48A 3ZD7A 3KQUA 1R5BA 2JLSA 4GT1A 1S1MA 4UKDA 3VHXA 4B75A 1ZUHA 2JLQA 5G53C 2BOVA 4BFUA 3LFUA 2GCNA 1RYHA 1KTVA 3GLIB 1E9FA 4NMMA 3AVVA 2AWOA 2OM2A 1GILA 2WKRA 1SVKA 2CHGA 3EZ7A 1XP8A 4PSVA 1Z63A 3MG9A 3I4LA 4M1KA 1ZD9A 2WOJA 1FUUA 2DWQA 1Z3IX 1CR2A 4DWJA 1MOZA 3GJ6A 3BB1A 4GRAA 2DCUA 3KQNA 2WAXA 3FB4A 2W6ID 1R8SA 4ARZA 4D82A 1NSTA 5J4LA 1TPZA 4URXR 5HR5A 4P4TA 1KMHB 2J0QA 1ODFA 3KFVA 3RSLA 1Z47A 1OE0A 2WPDD 2H16A 2P5SA 3IEVA 3SFZA 3AM1A 4NCKA 4A6XA 3AP2A 3MD0A 1Z06A 3VR1A 3MUFA 4TL8A 3A4MA 2ECKA 4D0NA 2REOA 3PFIA 1H8HA 3CZQA 4FMCB 4IDQA 3TVDA 2DHRA 1YE8A 4MRVA 2X2FA 3CPHA 4N1AA 4LGMA 4YDHB 3E70C 1N6HA 3QKSB 5DYIA 1VG0B 4YXWD 4DKXA 1G8YA 2GF9A 3OAAD 5JSZB 2FWRA 3ZGXA 2F43A 4V0LA 3K8YA 1W4BA 2OCAA 3PUZA 2LWIA 5L3RA 3EW9A 2WSMA 4GZMA 3B8HA 3H1TA 2C95A 2RGNA 5JHGB 2GJ9A 4OHVA 2H7VA 2IHBA 4GL2A 3ZZUA 3VNUA 2A5JA 1SZPA 5L3SB 2OAP1 4NCNA 3WMEA 3IEUA 1NVXQ 4IRUB 4Q5IA 4Q4HB 4H1UA 3R20A 1KK2A 2IYWA 3C8UA 3EZFA 3KTAA 3IQXA 3PEWA 3ND8A 2VF7A 1DAIA 3VTKA 4C0SA 1OXXK 1W4AA 2IF0A 2PX3A 4JYBA 1SVIA 5FBWB 1OHHD 1VCNA 2XOKD 3QKRB 4V0MA 4PX9A 1TUIA 3T34A 2V3CC 3MWKA 1YZUA 3WYFA 2E1RA 5CM8B 1XF9A 1XTSA 2W6IA 3KX2A 1J8MF 3QEOA 2VPPA 4A6PA 2QTHA 2ZRIA 2D06A 2W0SA 2CK3D 2WPDA 4LYAA 2FOLA 4NCIA 2YWFA 1AZSC 5DH9A 5FBRB 5LPNA 4L15A 1R6BX 2RH5A 3FMIA 3W3AA 4L16A 4JLKA 3RRZA 2QBYA 1XZQA 2PLFA 2WVJA 3NVAA 3UATA 2JJ1D 3CONA 4OQMA 2FFQA 4JLVA 1YR7A 1P2UA 2HCJB 1ZNYA 4G5RA 1P75A 2BM1A 2FPMA 3T06B 3KJHA 5FUVA 4YXWA 2BJVA 3PITA 2XGJA 1A2KC 3OAAA 1Z0JA 2IA5A 5DHFA 1JAIA 1U9IA 1G8PA 2QAGB 1N0UA 3TQFA 1P9NA 2R6DA 1ZU5A 2D7CA 4DLXA 5EXPA 2MSEB 2FZ4A 2O0HA 2Q9BA 2ZI6A 3VR6A 5H8WA 4IEEA 1RRFA 3X2SA 4C0BA 2DFNA 2NZJA 4QNMA 3VKWA 3LAWA 1TQ2A 3K0AA 3PIRA 5EUQB 1JI0A 1Z0KA 3K09A 2XITA 3CWZA 3QIAA 3WBJA 1UKYA 4CRWB 1YU9A 2FPLA 4ZV4A 5DO9A 4P4UA 1OXUA 1TNDA 2GZDA 5DIFA 3NTUA 1UEJA 5GVRA 2XAUA 1H65A 1OFUX 4ZPXA 4C4PA 4B74A 2VIIA 4OQFA 4A8JB 1OHHA 1QF9A 2XOKA 3LBHA 1ZM9A 2RGDA 4LC0A 4NYIR 5B30A 2WZQA 3UMFA 5BN5A 121PA 3I1FA 4NPHA 2BKEA 1S9DA 4ZDWA 3WXMA 5ANRB 1CULC 1MRSA 2MMGA 4JZKA 2IXEA 2AN9A 2JLUA 1TMKA 5AJZA 2GVZC 1AA9A 2V1UA 2F1HA 3RS4A 4W9MC 2J59A 1GKYA 1DO0A 4LJ5A 3TR5A 3CLVA 4IDNA 2YHSA 5G40A 2F6RA 2OBLA 4I1VA 2OT3B 3H84A 4DDTA 5KNDA 2ZR7A 4AY2A 3B5JA 3TIFA 1Z5ZA 4PAQA 4KYUA 4D0LB 3ZIAA 3LNCA 2CDNA 2OHFA 4OQLA 3BB4A 5IHPA 1OLOA 4GOJA 4K8OA 1XTQA 4A2QA 3GLGE 1AS0A 1HE1C 1KJWA 2ODWA 4HAWA 4UNSA 4US0R 3KQLA 2JJ2D 4BWYA 3GLGA 4ESHA 2CHQA 1P62B 4RZ3A 2CEAA 1JXOA 4RD0A 1FNNA 4NHOA 4MKHA 4NL4H 1OH7A 5CLQA 2OE2A 2ZI5A 1RE0A 2IYQA 3KJIA 2WKPA 4I99A 1DS6A 3KJEA 4QBHA 1QBKC 4LJ9A 3CF2A 3VKHA 2JDID 5KSOA 2GEDA 3MJRA 3QNUA 3FHCB 3NC1C 4EFLA 3CX6A 4TT3D 3EPKA 5F3WB 4IXNA 2GRJA 1XPOA 2WJVA 4B2LA 1E2NA 4TZ6A 4URVR 1KSJA 4ARZB 5EZ6B 5FPHA 3SN6A 4AKHA 3AKYA 1T8UA 2ZJBA 3PV0A 4H1VA 3P1JA 3A4NA 1JPJA 4CT4B 4TTPA 1TUEA 2P67A 2WJJA 3BD9A 5HKKD 3MWYW 3EPLA 2IYVA 2R6FA 1NMZA 3TLXA 1G6HA 3DEFA 3G0HA 1FQKA 2AKAB 2GZHA 2AK3A 1L7VC 3KJGA 4HZUA 3RS7A 1VYVA 3Q9LA 5FOSA 1IONA 3E5HA 3CO5A 1YKSA 2O8EB 1N0WA 4MGZR 4QGAA 2F43B 4FMCF 3TQCA 3CRQA 3RVBA 5KNCA 4Q21A 5CDFA 3QY0A 3TE6A 3CF6R 3FMPB 3ZZ0A 1BMFD 5H1YA 2PJZA 2LKCA 1B0UA 1P72A 5ELXA 2YZ2A 5TMPA 2R6CA 4QKQA 5FOXA 3SZRA 5SZJA 4W5WA 2IEZA 1JQJC 5FUYA 3HYTA 4AC9A 1YVDA 4QBIA 3C5CA 3AP1A 3KTAB 4CZ2A 4D80A 1W36C 521PA 2HYDA 1G18A 3DZDA 1TTTA 2ZRMA 4X8OA 2GEUA 1JBKA 2JDIA 3TH5A 1XFAA 5FBVB 3AQ4A 3AVOA 3EIHA 5DISB 1BOFA 3M4YA 1XPRA 1FMJA 3W6NA 2PCJA 1C1YA 3ZJYA 4JL5A 1JR3D 1AQYA 5JWOA 5E3HA 5J40A 4DLSA 5JWHA 2OG2A 1XTJA 2GESA 3QXSA 2D62A 3BFKA 4LJ7A 5IK2D 2YKGA 1Z6AA 4II7A 2PMDA 4PSKA 3U3OA 2WWFA 2IK8A 1P5ZB 4KHZA 1E2KA 4DLVA 5AUOB 1M2OB 4C0LA 2QBYB 3A1TA 1EWQA 2ZI3A 3K9GA 1Z2AA 2ZJ5A 3HWSA 3RLFA 3DDCA 3D31A 1OKKA 3DO6A 3ZD6A 5JHHB 3VNVA 1N6IA 2RAPA 3CH5A 2VTKA 1G21E 1GL7A 1Y3AA 4R2HA 5SZKB 1GM5A 2PT7A 1IY2A 2CL6X 3LH5A 1U2RA 1BMFA 3FFAA 3LQQA 2J0VA 3A37A 4IEIA 2OO7A 1R8QA 1T3HA 1NJFA 4EJSB 4D4JA 2N1BA 4F4JA 3L8ZA 4Q03A 2H92A 5E7JA 1N0VC 2JLZA 4IXMA 2QT1A 1G5TA 3HPRA 4B3DA 1S0UA 2DFLA 4L8GA 1KNXA 1VHTA 4F92B 5TVKA 1E2JA 1KI9A 3JZAA 4OI2A 3S1AB 4QOSA 2Q3MA 2RHDA 3EWAA 1JR3E 4B2IA 3T61A 2QGNA 4CDGA 1E9AA 3C41J 3HPQA 1JR3A 2REXB 1FTNA 3BXZA 3QBVA 4PO1A 5CIWA 4YDSA 1RRCA 3U3KA 2VSFA 3GJ4A 1IBRA 3ASZA 4OHYA 4Q19A 1W2GA 4FINA 1CRQA 1ZNXA 2F1RA 2F9LA 2VP4A 4PC6A 4R9UC 4NYJR 4CGZA 4DLZA 1Z2CA 2G0TA 2Z0MA 3NKVA 3A6PC 2H1LA 2FN4A 3AVPA 3GJXC 4BLQA 4MYTA 1CR4A 3ZS8A 4B6FA 3IUYA 4K46A 3KZ1E 3X1ZA 3CX7A 3QKUA 4LHZA 1ZUNB 4Q9JA 2ORVA 3ASYA 1UDXA 4A1FA 4ZIRA 1N5LA 4XVRA 2OBNA 4OQNA 5CLLA 4JVMA 4TLBA 4MYCA 4Q00A 3T1OA 4C0QC 3RS2A 4NU0A 4JLDA 1ZC3A 1KO7A 4L5BA 4IFBA 4JT4A 1G291 1M1YE 2O8DA 1HT1E 3R9WA 1VPLA 1KSHA 1DG1G 1KYIA 3GLGB 1OIXA 2ZIAA 3WHKA 2R44A 3QKTA 4LJYA 3NDBB 4PPNA 2DWPA 2J9RA 5JEEA 1NNEA 4O0MA 2HXYA 4XTCS 2AKYA 3IIJA 1E1RD 3REGA 4POAA 5K8LA 4XH9B 4JIMA 1NY5A 2ZRBA 2V9PA 2KB0A 3E2IA 1BYUA 4QGGA 5KO2A 2RKOA 1NBME 3DMDA 1S1CA 4LZZA 2AL7A 4C9BA 4KFUA 4WW0A 2ZQ5A 5JZVA 3WP0A 4OKSA
chains in the Genus database with same CATH superfamily
3SG0A 4DG8A 1VHWA 3CEPB 3KYDA 2IEDA 3T5DA 1HFKA 1FFWA 3UKDA 5DK6A 2J9YB 4MKXA 4NCJA 4KN6A 3NEAA 4FI3C 4NCQA 1ZK4A 3WMRA 3PGKA 3L1HA 3Q7QA 3RARA 2LNDA 5CMLA 2V4UA 5JJ5A 3SC3A 2FWJA 3AFMA 2KHZA 1FVHA 3J7TA 4L9SA 5FBHA 3A6HA 2JHGA 1CGNA 3A7DA 5DXJA 2V1XA 3M8KA 1IY1A 2DU8A 3GA5A 2VHXA 4XVHA 2ZXEA 2VJMB 4QXRA 5EP1A 4IIBA 3RFCA 3C8HA 3SKYA 3KXPA 1EKYA 4KXFB 2NNWB 3CSSA 1AK9A 3CM0A 2JGKA 1A5ZA 2W2LA 5IBQA 1OILA 4OJKA 1DMSA 3SR0A 1CY6A 4FE3A 5EUMA 16PKA 1V7ZA 2H3EA 4HB2A 3C3CA 5AT1A 1AUOA 2WWGA 2DQYA 2XKAA 2Y0DA 3FUVA 3T4PA 4LOLA 3QLJA 3ZXXA 1F0KA 2X5OA 3BD8A 3UHFA 1CWUA 4J16A 9MHTA 2XODA 2H8KA 4BWFB 2J3EA 3FLMA 2D2FA 2H0AA 3JZMA 4EBFA 5I45A 5HQTA 5ERXA 2DQ4A 3V1NA 2JBWA 4I4NA 3ADCA 2XD9A 1G1MA 3D0KA 2ZBVA 4DJAA 3MCTA 2O2IA 4KXLA 1XZPA 1S7GA 5FL3A 3HB7A 5EWMB 4NYMQ 1GUDA 3L5OA 1X6VA 3NOVA 4GQBA 1E2LA 2JLXA 1CX9B 4ZI3A 1OX4A 1ONNA 4QFDA 3QXXA 2FMHA 4N0QA 5EP3A 2MSLA 4HXGA 1C4XA 4BX8A 5DGXA 3RC9A 1B14A 1UFQA 2GHRA 5LMZA 1HA3A 1LW7A 1W73A 4ND8B 1VLZA 3TJMA 5LU8A 4W8PA 2FEKA 3F6BX 1RXQA 1R74A 4M87A 1BDJA 2FYTA 3HCFA 1T8PA 5C5IA 4OUDB 2O8NA 3NDPA 4P5DA 3LVRE 1NF9A 5AVQA 5J47A 3D6MA 3PHHA 4IF6A 3IXQA 5IDYA 4S04A 4ZEMA 2KQUA 1EG7A 4GP7A 4TUYF 1H9TA 4C7VA 5JADA 1AKWA 2L82A 3DEAA 4KZPA 2BZ1A 3QU2A 4YL1A 1P1HA 3UBTA 3RU7A 4GIBA 2IS6A 1EJ2A 4Q39A 4LWQA 5EXEA 3KE9A 4JIGA 3DE7X 2O8BA 4LY3A 4ZFNA 1YL6A 5A71A 4U2FA 2ECPA 3D3EA 5HS6A 2QJOA 1N8SA 5FEUA 3LBIA 2GYWA 2DX7A 4DWOA 2O3SA 3I3OA 1UBKS 3UJAA 5EK0A 4RY2A 3UH1A 4MVRA 2WU4A 1O94C 3L8IA 2G63A 3SVZA 3UB4A 4WNYA 1JQAA 3H5VA 2HSQA 3RADC 2WFMA 4FFBB 1BVRA 2AC4A 3RAEC 1XZNA 2F67A 3KYJB 2QB5A 5LL6P 1WPXA 2X8JA 1UK9A 4RNDB 4O08A 5FT9A 1FFSA 3RANA 4E7PA 4D9BA 1NVTA 4AO7A 4CTMA 3E61A 2LPMA 4EQZA 4O1HA 2WB4A 3DL7A 4ZYZA 2G17A 1AQNA 5DYWA 2CJWB 8MHTA 1XEWX 3NORA 3GZTB 1VPEA 4UD2A 3OQIB 4P7BA 3CWQA 3K32A 1WPRA 4YT4A 3X3HA 1M1ZA 2Q00A 2GK7A 1TFUA 5JI3E 4CEJA 2E3JA 2DFPA 2P0YA 3AW8A 5IJ9A 3LKZA 3QUCA 2XTJA 5FV4A 5IAGA 4IZIA 1TMYA 5JI2E 3UMMA 2ZJOA 4E15A 4R6XA 2I7TA 5EYPB 4GMKA 5LP6A 3HUUA 3FTDA 2D2EA 1DDIA 4LACB 3CEMA 4JQCA 2KI5A 3ZG6A 3T99A 1B8PA 2JCXA 3OT5A 1EAYA 4K1OA 1AF4A 2W6JD 1EX9A 3ZY4A 1CZOA 2J0UB 1UMDB 3QVZA 4L22A 1DI0A 5LMNB 2ZETA 2ZZMA 2X8WA 1RAIA 4EG1A 2P5YA 3BWYA 2J3DA 3U1TA 4C7XA 4G24A 2X8BA 5B7PA 4UPVA 3UPUA 4XVUA 2Z8YM 4YHHB 1HK7A 3TW8B 1NW4A 1WY5A 2Q5HA 3F7TA 2B5VA 2OVBA 5KPJA 5FBZA 2ZIXA 4QU5A 5ADUS 4ZDIA 4DLTA 3ME5A 5B4TA 1BO6A 2X9QA 3NIWA 3EIOA 4LF4B 4TROA 3RSSA 1GVHA 1H2WA 2VYND 4OYRA 2W0MA 3NRCA 1EK1A 4K40A 3M0EA 1BJKA 1SCDA 4F6LA 1QU2A 1DPGA 4EA7A 2PYDA 5JVEA 1VLTA 1CY1A 3HDTA 3RJZA 4M8KA 4HN9A 2ZPAA 1XNGA 1N3IA 4RWEA 4P3NA 1RZUA 1WAMA 4G4GA 2WHPB 4LNUB 1C9EA 4BRUA 1FJGB 1O0BA 3ATPA 3L0OA 4P3KA 2JGDA 1FFEA 1IB0A 3I28A 4IDOA 3N0RA 2G06A 1ANKA 3QX9A 4EKNB 1ZCZA 2V7PA 1NJSA 4BO7A 1DJOA 3H2YA 5EXDA 5AJYA 2F59A 4ND2A 2RHRA 4E0BA 2YXBA 5H02A 2P9QA 1QIKA 3ORYA 5KOHA 3HRIA 4K9LA 1JQLB 5MGNA 4UUQA 1KAGA 5BYJA 3B9QA 1UPBA 4IWYA 1XXHA 3GLFB 5A3VA 4ALIA 2COKA 1QOZA 2R97A 1G21B 2WZFA 4U1RA 2ZVDA 3RIMA 4DMKA 2Y0EA 3W5CA 4AS2A 2F3RA 3SYNA 3UXHA 3WLKX 3CMCO 4BFWA 2ZSFA 3RSOA 4EYKA 4AWBA 3QPAA 1ETUA 4DJTA 2R6R1 2E7ZA 2UVPA 4JBGA 3ULKA 1VL5A 4EITA 2PMKA 1J0XO 3BN3A 2X0DA 1SU6A 4TQAA 1RWPA 1GV1A 2IITA 4M0CA 4HAUA 4DZZA 1TM3E 4INPA 3ADOA 2QN1A 4MYRA 2XLWA 3MWEB 4WD3A 1NBHA 3KSAC 2WSLA 5D6OA 2C61A 3IVCA 3IO3A 4RADA 5IJAA 1K7CA 2J9UA 1MLDA 5ALYA 1YE3A 3WLEA 3EBLA 4N39A 3U3ZA 3I1IA 1Z26A 3KS9A 5F12A 4PTYA 2C9YA 2FMXA 5I4IA 2PYIA 4R54A 3M1CB 5CLIA 4LN1A 1KP3A 4FEAA 1O9HA 4YREA 1GU1A 3ZHUA 5CFPA 5I4KA 3WV4A 4X66B 1YHZA 2D0OB 2LIPA 4HB3A 2BM0A 2MR6A 2VUHB 4G0WA 1WOYA 1NFQA 1GQQA 1Z16A 1JFRA 3FIUA 3EXHC 2JFNA 1ZEMA 3WK9A 2FZCA 1EK5A 5DM1A 3LKDA 1QRSA 3LEOA 4JYCA 4PIVA 1FW8A 2F00A 2P79A 2PR7A 2DFKB 1U0BB 3PD1A 1OVGA 3JTLO 4DMUB 1HX7A 1JA1A 4JP1A 3LUGA 2EZ4A 3DMHA 9ABPA 4UBNA 3FYHA 4TV9B 1LSSA 5AW8A 1VPWA 4UM9B 2EATA 1R8XA 3IQEA 5JE8A 2J6HA 4AF6A 2UU9B 1C8LA 1ZW3A 3CO0S 2R0QC 1TUGA 3BREA 4BP3A 3QYPA 4PLYA 4EL0A 5D86A 1O89A 4L0CA 4EKWA 3SLKA 4C7OA 1RWNA 1HDGO 4G5GA 3Q7RA 4YRDA 2FGJA 1HRKA 3V6LA 3AR6A 5BR1A 4QFBA 2F8SA 5BUZA 1IATA 1W1UA 4LRWA 4NATA 4FZVA 1Y9EA 3F8TA 3KQTA 2PU5A 3AR8A 3CLKA 1PBNA 4QG3A 3W2HA 1W49A 4B35A 1R5OA 2P65A 2J7PD 1E2IA 3I3SR 3I6MA 4ZI7A 1JF8A 4ZVVA 3MEQA 3GXOA 2A2ZA 2Q9CA 3GD5A 3NYIA 2NUTB 1Y8QA 4OIMA 1OMOA 2G4VA 1YCDA 3AUJB 4BQEA 3PC6A 4UULA 3QTBA 4O6VA 2PV7A 4HV4A 1HTTA 5EJFA 3V97A 3R2JA 4RCZA 4GNKA 5F52A 4FEGA 3AEQA 1IM2A 4CF6A 1KYXA 1RZRA 2YVUA 3UBMA 2QLMA 2RONA 3B13B 3N2GA 4YEDA 1MIHA 1RQGA 3ZQUA 3EXEB 5HKKA 1PX2A 1AUPA 3LKBA 2MWQA 1OAOA 1U5BA 4X1YB 4B3SB 3QXGA 1NXVA 5KAPA 4O4HB 3DBLA 3FPBA 2UYOA 2CHEA 1Z15A 3WNVA 4UUBA 1Q7TA 4FD2A 3RVQA 3GLHB 4NBTA 3MOIA 4CQMB 1AQUA 4XYLA 1GYPA 3CJRA 1QF7A 3KBBA 3KKQA 3PJGA 3LCUA 1EH5A 2G1JA 1GFWA 1XCGB 5F98A 2UZ4A 2J3HA 2R7WA 1YS1X 3LLVA 3HCDA 3ILVA 1OCRC 1H0RA 1NN0A 2NADA 3GJ7A 4G97A 4GXQA 4OHMA 4DIFA 1RP7A 5T4EA 1YAHA 3OIVA 4QT4A 2ISQA 5CUQA 2J9VA 2EFDB 4DJ5X 4U63A 1QXSA 1S3GA 3H6GA 3F1LA 4HC4A 4RYLA 4JEBA 1E4EB 1VL8A 3GGGA 3PE3A 1FBNA 2CF6A 4IM7A 1D0YA 3CE6A 4PZZA 3O2QB 1Z68A 1R3DA 4NJEA 3H6HA 4F5EA 3W1EA 1T91A 4AZTA 2WVGA 4FEEA 1X86B 2GRUA 2JEYA 3R40A 3OO0A 1U0NA 4QLOA 5BSTA 1I2BA 4CDRA 2RK4A 3KVRA 4ENUA 4ER5A 4V0QA 2EPLX 3UCEA 3TM4A 3BFXA 3QKRA 3R9KA 2YV2A 2ZRHA 4UD6A 5BW8A 2EL9A 2ZUWA 1ZITA 2GBGA 3EBPA 4E7OA 1XQ9A 3SXYA 3JZ0A 3TTUA 1U7HA 3VOTA 4EF5A 4WT7A 1HE5A 1S5PA 2VCHA 1H3FA 3B3JA 2W4BA 4DA0A 4GSYA 4INZA 1ULSA 2AYYA 3DOCA 3TEFA 2DP4E 5FUWA 1G59A 2FVYA 3MINA 5L53A 1RPAA 4WASA 1U1DA 3CLUC 4IFTA 3QEMA 4RUKA 2V9ZA 2VCYA 3DMPA 2CUZA 3K0EA 1PJ4A 2ZB7A 4P3PA 4AN1A 2AT1A 2I2FA 1MTZA 3UK2A 5F4BA 4EPVA 3UPTA 1VIDA 1OLXB 2GDJA 3ZWPA 3W34A 3TSWA 4A0FA 4KFRA 4HDMB 5CAEA 4TYNA 4R7ZA 1Y5IA 1ZUD1 4JGIA 4XRRA 3D8HA 3D1LA 1X7XB 2FJPA 4L8YA 2BE7A 4KYTA 4P4NA 1EDZA 4LZOA 1ZD9A 5HWSA 4JYMA 2PFDA 4UHJA 1PV1A 1RKUA 4V3CA 3DR3A 5AVVA 4TWAA 4F71A 5L0JA 4QO7A 3CPHA 4HNHA 3ES9A 1F2DA 1FLVA 4BVAA 1G5HA 1P4RA 4JR0A 4YCSA 1Y7HA 1IZZA 2GJ9A 3QBEA 1XSEA 3IEUA 3LY8A 3PEWA 1YAJA 3DEZA 3GVCA 3EUFA 4IJ5A 2V3CC 3AUUA 5DZSA 5F1OA 1DNPA 2NTVA 3K1AA 4MV7A 1DIBA 4WX2B 1R6BX 2X76A 2RH5A 3R0JA 3NAZA 4BCBA 1E5XA 4QOHA 4MWDA 5B1BC 1X7HA 1BKYA 1IRXA 4N6NA 1FS4A 1WVIA 1A2KC 3F6RA 1U9IA 2MSEB 4BJ5A 4E0HA 3ESQA 5EZYA 1JI0A 2CDAA 4YMLA 4PJMA 3VOSA 1TNDA 4BNDA 4WADA 4ZPXA 1JE0A 4RIFA 2EX0A 3ROPA 4PZEA 2RGDA 2Q3BA 1UK6A 5GY7A 1MRSA 3V46A 1S89A 5I7VA 2WNIA 2BP7A 4W9MC 4OAPA 3LRXA 1VIVA 2CFTA 2OBLA 2CXTA 2XQJA 1X7DA 4QYIA 4X7PA 4ZREA 4A6DA 4D0LB 3JD3A 4P92A 3ZBTA 2ACVA 4YRKA 2QV0A 1GS9A 4C4ZA 3GLGE 1SN7A 1W8DA 2A86A 4JI1B 1ZR4A 4XD2A 1ZK0A 3MWFA 3WGYA 3ZK9A 4IIGA 3WKEA 3FHCB 3NC1C 1RTKA 5AK4A 4UHFA 5EZ6B 4FYKA 2YXEA 4I1OB 3I5AA 4Z0HO 4WA8A 3SJUA 1UM9A 4F4DA 2C8LA 3WKCA 1RYMA 4DLPA 4LRYA 7REQB 5IN5A 4Y6PA 3TE6A 5I9BA 2O2SA 4EELA 3IKVA 5TMPA 5K0SA 2EZUA 1J1IA 1NXTA 2GEUA 4RIEA 4ZGBA 2MIIA 2OHHA 3BAZA 3EQ2A 3M4YA 3CLTD 5HF5A 5JNUA 5CGQB 4W5TA 2OG2A 4RTRA 4KQWA 1B2RA 1K98A 3OSUA 2PMDA 1UFKA 1DXQA 3D31A 4LSWA 4G0YA 2C5GA 5ARDA 2HOQA 2X5XA 2P5UA 3A37A 3MPUA 1Y98A 2HO5A 3FBWA 1P5HA 3PQ3A 4AN0A 4E17A 3F4LA 3G4XA 3H4VA 2W11A 1DKPA 4DIOA 1VHTA 1RXWA 2RHDA 3S5UA 4QOJA 4YDSA 3U3KA 4ND3A 3GJ4A 3ASZA 4KKXB 3C8ZA 1N5OX 1CRQA 1W9MA 2F9LA 5JYDA 1RT9A 5CT4A 2EKLA 2G0TA 4EATA 3KG2A 4Q9JA 2HCTA 4C0QC 3WV5A 4JVMA 1XTVA 3CVUA 3HBFA 1WP4A 1WZEA 2P1AA 4KOEC 3PKJA 4UDOA 4LJYA 1PW7A 5IC5A 3CBGA 1H9BA 3K9WA 4PIMA 3DB2A 5D84A 2X1HA 2XCTB 3DMDA 2PUFA 1J33A 1T4MA 3LLMA 1N2GA 1GG8A 1XQ1A 4GL4A 1C30A 2GHQA 1R6XA 3S44A 4GFDA 1Y34E 2XM4A 2HGZA 1GARA 3ORHA 1E0AA 3E22A 2GAQA 4B0PA 2VRWA 3AUYA 1XWJA 4XFJA 1C4OA 2BGLA 1D2GA 3ZU3A 5DLYA 1R0KA 1ZYUA 1HDZA 1FFAA 3NCTA 2GS9A 2VUIB 3EC7A 2OEVA 1I7NA 2EC5A 3ZV7A 1JQEA 2QM7A 1IY8A 4F60A 3LHIA 4Z8XA 3K4PA 4BQNA 2HWUA 2C00A 2XM0A 2PS9A 3N1UA 3JTEA 3GROA 1Q6YA 1EVKA 4PSAA 3WGKA 3Q5EA 3M9LA 3I4FA 2YNMD 4EEKA 2EP8A 2HTFA 3FTPA 2H4XA 1LD3A 1XXLA 4EGAA 1FU8A 3WLRA 2JFYA 1PUXA 4NNOA 3RK0A 1JPNA 2AR7A 1ILEA 1XN1A 1UJ6A 3O83A 4FNMA 1XD9A 4WTOA 3OLYA 1JW9B 3EF3A 3DAHA 4R2WA 2HA0A 4P6VF 3GVHA 4F2WA 3V8RA 3DW1X 2PA0A 2V7EA 3LKVA 1OLSA 3TF5A 3KJQA 1BVUA 3FCOA 4QUIA 2J4CA 2DB4A 3OIUA 1Z75A 2GR9A 3EAGA 1RBYA 5JNTA 2WA2A 3MTGA 4PWZA 4X6YA 3MLBA 4JP8A 3DFFA 1YR2A 1FDUA 1RXSA 3BRCA 3FE2A 4P08A 4NULA 1NSFA 3TOVA 1J25A 3E23A 2QSZA 3ASUA 4PSUA 4NE7A 4OOEA 3IPXA 3M2TA 2QXTA 1JH8A 3BULA 5CCBA 2DOKA 2QX6A 4DA4A 5C8YB 4BVEA 2FFAA 5FR1A 1U0GA 4YYZA 2VZ9A 3K1IC 1P3Y1 3TIXB 2PUAA 5HJ7A 2GYUA 1H1TA 1KO1A 1WCYA 2IEYA 2IE8A 3DNMA 2V7XA 3BIJA 1C1DB 4PLVA 2YWGA 4NMHA 4ER3A 4ZV7A 3KZXA 5JU6A 3GGSA 3WKAA 2C83A 1NNSA 5LZ5A 2HXSA 4G01B 3FOEC 4JHLA 2VDWB 1R0ZA 5JQGB 4PBRA 4MX8A 3JARA 5B4UA 2OO3A 3X0DA 4LPKA 2BC9A 5EUBA 3PD7A 2VJNA 3MJDA 3DWGA 5JNSA 1RXYA 2NU8B 3CW8X 2ZRCA 4M1OA 2I3ZA 3AHFA 4TYWA 4XB1A 1H2YA 2HY7A 4QL3A 4EHBA 2DUUA 3ONDA 4JC7A 3ABZA 3IHKA 221PA 1MIOA 1UXGA 3HP1A 3KXDA 2W9YA 4Y6RA 3UGQA 4RVDA 4MOWA 3KJZA 2CL0X 1J5PA 1G3QA 1JDPA 4NABA 2XB9A 1KGDA 1Q20A 3KJXA 1ORJA 4H9GA 2E6UX 4PQRA 4DCSA 1OX6A 1IEVA 2ZCVA 2ATVA 1M8KA 5FJIA 2PD6A 4MYUA 5LKRA 1MNEA 4A0HA 1XNQB 3JYYA 4COOA 1X8KA 4GU5A 1NSYA 1V54C 4U4AA 1ZNQO 5I4CA 2QA5A 3OCJA 4BFSA 3BWMA 1GPYA 4KWHA 4UNRA 1ADFA 1CNEA 2XXAA 4L2IA 3H9CA 3C5VA 3DKIA 4X41A 1F0YA 3S8EA 3AI1A 5K8UA 1FS5A 1TQHA 3FLAA 4GR5A 1T4CA 2J6CA 4MGKR 3LC2O 4G2NA 4ZCIA 1AUQA 1YDGA 2X0KA 1JUDA 4H6PA 3RYCB 1QSPA 4OXNA 1JA9A 2X2PA 4I81A 2NQ8A 5IKEA 1F8UA 2IIBA 1YB7A 4ZHQB 1BCRA 3RC8A 3PR1A 1GUYA 3WYAA 3JYQA 3GY0A 3M9WA 4D6PA 4V1CA 3H8VA 5HKOA 2CV0A 5KX5B 3M1AA 3LX5A 2F3SA 4F11A 4NRDA 2H7BA 5CLFA 1U31A 3AIOA 2Y2VA 2ODAA 4R0NA 4ZJUA 1SQFA 3DEJA 2C4HA 3L8GA 1Z6ZA 1QX4A 3H13A 3O6XA 1UT8A 1PZXA 1N6NA 4N5IX 3R3HA 3L1VA 3VSAA 1EUCB 1XRQA 4ZT2A 3BH6A 3WRYC 3WX0A 1KFEB 4KLCA 1R3UA 3ZJVA 5CVVA 2Z95A 4AMGA 4CI9A 1Q0KA 5AVZA 2FWMX 2QV7A 2W6JA 4DLUA 2VH5R 3STYA 3N8KA 5TNXA 1JLHA 1JP7A 1OB2A 3EHDA 2IH5A 1ZX1A 1T6NA 3PWZA 1QJ4A 3H5TA 4YJFB 1GLGA 2H59A 1CEYA 2F7SA 2QTFA 4JEHA 3TXXA 4HQ0A 2DUNA 4D4IA 3IT0A 3IUBA 4FYMA 3D2BA 4OHOA 3CNQS 2J5BA 2Q1SA 3ZJUA 1OC2A 1E62A 4RKWA 4HTAA 1E79A 3B3FA 2CFIA 1ESCA 4AICA 1O5TA 3GUYA 4LSMA 4JOBA 1AHPA 1F2VA 1Q1NA 3JXEA 2YQ4A 3WGTA 1SOMA 5HRUA 1K6EA 1T3SA 2H9YA 2VYNA 2O0JA 2H2GA 1G2PA 5J43A 4NU5A 4KUGA 4DR5B 1YL5A 4XM1A 4WK2B 3SJAA 3OURA 4OD0A 5H3LA 2IUUA 3TTYA 3QVWA 4AK9A 4GMGA 4I50A 3ZQJA 3AHCA 2JI4A 1NM5A 1T6UA 4RX1A 4MTFA 1HT2E 3OUTA 3SQDA 4OLAA 1RFLA 3OJEA 2QKYA 1DTWA 5JC1A 4KC0A 2Q4RA 4QXQA 4UHHA 4Q9NA 1X42A 4YHBA 1ZIYA 1KL7A 4JLWA 4MKFA 4B0OA 1LLFA 5JATA 4MP6A 3ZHRA 4X63A 4BDTA 4FWTA 1QYCA 2IEBA 3N5CA 4EW1A 3QUAA 1YJAA 1IXRC 2KE5A 1XKTA 2VTBB 3USZA 4MYDA 4QQFA 2Z4SA 4PNEA 1F6BA 1QLJA 4FUTA 2GARA 1MNQA 1C7ZA 2L6HA 3LW7A 5HW0A 3PVZA 1LFAA 3NJ4A 1AXGA 4LERA 2FZKA 2OORC 2NXNA 3CG0A 4CG2A 4N8SA 3KWFA 2AQIA 4MVZA 1UXKA 3ZNPA 4MVSA 3KQOA 5M04A 1JNYA 1JVNA 1JPVA 2V03A 1H4SA 3AEKB 2WFLA 1J4AA 2CL7X 4LNHA 2B8TA 2RKWA 1X7ZB 1OV6A 3DZ8A 3JQAD 3D8BA 4BNMA 3S27A 3PUJA 3FTCA 1Q16A 1QG6A 3MSCA 2LDBA 3WL7A 4PGGA 3CQ9A 3OJCA 3IUEA 3KPJA 4PC1A 1BE0A 3ABMC 2WSBA 5EMHA 3RRYA 1RADA 3LLIA 3LK7A 1TZCA 1ULAA 3OZEA 3V4LA 4RZIA 2ZPTX 3DAFA 2A9KA 5J4KA 2A88A 1TAHA 2XZTA 1WV0A 2CLEB 1EFPB 5JUAA 3NS7A 1L4BA 4PPGA 4D4MA 3H5AA 3ML1A 4UPEA 3R0IA 1UDAA 2NUPA 2C9ZA 2PRJA 4PTLA 4CWAA 2QRUA 3CC8A 3QXJA 2J33A 5C7OO 2ZT6A 3GPCA 4DRXA 4NJOA 5JLAA 5AESA 3WFIA 3U61B 3HDQA 1E6UA 4KCGA 5BQOA 5JNWA 3H5WA 3KQKA 2G71A 2JAWA 4TWZA 1CU1A 1M34B 4BBZA 2XMCA 3EK2A 4AURA 3ER9A 2FCRA 3IRUA 4RGQA 4CKEB 1CF2O 1JVBA 4C4YA 2ORYA 4RSHA 1LJUA 2IGBA 4FB5A 2LCHA 3DM9B 3LESA 1XJWA 3SJZA 3IMFA 1XYVA 4WFJA 1S3IA 3TFWA 5HILA 3CJTA 4JLMA 2C0PA 2ERXA 5DSZA 4J7UA 1JMKC 3HP4A 3L0IA 1Y4ZA 1J49A 4H2DA 5LDGA 3EY9A 1W85B 5AQ1A 3EXIB 3NBXX 2YW9A 3NU1A 3S1LA 1UOPA 4E11A 4FYWA 4Q4AB 5HV9A 2ZUVA 3R7LA 2FKNA 5FA5A 4PGHA 1WEKA 3ZZTA 5C5DA 2H00A 5CFRA 4TX1A 5BRJA 5C5EA 1K68A 1QH1A 5DI9A 2P0EA 5AM3A 2DG2A 3A6ZA 1XTBA 3RVMA 1RI5A 3G8AA 4GX0A 4PCLA 3U9TA 1D5WA 3K0FB 4CKBA 4KPUA 3ER8A 4DCCA 4PG7A 5CLGA 3SC4A 1HETA 4HJXA 2QT9A 1DJMA 5AVSA 2H63A 3FNRA 1T4GA 1SVMA 3FGZA 4C21A 3FNFA 2ZBDA 2IQIA 1V3VA 2BPOA 3SSNA 2IFTA 3FPHA 1LPNA 2I2WA 5F51A 2QNLA 3TNJA 1AHHA 1I33A 2AIRA 4Y0AA 1G20A 1U2DA 2VHEA 1ZGAA 3ESBA 3QMKA 2G40A 3WYBA 1G3IA 5CIVA 3KKPA 1EE2A 2ZI9A 1IY9A 4IDPA 3H1AA 4GR4A 3CW9A 1OX5A 3Q6NA 4LI0A 2EF0A 2P30A 4O3MA 5JRZA 3O4IA 3BFVA 3G9UA 3QTLA 4KDEA 3GEDA 2GX6A 1XVAA 1O0SA 2IBSA 3AERA 3O8CA 2Z6AA 5CYOA 3UAZA 1JXMA 3RRMA 2IYUA 1ZVJA 3OICA 1Z7GA 1V8DA 4B6EA 2OXTA 5ENDA 4JASB 2VRBA 3O7MA 1O0CA 3JVIA 5TARA 4MP3A 1YZTA 2ID8A 1ZVVA 3FWNA 5G1NA 2AX3A 3KTOA 4N0DA 1EB8A 1XTRA 1FSFA 4JUAA 5FOTA 1GRRA 3SF8A 4Q48A 4M0FA 2ICAA 4NYJQ 4MRMA 5CHYA 2Q46A 2QRZA 1TR2A 2B0CA 4E31A 3DOHA 1DKRA 1CQJA 4ZCQA 3OT1A 2IQ5A 4AG5A 5L3QB 1I4WA 4CTNA 4Q12A 2H1IA 4CYMA 2AC7A 3TTXA 2FI1A 2L6GA 5TSDA 3KLPX 3ETGA 1CS4C 2UDPA 7MHTA 3DEYX 5FNZA 3H2GA 2GEJA 3LM8A 3LX6A 1RXEA 1G8JA 4B43A 2VQEB 1NL3A 4F3CA 1G4US 3L0SA 2VF8A 4L9AA 5AUQA 3H11A 2ZB3A 4CBVA 1A9XA 1U1GA 2L18A 3SOZA 3BXXA 3UMCA 1UBCA 1EHCA 2XTAA 5HDBB 4Q6BA 3T6GB 5CDSA 2DC1A 4QPDA 1KIMA 4BGVA 2O59A 4J2OA 3U4DA 1WXEA 3PDWA 2PFGA 3QUQA 4YL0A 1OXBA 3TJRA 4E2FA 5B53A 1VTMP 1IMOA 1TCBA 1VE5A 4DAOA 3AMVA 4QFCA 1E9CA 2GKSA 2IX9A 2JASA 4OLJA 5DI3B 3HZOA 4DREA 4B7CA 2M1ZA 1TIBA 1E2XA 4G67A 5G3YA 3DQZA 3OE7A 1KQPA 5B1AC 3FPCA 3RAFC 4KIJA 2YDYA 2B25A 1XPUA 5GADl 2M6KA 3THYB 1OZGA 3UNGC 2TS1A 4Q47A 1SD1A 3GZ4A 4OTZA 2BHSA 2TMDA 1GVNB 1JWLA 1E7QA 2C2ZA 3JU3A 2YIVX 4BKRA 3T6KA 4GP6A 4UZSA 1H7IA 1O4WA 3CF4G 2ZYVX 4IYRA 5HYVA 4NYMR 4HE8D 3U7EB 3QQPA 4X44A 5MF6A 1ORIA 3QZUA 1A7VA 3QELB 5COMA 1LBQA 5EI5A 1D1CA 3K9LA 3GA0A 1TEZA 2QVZX 3ONWA 1IN6A 5IKPA 5JYCA 4HN4B 1SVSA 1DIHA 2EL7A 1A4UA 4EAAA 3GJYA 3BEHA 3LQKA 1EAMA 4B75A 1DMRA 2GCNA 4MS3B 1YBHA 3I4LA 1CR2A 3GJ6A 2QLNA 5HUHA 3R41A 5DULA 1CB7A 2JF0A 1Z06A 3A4MA 2H31A 5FUBA 3WMWA 3GT7A 3NLLA 2HK9A 4RQAA 4LGMA 2A0FA 4YDHB 5F3DA 2GF9A 4LLEA 1G9SA 2CJXA 1ESZA 3SQLA 2H7XA 2OYCA 1NKVA 3P9NA 1G0OA 3TCXB 2IEIA 4KNVA 2IYWA 4EP1A 4R84A 5LLSA 3FOBA 5TX7A 2HUJA 4MUJA 1TYEB 1SVIA 4GKVA 2BTOA 3WYFA 3VTFA 4BV3A 3VH1A 1KJIA 4NCIA 2YWFA 5LPNA 3OQBA 3FMIA 3PGLA 2JD0A 1T8SA 2OO5A 2VTVA 4M54A 3RH0A 1P2UA 1WSBA 1RM0A 5DYYA 5DHFA 3T5AA 3F3KA 3TQFA 1P9NA 1EZ1A 2VHVA 4ERXA 5K0IA 3B36A 4NLLA 4QNMA 5K9ZA 1L5FA 1U63A 1I30A 1YK0A 4CF3A 4CRWB 4WQMA 3O0DA 3IDAA 5DO9A 3NTUA 1OFUX 2PFSA 1OT5A 2YHUA 3IAEA 3WKDA 4KRGA 4LC0A 3HDHA 2P4EA 4I8DA 4QXPA 3IUPA 2D1YA 4R2KA 5JLIA 5B37A 2QUIA 4IDNA 3WI7A 3K9FC 2ZIWB 1RQRA 5AW6A 4YQEA 1M5TA 3A1CA 4PAQA 1WUJS 3I5UA 2GN9A 4K8OA 3DPSA 1XTQA 3OBIA 3PR3A 2QL9A 4B46A 3RUDA 3EDCA 2CDBA 2O2EA 3HV2A 4N82A 2MR5A 1R88A 1XC7A 4LJ9A 1GY8A 2AI1A 3NAMA 4RANA 3R0XA 1W34A 2GRJA 3KVVA 3EGXA 4OQEA 3L04A 3DUWA 5DTQA 4U5HA 1M8JA 3OOHA 2AJ8A 1IOWA 2B1GA 4X54A 1NMZA 2QTVA 1D2RA 4G0ZA 1UWLA 3AIKA 2VN8A 3W8IA 1UEXC 3DBHA 1QCDA 3FMPB 3QOXA 3ZZ0A 5BMVB 3HK2A 3Q0EA 5K8JB 3FMSA 1QIGA 1W59A 5EZQA 5TS2A 5FOXA 3K1TA 2CDCA 4GI5A 1I7QB 4RHCA 3AR3A 4B6PA 1C50A 2A67A 1TTTA 1YACA 2YDXA 2PQMA 2CFOA 3GCDA 4ZJYA 4ER9A 1UODA 2A1TR 2Z8ZA 1SK9A 3OEWA 3AG5A 1ECJA 2YKGA 1UCFA 3A1TA 3S90A 4OFWA 1GL7A 1Y3AA 3R0ZA 2JARA 2CL6X 1PGQA 1CUAA 2G5CA 5J5VA 2AR9A 3FFAA 4NZPA 3AESB 4EJSB 5E7JA 5HCUA 1N9GA 1T2AA 1MG5A 3BXOA 4Q3AA 4EF4A 2WINI 3UJ9A 4L4SA 4R9VA 4H16A 2HUNA 1WW3A 5SICE 1UPFA 3AUKA 3DD5A 4PC6A 3W4JA 4BNKA 2NXJA 3OF3A 3GG9A 1CR4A 3WA6A 3EH2A 1BXRA 3EG9A 4OKNA 5EJ6A 2YYYA 1ZC3A 2QIPA 4KBLA 1D6NA 5L45A 2O8DA 4PFJA 5J58A 1EVLA 4EW3A 3DL4A 4QQ8A 3KWJA 2HFKA 2POQX 4BMXA 4POAA 2G67A 3ZGYA 4EFKA 3LLSA 4UTRA 4MR7A 1NBME 3GT0A 3AL3A 2YFHA 2WWWA 4C7KA 1J06A 1TM7E 5TS3A 4GR9A 2GUGA 1WOLA 4HZUB 2ZPUA 1YZNA 3EGDB 4CIPA 4KMMA 2QTBA 4AU1A 3RVRA 2QW0X 4JMLA 5BW4A 4YMIA 4XWYA 1X7YB 5ALMA 5LWQA 3PI6A 3WWPA 2HJGA 5AXDA 4BBAA 3A6EA 2BMFA 1JPUA 1SPXA 4X5OA 4HJRA 2Y67A 5D3MA 2BBTA 3PEUA 2XEXA 1F06A 1WQ4A 5L3SA 1U3UA 3OPXA 5AVOA 4Q7KA 2DHQA 4C04A 2I99A 4BJTA 1APBA 1PNRA 3NOQA 2DR2A 1E1QD 2IL1A 5J2TB 1RKVA 1YZVA 1S2MA 5NLLA 4OB8A 1T5TA 3ITEA 1EA8A 2GWHA 3A6KA 4PG4A 5IYZB 4ASUA 1T29A 3ZWQA 3FWZA 2C4UA 2FPIA 4B17A 1OXKA 1DDGA 1K5PA 4XWOA 5LQJA 4UDXX 5KQGA 1MEJA 1ZIXA 4KGVA 2B2XA 1PSWA 5JS2A 4M0PA 2J9FA 1EQ2A 4LY0A 1UDCA 2NUBA 4G9EA 5IDVA 5I51A 1WY7A 2GBFA 1GFZA 2Z8XA 5D00A 5GONF 2XDQB 2YNMA 2QJRA 4HSEA 5KVCA 3EC2A 1AHNA 1UG7A 4AZVA 2EARA 1NYTA 1L9XA 1KMIY 4FTWA 4EMUA 3F3YA 2AJDA 1JDUA 2IIPA 2FA9A 3LQRA 2QDKA 3H19A 2MDTA 4LRQA 4DLYA 3RTBA 4JC5A 3THSA 9ATCA 2HKIA 3Q0IA 2O8CB 3Q15C 1B8OA 3SAJA 1LQ2A 3SZUA 5G1PA 5IEJA 2QLAA 2IDMA 2FRXA 5C1IA 4UUAA 4M9QA 4HTFB 1ITZA 1XNJA 4Q9DA 4J91A 4KQFA 4YRTA 3IPLA 1FZQA 4PANA 4YECA 2J5XA 4WOPA 3RC7A 1Q44A 3BDIA 3P9ZA 3U9SA 2LP4Y 3JD4A 4UNPA 3RUPA 3F7OA 1N2CE 3KQWA 4LOIA 4TN1A 1QYRA 1UBLS 3WP1B 4QTXA 3QSGA 2IPLA 2ZTVA 3RIEA 3VO2A 3UO8B 2WM9B 4YTEA 4R1LA 5HGXA 3GAZA 1C1XA 2FQWA 4PCUA 2EIMC 4M1MA 2P6RA 4IKOA 3ZIAD 4B3CA 4TYYA 1EE9A 4MEAA 1EBBA 4U6NA 1PJQA 3PGXA 1XRMA 3BWEA 3A9VA 1CNFA 3C1AA 3ZWVA 4GPZA 5LA6F 2HHLA 3IX7A 1RAHA 2UZ3A 1TK3A 1F48A 4QDLA 1VL1A 1WPQA 4BMNA 3BF8A 3DDSA 2YZKA 3WLIA 1DWQA 5REQB 3CR3C 4HBGA 2B7BA 2PH1A 3NGLA 5BQXA 2AXEA 4ADSG 3MBOA 2IYEA 2XUFA 5MN5A 2X14A 2H17A 3A9TA 3ZTWA 1R37A 4CPDA 1RI1A 1NOKA 4UNIA 5C53B 4ZTUB 2HUPA 5BV1A 2MMCA 4JJEA 2QTLA 4FHZA 2YIJA 2A1UB 2OGSA 2VHQA 4QEDA 1RABA 2RK3A 1UJ2A 3UHJA 4QTUB 4U3JA 2YWHA 2BEVA 4DCMA 4PHHA 3I61A 4Q16A 1MB0A 1KEVA 1V8OA 5IPFA 3ETNA 1UK7A 3W3ZB 4AQYB 4UM5A 2ZS7A 4WCFA 1VCMA 1KI4A 4MITA 4HUQA 2BEWB 4OBBA 2FPRA 2ZIEA 5EIBC 1DZ3A 1H22A 2EV9A 2RI0A 1TYDE 2CBGA 3IAS6 1V37A 2AF3C 1OA0A 3ZDQA 5JXHA 4HYEA 3O1IC 2O8FA 3RH3A 1YR1A 2VJLA 4Z9FA 4TUYA 4JLNA 3ENQA 1TD1A 3GELA 2H1RA 4OYYA 1QPUA 4AJKA 2XUOA 3FKSA 2Q1YA 2G3KA 1JWBB 4NECA