4AK9A

Structure of chloroplast ftsy from physcomitrella patens
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
308
structure length
302
Chain Sequence
SQDPDIQLLFSGFSKTRENLAVVDELLTYWNLDESESILDELEEVLLVSDFGPKTALKIVDTIRKDILAGRLKSGPQIKEALKKNIFKLLTERVTTTELQLGNSRPAVLMIVGVNGGGKTTTLGKLANRFKKEGVKVLMAAGDTAAAGEQLEVWAQRTGSEIVMAPRPAAVLSQAVRRAVEEDFDVVLCDTSGRLHTNYNLMEELRGCKRAVSKALSSAPNEVLLVLDGTTGLNMLAQAREFNQVIGVTGFILTKLDGTARGGCVVSVVDELSIPVKFVGVGEGIDDLQPFDAQSFVDALFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords CPFTSY
publication title Evolution from the Prokaryotic to the Higher Plant Chloroplast Signal Recognition Particle: The Signal Recognition Particle RNA is Conserved in Plastids of a Wide Range of Photosynthetic Organisms.
pubmed doi rcsb
source organism Physcomitrella patens
total genus 119
structure length 302
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ak9A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ak9A02
2ZJBA 4QGHA 1GG2A 3EPJA 3GJ6A 1GRNA 3OE7D 1XEWY 2AFIE 2V6IA 1Z06A 1HA3A 2ZUCA 3B1XA 3KXKA 1FPMA 2F43A 1CJVC 2VO1A 3G0HA 4ZDKA 1XB2A 1OH7A 3GLGB 2AK2A 2GEVA 2GXAA 3CNNA 1AGPA 2YZ2A 3GFOA 3EASA 2O8FA 1JR3E 4LJ4A 4WAUA 1OFUX 2HLDA 4TL8A 1G291 3DM5A 1OIVA 2HT6A 5J47A 4HB3A 3QPWA 3U7HB 2N42A 4AIIA 2OCBA 1E0AA 1U99A 2XOKD 3TVTA 4BLSA 4QJ3A 3AEZA 3O8BA 5CB8A 1R4AA 5L8VA 3VKGA 4F7WA 4WA7A 4HLCA 5JECA 5G41A 2GXSA 1KDTA 4HLUA 3FYHA 5TB5A 1P61B 1NVVR 1UKEA 1AIPA 4BASA 4KV9A 1PV4A 2RGDA 1Z6XA 4UXIA 4JSTA 4NTZA 3I3SR 4HLDA 2XTZA 3ONWA 4V02A 2GA8A 1NI3A 2JLYA 2D2FA 1E9EA 1Y63A 3BK7A 5IK2A 2V1UA 6Q21A 3THYB 2F55A 5AR1A 2A2ZA 1D2MA 2GTPA 4TQ9A 2IX3A 4A36A 3KJHA 4NYIR 4YXWD 1F2TB 1P62B 2JCSA 5DI9A 2LWIA 4ZPXA 2WJVA 5AUNB 2W6JD 2GETA 3PEUA 3BH6A 5JJKA 1RYHA 4DJTA 2RGGA 3AVVA 3LDAA 5K8LA 4E5UA 3ECCA 4RKFA 4B71A 4MGYR 1Q57A 3LBIA 1KO7A 5TDHA 1SKYE 2FEMA 1CULC 1JJ7A 2ZRMA 1BMFA 3LW7A 4TT3A 4WIAA 4R2IA 4C4PA 2V7QD 3IKJA 3QXJA 4M1KA 3I5XA 3SQWA 4NCIA 1D9XA 2FFQA 1FUKA 2GF0A 3CRVA 2XXAA 3PUXA 4IDOA 4EPWA 3EA5A 2OO7A 1ZJ6A 2B92A 1V5WA 2GK7A 4P3YA 3W34A 2J7PA 1GRRA 1RRGA 2YYZA 5KUTA 2JLUA 2VQSA 2ZJ8A 3NH9A 3QUSA 5DO9A 2A5JA 4Q48A 3DMNA 1Q44A 1FQJA 1W0JA 2FGJA 5DLQC 3TR0A 3FGNA 3DM9B 3I92A 4Z51A 2QBYB 2GBLA 2P67A 2XNDD 5CK4A 1G5RA 4EUNA 4U02A 5FI0B 3LVRE 3WNCA 1T3LA 1VCNA 3MLEA 1YVDA 4H1UA 4AURA 4IEEA 2O0HA 1OV4A 4QOSA 4O25A 2RHDA 4ZDIA 1U0HC 1WMSA 1YZQA 3CO5A 2CHGA 1NIPA 3QKUA 4XD7A 1XCGB 3QG1A 4OQLA 1G21E 4OK6A 2IYLD 1E1RD 3VFDA 4FW9A 4M53A 2X2EA 1Z2AA 3LX8A 4B32A 1RRPA 2NGRA 5CM8B 2QM8A 2XTNA 4OQFA 5AUPB 4TLBA 3OIVA 2LKDA 4FIDA 4DCTA 4G01B 1P3JA 2OLJA 3IPXA 3RNLA 1EFRD 2F1RA 3Q72A 2ZS8A 5AUOB 1YU9A 2HUPA 1IY2A 1ZYUA 2QQEA 4HZUA 5LB2A 1HE1C 1OXTA 2WICA 5EP4A 2ECKA 3CRRA 3HJNA 4UNSA 3K0FB 5D3QA 3T1TA 3B5JA 3C8UA 2O0JA 1W4RA 2QP9X 1VG8A 3H2YA 3WHLA 4CDGA 1AN0A 3AQ4A 4S35A 3CBQA 1OLOA 1QF9A 1LW7A 2PJZA 1GNRA 1HUQA 4GZMA 1GKUB 1TF7A 3TSOA 3FOZA 5FL7A 4C7OA 3AB3A 4LUCA 4TYNA 3THWB 1KKMA 1VCMA 4PC7A 3OF5A 4R9UC 3NHAA 1IONA 2ZQ5A 1G9XA 2MSDB 3P20A 1W1WA 4U7DA 1R6BX 2IUTA 2A78A 2DY1A 3CPHA 4Y0AA 3IEUA 3PQCA 1VHLA 4B3FX 4RD6A 3X2SA 4B75A 2RGBA 4LX0A 4OI4A 2IUSA 4URWR 3CRQA 3NBZC 4E09A 4ZKDA 1NBMA 4FMDB 2GNOA 3QI2A 5L3QB 1ZUIA 1QHIA 2D4HA 4KFSA 3LFUA 1DO2A 1YRBA 4RCZA 4D25A 3UXMA 3LX5A 5JI3E 4AY2A 3K09C 2J9RA 3EWAA 2MMGA 5FR2A 2RGNA 4A2PA 1F2UA 1IN4A 2VHCA 3EAQA 3KB2A 5DYIA 2J0SA 2AK3A 1S2MA 2PEYA 5BXQC 1Q20A 2QTFA 4EKDA 3NH6A 1OPXA 1GTVA 2FWRA 2GRJA 1DAFA 2E1RA 2GZAA 1XPUA 3PEVA 3X1YA 1FP6A 1TADA 3RC3A 4TWZA 1KJZA 2IL1A 4FWTA 4BFSA 2EFCB 4I4LA 3NTUA 3TW8B 1KMQA 3A37A 4BLOA 1QHXA 2ZR9A 4F4CA 3R9XA 4EFMA 4BFUA 4MGKR 4BFYA 2HJGA 3DZDA 4URZR 5EE5B 4K8OA 1CS4C 5TY0A 1NG1A 3KUDA 1NNEA 2O8EA 4TL7A 1E79D 2KB0A 3ZGXA 1E2LA 3WY9A 5HR5A 2H18A 3SDZA 5CYOA 2EWWA 5FOUA 5A5GA 4Q00A 4TMTA 1QDEA 1US8B 3GQBA 5M04A 5GADl 2VH5R 1ZIOA 1HE8B 2ZRGA 4CEIA 4FMCF 1NBME 4KBFA 3ZS8A 1JXMA 2Z0MA 2IYSA 1Z0AA 3K0CA 5B58C 5J4VA 5JEEA 1W46A 4PHGA 5EZ5A 3BWDD 4LBWA 2G77B 3NBXX 2PLRA 4Q4AB 1P72A 4QBFA 4D26A 4RD1A 2GJSA 1KDPA 3DZ8A 1G3IA 1XNJA 3D6TB 2QN6A 3A1SA 1OXXK 4PAOA 4BFVA 2BBSA 1JAIA 4PQYA 3CIOA 3W6OA 4IFEA 3PCRB 4W5HA 3TUZC 1HYQA 3I62A 5E7IA 3AP1A 1F2UB 4Q4JA 4BLQA 2ZEJA 2W2XA 1XTKA 1Z0IA 4JLOA 1E2MA 2PCJA 3ADKA 2VHQA 3C41J 1W4AA 3CRW1 4G1UC 3PIRA 3AUYA 1G64A 1L4UA 4HAYA 1JPJA 3OESA 4ZIRA 2IYRA 1M8PA 5AJZA 4ASUA 2JLVA 2VHUA 3SC3A 3WXMA 3WYAA 4TSFA 3I72A 4M1WA 2FZ4A 4GOXA 3GFPA 2Q3HA 3H0KA 3QSYA 1KI6B 1GL9B 5HCNA 1FQKA 1C1YA 4DDTA 3HYRA 5EZ6B 1KMHB 1U90A 2OE2A 4GPTA 2LKCA 2PCLA 1II8A 2QENA 1TMKA 2ORVA 3Q8XB 3X1DA 2ZYUX 2EYQA 2WPDD 4FINA 2E9SA 2Z5FA 1SVLA 4EQ6A 4GRAA 2OHFA 3QVUA 5UKDA 2BMDA 2J1LA 3OEHD 1XDBA 3KXIA 4UKDA 2UZ3A 5DHAA 5KU1A 3B1YA 4M9SA 4LJYA 1NMYA 2CMKA 3IBGA 5D3MA 2IS2A 1VYVA 4EFLA 1NJFA 3UMRA 1W49A 1OH6A 3RS7A 4GMXA 2ANCA 2ERXA 4QXAA 4YMTA 3VR2A 3ETLA 4CIDA 1N0UA 4TLCA 1XJ0A 2QE7A 2G83A 2ZE7A 3HU1A 3IPYA 3PXGA 3P27A 4UXHA 4NCNA 2VTKA 4Q66C 1I4TD 1GUAA 3V00A 3QKSA 1IN8A 4B73A 2QAJA 5B30A 5FOVA 1YZTA 5KO2A 2OXCA 4C0JA 1I2DA 4PO9A 2KI5A 2JJ1A 2P6UA 4P31A 2IUUA 4DB2A 5FTMA 4A0GA 4OHVA 4QG7A 4YMSA 2JASA 3AF1A 1DS6A 2UKDA 4L9WA 4ON9A 4GNKA 3ZVNA 3AVXA 3CR8A 1TPZA 3EZ9A 4TTRA 1YR8A 2X8AA 4XOIA 3N2EA 4A82A 1CTQA 3C15C 3N5CA 1W2GA 1Z5ZA 1Z3IX 5B57C 4GDFA 1G5TA 4DKXA 1Q21A 4JIMA 4B74A 3IQXA 3L8YA 3AP3A 2ZRKA 2EYUA 1J7KA 3CONA 1NLFA 1FMLA 1U8AA 5JS7A 4OJKA 1R2QA 2FSFA 1ZINA 4IOJA 2Q0HA 1J8MF 1IBRA 2AD5A 4MITA 1UBFA 2IYUA 3FKSD 2DBYA 2IHBA 3GEHA 2X1VA 3QXSA 3ZVMA 4IEIA 4IVPA 4L15A 3SFVA 2ZRAA 221PA 2DWOA 1LB1B 4IXMA 4V0LA 3LD9A 3TUJC 4LV5B 1ZW6A 2XITA 2PBRA 3Q7QA 2D7CA 2F1IA 4DLWA 3FMPB 2QTHA 1S96A 1G20E 1KHTA 2AXNA 4M1TA 4BUJA 2FGKA 2YC2C 4AG5A 1OYWA 2JJ2A 5JI2E 4XWAA 1R5OA 2WTUA 1JJVA 1ZU5A 1OFIA 2D3WA 1KAGA 3GCGA 2QSZA 3K9NA 5JJLA 4LYFA 2DCUA 5BN5A 1R8QA 5KOYA 3AVTA 3DO6A 4JMPA 5DI3A 1E2DA 1N25A 1IOZA 2ZJAA 4TMKA 3JZAA 3V4FA 3TK1A 3HR8A 3CWQA 4Q5IA 5GJVC 5DYGA 4D4KA 1Q3HA 1X8KA 3I32A 4NONA 4HI0E 2RGEA 2RMKA 4O0MA 1GOTA 2WKQA 3GLIA 4MRRA 1XD9A 1ZNXA 1W4BA 3UWKA 3R9WA 4HEJA 2EFEB 4RD0A 2XSZD 1IAQA 5DN6A 4UQOA 3NEYA 4LJ7A 4L4UA 5EP3A 1Q1BA 3KKPA 4OI1A 1EESA 2FPLA 4AD8A 4A1FA 2J41A 4B76A 1JEDA 4PAQA 3X1WA 4DLUA 4HAXA 3EC1A 3SQXA 1NN5A 4G5QA 3UATA 1COWA 5AK0A 1JBKA 2GAOA 3L0IB 1NSFA 4LZZA 3IBYA 2IT1A 5FUVA 4DEXA 2ZE6A 2RCNA 5G40A 3KFVA 4O2RA 4Q1AA 4C30A 2IS1A 3G5UA 3Q9LA 1TUIA 2D06A 5CITA 4NYJQ 3FTQA 3KJIA 1S1CA 3B1ZA 3ICEA 1XRJA 4H9GA 4NE2A 5IDVA 4YMUA 4GSYA 1SQ5A 2IBMA 3WP1B 2D7DA 1DELA 3WNBA 1KDOA 2GCOB 2F6RA 2WJHA 5HCIA 2AFHE 4WZ6A 2BBOA 1JALA 2JLRA 4ZI3A 2JLSA 2G0TA 4WOPA 3U3MA 5FPKA 2VF8A 1T9HA 2IS4A 4M2LA 3TAUA 1OHHA 3KB1A 5CB6A 5DI3B 1MO3A 1CXZA 3NKVA 2FZLA 4KI0A 4PTLA 4RCYA 3IIMA 4PHTA 1TQ6A 3RSOA 1T5IA 1WXQA 3VR1A 2FNAA 2G1KA 3RS5A 5JSZB 2H57A 1R0ZA 1RZ3A 1GVNB 4CEJB 2BM1A 4IDNA 3GLIB 1VIYA 1WE2A 1XJQA 1QHHA 1J90A 3CRMA 3FHOA 4OI2A 3EIHA 3KQLA 3GLFB 1FW6A 5FUYA 1OXSC 3L0PA 3HYTA 4DT1B 2EVWX 1K6MA 3VNUA 4GI7A 5AJWA 3A36A 1KTVA 1J8YF 3AVUA 5HKKD 4E22A 1BKDR 1J70A 1QG2A 3CKLA 3CZQA 2JIZA 2BEJA 4LRWA 2W00A 1XEXA 2XJ4A 4PSVA 1OH5A 3BORA 2YWEA 4WXPA 1N6LA 4MQBA 2VRWA 4IVRA 4Z1MD 1JAHA 1N5JA 3I61A 3OE7A 2PMDA 3B85A 1N5LA 2WVJA 3VAAA 2NO6A 2C8VA 1N6KA 4UJ5A 4DWJA 2BC9A 2HF9A 3L0SA 4OK3A 1P73A 3CF6R 2ZSFA 4QRHA 2ZRHA 4QBGB 1WA5A 4V03A 2ANBA 3CH5A 3WBKA 3SU8A 1W36D 1OIWA 4TMZA 2AL7A 3OFNA 1Z0KA 5J4YA 3M1IA 2CCJA 4DIDA 1IN5A 1E6CA 2DWQA 2YJTD 4IOMA 4DLVA 3U2QA 2IS6A 621PA 1A2BA 3QNUA 2PX3A 4KVAA 2VP9A 3GEIA 2WM9B 4EIWA 2ZR0A 4Q7MB 2ONJA 4JL6A 2O8DA 2XOKA 2IC5A 3R8CA 2VF7A 5IRCD 3OHMA 3CPJB 1BO6A 1M74A 4Z8XA 3RRYA 2C5LA 2FFBA 3DHWC 3ZD6A 1XXHB 4LK2A 1KOFA 1P7CA 1U0JA 1XF9A 2BM0A 2KSQA 2PZGA 3CR7A 4QKQA 5FOTA 3KZ1E 4ZKEA 4IOKA 2PL3A 4GZLA 4US0R 4Q1DA 4TYPA 4CEHB 3GLGA 2BIFA 1NSTA 4Q18A 1TTTA 1UKVY 1U9IC 3LWNA 4I1UA 1AZSC 5H1YA 4MRVA 4YXWA 2YC4C 3CH4B 4IOLA 4US1R 3KJGA 2W6JA 4Q4HB 4RD2A 3CF2A 5HZHA 5FBQB 4F4JA 2Z4RA 4X8HA 3GJXC 1M1YE 1LF0A 2R9VA 2DPXA 1DOAA 2CEAA 2OAP1 5C1BA 4N0DA 4EPYA 4DB4A 1AQUA 1Z29A 3LBHA 4OQNA 1E3MA 4IFBA 2QG6A 4ARZB 2V7QA 2GCPA 5FPTA 3C7KA 4LBZA 5JWOA 3TKLA 1Z8FA 4QC2A 5DIFA 3J81k 5JJIA 4GOKA 4ZDWA 1RC8A 1H8ED 4CF7A 3H84A 1I4DD 3DL0A 1L7VC 1ZM2A 1XMVA 3PUVA 3T1QA 2O8CB 3THYA 2I4IA 1G18A 2ASEA 4E07A 4QBIA 4EDHA 3I4LA 4BZQA 1F2TA 2ZITA 2ZS9A 3P32A 2R6AA 1X8LA 4OHZA 2XNDA 3GLGE 4BWYA 3B2EA 4PC6A 4KFTA 4TMWA 3DKPA 4DLYA 4MYUA 1R7RA 3VU9B 4TYYA 2O8BB 5SZIA 2J0VA 1T4GA 5DH9A 4DZZA 1E2FA 4MKHA 2OLKA 2J46A 3CX7A 1MO6A 1AA9A 1IN6A 2QT0A 3WMGA 1H65A 4X8OA 3B7GA 4XSHA 4DLTA 2JJ8A 1ESNA 1SHZA 1U81A 4RZ2A 4G5OA 5JLJA 1KYIA 2ZRDA 2IXGA 4YLGA 2ODNA 2ZYTX 1NP6A 1OKKD 4KVGA 1E1RA 1DBSA 4ZCLA 5EUMA 1P4SA 3I8SA 1ZUHA 4LPKA 3NC0C 4PSAA 4C3ZA 4Q1BA 3FHTA 1KSGA 1EGAA 1GITA 1ZIPA 2BWJA 4XJXA 4CZ2A 2IK8A 2OFOA 3LQRA 1J99A 1IHUA 2BKEA 4IVQA 1RJ9A 4Q21A 5HZKA 2QBYA 3T35A 5JWRA 3BBPA 2YVUA 3C5CA 1ZM3A 3SHFA 1IXSB 1PLJA 1SVMA 2WSSA 2LCFA 2CE2X 1RE0A 2HXSA 4LDJA 3BB4A 4NU0A 2J0UB 1EWRA 4XTCS 1Z2CA 2ZUBA 4D0GA 1N6NA 4ERNA 2IYQA 3H1TA 1G5PA 3UMSA 3A1WA 4B43A 3UWOA 2WWWA 3IHWA 1AS0A 3LRPA 5J4KA 1XBTA 3R7WB 3LXXA 1RKBA 2C9YA 3EARA 1G6HA 1LF5A 3K0SA 1IXRC 1E9SA 1RIFA 1Y3AA 2QP3A 2IWHA 3K53A 1XTSA 3U5ZB 2ZSDA 5J40A 4I1SA 4QJ5A 1KNQA 5KSOA 5FPYA 2IYVA 1M7HA 5FBVB 5EXXA 1KSHA 1Z83A 4NL4H 4PZYA 2VP5A 3FFBA 2G6BA 4KU4A 5BQ5A 1BH2A 4P33A 3QJYA 4A0HA 1SXJC 4P4TA 4M1MA 1LS6A 1W5SA 3L2OB 3TW4A 4XVUA 5H68A 2J87A 1IJEA 2IEYA 3QEOA 1NN1A 2QMUA 1JR6A 2C04A 1SHKA 3SBEA 3QG5A 2BCJQ 1OW3B 2CJWB 1AZTA 3K0FA 1E98A 1Q22A 1XMIA 3U3KA 3I73A 3PUYA 3Q3JB 4HDCA 2CXXA 4QHYA 2ZANA 4S2EA 3ZQ6A 1E96A 1HV8A 1M34E 1XD2B 4BECA 5L3SA 3UK6A 2NZJA 3C16C 4GT1A 3KQUA 1E0KA 1RJ9B 2SHKA 3ZJYA 1NVXQ 2CL6X 4UJ3A 1RRFA 2IXFA 5JWHA 4NMMA 4MYCA 5JHGB 4NZYA 3L0OA 1WGWA 2CCGA 3KTAB 3THWA 4B35A 2FFAA 2ZI3A 5HPYB 1FZQA 1P6XA 4JVMA 1IXZA 2QMEA 121PA 4FMDF 5DISB 4TYQA 4NBSA 5JFGA 1WF3A 2CK3D 3C5HA 4M9ZA 1XEFA 3TSZA 5KPJA 3AVQA 3ADCA 5JCZA 3IEVA 3NBYC 4P4UA 4I1VA 3FMIA 4XVQA 1E79A 1UFQA 5F9HA 2C9OA 3QENA 2PJRA 1IM2A 4JVNA 2KJQA 4Q7KA 2D62A 4E03A 821PA 3U4QB 5L3QA 1BOFA 3A4MA 1U8YA 3MJHA 1Z6TA 2DHRA 2FJUA 5BYJA 1XU4A 1W0KD 1CF4A 3BFKA 2GJ9A 2GVZC 2R6FA 4M21A 3PEWA 3W90A 4DCNA 1DPFA 1NVWQ 2F1JA 2GWHA 2ORIA 5B2ZA 3U44B 2VA8A 3WHKA 2V54A 4A8JC 4PO8A 4WZBE 3WP0A 2CL0X 5JEDA 3B6EA 1CJUC 1YKSA 3TQFA 1SVOA 3TVDA 1T8UA 4QNRA 4GBMA 5EUQB 4UXJA 1WCV1 5L3SB 4A2QA 1YZUA 1KK0A 3K0AB 4Q7LA 3LY5A 2ZJZA 4RZUA 1TUEA 1ZNWA 1CRQA 2OAQ1 1CIPA 3NVAA 2ZE8A 2QL6A 1P2TA 1Q1QA 1W48A 2P2LA 1RRCA 3MD0A 4CVNA 1FTNA 3O47A 4DSNA 1KK1A 3EPKA 1G1MA 1US8A 5IK2D 2HT1A 1ZNYA 2Z43A 1E4VA 3VTKA 3LXRA 3WMEA 1SVWA 1QBKC 2QZ4A 2QQ0A 1D2NA 1D8TA 4H1VA 2OEPA 4IDHA 2P65A 3SJAA 2W6ID 1CP2A 1G8YA 1XX6A 2V8OA 4Q4AA 4B2IA 4F4IA 2HDNB 3GD7A 4B44A 4G5SA 4A4DA 3LAWA 2IEZA 4OL0A 3MGCA 2OZEA 4N1AA 1P9NA 1BMFD 1GAJA 2QPOA 2OFWA 2OUKA 1R10A 2VYFA 2WPDA 2CDNA 4U00A 2ZAOA 1NY6A 1RW4A 3QF7A 4PQFA 3FMOB 4AWXA 5K8UA 1Z6YA 4HAUA 3N70A 3DVLA 3RS3A 3ZDQA 2ZSEA 3LH5A 2IF2A 4WVFA 1G4UR 3SJZA 2DFLA 2ZI5A 5IT5A 3SS8A 5CK5A 4RZXA 5JMTA 2ZRLA 4KSCA 1GL7A 2H17A 3CPEA 1SXJB 2J7KA 2J0QA 1KK3A 1AGRA 1KI6A 3B1VA 3IDQA 1DG3A 5EE1A 2O52A 4DVGA 1F48A 5HE9A 4Q01A 1OB5A 2QAGC 2CE7A 3ZS9A 3W5JA 1KMHA 4QHSA 4KJZA 4URUR 2KBFA 2NG1A 4Q7JB 5EE3A 3VHXA 3W5IA 4DCUA 2OG2A 2EWVA 1VIAA 5EJEA 4KXFB 1DO0A 1QHNA 1OSNA 5DNYB 5P21A 3NXSA 2WJIA 4M1SA 2ZRJA 3NDBB 1UDWA 1P2VA 1KAOA 2FMXA 4J0QA 4NYMQ 4RD4A 1TU3A 2PT5A 1ZVQA 3NWJA 4XWKA 4IDPA 2DR3A 3FVQA 4IXNA 3GJ0A 4MUBA 4P32A 3U7GA 2XJ9A 3SHWA 1UF9A 2VHJA 4TLDA 3G82C 2JA1A 4FCWA 5CLLA 1RYFA 3NC1C 1HEIA 1SXJD 3QXCA 1XTJA 1HQYE 5GVRA 1GILA 4EFNA 3QE0A 4OBEA 3RRNA 1SZPA 3NEJA 4JT4A 3P4YA 3AVPA 3FKSA 1UADA 2W83A 2PLFA 2YKGA 4Q03A 3GJ4A 5C4GB 2ZRIA 1XFAA 4JL8A 2OCYC 4ACAA 2V6JA 2H7VA 1QRAA 1XD8A 3LLMA 1JQLB 1TAGA 4OI0A 2DWPA 2EQBA 2DFNA 3K09A 2HV8A 2K5UA 2NOAA 3K9LA 2N46A 3K9HA 4M4SA 1U8ZA 1ZC3A 4DLXA 3GJ8A 3U60B 3OAAD 2ZVQX 4Q02A 1E9CA 1FP7A 1FNMA 2FN4A 2VSXA 4A8JB 721PA 3AM1A 1TX4B 4LJ5A 4QBHA 5LDDC 2BKUA 4M0LA 2MSEB 2RB4A 2AXPA 3GLHB 4UNPA 4D4JA 4TLEA 5BYKA 1NN0A 3BFVA 2REOA 4FWIB 5E7MA 4I99A 4HUQB 2YOGA 5A4JA 4KSBA 1ZNZA 1X6VA 1BYIA 3K1JA 1AKEA 3QIAA 4MGZR 4D81A 2C98A 1GP2A 5J4HA 3DPUA 2FE4A 3R20A 2OCAA 2XSZA 1VECA 3PVSA 2VLIA 4BEJA 2CL7X 3L43A 2F1HA 3M6AA 1TQDA 2ODWA 2QMOA 3D7MA 4Z54A 1N6RA 1W36C 1KO5A 3CLVA 4L9SA 2EW1A 4YC7A 2UZIR 5H70A 1E32A 4NP6A 2F3TA 4ZCIA 3BB1A 2BCGY 4C0QC 4LJ8A 1Z28A 2OBLA 3PENA 3ZQJA 4NKRA 1MO5A 3ZIAD 3UIEA 2CBZA 2F9MA 1P2SA 2BDTA 1EFCA 3JZMA 1G17A 4KFRA 1U94A 2IYWA 2R44A 3QY0A 2ZR7A 1UAAA 2QRNA 3QKTA 3TR5A 2H16A 2Q6TA 2NPFA 3QF4B 3RDPA 3KKQA 3A1VA 2XAUA 1GKIA 3MG9A 1TF2A 1C4OA 3THXB 3MAAC 2IF0A 2OXRA 4QL3A 4IW3B 1VTKA 4Z8YA 1Z0DA 1ZAKA 3VMFA 2WOJA 2H1LA 4F91B 3F3YA 4EJSC 4OHWA 1W7AA 4ABYA 2GXQA 5FOXA 3OEED 1WDTA 3RANA 1A7JA 1E1QD 4A0RA 4QGGA 2QORA 3TQCA 2ZRPA 1KK2A 2JDIA 1YZLA 2AWOA 2PZEA 4LSGA 1E9AA 2AX4A 4LC0A 4Q1CA 1JECA 3E2IA 2BBWA 1OFTA 4AYWA 3S1AB 2QAGB 2WKPA 3WBJA 2WWYA 3TJZA 1VYUA 1WRBA 1JI0A 4FCTA 3E5HA 5SZHB 5L3VA 1P9RA 2YHSA 2W0SA 2ZJOA 2WJYA 4TL9A 4YONB 2GCOA 5HKKA 4OJQA 3BS4A 1WP9A 4JLMA 3QQ5A 1A1VA 1E94E 3VX4A 4Z1MA 2XB4A 4HUTA 2VP6A 3EIQA 4TZ0A 2CVFA 3M0EA 5CYPA 3E1SA 2XB2A 1UKYA 1S9HA 1DADA 3IIKA 4MDEA 1II9A 4DUGA 4DCVA 5JSZA 4PX9A 4MH0R 4JYCA 2VIIA 1NLZA 4CEJA 3Q5EA 3W8NA 2RGCA 2GEUA 2HXYA 1WB9A 1Z0JA 3ZZ0A 4DCSA 2A5GA 4ACBA 1VG1A 4M9QA 1KO4A 3GLFA 2YWFA 4C0LA 2OFXA 3NBFA 4RSGA 3T1VA 5K8IA 2ZU0C 4DT1A 2C9CA 3K8YA 1UEJA 2ZI4A 1NJGA 4DC9A 4QM6A 1CJKC 3U7EB 1NVVQ 1NLYA 1ANKA 1TEXA 3EC2A 4PC3A 3WYFA 3RRZA 1FX0B 1T6NA 4BFXA 4BLRA 1N0VC 3RRMA 1LNZA 5FPSA 3ZYCA 5BW8A 1Z0FA 3FKQA 3CF0A 2OT3B 3SNHA 1E2HA 3FHCB 2WAXA 3RWMB 4B3XA 2BEKA 4NYIQ 5G3ZA 2XZLA 4XVRA 4LY6A 5TXGA 1EG7A 1HTWA 1E2GA 1YZNA 2XTMA 3UKDA 3LLUA 4BZPA 1HY3A 1W5TA 4YQFA 3QBTA 3F0TA 4C9BA 1DAEA 4V0NA 3GEEA 5KSPA 3VQTA 1JB1A 2QE7D 3JVUA 2QT1A 1XPRA 1EWQA 4URVR 1LVGA 1HT2E 1N3BA 3P4XA 3QXXA 2WWGA 5KYKA 3GLIE 4AKIA 4OKSA 1VKJA 1G7SA 1P75A 3CUEF 2P0EA 4LWZA 4DSTA 4PPQA 5CIWA 1XMSA 1XP8A 5CLQA 5F2EA 3P1JA 2KE5A 3GLFE 1W36B 3CZPA 3HU3A 4R71A 4M8NE 3VR5A 3A6PC 3IILA 4Q47A 5TARA 3FPAA 1FNNA 4RD3A 1XXHA 1GKYA 1PUJA 5AJVB 4CT5A 5C2JB 4TZ6A 1DAMA 4XIGS 3I8XA 3KX2A 3CB4A 1VHTA 1S0UA 3HP1A 5F3WB 2QROA 2VEDA 4RFSB 4CEHA 4NH0A 1JXOA 2R2AA 4JL5A 5ELXA 4CT4B 2QPAA 5IHPA 2CCKA 3T1OA 4PSKA 1E0SA 1MABB 3VR3A 1YRAA 4DRZA 2FV8A 4AKGA 3BGWA 4Q4HA 3EW9A 4KLNA 3U3JA 3RS4A 1E69A 4JVSB 2B21A 4X8LA 2QA5A 3QXHA 2R6CA 2ODBA 3O8DA 1QHGA 1L8QA 3B9QA 1R5NA 5EE9A 2ZU6A 2ZETA 4N0EA 3HPRA 4B3CA 1VDZA 5EXSA 3RYTC 4EJSB 1GL6A 2CLDX 1NIJA 1ZM7A 1S3GA 1UBEA 5JZVA 1UEIA 1F5NA 4ARZA 1ZBDA 3MFYA 1N6IA 4JLJA 3EA0A 3ZZUA 2JGNA 3SN6A 4KO8A 1OF1A 1HT1E 3QBVA 2Q21A 4UNNA 1K5DA 3IQWA 1OKKA 3D3QA 4RZ3A 2CHVA 2O8CA 4MUAA 1XXHE 4UNQA 1EX7A 2FSIA 1XTQA 4TL6A 2AD1A 1F6BA 3M4YA 3GP8A 1VCIA 1QHSA 1CBUA 1X3SA 3BOSA 4I81A 3DMDA 1FTSA 4A6PA 3R8FA 4OK5A 5EXPA 4AYTA 2QGNA 3F5FA 4JVLA 4RY2A 3Q5DA 4RJLA 3X1XA 1YR7A 4MKGA 4EPVA 1VMAA 1MRSA 4XTRA 4F93B 1EFUA 1TF5A 3VU9A 4W7SA 3U61B 2O8BA 1YQTA 3A8TA 1TNDA 2CNWD 2JLZA 3ICQB 3OZXA 4O2LA 1D9ZA 4A92A 1QZXA 1X86B 4Q9HA 1FMJA 3K0EA 4G5GA 4R7ZA 1W47A 4MRSA 4BZXA 2WSMA 2XGJA 4HB4A 2C99A 3AV0B 2IA5A 2RKOA 3R9IA 1E9DA 1NY5A 2D74A 4DDVA 2ERYA 1JNYA 5JHHB 2X19A 1NN3A 1T8TA 4JS0A 5G53C 2YOHA 3TRFA 4PC1A 3T5GA 2G3YA 4HDOB 4MKIA 1XPOA 4LYHA 4AYXA 2QUZA 4B47A 2RHMA 4D4MA 3SJBA 3V9PA 4HLUC 4FCVA 5J5CA 2VSOA 4PANA 4R2HA 2C77A 4JLPA 1UBCA 4PZZA 4A0FA 4AKHA 2J0UA 2HF8A 2VHTA 2OV2A 4P4SB 4PHHA 4X8MA 2JEOA 2C95A 3DKVA 2FPKA 4LPSA 4AI6A 3KFXA 1XEWX 3AF0A 4ZV4A 5FTJA 2GF9A 3THOA 2R62A 5JRZA 2NPIA 3BFXA 3R7WA 1ZMXA 2REXB 4LHZA 1E2JA 3DDCA 4O3MA 5FBRB 1XTIA 2GJ8A 1G3UA 3EPLA 4PC2A 2FPMA 1ZD9A 2J3EA 3GPLA 1KZ7B 2FSHA 2ZYVX 1XCPA 3KJEA 3TAHA 1G7CA 1H8HD 1QVRA 2W2VA 2XZOA 1QVAA 1A82A 1MO4A 1CR2A 1Z6AA 1IY0A 3HR7A 4HATA 5FL3A 5KHOC 3VX3A 5EQTA 3O8CA 4HZIA 1IN7A 4K81B 3AUXA 3IO5A 2HCBA 1R0XA 3KKOA 2G9NA 2JLWA 4URXR 3IGFA 4GL2A 3EZ6A 4ITRC 1T91A 2C78A 5ANRB 5KDOA 3TH5A 2F3RA 2CK3A 2JAQA 1L2TA 5HTKA 3GFTA 4OQMA 5GJWC 421PA 1CJMA 4RKEA 4YMVA 1EXMA 4TYWA 1OXUA 2JIZD 2V9PA 4KYUA 2R65A 3Q7PA 3UG6A 2CJWA 4TLAA 4JYBA 1RVDA 5FOSA 4DXAA 2J45A 1V43A 1ZCBA 1GIAA 1KDRA 4AKEA 4C0KA 2ZS7A 3BXZA 1XD2A 5GVSA 2Z4SA 2BMJA 2ZXUA 1ZM9A 1W0KA 1U9IA 1EFRA 4JKYA 3MWLA 3OFND 1AK2A 2QU8A 1CU1A 2QRZA 4ZCMA 1GM5A 2CVHA 1DAHA 2QEQA 2GBLC 2V3CC 4B2PA 4LGMA 1DG1G 3KTAA 1CR1A 3FE2A 3MWKA 2GZDA 1AJEA 2BV3A 2GCNA 1N0WA 2ORWA 3OIYA 5FUWA 3KDSE 1CR0A 4ILEA 2WV9A 4JBWA 4TTQA 3AF2A 3ND9A 4IKEA 1ZU4A 1KI2A 5FBWB 2HYIC 4Q9JA 1MT0A 1UM8A 2H5EA 2I1VB 3DEFA 1I2MA 3HPQA 4BLTA 1KSFX 2FH5B 2QSYA 4BGDA 1IY1A 2JLQA 1R0WA 3U4QA 4IRUB 3SJCA 4LBVA 5KNBA 2O5VA 3B8HA 1WBDA 1OJLA 2ZPTX 2GEDA 2FA9A 4WBSA 1BIFA 4HAZA 1S3SA 4NYJR 2QI9C 3H86A 2Y8EA 3U44A 5C4MA 2C96A 3A58B 5LB4A 2W6IA 5BN4A 4HSEA 4HYYA 3MSXA 1FFHA 1YZKA 1JR3D 4Y0VA 4D6PA 5FPHA 1GDDA 2V55B 3K0AA 2V1XA 4JLVA 4JBYA 4TMXA 3B82A 2F43B 3BIFA 2B7BA 2HJVA 2NQ2C 4PQRA 4W9MC 1ELOA 4GOJA 1AS2A 2O8FB 4KITB 1CKEA 3QPUA 1D6JA 4IJMA 3BH0A 4WXRA 4GP7A 1SKYB 4G0NA 5FH9A 1F3OA 3QEJA 5SZKB 2A7QA 2KBEA 3QPVA 2QM7A 1M2OB 4Q4LA 3BRWD 2BVNA 2O0KA 2WHXA 1TQ2A 3EG5A 1O87A 4TQUS 2BMEA 1Z07A 1YR6A 1KJWA 3W8RA 1Z08A 4N3NA 3B1WA 2NMVA 1NF3A 2FU5C 3TLXA 2ZIAA 2FF7A 4C0AC 1Q0UA 4YDSA 2R6GA 1DAGA 1CLUA 2AR7A 3KUCA 2MSCB 3SEAA 4BPBA 4B3GA 2IYTA 3C4JA 1SULA 4PZLA 4PPFA 3VHLB 2GJKA 4I1OA 1GNPA 3AKCA 3B9PA 4V0MA 1XMJA 5DGXA 5FTKA 5JRJA 1NL3A 2BBTA 1M6NA 2ZUDA 2WKRA 2RGNC 2B8TA 3SZRA 4EPTA 2NZ8A 4G5RA 2HLDD 2FFHA 1XZPA 2GKSA 4LHXA 1EK0A 2ZREA 5JBQA 1X1RA 1PJRA 4QHTA 1KI7A 4Q19A 2G1JA 4JLBA 4W5JA 1C9KA 2NO0A 2A3RA 5FI1B 3F8TA 3P26A 3N2IA 4AK9A 4CGZA 1SXJA 2WOOA 2GESA 4MGIR 2YNMA 4HLQB 3A1UA 4HDQB 4JJKA 1KO8A 2FOLA 2WSSD 2Q3MA 1UBGA 4HAVA 2XXAB 4BRWA 2PEZA 4LHYA 2RAPA 3ND8A 1ETUA 2PH1A 1E9FA 1ZC4A 1LS1A 3ZVLA 1NG9A 3LW8A 1KSJA 4JLAA 1N2CE 2RGXA 1J2JA 1ZM4A 4LHWA 2F7SA 3K0CC 1VPLA 2B6HA 3IHLA 2NO1A 3OAAA 4JJZA 4V0ME 3IUYA 4QGAA 2JATA 2PT7A 1R5BA 1DVRA 2WWFA 1KO1A 4C0SA 5EE0A 2HCJB 1DEKA 4RVCA 1LY1A 1T0HB 3K70C 2ZRBA 4TT3D 4KFUA 4AG6A 3IIJA 1ZD1A 4M1OA 4JLKA 1G3MA 2WBLC 1QHYA 2A5FA 4Q1EA 5LD2C 3KQKA 1T3HA 3OEHA 1T5LA 4TTPA 1SXJE 4PPNA 3FFAA 3MUFA 3W6NA 3Q85A 1JQJC 3A4LA 2J7PD 3D31A 3CWZA 4LOAA 2UVQA 2FDCA 4DHEA 2ZJ2A 4R98A 2E87A 1W0JD 5HE8A 2GK6A 3EX7C 4QFMA 2YWHA 3B13B 4P0TA 4YDHB 3SFZA 3H4MA 3REGA 4OYHA 4NHOA 2WIBA 2C2HA 4LYJA 3WMFA 1VG0B 5KSYA 2YWGA 4A8JA 3KKNA 2ODEA 1ESMA 4HZUB 3U6BA 2P5TB 3TNFA 3ZIAA 4II7A 3B60A 4OHYA 3U3OA 1S8FA 3GLHA 2WAYA 3CNLA 5KTYA 1M7GA 1UKZA 3AVWA 1PVOA 1SGWA 2ZROA 2BOVA 3X1ZA 4B3DA 2PMKA 4HUQA 1Z6GA 3A1TA 4D0NA 4XD7D 5FR1A 1CR4A 2YOFA 1ZP6A 2NO9A 2QMHA 5DE3A 1OH8A 1WQ1R 1SVKA 3SYKA 5DSZA 4LCBA 1Z22A 3ZH9B 1S4QA 3DOEA 5E4FA 1PUIA 2Q3FA 3EXAA 4GMDA 4C7OB 4QGFA 1OYYA 5GJCA 3SR0A 5FBLB 4KLZA 4MDFA 2VP4A 1NKSA 3AH8A 2HEIA 2ONKA 2R8RA 2ZJYA 1BS1A 3T12A 3OEEA 2W58A 3TGPA 2ZVPX 3KQHA 1E1QA 1T0JB 4LJ9A 2EFHB 3RVBA 1DE0A 1G3RA 1G8HA 1TU4A 2ZI7A 1KI9A 1EX6A 1IJFA 3T61A 1DAIA 5CDFA 1HURA 521PA 2YINC 3BB3A 1DAKA 1Z63A 4EPXA 2P5SA 4LJAA 4M1YA 5F98A 1S1MA 2IHYA 2WIAA 2H92A 2VPPA 3QF4A 3GLHE 4MRNA 1G7TA 3WNDA 2IYZA 1E2PA 1YJ5A 5FTNA 3ZZTA 4BFZA 3THXA 3AKYA 3KXLA 5C46F 5FL7D 4IDQA 1YE8A 1FOEB 1FUUA 3A4NA 2CHQA 3ZVRA 4YMWA 1P2UA 3AVOA 1E9RA 3QOFA 1P60A 1KI8A 1K8RA 1MR3F 4DLSA 3I1FA 3LQQA 3VR4A 2J59A 3LO5A 1PLKA 3WRYC 2Q9BA 1B23P 2FEOA 4DSOA 4K46A 2OM2A 2PX0A 2QNRA 3RWOA 5EP2A 2RH5A 5FUXA 4BRUA 4W5WA 3PITA 2ZM5A 1ONBA 1KJYA 3S1AA 2QAGA 4DBLC 2O8EB 4PXAA 1MOZA 1NBMD 5TV2A 2DB3A 4A15A 3U7FB 3BERA 5SZJA 1GRQA 3TUIC 4NPHA 1KI3A 1Q1EA 5F9FA 1RFLA 4DLZA 5AWFC 1NMZA 3FMFA 1NVUQ 3E70C 1G19A 4V0OA 4CEIB 4NCJA 3NIBA 5CDFE 2A9KA 1ZRHA 3U6KA 1Q3TA 3NG1A 4L5BA 3FWYA 2P6RA 3GJ7A 2OCPA 1G4AE 4PPGA 1GFIA 1G6OA 3RABA 1KGDA 3RLFA 4XWOA 3D8BA 3BC1A 4DEYA 5IF9A 1MKYA 1E2EA 4B6FA 5CIQA 2YV5A 4D4LA 4FMCB 3K70B 2ATXA 3MWJA 4F92B 2W2TA 3MJRA 4URYR 2OSBA 4HAWA 1HH4A 4US2R 3EZ2A 1XCMA 2BJVA 4C0HA 2B7CA 2G88A 2IWRA 5KNCA 5LD2B 2WZQA 4Q4JB 4KYIB 2J5XA 3HU2A 4XSGA 1T3SA 4LC1A 4CW7A 3PUWA 4QNMA 4NCKA 3AF4A 2XNSA 4IHQA 3WRXC 3MWYW 2A5YB 1AS3A 3V4RA 1JEEA 2AKYA 4ZIRB 1M7BA 3KQNA 3EZ7A 5CJPA 2A5DA 1FX0A 4GFDA 2CLSA 1VG9B 2Z6VA 1RPZA 3BD9A 2I3BA 3LVQE 4JSYA 2Q9AA 1LTQA 2N1BA 3AKEA 2D2EA 2DFTA 3W9YA 4D2IA 3AP2A 1W4CA 3CM0A 3UANA 4FI3C 5BN3A 3K70D 4A2WA 3C14C 1XZQA 2IW3A 4NCHA 1II8B 8OHMA 5B64A 5H8WA 3L82B 5EXTA 4DIEA 1TEVA 3PUZA 2P3SA 1NMXA 2ZE5A 4G3XA 4EQ6B 3ADDA 3VKHA 4DDUA 2GILA 3LBNA 1A2KC 5DHFA 4OQXA 2WWXA 1TL7C 1JPNA 2VP2A 2VBCA 3AGQA 1UPTA 3IO3A 4B3BA 1G3QA 1EFHA 3KKMA 4HB0A 5D3MB 3TSWA 4ASUD 3HDTA 1Q1ZA 3FDIA 2GZHA 4TSFD 3MRSA 5FOWA 3PFIA 3EZFA 3RS2A 1YZGA 1OB2A 3T5DA 3AF3A 3BAFA 1DTSA 2NO7A 3L8ZA 4KHZA 1XWIA 4JZKA 1CJTC 2I1QA 3BH7A 4TQAA 5LBIA 2ZRCA 1QG4A 1G8GA 3RS0A 1YR9A 1A4RA 3QKSB 2WWIA 2H8KA 1LV7A 2ATVA 3ASZA 4RFSA 2QP4A 4WW0A 1GNQA 4AC9A 2CLCX 2EU8A 4B48A 4D82A 3B78A 1HQCA 3SBDA 1UJ2A 4NDZA 1MABA 1U98A 2ZTSA 4LBYA 3HWSA 2GXUA 2X2FA 1YHNA 4Q9LA 1WBBA 3RHFA 1AM4D 3RSLA 1OXVA 3LV8A 5KDLA 1Z47A 1K5GA 3WYGA 5JCPA 4OHXA 5TMPA 1KIMA 1MRNA 5G3YA 1R0YA 3SE0A 4TMVA 4M22A 4ZI2A 4PFSA 2CNWA 2ZYWX 4EJSA 1P5ZB 2P6NA 4L16A 4LHVA 4KCGA 2WJGA 5E7JA 3QKRA 1U2RA 2QGZA 4DSUA 4QJ4A 5KSZA 1KY2A 5FTLA 4KODA 1CRPA 3LA6A 5KPDA 1FL9A 2XEXA 1G8PA 4JT2A 3UMFA 4LYAA 4D80A 1SVIA 1ZUNB 1KY3A 4F38A 3QVVA 2ZAMA 3OIUA 3W6PA 2DYKA 4MYHA 1KI1A 4ZDJA 2AN9A 3CW2A 3AVYA 2JLXA 3CX8A 1ZD8A 3LNCA 2WJJA 4LJ6A 2ZI6A 2JJ1D 4XH9B 5KDDA 1N6HA 2TMKA 4MA4A 1GZSA 4EPRA 1NRJB 1E0JA 2WMNB 3TMKA 1ODFA 4U5XA 2PZFA 5E3HA 3ADBA 3EWSA 4BFWA 2REBA 1PZNA 3W3AA 2IYXA 5CM9C 4DDWA 3SYNA 1SVSA 5TVKA 1H8EA 1E4YA 4NYMR 4PHFA 1X8JA 1VCOA 5J4LA 1KNXA 1I4LD 1OIXA 1PLLA 2VP0A 5KNDA 2Q9CA 1X1SA 5K8TA 4PR0A 3AKDA 1XTRA 2Z83A 2BMFA 3SI7A 3FB4A 1D2EA 1NKTA 5AJXA 1E2QA 4MYTA 2ZI9A 5E95A 3PG5A 3PR1A 2JDID 4GP6A 4Q9IA 3SOPA 5AUQA 4BE7B 4ZO4A 2EFDB 1AQYA 2C03A 2R6DA 1KI4A 4PAMA 4JLDA 4B6EA 1H8HA 2AWNA 2RGAA 4KBGA 2GHIA 3PV0A 1KKLA 2OESA 4A6XA 3OIWA 4TN1A 1GSIA 3ZLJA 2AKAB 2OILA 3ZD7A 2L0XA 1E2IA 3QKRB 2FG5A 4C2UA 5A0FA 2JJ2D 2V4ZA 4CRWB 2FX3A 2MMCA 4FN5A 4P4SA 3U3RA 3CX6A 4BEBA 5FFMA 1B0UA 3TBKA 1GWNA 2GDJA 1OE0A 5EP1A 4BQSA 5JS8A 2G0NA 4KAXA 3I5YA 4M9XA 2XZPA 5AJYA 3BJIC 2QPTA 1D5CA 2X77A 4C0BA 4L8GA 4DUGD 2A30A 3W3ZB 4POAA 2KWIA 3K9GA 1IQPA 1E2NA 5GJBA 4B2LA 1DARA 3VR6A 5DN6D 3UG7A 2ZRFA 3O8RA 1G16A 1LFDB 2ZSBA 1UDXA 2ZJ5A 2GJAA 3PJRA 2BJWA 1SKQA 1VYTA 3VKWA 5LPNA 1ZCAA 4HB2A 2GVDC 4FMBB 5C18A 1S9DA 1W2HA 1G8FA 1II0A 1N6PA 3NDPA 4FXPA 4MKFA 3PEYA 1Q12A 1COWD 3BE4A 4LV8B 1N5KA 2WMOB 3T15A 2B8WA 2ZRNA 4ESVA 1TQ4A 3RAPR 4QM7A 4EAQA 2W0MA 1E2KA 1QHHB 2QY9A 4A9AA 5L3RA 1XJCA 3CNOA 3DOFA 4WZAE 1EFTA 5CJ2A 1G41A 1F60A 4Q9KA 4CYMA 3MCAA 4Q1FA 2VSFA 2XX3A 3MMPA 4RFVA 5BWMA 1P9WA 3TE6A 3UPUA 4BFTA 1MV5A 4V0KA 2NIPA 2EFGA 3T06B 1G7RA 4MRPA 2NTYC 4B33A 3GJ3A 1XEXB 4DLRA 1OFHA 4C2TA 2QTVB 1E9BA 4D0LB 1N6OA 1OHHD 1CEEA 4LV6A 2GAAA 1MH1A 4FD2A 2AHOA 2ZSAA 1KZGB 2DFKB 1JR3A 2FSGA 2IYYA 3AGPA 2OBMA 3SYLA 3EPHA 2VL7A 1A5TA 2BHRA 2HYDA 2WWHA 4JBXA 1OT3A 3EIEA 1L4YA 4ESHA 2OBNA 4UNRA 4JLNA 3TIFA 4JKIA 4BLPA 3NHBA 2IXEA 3KL4A 4B34A 3RC8A 3REFA 3VNVA 1W44A 3T34A 3GMTA 3GJ5A 2F9LA 4PO1A 1E99A 1BYUA 1O3YA 3JVVA 4LI0A 3ASYA 2O8DB 1AKYA 1U0LA 1N5IA 1R8SA
chains in the Genus database with same CATH superfamily
1XZHA 3DKKA 5K0GA 3STXA 3GVCA 4RK6A 3OOHA 2F43A 1CJVC 5CDYA 1NLMA 2H2WA 5DGIA 1A7UA 4KGZA 2XUHA 2Z58A 1FEZA 5A3RA 5T4BA 3ITKA 2JF0A 3IESA 2R96A 4HB3A 4AIIA 1NDHA 1R37A 3S3TA 4EY4A 5CH8A 3FYHA 3HWWA 2Y1DA 3KFLA 5B58T 3UBTA 1U1EA 3ICWA 5BQGA 1WUHS 4FJ2A 3THYB 4I7EA 4QPZA 1ABBA 2F3QA 2XMGA 3PI7A 1Y7TA 1YOVB 2UUCB 4E5UA 1Q7RA 7AT1A 3FLBA 2ZRMA 4UARA 4AMYA 1KVSA 4AZ3B 4EPWA 3W34A 3SLKA 2ZJ8A 2HFIA 4Q48A 2RI1A 3VOAA 4FR0A 5A9SA 5BUCA 4NAHA 2GBLA 1NASA 2O6HA 2ZLBA 1SIUA 3FNIA 2F1KA 2J5KA 5EXEA 1ONSA 1QLHA 1U9ZA 3W7AA 2B69A 4M53A 3DEKA 2C61A 1SO8A 3ABIA 4MEJA 1VMEA 4KXXA 3F8SA 4RV4A 2LKDA 5K0TA 1K98A 1H4VB 4WOKA 3G6WA 1Q19A 1K4YA 2DAPA 2C1ZA 5LB2A 1E6KA 4G97A 1WUKS 1W4RA 3HA5A 3H2YA 5EMJA 5HIJA 4F5EA 4DABA 4CI9A 2ZQ5A 2MSDB 3WGYA 4KR9A 3SQLA 3EFOA 1WLYA 4YWQA 2GNOA 2P9YA 1C9JA 5DYTA 4LZNA 4KQJA 5I7VA 2PKWA 3LL7A 1R4ZA 4ZXPA 4MVJA 1KJZA 3EDQA 3A37A 5GMOA 4X3OA 3UJAA 5CX1B 4Z9XA 4MGKR 3S8MA 4NATA 2V6GA 1CS4C 3SDZA 2EWWA 1US8B 5CVVA 4E3WA 3IH5A 1YRYE 1ONOA 2WJWA 3QFHA 1IZZA 4RSHA 4QBFA 4RD1A 5AM0A 1UWVA 1EB9A 3AYZB 4JTAB 4EUKA 4N6GA 4PQYA 3CIOA 4ZYYA 5FA6A 2FWMX 4GIBA 1E2MA 2R5NA 3VNRA 3G0IA 2RHOA 2V26A 2PR2A 1FP4B 1WTCA 1Z4NA 3QSYA 3H0KA 1Z9BA 3DSRA 5EJ9A 2HIGA 2WSIA 3L9WA 5EMMA 2X23A 3NMJA 2JKVA 1PJZA 1XZLA 1V5EA 2R6R1 3NC4A 2CMKA 5D3ZA 1Y7PA 4ZYZA 1XTTA 4E46A 3AUKA 8GPBA 3VR2A 2WT9A 2ZE7A 3BJZA 1FMWA 1GDHA 3UJHA 1TM7E 2JI7A 3V00A 1IN8A 2Q6OA 3S0JA 1JLLA 1W9HA 4IXTA 3VVBA 2G4CA 4NNJA 3L7JA 2ODQA 1KY4A 4L9WA 1KYTA 1HT3A 3CR8A 3RVZA 4I6GA 3GBVA 3N5CA 5A6VA 1J0CA 3QSGA 4H3SA 1JSCA 4MITA 1I0LA 3BM5A 2IYUA 3W8DA 1N1CA 5A9RA 1ZW6A 2QTHA 1E5LA 3RTDA 1BSVA 2ZAIA 2OD2A 1YBHA 5KOYA 2ILVA 1C9EA 1HDCA 1TUBB 3KT0A 4YDQA 1X8KA 3C7TA 3I32A 4R8KA 4CIBA 3C3MA 1TU0A 5FF9A 5TQ2A 1R9NA 3C8GB 4OI1A 3KQWA 1C29B 1RKXA 3WKBA 4IILA 1FP2A 4F4HA 5G1OA 3SKXA 1JBKA 2XD4A 4BMOB 2NSDA 1UK7A 2ZE6A 4BCBA 4O2RA 2D06A 4NYJQ 4EZIA 3J80A 3L0YA 1V1MA 1KDOA 5CA0F 4OIRF 4TWRA 3TIXB 4R1QA 3ZN2A 1SCUA 1RM4A 3I5UA 3R5HA 2FNAA 1Y8QA 3SEZA 5BV8A 1UMKA 1Z4OA 2A4KA 4UBOA 1QX4A 4YX9A 4QT4A 3CX3A 1DC4A 2XODA 4MQBA 3MIIA 1KFJB 3ETJA 4KKVA 3OE7A 4K1LA 4OK3A 3EMDA 4EY5A 3NONA 4FBMA 1H05A 5B4VA 3COSA 3R0VA 4O1IA 1AMNA 5EERA 1RXCA 4BMCA 4RLHA 3LT0A 5C4IA 4JGGA 1P7CA 1U0JA 3KZ1E 2Z4TA 3HZOA 1K8QA 3HN2A 1JVSA 4I1UA 3DGFC 3KJGA 2BFBA 4M8LA 3WIBA 1QFYA 1YFJA 4R3WA 1X7GA 4R8LA 5FPTA 1XXLA 2P6PA 4ZDWA 1I4DD 2P9FA 4OXIA 2O8CB 2PFGA 2PM8A 5J9FA 4G0ZA 2H3EA 3JD1A 2O8BB 2P27A 1T4GA 3WMGA 1Q83A 3H0EA 4O4JA 4JGIA 1FDTA 2I76A 2RONA 2ODNA 2FEKA 4PG7A 3MNFA 4IIGA 1E1RA 4PIMA 4ZCLA 5EUMA 2VUHB 1NX9A 2I3GA 5BVGA 4IVQA 2Q2VA 4YJ2F 4HGRA 2O9XA 2R1UA 1BH6A 1JIXA 4PSDA 3BB4A 4XTCS 4P6VF 1N6NA 1H2XA 3IHWA 5CLFA 1PX0A 4RENA 4J7UA 1I7LA 1XBTA 1OFVA 4Y6SA 4QJ5A 4XEVA 3DQPA 1EFKA 4OAQA 5BWNA 3LYLA 1Z83A 2ZUVA 1CV2A 3GJSA 2VDMB 4PZAA 4DJFC 1K8ZB 4YALA 5D6NA 1VPEA 4YFYA 4WV3A 2VPYA 3K0FA 2DULA 3I73A 3BRCA 2L9JA 4Y1FA 3BSFA 3VYVA 2AOUB 3UK6A 1RYMA 5KNDH 4X6XA 3ZJYA 3U80A 1Z56C 3F5DA 1A76A 3T9CA 4BU1A 1G2PA 4PJJA 2EW8A 4NZNA 2DBQA 5E3JA 3ZW8A 4JRZA 5F9HA 1QOZA 3O4HA 2PJRA 1SOVA 3U4QB 1U8YA 1WB4A 1MJHA 1ZI9A 2QYOA 3SHOA 3IFSA 4CNBA 2GVZC 2HI0A 4H1HA 1F4PA 3EYAA 3N39C 3M5DA 2CL0X 1CC1S 1T8UA 5CB4A 4JE9A 1V4NA 1YZUA 3PX7A 1EVEA 3CTPA 3PQ3A 1JILA 4FDAA 4OXKA 3AILA 1G1MA 1PNQA 1E4VA 1MJFA 4W1QA 1DINA 2XS1A 1ZH0A 5EIAA 2I8CA 1I3KA 2EL7A 5BW6B 3SZ3A 3MGCA 3KOWA 1B16A 4FWBA 2J0XA 3SPXA 4BVJA 3GV0A 1Z6YA 3L7CA 4WVFA 5F35A 3MBOA 3JSXA 1Z18A 3R44A 1FVXA 5JRDS 4DV1B 2H2HA 3AIKA 5C51B 2HY7A 1E9VA 3W5JA 1L1EA 3OCVA 3S81A 4LERA 4Q7JB 3KZKA 3I1IA 1OSNA 4MEBA 1U1GA 4MS4A 3VPXA 1UDWA 5HKAA 3U37A 1CUFA 2BZ0A 3VZBA 1UF9A 1PEKE 1BA3A 1Q6YA 2B1GA 4YIHA 5A6BA 1UADA 3R1IA 3HEAA 5C4GB 4W6QA 4KE7A 5JNLA 3DJUB 1Q84A 2EQBA 2DFNA 2PQMA 3OM8A 4X7MA 4CM4B 4X91A 3E9VA 1TX4B 2R68A 2GUWA 2XUOA 2AXPA 2REOA 1PJ8A 1CNEA 1WDLA 1DO8A 3U1BA 4MGZR 2C98A 2V7UA 1ST2A 2HRBA 4MW5A 2CL7X 1U2GC 2QMOA 3CLVA 4O2BA 2H9YA 1D1SA 2F3TA 5KOIA 1JMWA 4DLBA 1DZIA 4F45A 1QC5B 3RJZA 1OAKA 2R44A 2XA9A 3CB2A 1XDDA 2OU6A 1KWKA 4RNDB 1C4OA 2G71A 3PGA1 3UGTA 3SM3A 2WSLA 4QU5A 2XGSA 2AWOA 4RNCA 1OY1A 4J29A 2BBWA 4EK9A 3TJZA 5C1OA 3HKBB 5C5DA 3GDWA 3G13A 2I9PA 5HEKA 1QQ5A 5ISMA 4WTOA 2WJYA 3FWKA 3BS4A 5KWEA 2IPAB 1JIUA 1Y8CA 5FADA 3QW4B 5TT0A 1G5IA 2VP6A 5LQAA 3T6BA 4OP3A 3QZCA 4IAOA 5JNUA 1II9A 3DBRA 3TKAA 1RRMA 1BE1A 1WB9A 4H0NA 2X76A 3M1YA 2VQ3A 4M99A 3OQJA 2YW2A 3RYHB 1ZD4A 3N2KA 3OJCA 3L1KA 1X1AA 3EC2A 1JRLA 1JHXA 2QRQA 4CWAA 2WPNA 3CCCA 3ZYCA 2BEKA 4XVRA 4HDRA 1E2GA 3UKDA 5K3DA 2VH2A 1UBKS 3DMYA 4EHBA 3GZ4A 4QDJA 1ISFA 4ME6A 1N3BA 3QXXA 3B48A 2Q1TA 3ZIUA 5CIWA 5C8XA 5F2EA 3GLFE 1THMA 5A62A 3FPAA 1LC0A 5IAGA 2Q8NA 3IAXA 3LQ4A 2QROA 1NMQA 1JXOA 3DKIA 2G76A 3NBQA 1N92A 3CHYA 4KR2A 5F3DA 1VDZA 3RYTC 4K87A 1S3GA 3MJ4A 3MFYA 1NNLA 4IHJB 2BFCB 1L5WA 4RPHA 4XDZA 1YE5A 4LYDA 4RZ3A 4UNQA 2JLCA 4DG8A 3R3SA 3C3WA 1OC2A 2XGMA 1YR7A 3KYDB 3U61B 1YQTA 4TKLA 2CNWD 2ROQA 1MX9A 1FMJA 3SMQA 4BZXA 3IVAA 4HB4A 3F47A 4JS0A 4HDOB 4MKIA 1UDAA 4RKQA 1E3IA 1XKXA 3KHTA 4PANA 4CV2A 4G63A 1Y3DE 4OD0A 4MV7A 1Y3BE 1JTEA 4DADA 1K0UA 4Y3UA 4P7FA 2PPVA 3DDCA 5ALJA 3FETA 1YZYA 1KZ7B 1XCPA 1G7CA 3A70A 4XWTA 1A82A 3N8NA 2ZGVA 3E3OA 3HR7A 4N6NA 3A2NA 4K81B 2IH5A 1HBJA 5AI6A 1EUYA 2G67A 4EVIA 4RDHA 2OB1A 1B0PA 1JBQA 1F8GA 3TTUA 1W96A 2IUEA 4HPJB 2OXIA 4D9KA 4X1YB 1M76A 2VAVA 2ZS7A 3D2BA 4QYIB 1H42A 3RGWS 5HJ5A 3LPDA 3TR6A 5JNWA 2C2MA 4ZQEA 2CVHA 3JYLA 5KVVA 1CR1A 3FE2A 5BV2P 2GHRA 1I3MA 1OYOA 4NQZA 4ILEA 1AK9A 3ND9A 3F5QA 5FBWB 4Q3KA 2FJ0A 4CM7A 3OZIA 3LI2A 3ZEAA 2ZPTX 1RXEA 2QI9C 4MMXB 2P2NA 2FOXA 4LQLA 2FPPB 2GVNA 3ELBA 1QTRA 1ZIDA 4E7OA 1T34A 3PT9A 4RVFA 1MG5A 3LZCA 4LXIA 4N0QA 1U7UA 1RQPA 1CP3A 5C8YF 1RLTA 5DOZA 5E4TA 3T8YA 4CL3A 4WGGA 2YLIA 4KO3S 1DAGA 1CLUA 4PNHA 1ZKDA 1E61A 4C3EA 4PPFA 2O2XA 1XMJA 4INOA 5L7WA 3L84A 2ZUDA 3K5PA 3GRAA 16PKA 3NT5A 2HLDD 2W93A 5DYYA 2X7XA 1BCSB 4R0NA 2JH3A 3UW1A 4CGZA 4N3BA 1Z13A 3GAZA 4HLQB 1IMJA 2B4AA 1C1XA 2XLVA 2WFZA 1NZDA 2VPIA 4LGCA 5P8WA 2XCRB 5EMNA 1V8BA 1WG8A 3NOOA 1B73A 4C0SA 5AHXA 1G0NA 3FDZA 7MDHA 1G3MA 3M70A 1R9MA 3OEHA 3DFFA 1SXJE 4ZI7B 3UMJA 1NE2A 4DPKA 3LLCA 3KS9A 1U1DA 5ALWA 4E4RA 4IXDA 3T7DA 2GK6A 1M57C 1A9XA 1E3QA 1OBFO 2HIMA 2ODEA 3ZIAA 4OHYA 2F8TA 5H5JA 3GLHA 5JXJA 1EGMB 3HCOA 3JT1A 4B3DA 3G5LA 1C3XA 2YOFA 3KSDO 1T1IA 1DKQA 3F96A 1S4QA 4FKMA 3FYSA 3KB6A 1L6RA 1ZQ1A 2FP3A 4BHTA 1L7EA 1TU4A 5ADHA 3K7EA 2RH4A 2HDOA 3Q7LA 4FVTA 3BB3A 1Z63A 1ZJZA 1AUVA 3L93A 1S1MA 1V4AA 2ACWA 2P2CA 4DGQA 4E2YA 4FOSA 5KSWB 3T9EA 5JO9A 1IK6A 4IDQA 3U16A 3TQIA 1B1AA 2PBZA 4LXYA 3N75A 1FXWF 2ADFA 3I1FA 1E58A 1Y82A 2H8AA 3R9XB 2QRHA 2UZAA 2HNAA 1KQPA 2CFTA 2X0IA 4AY3A 1SVUA 3VJLA 1Y6RA 4LDPA 4YP1A 4U0KA 1NMZA 4P53A 1KJQA 3GLQA 4TQGA 2WNSA 1M2EA 1GFIA 5LN1A 4LDRA 2BSAA 5JR3A 3TQRA 4DV4B 3PVCA 2PD4A 3Q87B 4URYR 3UFBA 5JE8A 3HG7A 2FLWA 5KNCA 5CVEA 5AOVA 5COBA 3MWYW 1JEEA 3AETB 4ECAA 5JS6A 3IXMA 3KUUA 1RPZA 3O3OB 2I3BA 4L6IA 2O19A 3MJEA 4IP0A 1II8B 1UFRA 4B45A 4BKPA 1HZZC 3DVSX 1V8PA 3RQSA 4DQ0A 4JXKA 1NWCA 5KVCA 2VP2A 3GHYA 2XWQA 1EFHA 4TSFD 3PLAE 4I2VA 3COYA 5LZ5A 2XV1A 1DCTA 4A0QA 4NZ9A 5DF1A 3NT2A 4A73A 3OKFA 3ZXYA 1FFTC 4D82A 4XYEA 5A4KA 3EBLA 4KLRA 3TRHA 2GXUA 1Y7HA 4YGXB 4OHXA 1NUQA 2VJAA 5E7JA 1OAAA 3MXOA 4H2DA 4YJ3B 3UTCA 1U4OA 2A58A 1VHWA 2I1WA 4BJ5C 4MYHA 1I8TA 2IIBA 2XQVA 3P71T 4YAJA 4MA4A 1NRJB 4BFWA 2REBA 2DPHA 1QF6A 2B36A 3DKAA 3LF2A 5TVKA 4GL4A 1XAIA 4B4DA 1OIXA 1XQYA 4WABA 4F84A 1X1SA 5K8TA 3INTA 2C9MA 4H60A 1QKRA 4BEWA 4Q9IA 4GP6A 5AKZA 3IQDB 4FBLA 3S2FA 2CFIA 2R6DA 1NW7A 1MXHA 1LJLA 3ZLJA 3LUBA 1P0FA 1F0NA 4XQ9A 1M3SA 1W5BA 1B0UA 3TBKA 4XIYA 4ZJZA 4CBEA 3I5YA 4K0RA 2QPTA 3D4IA 4XPXA 1I5RA 5GJBA 1N75A 1DARA 2FK7A 3OQBA 1RACA 1TWAA 1IFXA 2C9BA 4X20A 1Q1AA 4DCMA 3U19A 3BE4A 2R1TA 2J5BA 3N2NA 3QEBZ 4NBLA 4JYZA 1J6UA 4UNIA 4XWJA 2Q41A 3V48A 4MJLA 3JQQA 1EE9A 4LKRA 2EFGA 5T3WA 4IIHA 2O2EA 1DKNA 4UHHA 5ALVA 5JZBA 4DA6A 1QYXA 4TGLA 2CMHA 4DEVA 1LLFA 1RTKA 2WHEA 1XCLA 3DLCA 3NHFA 1FNSA 1L4YA 5DS4A 1VE5A 4BLPA 3OCYA 1E7WA 4MP3A 3GMTA 5AKJA 3WL5A 2EZUA 1Y42X 4YREA 1K7EB 2H06A 3EPJA 4DQDA 4MVSA 4CKCA 4A4AA 1HA3A 1H6GA 2Q5CA 5KYYA 3A6LA 4BFCA 1AK1A 4ENTA 4G67A 3MJSA 4WAUA 1OFUX 1MA3A 2OJQA 1OIVA 3SXUA 5DVZA 3EOBI 2FR0A 4BLSA 3O3CA 3HUDA 2R8PA 1F6WA 2XTZA 3HN6A 1E9EA 1RADA 1J25A 4A2CA 4B40A 1OI2A 2O2GA 2Z9CA 5AUNB 2WJVA 3RH0A 2GETA 2DUNA 4QQNA 2HMQA 5H02A 2VTEA 1HDRA 1U7DA 5LU9A 2YYZA 3NH9A 3JZIA 3DMNA 4ZVNA 3FGNA 1QQTA 3WLKX 4IHKA 3OQPA 1WUIS 5LZ9A 1S8OA 1XTBA 2R7KA 2KJGA 3QKUA 1OZFA 2B7LA 3NWBA 1ILEA 2UXCB 5G0VA 3ZLTA 2J9XB 5TSDA 4GXTA 3I1YA 2QI9F 3WAGA 1DZ3A 2YR0A 4E15A 3KZOA 5AUPB 5CHYA 3RNLA 4OM7A 2QX7A 2FK8A 2R7RA 1O2DA 1YCFA 1WMAA 1UIMA 4UNSA 4JC0A 1U2DA 1G66A 4S35A 1QKJA 1T4CB 1O6CA 4YCJA 3L8IA 4AKSA 4H7DA 3TSOA 1BHSA 4ND8B 2QRKA 3NHAA 4RVOA 1W1WA 2O5RA 5AVOA 2GM4A 4JI4B 1VHLA 2C59A 4LX0A 1NDQA 3R40A 2Y68A 1MMGA 1QHIA 1KVRA 2O7RA 2WKWA 4PFOA 1F2UA 1Q20A 3K4HA 2W2NA 2XMPA 3VBEA 4XYBA 3X1YA 1U7PA 4BFSA 3RIEA 2WR8A 2C0QA 4WLEA 2YUTA 3T4UA 1VBKA 4BFYA 2FX2A 4FGSA 1TQ8A 3CF4A 1L4MA 2JCBA 5FOUA 1J0XO 1NAHA 4URFA 2A67A 4CEIA 1RM3A 2ORED 2Z0MA 2IYSA 5ITWA 4KZPA 4OEHA 3BMCB 5BQ3A 1V39A 4IAQA 1JIKA 4EJMA 3L34A 1PJLA 5CVUA 4ZRDA 1JPJA 4YMLA 4NMLA 2FZ4A 1A8PA 3GFPA 2WYUA 3BZBA 1BVUA 1AB5A 1YQEA 4Q4ZF 4B17A 2PSFA 2BSXA 3JVDA 4R81A 3KXIA 4UVDA 2UZ3A 4BZWA 3TSYA 3BN3A 4WMLA 4XQ1A 4J0KA 2WMDA 3EQZA 2G83A 3SC2B 1A95A 1U63A 4WCFB 1CY4A 1M66A 4M86A 1M6WA 1MJGA 4C0JA 3CE9A 3Q9UA 2JJ1A 2QTAA 2AUMA 4DF3A 4A82A 2PV0A 5I4CA 3OZCA 2FN3A 4D4IA 2ZBRA 3EEYA 5IEJA 4M76B 3I6MA 2YXLA 1T8RA 5EZQA 2DBYA 5ADUS 1E4OA 3QXSA 4LVCA 1XRMA 2WZFA 5DLJA 2GZ1A 5JD5A 4JOCA 4CNQA 4LAFA 2J0EA 3HJAA 3LC1O 3GCGA 2IELA 1CERA 3QLEA 1Z4PX 1ESDA 2H85A 5F2NA 2YXNA 4B4KA 4TWAA 2Q1YA 4NVRA 1XA3A 2PKXA 1IAQA 3CZAA 2EKPA 4NJEB 1ZUWA 1W1IA 4PAQA 3ZOZA 1Y4ZA 2MSKA 3UKOA 5AK0A 5K7SA 2WUWE 3FJOA 3IBYA 4AZVA 4XASA 4LNUB 1DCMA 4DANA 3B1ZA 4NE2A 4GSYA 1BG6A 5LQDA 3BE5A 3JQ9C 2BBOA 5FLXA 5ALOA 4MNTA 3KB1A 2RK6A 3IIMA 3M2TA 5CA0A 2W2LD 2JH8A 4M8SA 3GP5A 4NBUA 4FQ5A 3V1LA 3F5SA 5ES4B 3GLIB 4AAYA 3T1HB 5BQPA 2YV2A 3L6EA 1KTVA 1J70A 3T7AA 2LZ0A 2ASRA 5BOSB 4I19A 5LQUA 3HKEB 4G65A 4HVCA 1QJ4A 2AFRA 1F12A 4TMZA 4IJVA 1A7KA 1M1YA 4B8WA 4GUAA 1C9MA 1DC7A 4MW4A 4HK4A 1VJ0A 3IPCA 2AJLI 2PTGA 1M74A 5AI8A 3WB1A 2C5LA 3DW3X 2QF7A 4AF7A 2E0IA 3N24A 4QKQA 2YXEA 4IOKA 3OT5A 5F4BA 5B55A 1TKBA 3CH4B 1R6TA 5IC4A 2XDQA 1K66A 1BDJA 1FJ2A 4KOAA 4OOEA 3AI7A 2PZLA 2ZULA 3C7KA 3H1BA 3H2IA 1TCAA 1Z8FA 3D1LA 3VYUB 4PW0A 4Q1VA 4FDLA 1YQQA 3FSGD 2V97A 1CEXA 1ND5A 5ICMA 4IRXA 1XL0A 3GLGE 4DLYA 2DPGA 4IH1A 2J0VA 4DZZA 3NV9A 3RIYA 3FF4A 4RSMA 4P7GA 4RFLA 2PHZA 7GPBA 2AR0A 3LOQA 5C0OE 5TR9A 3ROGA 3GBPA 2R1VB 1M34A 1G5PA 3UMSA 4YDRA 4YJ2A 4AW9A 3D6VA 4FC6A 5JSHA 4BKMA 5MDHA 1AHIA 4KSYA 5ILOA 1K7SN 1U1FA 3FFBA 4RHYA 2CXHA 4ZMRA 3HNOA 3NJRA 2VDOB 3L6DA 3B71A 3JQEA 4RDXA 1SHKA 4KH0A 3QTBA 4K28A 2ZSKA 3DWWA 3W3AH 5B3JC 4W5QA 3MBKA 2PUGA 1PU2A 4CDVA 4MYCA 5EHHA 5FQNA 3KTAB 2BZSA 3LUKA 4W1SA 1M2KA 5EWLA 5ALZA 3F1LA 5IFKA 3FXHA 4UHFA 4YCDA 4U5CE 1NXOA 3QENA 5JY1A 4KWCA 2BL2A 2DHRA 2ZWPA 4Y2VA 1LSUA 3VYRB 4KUEA 1X74A 3U44B 2X0EA 4WZBE 4M0CA 3WP0A 4ND6A 3K0AB 4Q7LA 4IUYA 4UBMA 3PRJA 2BFEB 5EGSA 1PR0A 1QPBA 5T8KC 4R40A 4FDUA 1PWXA 2GK3A 5I6DA 4L85A 3LCMA 5E33A 5EMHA 4ZHSA 2EZ9A 3O75A 4E5PA 2OZLA 3ZNNA 3RTEA 2OFWA 1MEEA 3VRCA 1NATA 4WKGA 2V8BA 1BD4A 3KQMA 4XCQA 4YT2A 3FFXA 1A88A 3A6EA 5LMNB 1YT5A 4HTFA 3ZUGA 3C8HA 1P3DA 5JVDB 1E5DA 1TW3A 4C05A 3UJ8A 4ZJUA 4BNIA 3HGTA 2X8WA 4HX5A 3ESAA 4J0QA 5AW4A 1BXGA 3HR4A 2PYIA 4FYMA 4TLDA 3WB0A 3UGOA 4B6PA 2VLBA 2PRKA 4AMBA 3RRNA 3NEJA 2QJFA 2FXIA 3F7NA 5DTIA 5DBIA 4W63A 1VJRA 3P52A 2V6JA 1E1KA 3LLMA 3VPSA 3K9LA 1I9GA 3B7WA 3BRQA 1FNMA 1QKIA 3A2LA 4DG5A 2HDWA 4CMAA 2DI3A 2OBYA 4PBTA 1ZNZA 4DR2B 2XMDA 3TIGA 2WFLB 5ALFA 4GXNA 3LQ1A 5F5LA 2PL5A 4N47A 3I2GA 3RW0A 3WZLA 1EP3B 5GPGB 4MRMB 5EPUA 1JLHA 1EFCA 1O3UA 1EDDA 5U1PA 3CLSD 1X7YA 5K20A 1QFMA 4KR0A 2Q6TA 4YRNA 1BWPA 1H69A 1VLQA 2Y71A 2GYUA 4QL3A 2OYRA 5A3QA 4LMBA 4F91B 4EJSC 2WAAA 3HN7A 4GC5A 2PK3A 4NFYA 4A0RA 1KFBB 3AQBA 1J06A 1JECA 1EJ0A 2VJCA 3BMNA 2HF2A 1CY0A 5A6SB 3NEPX 2NV6A 3ZK9A 3QRWA 1MFPA 5B7GA 4IQFA 2H5IA 3QQ5A 5L0GA 5DHSA 4HUTA 2DT8A 3V32A 4RGBA 5I9MA 3VPAA 1BGXT 3Q5EA 3LYUA 4FOLA 1Z0JA 4D99A 4C0LA 2OFXA 3NBFA 4RSGA 5K8IA 3O4IA 1YNOA 2PGIA 4DC9A 4PC3A 2ZIZA 2E4YA 5EJ8A 3OQ6A 3RRMA 4C89A 1T5BA 2P1DA 5KKNB 1UPBA 4JUIA 3FHCB 1LC3A 3T6GB 1WMFA 2XTMA 2JHAA 2DUUA 2GERA 3L02A 4PLCA 1UPXA 3GJQA 3F3KA 5L45A 4F60A 4GEKA 1G7SA 1XJWA 5BQIA 3P0JA 4FKBA 2IYEA 3EC7A 1XXHA 1PUJA 1TJ4A 3ZC4A 2QN7A 3NRBA 2J3QA 1S0UA 2HJSA 5SYNA 3FYDA 3MAGA 1IBKB 1T15A 4KAFA 3G0BA 3VO1A 4AJPA 2XMBA 1USIA 4WSOA 1UEIA 4ARZA 1ZCJA 3ZV5A 4RVGA 3FPSA 1SUFA 3C1UA 1ZOSA 5I7SA 3L4SO 1M2HA 3VOSA 3KJFA 4F1WA 2Z5VA 1TO2E 4LHEA 2B3TA 1VM6A 1QHSA 2FW0A 4L7VA 2AI3A 1HEUA 3BFPA 3TS1A 2NVOA 2QGNA 3X1XA 3VU9A 3QPAA 3ZWKA 1S2NA 3QW2A 1N3LA 3F6RA 4A92A 5H7XA 2JD0A 3UC9A 3FN4A 4J2TA 2OP1A 5L51A 1AE1A 4DDVA 5HA5A 4LYHA 2QW8A 3GDHA 1Z7Qc 4GMGA 2NO5A 3TWOA 3QVSA 4A0FA 6REQA 5F7OA 3KFXA 4A8TA 5KNDD 4CCSA 3DMFA 2HA0A 1NVDA 1W85B 2FSHA 2XZOA 1Z6AA 1IY0A 4HS9A 3IQZA 1Y8AA 2HCBA 4EJ2A 1YMVA 4WOBA 5CVCA 3OD5A 1HDYA 4AVYA 5FOSA 4K40A 3G7UA 1FTYA 1XD2A 2HMAA 4DNOA 2XRMA 3MFQA 3NT4A 1L5RA 4ZCMA 3RUDA 1QGYA 1U0TA 3VDRA 4ZANA 4QXOA 3R0XA 3LP5A 3TEMA 4DRXB 1IUOA 1RKEB 5CT9A 1AQLA 4C4YA 2BFDA 2HYIC 1YJBA 4IV5A 1OGJA 1BAPA 1UM8A 3DEFA 3SJUA 5BQFA 4ZGWA 4JKVA 2FMUA 4PONA 4IRUB 2O5VA 1PT8A 3MOSA 1VFPA 2COEA 2P78A 2A0UA 1Z12A 3MXTA 4MR7A 5HW0A 2H7BA 1O89A 2V1XA 4KQGA 2B7BA 3T9DA 3GFVA 5HYVA 4HGNA 1K3TA 1EWKA 3MYIA 3HU5A 3QEJA 3EG5A 1O87A 3M5PA 3VGJA 3JQGA 1VI6A 1OOEA 1PWEA 2YXDA 4V39A 3GRFA 2VNIA 3KUCA 4F4DA 5C8VA 5C8YA 1KZ4A 3OJOA 1TCBA 3VHLB 3AR9A 5T3UA 2HKIA 1L5MA 5HWSA 1JFSA 3CC8A 1V7ZA 3G4XA 2IOQA 1WCWA 1ZLXA 1XLWA 1YRHA 3TYXA 5AVTA 1K7FB 2XXAB 1CVLA 2PZ8A 3LWZA 3S2UA 1NJSA 2QN9A 1EEHA 3R7CA 4ND5A 3VPCA 4DWVA 3BL6A 4M1OA 3CSDA 2I4RA 2LXNA 4B8ZA 2RGWA 2HSZA 3W6NA 3JQ8B 1WPRA 3BMQA 2NU9A 2VHVA 1JEJA 4X0EA 4XX1A 1BXRA 1WZ2A 1NNSA 1MHTA 2I4MA 4AE4A 2B82A 2XH8A 3U3OA 5B3IA 5KTYA 1W5AA 3UWPA 2ZROA 3ZXUB 1WTAA 3UMVA 5FPPA 3QE3A 5HK9A 3ROMA 1ID1A 3I1JA 4R51A 5MHTA 1BQEA 1OR2A 2C5HA 4KIFA 2YINC 3S99A 3PFCA 1RT9A 2ZWAA 1ZHXA 5REQB 1E2PA 3QW0A 3GO4A 4WNAB 3EBPA 3CUVA 1L7BA 1EQ2A 5I45A 2I80A 1YS6A 5FUXA 4WL0A 1FXWA 4ZAZA 4D9FA 3OKCA 2O5EA 2I29A 3OEWA 2P35A 3NG1A 5SY9A 1JEOA 1NLUA 1G6OA 2CD7A 2X6QA 1YJ8A 3LT5A 256BA 4B6FA 3R8XA 4CM9A 2JFGA 3QUAA 4Q4JB 4UMDA 3M6XA 4EUSA 4E5MA 2J9WA 2A5YB 1F7VA 4W8HA 3EVZA 2RHGB 4BX0A 3DWFA 7ADHA 2CLSA 4YLEA 2ZT7A 4FFWA 2Q9AA 2Z6UA 3JCUQ 2GSDA 2PN1A 1RMTA 2B0HA 8OHMA 4I1YA 3FWHA 3FGZA 3L82B 1NMXA 3LP8A 1TL7C 4Z4IA 5K01A 1U2GA 4B3BA 3DF9A 3TSWA 5JRAA 3FDIA 1JXQA 1JE0A 1L7PA 2XVAA 3T5DA 1Q7CA 1JFFA 4YPOA 1CJTC 4F4BA 1G8GA 3DS8A 2EU8A 2Q1WA 3LOPA 4NDZA 2BMWA 3RHFA 2VXYA 3O7WA 5JCPA 4IQ0A 4RPCA 4TMYA 2HA4A 2OOKA 4NXMB 4OY3A 1ESEA 2W22A 4K9NA 3C3KA 4PGMA 3D3NA 5K3EA 1K06A 1EX1A 2AC2A 1XYGA 4MO2A 1L7CA 1OZAA 5H82A 4WUTA 1ZVKA 3FI9A 4R9SA 5F78A 2EW2A 4PHFA 3N6RA 1PLLA 1GCOA 5JH7B 2Z83A 5CM2Z 3GMDA 4PAMA 3TZLA 1LSOA 3VVLA 3VI3B 1ZS9A 5GGXA 3QW1A 4Q37A 1U6KA 3WODF 4BVAA 1GSIA 4L1KA 3ZD7A 2OWDA 4C2UA 4P4SA 1XF1A 2C57A 1L1RA 3O8QB 2BFFA 1GXSA 3ZE8A 4IY1A 3JPYA 4BQRA 1PFVA 2ONCA 1GPMA 3VR6A 1Y3FE 2XUAA 2VATA 6ABPA 1LFDB 3BD8A 5HG0A 4TSRA 3HL0A 5I9SA 1SG0A 1QHFA 4LRYA 4M38A 3RAPR 4D97A 4XEUA 2W0MA 3GH1A 2I2WA 3PZBA 4PG4A 4U5DE 2XX3A 1ADYA 1YAHA 1DQYA 1XE3A 3OETA 3T06B 3G5TA 3DC2A 1IPEA 2NTNA 3NTLA 4HHEA 3OPYB 2IYYA 4ZQHA 2NT4A 4OFBA 1ZJ4A 1NUAA 2WWHA 3EIEA 5LP6B 1U7TA 2GM3A 4U7FA 1JKJB 1OX5A 1W44A 3T34A 3BRWA 3KYJB 1R8SA 4MLZA 2ZJBA 2Y0PA 3MWEB 4F2HA 3ILYA 5IJ0A 3V4LA 3K6KA 1X0XA 1YLMA 3OZSA 3I39X 5H83A 3ANNA 2QAIA 2F64A 2DQ4A 2GXAA 2YZ2A 2B4KA 3JPWA 4IFTA 4CLOB 1F0PA 3JATB 2XQFA 1YL6A 4WA7A 3D81A 4AFNA 4F2GA 1CY1A 4BASA 1V7PC 1Z6XA 3GA7A 1H4SA 4HEQA 1RI2A 3FDFA 5DI9A 2GPYA 2V0GA 3V2IA 1XRQA 1DDOA 4EB6A 3VHRA 2OHVA 1Y9JA 1SKYE 1ZA1A 1CULC 2II6A 3R5TA 2OBFA 4ZEXA 2B1QA 5J63A 4DILA 1GRRA 3Q4GA 1ZOPA 4MROA 2JVJA 2HA7A 3FPEA 2Q4BA 3TR0A 3I92A 1T3LA 5CURA 4E30A 4OYLA 4EGFA 3AIOA 3EQ8A 2WG0A 4MI6A 3VRHA 4P81A 3GDOA 4GAEA 5AOAA 5JVEA 3EF0A 1HLPA 4OHCA 1UBTS 5CM8B 1EVQA 2P1ZA 4BV3A 1RE1A 4OB6A 2DF8A 4G01B 2OLJA 4J30B 5EIEA 4S0XA 2JL1A 4D9EA 2VAMA 4D9JA 3WHLA 4Y8VA 2AH5A 5IY5C 3CBQA 4W5NA 1GGFA 5IKXA 1OLOA 2NUBA 4WQMA 4PINA 1DJMA 4TYMA 3BDAA 4PRKA 1GPDG 3IT1A 1PZEA 1R6BX 4EZBA 1Y4UA 3PQCA 4B75A 1DRUA 1NBAA 4URWR 2XVMA 1MIOA 4KFSA 5CGZA 4IZIA 2QVCA 1GSOA 3IQGX 5FR2A 4ZOAA 1UMBB 2YWDA 1FP6A 2EBUA 2OO3A 3WYDA 1BVYF 4J2HA 4DW8A 4EI9A 3USCS 1OI4A 2WTAA 4KGVA 2KB0A 1RPNA 1E2LA 3DFIA 3EDOA 1SWWA 2FLKA 2O3UA 3GQBA 2KYRA 4H6WA 1W94A 1NBME 4PYMA 4LOIA 4MRAA 1JHAA 4RA6B 2GPJA 2DERA 3MB8A 4PIPA 4PAOA 3IQEA 3SS9X 2DFVA 1IY8A 1DEOA 2VHQA 3H1AA 3K9WA 1PWZA 2N0SA 2ZSIA 3SC3A 3E9MA 3M2PA 1X70A 2X6RA 2M64A 1JQDA 5HCNA 3RW9A 3TEJA 2CXRA 3LLVA 5JLIA 5EWMB 4BKUA 1REQB 3PFWO 2QX9A 1XZ8A 2EYQA 3PKJA 1YQDA 2F8MA 1Y7LA 4H77A 3I0MA 3B1YA 2Z9DA 1YVIA 1Y1PA 1YS1X 1KA9H 1PSWA 3QU5A 4Z9HA 4Y6GB 1V3VA 2DLDA 2ERXA 2QTTA 1N0UA 3CQ9A 2BFPA 1UZNA 2D4UA 5DBEX 4IICA 2J67A 5B30A 1M10A 3WGMA 5HMLA 3LRTA 4RIHA 3N1UA 3O8OB 1RYYA 4BUCA 4YJFA 8ADHA 4FHDA 1AGXA 1MAHA 3K33A 1ODSA 1A3CA 2Q1XA 3KMIA 4MV5A 3SMVA 1S96A 1G20E 5ERGB 4YRPA 4L4XA 1ZU5A 1ILWA 1HTTA 4JNKA 4B9EA 1N25A 3ZNPA 4UHEA 5AKYA 3HR8A 1QO0D 4JQOA 4R2MA 1U0OC 2QVYX 1AHNA 2ZR8A 3KE9A 4UQOA 5AW1A 2RH9B 2ZCUA 3HFRA 1ISSA 2IEAA 4KPYA 3DLTA 4B76A 4WDRA 5BSFA 4IMIB 1DT5A 4Q1AA 3DFMA 2P90A 1TUIA 3SSMA 3JQAA 3MJTA 3JWJA 1HZZA 1D6MA 2F6RA 4UZFA 2WYWA 1JALA 4ZI3A 5FPKA 1RAFA 1CUGA 1RABA 3NKVA