4AK9A

Structure of chloroplast ftsy from physcomitrella patens
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
308
structure length
302
Chain Sequence
SQDPDIQLLFSGFSKTRENLAVVDELLTYWNLDESESILDELEEVLLVSDFGPKTALKIVDTIRKDILAGRLKSGPQIKEALKKNIFKLLTERVTTTELQLGNSRPAVLMIVGVNGGGKTTTLGKLANRFKKEGVKVLMAAGDTAAAGEQLEVWAQRTGSEIVMAPRPAAVLSQAVRRAVEEDFDVVLCDTSGRLHTNYNLMEELRGCKRAVSKALSSAPNEVLLVLDGTTGLNMLAQAREFNQVIGVTGFILTKLDGTARGGCVVSVVDELSIPVKFVGVGEGIDDLQPFDAQSFVDALFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CPFTSY
publication title Evolution from the Prokaryotic to the Higher Plant Chloroplast Signal Recognition Particle: The Signal Recognition Particle RNA is Conserved in Plastids of a Wide Range of Photosynthetic Organisms.
pubmed doi rcsb
source organism Physcomitrella patens
molecule tags Protein transport
total genus 119
structure length 302
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ak9A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ak9A02
1CRQA 2QM7A 1HT1E 2Z4SA 3THOA 4IDHA 5AJYA 3NBFA 4GMXA 1OB2A 1ZM7A 3LAWA 1P5ZB 1XTIA 1Z6GA 2REXB 3ZIAA 5DYIA 4DCNA 1NVXQ 3AVVA 5LBIA 1P72A 4LWZA 3TR5A 4GT1A 4Z51A 2AWNA 2J87A 2LKCA 4A8JB 3VKHA 3W8NA 4JJZA 1WQ1R 4TQUS 1EGAA 1TQ2A 4LYHA 3J81k 3IIJA 4OBEA 5E7MA 4Y0AA 1GKYA 1Q1QA 4LJ8A 3MRSA 3GLFE 2J45A 4L8GA 4B71A 4KV9A 1OIXA 4DT1A 1JECA 1ZUIA 3T5DA 2QTFA 4LJ9A 2F3RA 2W2XA 3K0AA 1AA9A 1GNRA 4DSUA 4TMTA 2EYUA 3FYHA 1GKUB 2NIPA 3NBXX 5AWFC 5GJBA 1E2NA 3CNLA 1NSFA 4NPHA 3IEVA 4PO8A 2GVZC 3NHBA 1TX4B 3U44B 2ATXA 2A5DA 1N5KA 1Q1BA 4ZIRB 1KI7A 1KI1A 4OJKA 3TGPA 1W4AA 2QBYB 3IBYA 4XOIA 2ZJOA 2GXUA 1YHNA 2BKEA 2JJ1A 1P2VA 4BE7B 1CEEA 2CE2X 2OHFA 1R0YA 1UKZA 2FF7A 2FV8A 2NQ2C 4G0NA 3VU9A 1ZD9A 1JJVA 2DR3A 1Q22A 1ODFA 1TF7A 3CPHA 5HCNA 5FI0B 2VIIA 2AL7A 4V0LA 4B47A 4LCBA 1EWRA 2OAQ1 5DI3B 4TYNA 3GP8A 1XMVA 3EWSA 5HCIA 2E9SA 4DEXA 4A8JC 3DDCA 3IILA 3P4YA 3AKDA 3EZ2A 4I99A 1R0ZA 3Q5EA 3SJCA 4MUAA 2CLSA 2GNOA 4F7WA 1DADA 3KXKA 1KO7A 2H5EA 5L3QB 3CM0A 2G9NA 4MYTA 3RS7A 1B23P 1GOTA 2ZVQX 3W6OA 4X8MA 4US1R 2O8CB 4UNPA 1RFLA 4BZPA 3U7HB 2A2ZA 2RGGA 3Q7QA 1KKLA 3IBGA 5JZVA 1GL7A 2CXXA 1PLJA 1Y3AA 3HYRA 3Q8XB 2NMVA 2FFBA 1OHHD 4R2IA 1DAGA 5H1YA 3EIHA 1MRNA 3TR0A 5JI2E 3U6KA 3ADCA 2W58A 1OH7A 2WWYA 3U3RA 3LD9A 1JNYA 1E32A 4H9GA 2RAPA 2QTVB 4JLAA 4M1WA 5EP3A 3UANA 5K8UA 2ODNA 3CWQA 5EE3A 1G3MA 2FGKA 4M2LA 3I5XA 2PZGA 3IPYA 4I1SA 1M8PA 2XEXA 3OF5A 3SS8A 3EZFA 3U44A 2G1JA 2GZAA 3KXLA 5KDOA 1MV5A 1SVMA 1U0LA 2HYDA 4B33A 4C0AC 3THYA 3SI7A 3U5ZB 1HV8A 1ZW6A 2ZUBA 4WVFA 3RRYA 2ZR0A 1S9DA 4ARZB 4DXAA 2AKAB 2QBYA 1SQ5A 3RS4A 5FTLA 2DHRA 3ADBA 1KK1A 1G8YA 3TMKA 2ODWA 2RGBA 4P4TA 2GEUA 1ZVQA 3I62A 1HE1C 3CW2A 4Q1CA 4GZMA 4I4LA 2JCSA 4ZPXA 5KDDA 4OK6A 1G8GA 1SKQA 3ZZTA 8OHMA 2BMJA 1J8MF 1FOEB 4LBWA 2DCUA 4Q9JA 3VTKA 5JJIA 1US8A 1OE0A 3IO5A 1PLLA 3U7FB 4E5UA 2QP4A 2F1HA 4IFBA 1NLFA 1IN5A 4HZIA 3W90A 4XVQA 3NDPA 3VX3A 2X1VA 1ZBDA 3SDZA 3Q72A 4JVMA 4M53A 1E2EA 4HLUC 4MUBA 3W6NA 1XTKA 3VR4A 3P26A 1QRAA 4PXAA 1NIJA 2ZRHA 1M1YE 4PO9A 2PCJA 4TZ6A 4A4DA 2A3RA 2ZRJA 1ZYUA 4M0LA 5BN5A 3HU1A 1JXOA 5DI9A 4GOKA 4D80A 1NI3A 1Z47A 3D8BA 3O8BA 4W7SA 3KX2A 3P27A 3ZH9B 3D3QA 1NJFA 4RKFA 4F93B 2F9LA 5JWHA 4CT5A 1F2TB 2HXSA 2CBZA 5FUVA 4MYUA 2JJ8A 2NO9A 4Q1DA 2I3BA 2IT1A 3EPKA 3FMPB 4O25A 2QEQA 3T12A 1W2GA 3HWSA 5JHHB 2X8AA 2ODBA 2HCBA 3GJ4A 3UK6A 4ZI2A 4BLRA 3QBVA 4CW7A 2JLZA 3QPVA 4A92A 2ODEA 3CLVA 1HQYE 3B2EA 3OIUA 4JLMA 3QEOA 4CVNA 3F3YA 4M1KA 3MG9A 5LPNA 3WNBA 3BB3A 4DBLC 1VDZA 2C03A 2Q9BA 4UKDA 3U4QB 1BKDR 1UPTA 3GLIA 2W00A 4M1YA 5HTKA 2WBLC 3DMDA 3AF4A 2CDNA 2F1JA 3PITA 1VTKA 1XCGB 2O0KA 3E1SA 3SN6A 2YWHA 1W47A 5FTNA 4DKXA 1XMJA 1N6KA 3CUEF 5H70A 1ZNYA 4II7A 3GLGE 5EXPA 4D0NA 3BAFA 1Q1EA 3ZVRA 2ZVPX 1KNXA 1K8RA 4XD7A 1SVSA 3PEWA 1Z06A 1Q21A 3BGWA 5HE9A 2D7CA 3ZVLA 221PA 4CEIA 2XTMA 1DEKA 4OQNA 2EFEB 4YLGA 4LYJA 1E1QA 1OXTA 1JPNA 2FSFA 4HDOB 1U0JA 1F5NA 3WYAA 2HF8A 4JLJA 3FHOA 2QMUA 2QA5A 4LPSA 3EA0A 1FPMA 2WWWA 3TNFA 5HKKD 4LV6A 3WYFA 5J40A 2BHRA 3AKEA 4IOLA 2N1BA 3W9YA 2VEDA 2PT5A 4OJQA 1G21E 2YZ2A 3T35A 3TK1A 4HZUA 2YNMA 1GL9B 4Q7JB 5KSOA 2MSEB 2V6IA 2R9VA 2C9CA 5DHAA 2HYIC 3ND9A 3GLHE 5D3MB 2HT1A 3B9QA 3DM5A 1GG2A 4PQFA 4QJ4A 5JCZA 4Y0VA 3UPUA 3B60A 3AH8A 4KBFA 2YC2C 4RFSA 3ONWA 3HJNA 5CB8A 1AKEA 2UZ3A 5FTJA 4PZLA 4AKIA 1TF2A 2REBA 3OHMA 4QBHA 5TB5A 4KLNA 1XP8A 3M1IA 5G41A 1E2DA 1S2MA 5KPJA 3CRQA 2P2LA 4HUQB 4LYAA 5FPHA 1L4UA 3QKUA 1IN7A 3PUVA 2Q3HA 1AS3A 3CPJB 2DWPA 2KE5A 1II9A 4KVGA 2H1LA 2OSBA 3DZ8A 1HURA 3C41J 4RZXA 5SZJA 2ZJ8A 3W5JA 2QN6A 4UQOA 1NBMA 4HLCA 3VR1A 2IHYA 4ZCIA 1FQJA 1IXRC 2PZEA 4GP7A 4LI0A 3TSZA 2JIZD 3HDTA 3I4LA 4TMVA 1X8JA 1E79D 2AD1A 1ZCAA 3LQQA 1W1WA 4XWAA 3KJGA 4GOXA 1FZQA 3KKQA 3RC8A 4KFTA 3AVXA 4JKIA 2IYRA 2NOAA 4GNKA 4F4JA 5KU1A 4Q66C 4Q00A 4G5RA 4P4SB 3K53A 2GJ9A 1Z08A 3A1UA 4NYJR 3IEUA 3WBJA 1UKVY 5AJVB 1IM2A 3HU2A 3IDQA 3O8CA 1N0WA 1E2LA 3MWYW 4FXPA 3SJAA 5FBWB 1EG7A 1HH4A 3O8DA 1ZMXA 1WF3A 3AEZA 4D4MA 5CDFA 1AGPA 3CONA 4C0SA 4RD0A 1XZQA 3QPUA 1KDTA 4WZBE 2DB3A 1JB1A 4Q4JA 2QSZA 3I32A 1XD2A 1Q3TA 2QP9X 5K8TA 2BEJA 2Q0HA 4QOSA 1NIPA 5JBQA 3SU8A 2B92A 4PPGA 1COWA 1JR3A 4BLTA 2WKRA 4MYCA 2KBFA 5IK2D 4KFSA 2WWHA 2AKYA 4DEYA 5C18A 1CTQA 4IDOA 5SZKB 1Z6XA 1T8UA 4MA4A 2B6HA 2J7PD 3LX8A 3EPHA 2GVDC 5EE1A 1R5OA 3G5UA 3RS3A 5SZHB 2ZRDA 1AQYA 4WBSA 5FPSA 3B8HA 1KZ7B 4HUQA 2A5FA 2Z5FA 5FUWA 1OF1A 5GJVC 4QGFA 1TADA 2DYKA 2G3YA 2ZI3A 1BMFA 1DTSA 1YR8A 1PV4A 2J0UA 2GXSA 4IVRA 1OW3B 1Z22A 5FL3A 1KSGA 4Q4AB 5B30A 1OFTA 4MKFA 2ZSFA 1UJ2A 1PUJA 4DVGA 2IF0A 1E2HA 2C04A 2BJVA 1WXQA 3B1ZA 5F2EA 1KKMA 621PA 4TL8A 2EWVA 2JLWA 3PENA 4TYQA 5CIQA 5B57C 1KNQA 3UKDA 2G6BA 5DNYB 1DO0A 2ZE5A 4BFSA 3LFUA 4RY2A 4DSOA 3QKSA 1C1YA 4KLZA 2QRZA 3K0SA 2GCPA 2WJJA 1KJWA 3U61B 1N0UA 3ZZUA 1NNEA 4G5QA 3CF6R 1E9EA 1W2HA 2QNRA 4YMWA 1ZC4A 3CX6A 2CHGA 1F6BA 1J8YF 2AN9A 4BLOA 3K0FA 2ZREA 1EFCA 1F3OA 4B34A 1E9RA 4A0FA 5BWMA 1W4CA 1OXSC 2AK3A 2RMKA 4BLSA 4DRZA 1W36D 4AG5A 2PEYA 1G9XA 4WXRA 2NZ8A 1X86B 721PA 1Z63A 2XJ4A 1G3UA 3UXMA 4EDHA 1MT0A 2IYYA 3KL4A 1SULA 3LDAA 1Z3IX 2ZRAA 1XEXB 1II8B 1UBFA 2X2FA 1ZM3A 1YZNA 3CH4B 3LXXA 3QPWA 1U9IA 3QBTA 3OFND 3KQKA 3K9NA 2ZE7A 1K6MA 1YVDA 4X8LA 4Z8YA 3CX7A 1OH8A 2CCJA 1N6IA 5UKDA 3WMEA 1EFUA 1SVLA 2ZTSA 2HJVA 3NXSA 4JJKA 2OCBA 3QUSA 4Q4AA 1W0JD 4OHZA 2JLVA 2GJAA 1E69A 2OCPA 2ZI6A 4JKYA 4D4JA 1KMHB 1TPZA 1M7GA 1FQKA 2BV3A 2CVHA 3TBKA 4ZO4A 2GEDA 1W36B 3KKMA 3EWAA 3S1AB 2IYUA 3WMFA 4FI3C 1YR7A 3QKTA 1G291 2PH1A 3GFPA 3H84A 1OKKA 3AP2A 1CJUC 4W5HA 3FMIA 2AFIE 3P20A 1XD9A 3CO5A 4NKRA 5A4JA 2FSIA 4LJ6A 4EQ6A 1G20E 2ZXUA 1LY1A 4LOAA 1UDXA 3TQFA 2ZIAA 2VSOA 2AD5A 2C78A 1IY1A 3TAHA 5D3QA 1OLOA 2BOVA 1ZNZA 4LHXA 1HYQA 1DG3A 3I8XA 5DLQC 2TMKA 3U2QA 4PAQA 2VF7A 4PC2A 2A5JA 3ZVNA 2FPMA 4TSFA 2J0VA 3W34A 3SJBA 2PJZA 5FBQB 1WCV1 1LTQA 1NY6A 4HYYA 4A0HA 4L5BA 1XXHB 1OH6A 4RCYA 2GBLC 4K81B 1XTSA 3BD9A 1VECA 3I5YA 4DDUA 4PPNA 2VHQA 1Q1ZA 1U8ZA 1ZAKA 1RRFA 3ZS9A 1EX6A 1QHHA 1E2JA 2A78A 2WV9A 4M1SA 1SKYE 2EFHB 4QJ5A 4OHVA 5IHPA 4UXIA 4B3FX 4JZKA 2V3CC 2ZRGA 4ZDIA 4BGDA 2YYZA 2GBLA 1UEJA 1AS0A 1D6JA 2V7QA 4ZCMA 1MABB 2EFCB 2BDTA 1IJFA 2EFDB 2UKDA 2OLJA 4KODA 3OEHA 1BOFA 2PMKA 2QZ4A 1W36C 2IEYA 1Z6TA 1E6CA 2P65A 1OYYA 2DPXA 2D06A 1XCMA 4LK2A 3QF4B 2IXGA 5EP4A 3AVYA 2A30A 1E2PA 4A1FA 4ZV4A 3A4NA 1QG4A 1W48A 2OBMA 2NO6A 3PEUA 5JEEA 4YMUA 1S8FA 1P9WA 4JLVA 1YR9A 3LLUA 3EZ7A 5JI3E 4PQRA 3IO3A 4HATA 3IHWA 4QGGA 4BFZA 1GZSA 4MRNA 4BFUA 3AVQA 5J4KA 1XDBA 3QE0A 3VNVA 1U90A 1XMSA 2WPDA 4JSTA 4ERNA 1KO8A 3I73A 1UKEA 3KUCA 4UXHA 2ZS8A 4BLQA 3VHXA 1TL7C 5GJCA 2JASA 3A4LA 2ZYWX 2JJ1D 4KVAA 1K5DA 2VH5R 2W6JA 5G3YA 1VHTA 4XJXA 2DFKB 1XMIA 2W83A 4B32A 2O8DA 1IXZA 5G3ZA 3U6BA 3AP3A 1T0JB 1ZM4A 2IBMA 4OHXA 1E2KA 4P33A 1Z83A 4DT1B 1TU3A 1G3QA 1KDRA 3NBYC 2VSXA 3FKSA 3AP1A 3AQ4A 3CX8A 4RKEA 3K8YA 1HUQA 3K0AB 4LHVA 1E1RA 3LRPA 4FMCB 5FL7A 3THXB 1T91A 4HAXA 4UNQA 5CLLA 1EFTA 4C0HA 3ZZ0A 4XSGA 2A9KA 4LGMA 2GK7A 1LW7A 3QI2A 2FH5B 2OILA 3I1FA 3EASA 1GRNA 1IN6A 3BBPA 3MJHA 3KFXA 2G88A 2C9YA 2CEAA 2CNWA 1Z8FA 3BWDD 2CLCX 3K9GA 3L0SA 1J99A 4RD1A 3WHKA 3WBKA 3WY9A 3BIFA 3FB4A 1HT2E 1ZJ6A 1OIVA 1H8HA 1S96A 3OEEA 2WVJA 4TYWA 2GEVA 4V02A 3VU9B 4PANA 3WP1B 1PUIA 4A9AA 2HT6A 3EC1A 4RCZA 4BRUA 4DLWA 2CK3A 1W46A 5JRZA 3A1WA 3U3JA 4F4CA 4NTZA 3KQUA 3ASYA 1ETUA 2NTYC 3SBDA 1DARA 2QENA 3AUXA 3Q3JB 4B75A 4O3MA 4MRVA 3FGNA 1KMQA 1NLZA 4JIMA 5EXSA 1G3RA 1RC8A 5CM8B 2RKOA 1G7CA 3LBNA 2XSZA 3AVOA 1OFIA 4OL0A 1RPZA 1DAEA 1U0HC 2GJKA 1ZU5A 3LBIA 5C4GB 3HU3A 1XPOA 3LBHA 1XJ0A 2GETA 1TTTA 1ZU4A 2FZ4A 3REGA 3CRRA 4HB3A 1KSJA 2WHXA 4B3CA 5JMTA 5E7JA 2O0JA 1E9BA 2F1RA 4G3XA 2HF9A 3QSYA 3K09A 2V1XA 3FFAA 4NCIA 5FPTA 2I1QA 1GIAA 4GL2A 4WAUA 1T3LA 3C7KA 3HR8A 4MRPA 5B2ZA 4QGHA 1B0UA 2DBYA 1Z6AA 1KI9A 4QC2A 2VA8A 2REOA 2XJ9A 4TQAA 2Q9CA 4NCKA 3RAPR 1FUUA 1RRPA 5KNDA 4Q48A 1UF9A 3THXA 2WMNB 4S2EA 4A82A 1BYIA 1F60A 1CJVC 4B44A 2IUSA 4C30A 3THYB 3U7EB 4L15A 2OV2A 2DWOA 4TMXA 4HDCA 4BECA 4HLDA 5JS7A 4LZZA 1MOZA 2YV5A 4RD3A 3GCGA 3MJRA 2KJQA 1AS2A 5JJKA 3BORA 2BEKA 3CRW1 3QXXA 3EIEA 1DBSA 4NYMR 5A0FA 3VQTA 5KHOC 5FOXA 1GITA 3LW8A 2V4ZA 4QL3A 2AR7A 4V0ME 5L3VA 1JAIA 1TEVA 4IKEA 4HDQB 4U02A 3RSLA 2A7QA 4K8OA 3PUXA 4Q1FA 1VMAA 2QSYA 4Q1AA 2B8TA 5EE9A 2WOOA 4NU0A 3V4RA 1EFRA 4IDQA 3W3ZB 1KK0A 1KDPA 5CJ2A 1E4VA 4B6FA 1UBGA 3GLIE 3CIOA 2WJHA 1G41A 4V0OA 4Q4HA 2FSGA 4IDPA 1M6NA 4LHZA 5FBLB 2OBNA 2YVUA 5FR2A 2ZETA 1KK2A 1NVVR 2VLIA 1US8B 3DHWC 2OO7A 1XB2A 2V8OA 2WJYA 3DOEA 4QG7A 3T06B 3U3MA 4DCSA 4IW3B 4HAVA 2DFTA 3LQRA 4DUGA 4IEIA 4KITB 4AIIA 1Q3HA 1GRRA 1G16A 4G5OA 4E07A 1CJKC 2W6IA 3IHLA 2D7DA 2PBRA 2FEMA 5FOWA 2BBOA 4EFMA 1E2IA 2Z0MA 1E9AA 4DLYA 4I1OA 1OJLA 3X1XA 3SR0A 1VHLA 2ZUCA 4R7ZA 1KI6A 4OYHA 2JEOA 2ZPTX 3C15C 5LDDC 2OFXA 2H57A 2ZJBA 5H8WA 1P4SA 4U7DA 3NKVA 2ZI7A 3GJ0A 4F4IA 3VR6A 1A1VA 2Z6VA 3VFDA 5FFMA 1RYFA 1MR3F 3NHAA 3VMFA 4IJMA 1II0A 4XIGS 2RH5A 5LB2A 4PAMA 2ZANA 4N0EA 3L43A 3B9PA 5DN6D 1NG9A 4A36A 2XOKD 1SVOA 3ZD6A 1G4AE 2G0NA 5KOYA 1C4OA 1E1QD 2ZE8A 4ZKDA 1M7HA 1OB5A 1N6PA 2C95A 1KI4A 4O2LA 4TLBA 2IUUA 1VIAA 3FDIA 1PVOA 4NONA 2E1RA 1ANKA 3OE7A 3L0PA 1JALA 1DE0A 4JT2A 4DIEA 4FCWA 4US2R 4KFUA 2AX4A 3A4MA 2B7CA 2FFAA 1OV4A 4Q1BA 3UIEA 3FHCB 3QG5A 1RYHA 1VYTA 2JLSA 3OIYA 5G40A 3NG1A 4Q19A 3X1ZA 1NBME 5EJEA 3DMNA 2OAP1 4KSCA 3GLIB 1KHTA 4FMCF 1KOFA 4B43A 3BC1A 1SVIA 5M04A 2QG6A 4JVNA 1U98A 3T1TA 1RW4A 1O3YA 3NDBB 2DFLA 1NKSA 1U81A 4BFXA 2ZRCA 3C8UA 3GJ8A 2Q3MA 4LYFA 2EQBA 3SNHA 1S1MA 5KSPA 2LKDA 3Q85A 4CIDA 3RVBA 3W5IA 4IVQA 2R65A 2XITA 4PPQA 3H0KA 4ILEA 2PL3A 5EZ5A 3FE2A 3W8RA 1RIFA 4CEIB 5L3RA 3RS0A 1XU4A 3UWKA 5JSZA 5FOTA 2C77A 4CF7A 5DH9A 3VR2A 4M21A 2J59A 4C0LA 4EUNA 1NBMD 2XB2A 3CR7A 3GFTA 2PCLA 5K8LA 4QBIA 4PHHA 5EE0A 2IX3A 3KJHA 4HZUB 1Z0IA 1RVDA 2BM0A 4OHWA 2FDCA 1CR0A 1NSTA 3ZD7A 1E2FA 2H16A 3BH0A 1JR3E 1NKTA 4BRWA 2RGXA 3X1WA 1W5SA 2WWXA 5F9FA 1IAQA 4Q7MB 4V0NA 1BS1A 1R10A 5EZ6B 4RFSB 3RYTC 3UATA 5IT5A 4NZYA 5DHFA 2IA5A 2ZUDA 3GLFA 2OXRA 2IYTA 2EW1A 4TLAA 1P2UA 2FG5A 3SQXA 3IIKA 1TQDA 1SVKA 3MFYA 3CWZA 1GM5A 3NEYA 4B3XA 4JBXA 2GA8A 2ZSEA 4DJTA 3PUWA 2IYXA 3SYLA 1E2QA 4M9ZA 1JAHA 2VHJA 1COWD 1JR3D 3KKOA 1SZPA 4Q01A 2XNDA 1KK3A 1N5JA 1NVWQ 2ZRBA 4YDSA 4JBWA 2HLDA 2VP2A 1EWQA 4GP6A 1I4LD 1OXXK 2BC9A 4R9UC 2B21A 3TSOA 3U7GA 2VP4A 1Q20A 3EZ9A 3PQCA 2WMOB 5CJPA 4EKDA 3G0HA 1FMJA 1ZM9A 2C9OA 4Q18A 1XTRA 5CK5A 3K9HA 2QGZA 4EPTA 2D74A 1R0XA 2ZS9A 1KAOA 1RE0A 1QHXA 4QXAA 4KXFB 4D0LB 1BMFD 2ANBA 2GESA 3VHLB 5J47A 1FMLA 4WZAE 3WXMA 1NL3A 3X1YA 2AXNA 4A6XA 3IPXA 4EFLA 4Q4LA 4MRSA 1MO6A 2GXAA 2QMOA 1M74A 4AYXA 4BZQA 2ZROA 5BN3A 2HDNB 1G4UR 4PQYA 2B7BA 3BS4A 3OZXA 4C9BA 4Q4JB 4C0BA 2O52A 1D2NA 4RJLA 1XD2B 2WZQA 1V43A 5B64A 1YRAA 3GMTA 6Q21A 2OFOA 4NCNA 4Q5IA 5DISB 4IOKA 3T34A 1FP7A 2DFNA 5AUOB 2QROA 2WIBA 3WRXC 2VRWA 1D9ZA 1IY0A 1AQUA 2XAUA 3PV0A 4NYIQ 2OLKA 3P4XA 4ESVA 4DZZA 4CEHB 4US0R 2VQSA 5BW8A 1ZUNB 5AJZA 1SGWA 2CHVA 4ZI3A 2NO0A 2FGJA 2G1KA 2ORVA 1KJYA 3NTUA 4KI0A 2H7VA 4XTCS 1SXJB 3CH5A 5HR5A 1UM8A 2EVWX 3AV0B 4MKIA 1N6OA 1U94A 2C2HA 2HEIA 3KJIA 2GJ8A 2J0UB 1R7RA 1JJ7A 4GFDA 4KCGA 4QBFA 1G8FA 4UXJA 5J5CA 1A82A 4KJZA 4DCVA 2SHKA 2OE2A 3DO6A 4QBGB 2GILA 1L2TA 2VO1A 2PLRA 3BH7A 3H1TA 3ASZA 2KSQA 5SZIA 1IQPA 2GCOA 5H68A 2IYZA 2D62A 2QPOA 1DOAA 1KSFX 3QKSB 3KQLA 1QG2A 2XTZA 1ZINA 2IYVA 2ZJYA 3ZQJA 5L8VA 1T4GA 4KO8A 1NJGA 1SHKA 1ZCBA 3A1VA 2P5TB 2EYQA 2W2TA 4S35A 1LB1B 3GJ3A 3LWNA 2WSSA 2GKSA 2KWIA 1FNMA 1QHNA 2ZSDA 2ZU6A 1UEIA 3K0FB 3KKNA 1ESMA 3RRMA 1RRCA 4B2IA 3VKGA 1A2BA 1N5LA 3TAUA 2RB4A 3PEVA 3AVUA 4JLBA 3WMGA 4LV5B 3E70C 2ZM5A 2FSHA 5ANRB 3RLFA 1WE2A 3EPLA 4IHQA 2FJUA 1KI8A 1OKKD 2QTHA 2ZRMA 2WKPA 4M8NE 3DOFA 3D31A 1MO5A 3AF3A 1SXJC 1Z2AA 1BYUA 4CEHA 3QJYA 3PFIA 3VR3A 2YHSA 3R8CA 1T3HA 1M2OB 2A5GA 3BE4A 1WA5A 3QNUA 1LF5A 2VPPA 4MGYR 3W3AA 4PFSA 3OAAD 4BWYA 4FW9A 1OH5A 1I4DD 1BIFA 4HAWA 2J0QA 3RS5A 4LJYA 4YMVA 1SXJA 1C9KA 2QAJA 2YOGA 3VAAA 5AJXA 1E2GA 4TT3A 2IS1A 1H8EA 4TSFD 3CF2A 1NVUQ 4RSGA 2BBWA 1KZGB 2B8WA 4DLUA 3GEEA 4C2TA 4DC9A 1TEXA 1TMKA 4L9WA 2R6CA 5C46F 1YZKA 2KBEA 4A2PA 4ZDKA 1Z0DA 4CGZA 2ZSAA 1CXZA 2XNSA 1V5WA 2GCNA 3EXAA 4OQMA 4L9SA 1XZPA 4Q7LA 4D82A 4EJSC 4EPVA 1XX6A 1ELOA 2XX3A 2O0HA 2WAYA 4B73A 4RD2A 2GWHA 3BK7A 3AVPA 1VPLA 3KDSE 1GDDA 2JJ2D 2ZRPA 3K0CA 2V7QD 3QVVA 3T1QA 4EQ6B 5KTYA 3B1WA 3DL0A 4EJSA 4CDGA 2ZJ5A 2FEOA 3CKLA 5HKKA 3AGQA 3RC3A 1XNJA 1VCMA 2EWWA 1JEDA 1LVGA 2BBSA 3B6EA 4NE2A 4CT4B 1L4YA 3SYKA 3GLGA 1S3GA 2IWRA 4PZZA 2QE7D 2C96A 1XXHE 3R9IA 3T15A 1N0VC 1U9IC 3PXGA 1Q0UA 2R44A 2DY1A 1W0KA 4P32A 5BQ5A 1MO3A 3JVVA 4A0RA 1O87A 1F2UA 2O8BA 4ACBA 2D3WA 1G5RA 3AM1A 3LV8A 1NP6A 3RABA 1QHHB 1W5TA 2QI9C 2ONKA 4JSYA 4MQBA 4PC1A 2WPDD 2NZJA 3M0EA 4UJ5A 3RHFA 2P0EA 2VF8A 1U2RA 3A36A 2OM2A 1QHSA 2JA1A 3M4YA 4LBVA 1YKSA 4C0QC 1NN5A 2HV8A 3LA6A 4GPTA 1FP6A 2IYWA 2IS2A 2GXQA 1LS6A 1XBTA 4PC7A 2CL6X 3T1VA 1YJ5A 4URVR 4OK5A 3AB3A 2W6JD 2WWFA 3UWOA 3GLHA 3Q9LA 5BYKA 1E0SA 2XTNA 4DLZA 1W49A 3AGPA 4DLXA 3LVQE 4R2HA 4R98A 2JDIA 5DIFA 2MSDB 2H18A 2V6JA 4UNSA 1EESA 2AWOA 3LO5A 4OQLA 1G6OA 4A15A 2NO1A 1FL9A 1P2SA 2V55B 2UVQA 1Z6YA 4UJ3A 2CCGA 2ZI5A 3FKSD 4P3YA 4ZDWA 1QBKC 4B2PA 3ADDA 4M9SA 4AD8A 1E1RD 1NG1A 3NC0C 4FD2A 2PT7A 3ICEA 3LNCA 5FL7D 3ZLJA 4B3GA 1G3IA 4GSYA 3FPAA 3KTAA 4PPFA 3HR7A 1VKJA 1X8LA 1YQTA 1N6RA 5CYOA 2CNWD 3AF0A 1KI2A 5ELXA 4HAYA 3CZPA 1LV7A 1TQ6A 3CB4A 2WTUA 2KI5A 1S9HA 1E3MA 1H8HD 2J1LA 3OEED 4BPBA 3QKRA 5EUQB 2FWRA 4TL9A 3MSXA 4L4UA 5IK2A 1OPXA 5JFGA 3PG5A 5FTKA 2O8DB 2FU5C 1TQ4A 4HUTA 4IXNA 521PA 1HEIA 5FI1B 3TE6A 3LVRE 3BFKA 4M9QA 4H1UA 3TW4A 4HB2A 1J90A 3QXCA 3ZIAD 5A5GA 3F8TA 1CKEA 4L16A 1RRGA 5HE8A 2XSZD 2WSMA 4Q7KA 4LUCA 5IRCD 4URZR 4QM6A 5KO2A 1P7CA 4LJ5A 1P62B 2FA9A 1E9SA 1YR6A 2WOJA 1X3SA 3GQBA 4B6EA 2ZITA 1FNNA 4HEJA 5JJLA 2ZRKA 4LSGA 4LJ7A 1XRJA 2PZFA 2VHTA 2IHBA 4N0DA 5EP2A 4ABYA 1QHGA 3AVTA 5BYJA 4EFNA 2ZYUX 2OCAA 1GL6A 3VX4A 3EX7C 1P61B 4W5WA 4LY6A 1VYVA 2XXAA 2Q6TA 3E2IA 1AJEA 2CJWA 4Q21A 2BJWA 1ZUHA 1TAGA 3TUJC 2F55A 1DELA 4LC0A 1HTWA 4NYJQ 3GPLA 1Q57A 1X6VA 3SQWA 4XVRA 4Q9HA 4YC7A 4EPRA 2FPLA 1VG0B 1KAGA 1YZTA 4QHYA 4BUJA 3F5FA 4E03A 2J46A 3QF7A 4G01B 4LV8B 4PAOA 1QF9A 5E4FA 2MMCA 4KSBA 2J0SA 3PIRA 2I1VB 2P6UA 3DVLA 1IONA 2N46A 1EFRD 4XSHA 1N5IA 4CEJA 1T8TA 4D2IA 2IS6A 2ZRNA 2GK6A 4N1AA 4KYIB 4Q03A 3OFNA 3RDPA 1E2MA 3DZDA 3K0EA 3MCAA 4TTQA 2OEPA 3SOPA 4P31A 3W6PA 1NMZA 1DPFA 3ICQB 4GRAA 2ZSBA 1Q12A 1GKIA 1L7VC 1Z28A 2Z83A 3QG1A 5FUYA 1LFDB 4PX9A 3ND8A 4W5JA 4DUGD 2VBCA 1P6XA 4TLEA 3V00A 2W6ID 4MH0R 1A2KC 4DSTA 1Z29A 3VKWA 2OESA 2BMDA 1LNZA 4RZ2A 5AR1A 1E9CA 2YWGA 2P5SA 1MH1A 1YE8A 4O0MA 2ERXA 1NMXA 1VCIA 3SFZA 4QGAA 2BMFA 5EP1A 1CP2A 1DAIA 2PLFA 4NMMA 3DKPA 4BQSA 5FBRB 4PHTA 3X2SA 1UFQA 4OI1A 2AFHE 4LJ4A 3BERA 1PLKA 2GAAA 4M1OA 1TF5A 4GOJA 3CRVA 2CHQA 1HA3A 1CF4A 2A5YB 1MO4A 3RANA 4Q4HB 1OSNA 5TARA 1OIWA 2F3TA 2Y8EA 5C4MA 3TUIC 4JMPA 3GEHA 4M4SA 1E0JA 4K46A 2QT0A 1HY3A 3RSOA 4XWKA 4DLVA 2H17A 4URXR 4HLQB 5TDHA 1KSHA 3SFVA 4FIDA 2PMDA 3PJRA 2ZYTX 3QY0A 4EPXA 3K09C 5AJWA 5BN4A 2R2AA 4QNMA 2CCKA 1RJ9A 2NG1A 3K70B 1ZC3A 1CIPA 4KBGA 1UAAA 1SHZA 2VSFA 2QPAA 2WAXA 1S1CA 2ZQ5A 2WJVA 3G82C 1KI6B 3HPQA 1CS4C 3HPRA 2P67A 3KB1A 1KY2A 2VP0A 1G8HA 4PZYA 1UBCA 3Q5DA 2ZAMA 2RHMA 4M9XA 3UMSA 1GRQA 3AVWA 3NWJA 1DO2A 2LCFA 1DAHA 3PUZA 4KHZA 2QQEA 4TN1A 5LB4A 4UNNA 2X2EA 3THWA 1GAJA 1DS6A 1BH2A 3SBEA 3SE0A 3BJIC 5DO9A 3C4JA 4AI6A 4NCHA 2FN4A 2JLRA 2VYFA 3AF1A 5KNBA 1N2CE 5FPYA 1W7AA 3RWOA 4AY2A 5E7IA 1IBRA 3VR5A 2HCJB 2BBTA 2ZRLA 3N2EA 5JS8A 1VG9B 5EXXA 1UKYA 5JWOA 3SHFA 1KDOA 1KI3A 4XH9B 3T1OA 4TMZA 1ZD1A 4A6PA 5EE5B 5AUNB 1FX0A 4Z1MA 5FPKA 3R8FA 3AKCA 4B2LA 2OXCA 1GNQA 4EPYA 2J41A 4NYIR 1TUIA 2AXPA 3R7WA 3SZRA 4OK3A 1JQJC 1T6NA 1YZUA 2OCYC 2ONJA 1TNDA 2ZE6A 2QY9A 3QQ5A 5E3HA 4ACAA 3K70C 121PA 2QRNA 3IGFA 4G1UC 4HB0A 4AYWA 3ZYCA 3A6PC 1U99A 1TUEA 5FR1A 4JLKA 3FWYA 3NEJA 4WOPA 1YRBA 4F91B 2VP9A 3FMOB 1S3SA 1XJQA 3A1TA 1ZRHA 3ECCA 1IY2A 3U60B 3REFA 3WNCA 1Y63A 2ATVA 2GZHA 1NN0A 2QP3A 3EW9A 5JSZB 1EK0A 5F9HA 2WICA 3CRMA 1KO1A 4ASUA 4MDFA 4YXWA 2I4IA 1XTQA 1JEEA 4WIAA 1NLYA 4OI2A 4PSAA 3DM9B 2H92A 3F0TA 4RD4A 4XWOA 3BOSA 4OI4A 3TJZA 2OZEA 2XNDD 1J7KA 1S0UA 4A8JA 5IF9A 1XEWY 4I81A 1JR6A 2HLDD 1ZIPA 4WZ6A 4F38A 4YMTA 1AM4D 2CE7A 3CF0A 2AK2A 2J7KA 1GSIA 1I4TD 1T3SA 2J9RA 2ZAOA 3A37A 3B85A 3H4MA 4XD7D 4ZDJA 3NH6A 1FW6A 1Z2CA 2C8VA 3PEYA 3RRNA 4DLRA 5JWRA 1IHUA 2ZR7A 3GLFB 3PVSA 2CLDX 4F92B 5B58C 2YWEA 4QJ3A 4CZ2A 2NO7A 2OBLA 3E5HA 3IQXA 3BFXA 3I72A 4V03A 3P32A 1IJEA 3H86A 3I3SR 3BH6A 2ORIA 4NCJA 5GADl 4FMDB 2ERYA 5CB6A 4ZIRA 2XZOA 4N3NA 1R4AA 2J3EA 3V9PA 4HSEA 4PTLA 4AC9A 3SJZA 1XEWX 5TXGA 2GAOA 1T9HA 5CM9C 3B78A 1P9RA 1XPUA 3KFVA 3C16C 4GBMA 1G17A 3A1SA 2Q9AA 3ETLA 4ZCLA 4AG6A 4D26A 3NC1C 4LX0A 4QHTA 1AGRA 2K5UA 5LD2B 5DI3A 2IL1A 4DDVA 2Q21A 2Q3FA 1OYWA 2FNAA 3ADKA 3GJXC 2R6FA 3C5HA 4V0KA 4FINA 4IDNA 5KPDA 3B1XA 3T61A 1FTSA 3ZJYA 1P2TA 4LBYA 1NRJB 3L82B 4Z8XA 1IOZA 5CDFE 3MLEA 2ASEA 1BO6A 3L2OB 1FUKA 4TYPA 5J4VA 2HUPA 5L3QA 5CYPA 4TL6A 3QXJA 1T5LA 2O8CA 3QIAA 4TYYA 1CBUA 1CR4A 4JLOA 4FN5A 2R6DA 4DDTA 2BCJQ 4GDFA 3FMFA 1I2DA 4MGKR 4IRUB 4JYBA 1DVRA 4QHSA 5L3SB 5TV2A 2AHOA 4RZUA 4IEEA 4D4LA 3CNNA 1M34E 2DWQA 1U8YA 1QVAA 2WSSD 1NMYA 4HLUA 3TUZC 4IVPA 1X1RA 2FFQA 2XGJA 1P3JA 4Q1EA 2IYSA 1SXJE 2R6GA 5G53C 1P73A 1QZXA 4NP6A 1E99A 4EAQA 5IDVA 4GMDA 4JVSB 1CR1A 4D25A 1IN4A 1AN0A 1X8KA 5TVKA 1GFIA 1UADA 1P60A 2GZDA 2C99A 2BWJA 4GI7A 4ARZA 1GTVA 2NPIA 1OXVA 4X8OA 3TVTA 3CZQA 5LD2C 3I92A 5J4HA 1KYIA 3B1YA 3C14C 2Z4RA 2ANCA 1ZIOA 2GCOB 2KB0A 5DE3A 2ZS7A 3QVUA 4V0MA 1X1SA 4M1MA 3LXRA 1KIMA 1YU9A 2WWIA 3T5GA 4LJAA 1R2QA 2BCGY 4P4UA 5P21A 1OHHA 1SXJD 1G7SA 1MKYA 1WBBA 3X1DA 4TT3D 1H8ED 1E0KA 2FFHA 1TU4A 4JVLA 2Z43A 4BASA 1XEFA 3EAQA 3CR8A 1CLUA 3L0IB 5JECA 2P6NA 2D2FA 4I1VA 3A58B 3SEAA 2JLYA 2IEZA 2X77A 2BMEA 3I8SA 1J2JA 4NH0A 4TLCA 4TLDA 1R8QA 5J4YA 2YKGA 5FOSA 4BZXA 2GDJA 5DN6A 2F9MA 2QORA 2XOKA 4MKHA 1KTVA 2F7SA 3KZ1E 4POAA 4JS0A 5L3SA 2FPKA 4QNRA 2LWIA 3RWMB 2R8RA 4ZKEA 5EUMA 4KYUA 5K8IA 1AZTA 4E09A 1AK2A 5CIWA 2WIAA 4NYMQ 1N6HA 2D4HA 5HZKA 3M6AA 3D6TB 2BVNA 1EFHA 2MSCB 4O2RA 1W4BA 2IK8A 2XB4A 4MYHA 3GJ5A 4XTRA 2WJIA 4D6PA 1CRPA 3O47A 4ON9A 3CPEA 2C98A 1F2TA 1HQCA 1G7TA 3BXZA 3MMPA 2OG2A 1G5PA 4KU4A 2QL6A 3B82A 4B74A 3FTQA 4FCTA 5GVRA 1KGDA 1QHYA 1JI0A 3IQWA 1FFHA 5GJWC 1VYUA 1W0KD 4AYTA 1NVVQ 4GZLA 1AIPA 1N25A 2VHUA 5DSZA 1SVWA 2JATA 4UNRA 4HAZA 1E94E 2ZYVX 1GP2A 1HE8B 1QHIA 2EU8A 4AWXA 4FMBB 4OQFA 2GF0A 4C0JA 1NY5A 3D7MA 2CVFA 2F6RA 3RNLA 5FH9A 3DKVA 3LW7A 2IXFA 2IW3A 3K1JA 4JL5A 2HJGA 2J5XA 4PHFA 4B76A 1W44A 4EJSB 3U4QA 2VHCA 4A0GA 2V1UA 5F3WB 1Z07A 2FX3A 2JDID 3EG5A 1KY3A 3LLMA 4B3DA 4FMDF 2FE4A 4PSVA 2R6AA 4NHOA 5CITA 3EIQA 3U3OA 1G7RA 2RGEA 3KXIA 4PO1A 5CLQA 4IOJA 1VCOA 1XCPA 4BEJA 3NH9A 3C5CA 1CJTC 4KFRA 2QMEA 4LHWA 3GLGB 3FOZA 3TIFA 2QGNA 3TLXA 3JVUA 4NL4H 4X8HA 5JLJA 1JBKA 3SHWA 2P3SA 4TTRA 1GUAA 4ITRC 2GJSA 3FKQA 3MWLA 3MWJA 4DCTA 1GWNA 4PSKA 1F2UB 1XPRA 2O8BB 2FZLA 1R8SA 3MD0A 3B5JA 1WMSA 1XF9A 4IFEA 4QFMA 2ZU0C 1E98A 3CNOA 2HXYA 1Z0AA 3BB1A 3JZAA 4NBSA 4URUR 3R9WA 3MGCA 5D3MA 1JXMA 1T5IA 3DEFA 3WYGA 1ESNA 1ZP6A 2G77B 3L8ZA 3GLHB 2IXEA 3HP1A 5FBVB 5C2JB 3OESA 2G0TA 4MGIR 3GJ6A 3TKLA 4U00A 3TH5A 2ZJZA 4B48A 1NF3A 3K0CC 1KJZA 1OFUX 2E87A 4C0KA 1G8PA 2PJRA 4WA7A 1K5GA 4HAUA 1CJMA 3PUYA 5AUPB 3HYTA 1E9DA 1PJRA 1R0WA 4BFYA 2VL7A 2WM9B 4TL7A 4JBYA 5CK4A 3UG6A 2YC4C 3V4FA 4WXPA 3QXSA 5JCPA 2YJTD 4MITA 3VNUA 4BEBA 3BB4A 3OEHD 3PCRB 3KTAB 4PHGA 2QU8A 3R9XA 3EZ6A 4M22A 3TW8B 1DAKA 2QMHA 1H65A 2R62A 3ZGXA 4C7OB 1RKBA 2V54A 3L8YA 3WNDA 3TQCA 4CRWB 3EPJA 4XVUA 4LPKA 3P1JA 3ZVMA 4BFVA 1WRBA 2QAGB 2O5VA 2ZI9A 3BRWD 4BLPA 4PR0A 5J4LA 4IXMA 1ZM2A 3QKRB 3NVAA 2IYLD 3QXHA 2GRJA 4P4SA 5BXQC 1WP9A 2WJGA 1P9NA 2W0SA 1ZNXA 2JGNA 3GD7A 3FVQA 3GFOA 4G5SA 3GEIA 5DYGA 2RGAA 1A4RA 4G5GA 2XZLA 5HZHA 1OXUA 4YONB 1Z0KA 4DIDA 3NBZC 3TVDA 4BFWA 2YINC 1A5TA 2EFGA 2QUZA 4URYR 4OI0A 4TMKA 1XWIA 2CL7X 2N42A 5TMPA 1T0HB 1XFAA 3KQNA 3CBQA 3A8TA 4AKEA 4KAXA 1G64A 4JLNA 3O8RA 1U8AA 2PX0A 4LRWA 2JIZA 1YZGA 4EPWA 1E79A 2O8FB 1NN1A 5E95A 4E22A 2RCNA 1FTNA 1N6LA 4RZ3A 3KQHA 4AKHA 2D2EA 2BIFA 1Z5ZA 4CYMA 2VTKA 1GVNB 4YQFA 1Q44A 2GHIA 2BKUA 2IS4A 4DLSA 4B3BA 2XXAB 3KKPA 3DPUA 2CJWB 1VG1A 2IF2A 2VP6A 5TY0A 1L8QA 2RGDA 1R5NA 1CULC 1Z0JA 4YDHB 2YOFA 1OFHA 4TTPA 1WDTA 2JLQA 1WGWA 2QAGC 2ZI4A 5JEDA 4LBZA 4TQ9A 3FFBA 4ESHA 4OQXA 5EXTA 1ONBA 1DAMA 1E9FA 3KJEA 4C7OA 3MUFA 1PZNA 2ZRIA 4MKGA 1G1MA 2F1IA 2QAGA 1DG1G 4EIWA 1N6NA 1OT3A 1S4QA 3GJ7A 4JT4A 4DB2A 1E96A 1NN3A 2CL0X 3IIMA 2ECKA 4Z54A 2NPFA 2F43B 4QKQA 3ZDQA 2CMKA 2ZRFA 4JYCA 3JZMA 2CK3D 4OKSA 4D4KA 4CEJB 3TRFA 4P0TA 2QT1A 2J7PA 4MRRA 3UG7A 1QDEA 1E0AA 1D9XA 1P75A 2C5LA 2GTPA 4A2QA 3OAAA 1E4YA 2UZIR 2RGCA 5DGXA 4DSNA 5KNCA 2OT3B 5FUXA 4QRHA 4HI0E 4MDEA 3EARA 3LH5A 1G5TA 4C3ZA 3AUYA 4B35A 1ZD8A 3RS2A 2PEZA 3PR1A 4M1TA 4I1UA 1J70A 3KB2A 4JL8A 4A2WA 4H1VA 1VCNA 1QVRA 2IC5A 4YMSA 3MAAC 4AK9A 2O8FA 3KUDA 1XEXA 1II8A 1D2MA 1EX7A 3QEJA 3QENA 4Q9IA 3FHTA 2YOHA 4RVCA 1IXSB 3L0OA 4JL6A 4AURA 3AF2A 3WHLA 4DHEA 2JJ2A 3B7GA 1R5BA 4DWJA 3N2IA 5KSZA 1VIYA 2MMGA 3IUYA 4NDZA 4URWR 3WP0A 1XJCA 4Q02A 1KO4A 2QM8A 1A7JA 2JLXA 1D2EA 4Q9KA 2NGRA 1N3BA 1M7BA 2ORWA 4Q9LA 3EC2A 4FWTA 1JPJA 2ZJAA 1YZQA 3N70A 4JLDA 1XTJA 1LS1A 1JQLB 4U5XA 2GF9A 2IUTA 1KMHA 1GILA 1RZ3A 5JRJA 2IYQA 1XD8A 3TSWA 4RD6A 1G19A 2WKQA 1IN8A 3S1AA 2O8EB 1VG8A 3SYNA 3H2YA 1WB9A 1MRSA 2QE7A 1F48A 4PC3A 5KUTA 2G83A 5FTMA 5FOUA 2X19A 5JHGB 1RJ9B 4RFVA 2F43A 4C2UA 5EQTA 5FOVA 4LC1A 2OUKA 2FMXA 2XZPA 4Z1MD 5GVSA 2P6RA 3AKYA 1DAFA 4TZ0A 3ZQ6A 4DDWA 2FOLA 4PC6A 4TMWA 3RRZA 4DB4A 4J0QA 4MGZR 2V9PA 2JLUA 2JAQA 5AUQA 421PA 5C1BA 2W2VA 2L0XA 2QQ0A 1LF0A 2ZR9A 5HPYB 4Q47A 4DCUA 4QM7A 1Z0FA 4OHYA 4IOMA 3THWB 1UDWA 1D8TA 1WBDA 1W0JA 3U3KA 1R6BX 4JLPA 3LY5A 4W9MC 1XXHA 3OIWA 1G18A 4AKGA 1I2MA 3K70D 3OIVA 3UMRA 5KYKA 1KO5A 3I61A 3IKJA 4ASUD 5AK0A 4DLTA 1GNPA 1UBEA 1W4RA 2ZJ2A 4YXWD 4D81A 2IWHA 4C4PA 1D5CA 5F98A 1G6HA 1SKYB 3B13B 4D0GA 2RGNC 3SC3A 1MABA 3B1VA 5KDLA 2YWFA 3LX5A 1ZNWA 4LDJA 1FX0B 2H8KA 2RHDA 3BFVA 3R20A 3UMFA 5KSYA 4WW0A 1YZLA 4R71A 1EXMA 3R7WB 3N5CA 2RGNA 4LHYA 2ZEJA 4HB4A 3QF4A 4FCVA 2QPTA 4BFTA 1CR2A 3MWKA 3NIBA 3ZS8A 821PA 2WWGA 3EA5A 2O8EA 3QOFA 2OFWA 2W0MA 4TWZA 2PX3A 1AKYA 1AZSC 1CU1A 2VP5A 3K9LA 4FWIB 3Q7PA 2BM1A 3OE7D 3WRYC
chains in the Genus database with same CATH superfamily
1B26A 2KK1A 5A71A 2QM7A 3GJSA 3A1EA 2PTGA 2DQYA 4CUKA 2EERA 1P72A 3ZGLA 1I7PA 4GI2A 1RSZA 2JIOA 2VJCA 1TEZA 3OM8A 4YAWA 1N5MA 5CB4B 2J5RA 2FFJA 4DT1A 4JP5A 2V7UA 2F3PA 5DASA 3F5SA 2K6GA 1G4HA 1E0DA 5LNK1 3ZTZA 2QBYB 4U5DE 4V24A 3U9LA 3A11A 4BQEA 1CEYA 4ZQHA 4C3UA 2VIIA 4S1PA 4TYNA 1C8LA 1XMVA 4MR8B 1EEXB 1JWBB 4MLDA 3ND6A 1VKRA 3DAYA 1U4NA 3AW9A 3IVMA 2CLSA 1XK7A 3VZQA 4QELA 5IFKA 1RAIA 1TR2A 4TTSA 1XWJA 4D44A 3SHVA 2O8CB 3DF9A 4KR6A 2OCGA 3IBGA 3RRFA 3FUUA 4RMHA 4PZ0A 4ZZIA 4PR9A 1LNQA 3FOAA 2OAGA 4J7TA 3JRWA 1GGEA 4I1SA 5CFRA 2GZAA 4LYGA 4B33A 4C0AC 4NJMB 3OLVA 1EUDA 1E1DA 4QUDA 1G8SA 2M1ZA 4W82A 2PA0A 4EENA 1WTAA 4P4TA 2R85A 4Q1CA 3K31A 4GNRA 8OHMA 2HUNA 3OQIB 4RZIA 3QLEA 3ZWMA 1ZS9A 1U28C 3W6NA 1NMEA 4PXAA 5COAA 1IK6A 3CZ9A 2JJMA 3IODA 5BSEA 3STUA 5TS2A 5BN5A 3HU1A 1S05A 4Y6OA 1NWHA 3D8BA 3VOSA 5BSUA 2AUNA 3WLEA 1A9SA 1Q17A 3ROEA 4NU5A 3F2VA 3IB6A 5IZCA 4IB4A 5ALPA 4RULA 4Y2YA 3B2EA 4H7KA 2Q9BA 2ZTVA 3EGWA 3GLIA 1GUBA 2WBLC 3RIXA 1C80A 2R6JA 1OAAA 3T7CA 4DTIA 4D0NA 3E4CA 1XLTA 5LWHA 1MQ9A 4X94A 2D7CA 1DEKA 3LL4A 4OGKA 1C9MA 3DE3X 4AWAA 2HF8A 4BO6A 1N9KA 5FRDA 1R16A 2XLWA 4YAEA 5DOVA 3FI9A 4Y0VA 4D3DA 4MV4A 4EI7A 3N0TA 3ONWA 3MJEA 1RKUA 2VWPA 4PZLA 4PCVA 1XKLA 2AYYA 3M1IA 1S2MA 5CHYA 4Q3NA 5J2TA 3I9OA 3TOSA 2GRUA 3KH2A 1PG2A 3CPJB 1S4MA 4KVGA 2L7AA 4JITA 5F1OA 1W9HA 4HLCA 2IHYA 1FQJA 2DM6A 1WBJB 4Q4CA 3GX1A 5INTA 4YRJA 1JSCA 1RHMA 2ZQYA 1NI4B 3ZLUA 1R0BA 2IOFK 3SJAA 4XXHA 2HQRA 5MGBA 3U7QA 5I7UA 1YDIA 3HSSA 3SSAA 3HY4A 1J23A 4QDLA 4BJ6A 1T6ZA 4KWEA 3FD8A 3KSZO 1QCDA 3AIMA 2JGDB 2Z5FA 4GR9A 1TADA 2ZUVA 5GGXA 3KYIA 2RK4A 5B30A 1MJ5A 5BSKA 2A0FA 4JGIA 5CIQA 5D2CA 3QKSA 2YICA 3K9CA 2DCMA 2HMSA 2R4QA 1LBQA 4G0HA 2GLUA 2Z6UA 4HAIA 1N2JA 4A0FA 1WM1A 3PYLA 2AK3A 5B3LA 4OAQA 1P4JA 2NZWA 3FAZA 1DOZA 2WUWE 2DECA 2NZ8A 1UXIA 1CE8A 3DDUA 1ADCA 2IP2A 3CH4B 3OCJA 1U9IA 4RAQA 1QAQA 5JAPA 2P4HX 3WMEA 5KMGA 2TS1A 2GZ2A 4H7PA 1YZ3A 5CNKA 1WEHA 4GICA 2VZ0A 2P7HA 2IYUA 1GAEO 4NPCA 3U7IA 3S8EA 5T57A 1U7WA 4ZAXA 4CM3A 4HH0A 4YP5A 3D5EA 5DOZA 1G9SA 2X8JA 1HEYA 2VCCA 4A0HA 5A6SB 1OXKB 1QHHA 4KYTA 3MLAA 4W9RA 5JSFA 4B6QA 2RI1A 2IEYA 2QR3A 1L7PA 2DPXA 3DLPX 2CLKB 2BTEA 2WVQA 5ALYA 1FIUA 3PEUA 1XZHA 4WBNB 4L4ZA 1SURA 1JA1A 5L7WA 3OZ7A 2XCLA 4RPIA 3PHF2 4J2TA 3D8TA 1PQ4A 1WUTA 5J4KA 3ILYA 1XMSA 4YJ2F 4ERNA 2Q9UA 3I73A 4YL0A 1UKEA 2B4AA 1JIKA 1ZOLA 2R7LA 1F8YA 5DXFA 2ZYRA 2OGTA 3KJZA 3R7CA 2XYQA 3AOEC 2L69A 3AP3A 4HE8D 4CM8A 2CXHA 2EPOA 1QIHA 6ADHA 4A03A 1H85A 3OCCA 1U2GA 4LHVA 2GM4A 2H07A 5CFLA 1T91A 1RAGA 5TF0A 5EJAA 1TUBB 4EG3A 3UF0A 1JDSA 4V02A 3ZWWA 1P33A 1YRYE 4WFQA 4JI6B 4P80A 2FVXA 5E2BA 3PFBA 3D5TA 4R5HA 1GPWB 4EAAA 1OI3A 4MVQA 3Q12A 3AVOA 5AD1A 5AVKA 2C92A 3HYNA 3TZQA 3WFZA 4PWZA 4B3CA 3ENNA 5CD9A 1ORWA 4G3XA 4G9BA 4Q9NA 3NTLA 3KWJA 2HRRA 5B2ZA 2YIJA 4YJHB 4NCKA 3I5PA 2BFCA 3E0QA 2XUDA 4LZZA 4UAUA 2B94A 1H6AA 5IT9A 4NYMR 5KHOC 1GITA 4V0ME 1JAIA 1TEVA 4HDQB 3WG7C 4QEKA 3O91A 4K9KA 4EYSA 1EFRA 1B1AA 2I8LA 1V4AA 1G41A 1OI7A 1SC4A 2DR2A 2OBNA 4ENQA 3ZQKA 3DVAB 3U3MA 1UT8A 4IW3B 4IJ6A 3BICA 1CY1A 4KXYA 2VXOA 5FV7A 4EO7A 3UMBA 1KI6A 4HGRA 2J8ZA 2OA0A 3URKA 3C15C 1X80B 2H9YA 2PV7A 4XQ9A 1IMOA 1CQWA 3CUKA 1DO8A 2NYVA 1J22A 3VYSB 4A36A 2FMIA 3KBBA 1SVOA 1L1FA 4ALJA 4YK7A 4DV0B 4TLBA 4DF3A 3L0PA 5E0KB 5CHEA 5E6UA 4YLYA 2AX4A 1BMQA 1OV4A 1VYTA 2CF6A 4CMEA 1KJQA 1SVIA 5LMUB 3IQTA 2BMWA 5EIAA 3PYXA 4MQFB 1IBKB 4JP2A 3ZQ4A 3ZWKA 3Q85A 2R65A 4KDFA 4AO8A 5HKAA 4E2YA 1W2WA 4DCPA 4D9EA 4PHHA 1MVNA 3ITEA 4QDKA 1Z0IA 4MV6A 5F2OA 3AG5A 1Q0TA 1EP9A 2IP4A 1YZYA 2ZTMA 3MFYA 4YUAA 3JQ9A 3T7EA 1BJKA 4OIPF 1RBMA 1QVWA 5IKOA 3KKOA 1N5JA 5FKJA 4B6SA 4ED9A 3VVCA 5LVAA 1XTUA 1Q2UA 4F4UA 2VP4A 4EKDA 3G0HA 2DQ4A 2WYHA 3HU5A 3L1VA 1A9XB 4KXFB 4QULA 3NUZA 4WZAE 5HVNA 4DUYB 1AUQA 5KAMA 1T25A 2E21A 2GXAA 4Z7OB 3NYJA 4YRFA 4GUAA 2E1PA 2H4HA 2XQVA 3GMTA 1ILEA 1D0IA 3TOLA 4IDAA 3TZBA 3LUJA 4OO3A 2XLBA 1KOJA 3UQYS 1ZUNB 5AJZA 2AW5A 5KVAA 4WGGA 3EXFB 1AZWA 1OZ0A 4P4GA 2GJ8A 1SCDA 3TTVA 4UXJA 3T38A 2PLRA 5CH5A 2Q27A 5HUHA 2XLDA 3S44A 3DE5X 2Q4BA 2VK1A 2VF4X 5L8VA 4KO8A 4XM1A 1WAMA 2XM4A 5B1BC 4XQ1A 4IX1A 3L0IA 1LD3A 5AGFA 1A2BA 4OTZA 2PKQO 4XKJA 5FAXA 3MJDA 1ML4A 2QTHA 5HF5A 3AF3A 1O8BA 3UYKA 3R7DA 1SXPA 1U31A 4QREA 1QRTA 1V8DA 4ZT3A 2KHZA 1ZUD1 4WKGA 4M86A 3O3MB 1A8QA 4TT3A 1LBSA 1UBOS 1NVUQ 3PNQA 4U7PB 4MW9A 3FZNA 3PRHA 1LBHA 1Q5PA 2Q3CA 2I62A 3H05A 2O0HA 4ZEOA 1T3ZA 2O50A 1XZEA 2JJ2D 3K0CA 1UPUA 4J0DA 3B1WA 3RTBA 5J5AA 3GFGA 1KRHA 2ZJ5A 2WQ7A 4ETMA 4G1VA 5EK0A 3O1IC 2IWRA 4ZVOA 2L9JA 2V6FA 2JNWA 1PZEA 4C01A 3B48A 1WB4A 2RD9A 4LBVA 4JA2A 1IM8A 5BSWA 5K05A 4OK5A 5TGTA 4GKJB 3UWOA 3FN4A 4CQMA 3GLHA 3LPCA 3AG1C 3IKVA 4E1VA 1J06A 3RYIB 2UUAB 3WYEA 5FLXA 1YAHA 3LO5A 3OU2A 4MWBA 4UJ3A 2VXYA 4KWCA 2ZI5A 4YJ2A 3T7DA 4M9SA 1N1CA 3JD1A 3I2IA 3IPRA 1EI7A 4I4TB 2YYAA 3EUEA 1VHQA 4XEVA 2PZJA 1IK4A 1YS2X 3PFFA 2IZZA 3JR3A 3VJRA 4G4JA 3WLFA 2P35A 3KLMX 3IOEA 3IP8A 4HL6A 3KOMA 5HE8A 2XSZD 1AUPA 4CJGA 5G1PA 1ST3A 2D1TA 4D45A 1N32B 3W4YA 3GQVA 4KPYA 1G5HA 3W5HA 3H4VA 3IKTA 4ZCPA 5ARBA 4BV3A 1VYVA 1FXSA 4JI7B 1X7YB 3RG2A 3AXTA 2QX8A 1YBHA 2QI9F 1L7QA 4MMZB 5H0IA 1ZESA 2UVPA 1VLTA 5E4FA 3GFQA 3HRHA 1DJMA 5KWEA 2Y1DA 1MIHA 3K1HA 3K0EA 2Y99A 4KH0A 5JAMA 5ADHA 2IY7A 5K8CA 3EVGA 4K9OA 2D2IA 2YN4A 4LXIA 1WABA 3HNKA 1XKXA 1BE6A 1E9CA 4YASA 4BNNA 5CUQA 4EG5A 3II6X 4P34A 3ICOA 2C29D 1LI4A 1AUEA 4YRDA 1WY5A 1F1BA 4G09A 3Q9SA 1LUAA 1KSHA 1GL3A 4NF2A 1UP6A 1VZ2A 4DJ5X 3TI7A 4QNMA 3RADC 4ZOLA 2OKCA 2NG1A 2Q5CA 2LP4Y 3BWCA 2H1RA 1Z4MA 1W76A 1Y3IA 1BEEA 4EG6A 3L8CA 3H11A 2B20A 1KMNA 3O8OA 4R8SA 1LRJA 4ZMBA 2JFZA 3DR5A 4AY2A 2EF0A 3PGVA 1USIA 4XGRA 3VH3A 2QHXA 5DKFA 1Y5RA 2J41A 2AXPA 2ONJA 3QQ5A 5E3HA 4BB0A 3LBYA 4KAAA 4YX9A 3H4IA 3C1UA 5I5EA 2HLNA 4JLKA 3FWYA 3KO8A 3QVYA 1S3SA 1XJQA 3AYXB 3WNCA 2ATVA 2RGYA 1KO1A 4FGSA 4JIOA 1UM9A 5SV2A 1XTQA 3M4BA 3UEOA 5KKCA 2P9GA 1S0UA 4I81A 1Q0QA 3D8UA 4I9GA 4YAGA 4ZICA 1P17A 1L3CA 3IUPA 4B7AA 4TKVB 4MS4A 1O6FA 3PJDA 3NYRA 1I2ZA 2IPAB 4W9NC 3BFXA 4NSNA 1A2QA 4UCQA 2ERYA 1JDTA 1DJQA 1YB4A 2QTZA 4NBWA 2WJWA 3BXPA 3INNA 2NSYA 5K6AA 1T8PA 3KFVA 4AJ2A 1W34A 3RJ5A 3I2FA 3E7FA 1B4DA 4IDNA 5KPDA 1H1TA 4H3SA 2L6FA 4G8CA 1U7HA 3QX7A 1JG1A 4YRIA 2A4KA 4WLFA 2BCJQ 3MRTA 1FP1D 2YFQA 1M34E 4GW3A 3OCYA 3TUZC 3H18A 2CBXA 4QYXA 3T5CA 2COUA 4OLAA 3W6ZA 3C3EA 1QV9A 2A5LA 1TTHA 3SQMA 1YA4A 4JOQA 5J4HA 3C14C 2EG9A 4MA0A 2AG8A 4LJAA 1C30B 3DR3A 3Q1KA 4M55A 1GTSA 1Z2PX 2E18A 4C06A 1ULBA 3PFGA 3ABLC 2W8BB 4I1VA 3SEAA 1QYXA 3KSDO 1FLDA 4NH0A 3TGWA 2ZJ4A 1DEOA 1XHFA 1X39A 4GLFA 1ZK3A 2NUTA 2A84A 2B5OA 1N6HA 3KLNA 3WL4A 1IOWA 2XBMA 1TT5A 2A9PA 3G6WA 3D8HA 1Z13A 3NEPX 4XTRA 1F2TA 2MR5A 3UA4A 2BISA 4CQJA 3U5SA 4Q9AA 2BELA 2OZPA 4DQDA 3CVWA 1AE1A 1GTJ1 4PIVA 4OA5A 3HCPA 4U1RA 4BKRA 2ZUEA 2GF0A 5JW6A 2DGDA 5JMPA 3W77A 5DCUA 4E4YA 4UM5A 2HJGA 3UJNA 1UMKA 3VHRA 5FZTA 1BR4A 5F3WB 5HKBA 4KO4S 1KY3A 4FMDF 1KFBB 2FWPA 1KH2A 3T7JA 4Y2QA 1BXRA 1QHFA 1SB9A 1HYEA 3QTTA 5KWSA 4U2CA 4U3JA 1ORVA 4IM7A 4AW9A 3GG9A 4IGKA 3U4GA 4AVYA 5D3MA 4JCCA 1HRKA 4OG2A 1P0CA 4IIFA 1I7DA 2I80A 3GYGA 1HW2A 4QNNA 4CQLB 4MQEB 4C0KA 2XYPA 1OC4A 3S4YA 1W75A 3HYTA 1KWKA 3H3FA 2BFFA 4C4TA 1E8MA 3WICA 3ZVMA 4J3NA 2KLBA 3EEYA 4CKZA 3N2GA 5F3RA 1B8OA 1LLFA 2V7WA 5JNSA 2WUDA 4R68A 4OP3A 2XZLA 3EPRA 3MCVA 3X1MA 3N53A 5KU7A 1JYEA 3L84A 4PEVA 2VH1A 4AKEA 3EGEA 2M6RA 1GPMA 2O8FB 1Z45A 2ZIEA 4BTLA 1K3TA 4LJKA 4ZQFA 1C1XA 1Y1QA 1P2DA 1H3EA 1L8QA 4RFLA 1F51E 1LZLA 3M6UA 4C7OA 1OXMA 3MUFA 3UK1A 1DG1G 1ZXBA 4EIWA 1A9ZA 4O59O 3JAWA 4F85A 3MOIA 3STVA 2QT1A 1B8PA 3OQBA 1ZH6A 3ABIA 4K40A 4CKWB 1MTOA 2RGCA 4DSNA 1NW6A 4FILA 1LSSA 5DVZA 1ZD8A 3TTWA 1TW3A 2PEZA 4O02B 3HB7A 4KGVA 4H4DA 4RVNA 2IC5A 3Q10A 3C3CA 3N2KB 4UUBA 3QENA 2XBUA 5EQDA 1K08A 2ZDQA 2HN9A 1TPYA 1KY5A 4KNVA 4DRYA 1YZQA 4Z9FA 4KOEC 2P2CA 3C1TA 3VH4A 5KNBD 5EWMB 4AN0A 4TV9A 3G2MA 2QE7A 3NPAA 4X6UA 5BN4B 1A0OA 1V7ZA 1Z39A 3W4JA 5EQTA 2YVQA 3AKYA 5LUBA 2WF9A 5B6IA 1Z56C 1JHQA 2VTVA 1QYWA 3HN2A 5BMVA 1G18A 1GADO 5BWBA 1NUQA 2CNLA 1GUYA 4F72A 5F98A 4YP1A 1CZKA 2NAPA 5KDLA 2W43A 2X1HA 4WHMA 3BFVA 3F73A 4O4JB 2PQ6A 5K3FA 1PFQA 1H2HA 2EJUA 1HEUA 4H7EA 4EGCB 4MWSA 3I6ZA 4K9RA 4IDHA 1A9PA 1KDYA 2FPGB 2V7GA 3WRYA 1K7CA 4MUXA 4D8TA 2VSYA 3RSGA 3OCVA 1UMBA 3W8NA 4FBGA 1ZH4A 1WQ1R 3FLEA 4LQDA 2A0XA 5E8RA 2XS8A 3NP7A 4DLBA 5KVCA 1PR3A 2QLFA 2PX2A 3JQAA 4FE4A 2EYUA 5ENZA 1V25A 3WGVA 2Z56A 1TX4B 5AVJA 2CD7A 1Q1BA 3X2FA 4QXMA 3TGPA 2GD2A 3IV6A 1FMWA 4U6NA 3KCQA 2JJ1A 2OZLB 2O0MA 3FW1A 2OHFA 4JLWA 4EELA 1CLEA 1C7RA 4OMUA 3HFJA 3IP7A 5CFQA 2OV4A 4WCVA 3NONA 1VJ1A 3ZDLA 4DEXA 4A8JC 3I6MA 3E18A 2O2HA 2W4BA 1QDLB 1B23P 1JL3A 4O63O 3IAM1 4MA5A 1HG1A 5TT1A 5EKTA 1PR2A 4XGNA 4TTAA 1R0CA 5C9ZA 3I5XA 2I6XA 2EJCA 1JDNA 2G1JA 3KXLA 2PO5A 1ZO8A 2LDXA 1MH9A 1T9KA 4LLCA 2AG5A 1ZVQA 4EYOA 2BH2A 2PX4A 4R2WA 5DU2A 3T94A 1Z23A 1G8GA 3U5TA 4UUAA 4ZO6A 3FDQA 2CN1A 8AT1A 3VTKA 4P3OA 3U7FB 1J25A 1QMGA 2GJ4A 5F5HA 2X5JO 2XTAA 3D59A 3TZLA 2HK7A 4D96A 2IZ6A 4JVMA 1E2EA 3VJKA 1XTKA 4BU0A 3S1SA 4Q6WA 1M1YE 5HMMA 4EH1A 1LRLA 2ISSD 1NI3A 4W1RA 4RADA 1MB2A 3KX2A 5EHIA 1QC5B 3UT0A 2Y1XA 4IBOA 4EEZA 4C22A 3UMKA 2IGTA 5EPOA 4CW7A 4F2HA 2ODEA 1KVQA 1EQ2A 2Q6VA 2XMCA 4I5IA 3R7NA 3DMDA 1M66A 3MGGA 1R0SA 3CUEF 3JSEO 3JTLO 1ISSA 4FYMA 5C1DA 4KR0A 1GPAA 4YLGA 3V6MA 3VC1A 4CG3A 4BNMA 3EA0A 3R3WA 4J6EA 3HVKA 4LV6A 4P2BA 3AKEA 1RHUA 5EN4A 3S2UA 2R9VA 4XLNF 3B9QA 5JCZA 4K6MA 2UUCB 3EGOA 5KINB 4R7GA 3ZNPA 5SY6A 2ID7A 3TDNA 1V47A 4GP7A 1PJAA 1UOOA 4FHCA 3LQQA 4XWAA 1GV1A 4L5JA 6NULA 2NOAA 5KU1A 2PXHA 2BGUA 4OU5A 2DVMA 1JGTA 1QH9A 3EFBA 1ZMRA 3G13A 3OEWA 4ESEA 4JCZA 2Q2WA 3P45A 3R6LA 1JB1A 4CG0A 4BO7A 4FQ5A 4S1NA 3C62A 4KFSA 3VVLA 3LX8A 1GQSA 2OWEA 1WSDA 5G0UA 1SG9A 1EHYA 5FUWA 4JOBA 2FMKA 3SDSA 2JFUA 4G8BA 2ZSFA 3L8IA 3HTXA 1YH3A 4O0LA 4EW1A 2NSJA 2Q3LA 3LFUA 2QN3A 4D97A 1T15A 4BTVA 3O9MA 1EVLA 5CI8A 4K6KA 4L08A 1JW9B 4WZAA 1LBEA 3UMYA 1OX6A 1F3OA 4P3KA 4WXRA 3OX1A 3UXMA 2CXTA 1UBFA 4RDAA 1DXHA 2XF8A 1HSZA 1U8CB 2CY0A 1SVLA 4QFCA 4H27A 3L1UA 2MIIA 1C29B 4JKYA 2CVHA 5M7EA 1M7GA 1GLGA 1P29A 1TZMA 3IEIA 4DBRA 3PXDA 3UT5A 3KPJA 5EMMA 2J0XA 1B43A 5EFZA 1I80A 2AD5A 4GDMA 5F1YA 3ZWPA 3U4MA 2VF7A 3LY7A 3KOYA 2KSFA 5CT8A 3BD6A 1LTQA 1PGQA 3AXSA 3S9OA 4UMEA 2BHTA 1QZTA 5B1YA 2YYZA 1D6JA 3O5AA 3E0XA 4ZCMA 4DR2B 1B76A 2PR7A 3QMVA 2P65A 2SCUA 3FCCA 2HJHA 4A1FA 1MQVA 3OOYA 4Y2SA 1MQSA 1AEPA 2N75A 4X1IB 1O58A 2YTZA 4XR4A 1GZSA 4BFUA 4WK4B 2BHSA 2WZBA 1UBNA 3ZCRA 1DWQA 2EFJA 3K6JA 1TL7C 2G08A 4A7PA 3WYDA 3HDYA 4XJXA 3T3OA 4DAEA 2H0QA 1N2ZA 3PT9A 3LX4A 3SZ3A 3MTDA 1D1CA 2QLMA 3GDFA 4QDTA 1C3OA 2G8LA 1HUQA 1DTWB 4HPXB 2QTTA 2R66A 4GPEA 3THXB 3GYBA 4IRMA 3L7YA 4XSGA 2QVZX 3BWDD 4EITA 3URMA 1F4PA 3WBKA 3QMKA 3CSUA 1TA9A 4X7BA 5ALFA 4AMGA 3ND7A 4F0JA 1JA0A 1Z26A 4P4NA 3FM9A 1PGOA 1CUBA 1QG0A 1M8JA 1XEAA 1ETUA 3SBDA 1SQ6A 4XJVA 2DEUA 1M83A 4E5DA 5C3MA 1W85A 2GJKA 2IYAA 3LBIA 4E1BA 1XPOA 4FFBA 1I32A 2R1TB 3OT4A 1R6XA 2OQIA 5AO9A 4KRYA 3LHDA 4QA9A 4TQAA 3U81A 4PJMA 4Q48A 3EWIA 4S2EA 3W8IA 1F60A 3THYB 1Q0PA 4QLOA 1SRRA 5CVCA 3TRKA 1ADJA 1DBSA 2X9QA 4ZZ0A 4YI5A 3V4RA 1IUKA 4I8XA 3CIOA 3EVCA 1TMOA 4LY9A 3DSRA 2IY9A 2FN9A 4EKWA 4PLWA 4DCSA 4NMHA 2W9YA 4HAVA 3I3OA 1CF9A 1ZA1A 2D7DA 1BMDA 4GR5A 1E2IA 1U8UA 2HQSA 2Q07A 1YK0A 3S2IA 2ZZMA 3MM4A 2G76A 4N3GA 3DOUA 3V7OA 2WJAA 3KRTA 5JXGA 1XKQA 4WSOA 2QYHA 1ABBA 3D0KA 3NHAA 2P77A 4GMGA 3VM6A 4G1EB 3M70A 1FVHA 1G4AE 1T9ZA 2V45A 4AWBA 3FDIA 4FGLA 3IOBA 2OVFA 1U7OA 2OCCC 1U6JA 2AB0A 2OAP1 4OBWA 4RF3A 3JSZA 4FMCF 3OOSA 2RBGA 3C8UA 3OLZA 2A0YA 1TCAA 1Q0FA 2JFWA 4DTCA 3TKYA 4CF7A 2H8GA 5ADUS 2I4MA 3EVTA 4PG6A 4NCXA 1QSPA 2R25A 4Y1RA 3U8PA 3IDOA 4H31A 1E2FA 2HFIA 4BNFA 3X1WA 4F6RB 5KI6A 1WTYA 3RYTC 4KMMA 2F1KA 3GLFA 5TIIA 5AW0A 3NMKA 1X87A 3WX0A 3CWZA 1GM5A 3T1HB 1OXBB 2X14A 3HFRA 4S0ZA 4FZ3A 1J0BA 2P9HA 1NVWQ 1IWPB 1I4LD 1OXXK 3AETB 4GXQA 1RAHA 4FDUA 1J1IA 1S89A 1CQXA 1RE0A 2LTAA 2EP8A 5FNVF 3ZY6A 4MRSA 1TKNA 3TQRA 3ZV3A 2VYVA 3E7XA 4C0BA 2WZQA 1D9ZA 5DLPA 3BMQA 2B1GA 4WFKA 1VMIA 1V11B 3KV3O 2WTEA 2H7VA 2EVWX 2B0HA 1R7RA 1O95D 2VTBA 4BE9A 3GLUA 4YPFA 3KJXA 3M6WA 3D6UA 3CLHA 2YXBA 3C6MA 1ZLYA 1QPZA 3C3PA 1GZ5A 3WL7A 2QVCA 1CUSA 5IEJA 3GGGA 2JCXA 3PEVA 5TQ2A 1FUYB 4G97A 1Q2XA 1TCCA 4DBVO 5CG1A 4CR8A 4DXHA 3PFIA 1DDIA 3HC7A 3A31A 4Q3AA 1YGYA 1E2GA 2DWUA 4KQHA 2CZGA 3F6EX 4FGKA 1ELOA 3ILHA 2DJ5A 4Z4QA 3KEQA 4QAQA 3Q0EA 4EQ6B 4I19A 4BX3A 2DBRA 3ZYZA 4ECAA 3RTCA 3FGOA 3KC2A 1YNOA 2AOUB 2Z8XA 5GWXA 2PGLA 1N0VC 1MO3A 2GPJA 5DHQA 1PHPA 2ZVJA 4PC1A 3BWYA 1W29A 3M0EA 2QLJA 1CEQA 4C0QC 3GRVA 4K9LA 1FP6A 2OQMA 1JS1X 1RM5A 4RVOA 3AB3A 3LNMB 2XTNA 1UT5A 4TKZA 2V6JA 2HMVA 2VQ3A 1DV2A 1RDFA 4ERXA 4ZDWA 5E3AA 2EIKC 5LA6B 1L7XA 2CNWD 3AF0A 1QGYA 4HAYA 1LV7A 3CB4A 4U7WA 2OZKA 5JQGA 4WESB 1MU0A 5AM2A 5FTKA 2EPNA 3UT6A 4EY4A 4A8PA 4BX0A 4B6IA 2Q3JA 5K3OA 4H1UA 3TW4A 3JQPA 2WABA 2GR9A 3EOAI 4L16A 5E2AA 3CTPA 1ND6A 2FA9A 4EVQA 2C4NA 4W6QA 4MDYA 2C20A 5EP2A 4GVLA 5LFAA 1O6GA 1TYDE 4XQGA 2BJWA 4YB8A 3K5WA 4J8PA 3TCXB 3TJMA 5AW4A 3HZZA 2NAFA 4QARA 2XEDA 1TZCA 1J4AA 5BYBA 4LV8B 1QVVA 1VE7A 1Y6GA 1QF9A 4BNZA 3N9IA 4KXVA 3KSBC 4CEJA 5TMEA 2O9JA 4HF7A 5AJTA 2ZK7A 2OEPA 1YLMA 3ICWA 1QGUB 5TQ0A 3T3EA 2B99A 1EDEA 3D6JA 3CW9A 1N2OA 3KB8A 4NENA 2C5FA 4D92A 4GXRA 2FEAA 1U5BB 1YKGA 3IRVA 2WLTA 2PLFA 1AY0A 2IDMA 3H7IA 4OI1A 1TF5A 3D4LA 3CRVA 1HA3A 5L4LA 4W8HA 3BM5A 3ZQYA 4B7ZA 3E5MA 3GZJA 4DR7B 2PMDA 3QY0A 1PR0A 2ZT5A 1YZVA 1O77A 2YH2A 4MGEA 1V5IA 4PIPA 3IAXA 2OBXA 2VSFA 8ABPA 2WJVA 1UANA 2O1EA 4PZYA 3G9TA 5EZQA 3AVWA 3NLLA 4KMOA 1W8DA 4L73A 3QFTA 2VAPA 1C7JA 3ZBPA 3UH0A 3VR2D 4Z9AA 5EXXA 1PQWA 5EE5B 5LQRA 2LP4A 4UZFA 5DNEA 4L8YA 4KEAA 4NFSA 1V8BA 2P0AA 1V1RA 1P1KA 4HB0A 5CYGA 1UDRA 5I45A 4RDIA 4OJMX 4PYKA 3FMOB 2R68A 3CX3A 4Z0NA 1U5AA 2WICA 2J9FA 2EPLX 3TDMA 3CVYA 3V4VB 1V96A 4TMFA 2HLDD 1HKUA 3G2LA 2ZULA 5E4JA 3TEJA 4PLHA 2QRLA 2LXNA 3RRNA 1QFJA 4CZ2A 4QPZA 2OBLA 3ZXUB 3UFXA 5B36A 4IIDA 4IUBS 4WFJA 4FMDB 2UUBB 3IUNA 3G9ZA 2R03A 2NTNA 4AZTA 1LDNA 3ZDRA 3R7SA 4ZLCA 1RXYA 1IDN1 2FSSA 5K0TA 5HQJA 5FNVA 4G86A 5DBOA 4D26A 3TKAA 3UJCA 1SWWA 1L1RA 4KQFA 4C76A 1LI5A 5CFZA 4LXYA 3RFXA 4HMOA 2W2KA 2ASEA 1DI0A 1O57A 4XB6B 4TYYA 1CBUA 2VG8A 2ZR8A 2OXIA 1RLMA 4Q6BA 1AUXA 3W7VA 4PW0A 3DLTA 1OY1A 2FFQA 1VSUA 1F0NA 2N3ZA 1SXJE 2R6GA 4X3CA 3HWX1 5D6NA 3BHNA 1ARZA 4AS1A 2GN6A 1T3GA 2NU6B 5E6RB 1L7OA 2F48A 2ODQA 4JT8A 4CSAC 3UJ6A 3Q87B 3TIIA 3KYBA 1IZ9A 1S2OA 4E5YA 5A9SA 4K88A 1E0KA 5K0SA 3HZHA 2G5TA 2ZB2A 3EXG2 1PE0A 5DN6A 2W45A 4GWLA 1KQFA 1Z5OA 2Q46A 2HBZA 3R5SA 2BVNA 1Y1LA 2MSCB 4JC7A 4C7JA 4D6PA 7MDHA 2YZKA 1TO1E 5GJWC 5JS1A 1MNQA 4FEGA 3GFSA 5F35A 4CWAA 4YCCA 2H48A 2IXFA 3U4QA 2H59A 4ZVRA 2A9OA 2CHUA 2EZTA 4NHOA 1X1QA 1PSDA 5CITA 5MFZA 1G7RA 3FZGA 1W73A 4L74A 4O6VA 5EQJB 3ZBQA 3ZDEA 2XUQA 4BP8A 5BOVA 3PX3A 3B5JA 1JSRA 3WK5A 4B4UA 4HNQA 1GGNA 3OO0A 1ZMTA 3WTBA 1XDUA 2XL6A 2I2CA 3HP1A 2PWYA 3TKLA 2HA0A 2IKSA 1TD9A 4WY2A 1TUGA 5GOZA 2O2SA 1CHNA 5JD5A 5LU8A 4WVLA 3O4IA 2ZT8A 3BB4A 4NV3A 4D9HA 3CT4A 3TW8B 5A9RA 1GQRA 2EILC 3BSFA 3RFUA 4RVUA 3ZTWA 1JNXX 4DOZA 3SMVA 4NTFA 3VZDA 1Z7Qc 4F1KA 5H80A 3O8RA 3PE6A 5GZ3A 4FHZA 4N0PA 3NP9A 3K6BA 1X0VA 4JB2A 4DUPA 1CJBA 4TTPA 5JEDA 3V7YA 4A2CA 3IJ5A 4MKGA 1P7YA 4UARA 2VDQB 3ASOC 2HQ1A 2W48A 4MYDA 2NXCA 2GK3A 1T4MA 3OAAA 3SXUA 2OT3B 3IVAA 3G0IA 1T8YA 2QG4A 3BSSA 4B80A 1Y9EA 2FMUA 1RXIA 3RFTA 1JLHA 1DJOA 3MAAC 1DRVA 3QEJA 4GSKA 4L4SA 3NPMA 1T1SA 2HGSA 3IOMA 4AO6A 3X1KA 3WLQA 1KO4A 1U2PA 1N3BA 5KNDD 3CCFA 4YPVA 5A2QA 1XTJA 2BSXA 1RZ3A 3GN1A 3RFCA 4P7FA 2WKQA 1IN8A 3H2YA 3I53A 4IX9A 3ADPA 2O5EA 4Z1MD 1DDOA 4HQ0A 4X6XA 4F1JA 3W5UA 4R69A 4TMWA 1W19A 1LIHA 4Z2AA 2W2VA 1PV1A 2L0XA 2FPXA 2ONCA 3WSTA 1APCA 1EE9A 2YV2A 3ZGVA 3CZ5A 5DFAA 2H5IA 1CYEA 1SU8A 1QGOA 5AC4A 4D0GA 4DABA 2Q2QA 3UBTA 3GA5A 4PR3A 5IC5A 2QRGA 3R20A 1EQAA 4RQAA 2HSWA 3N8HA 5G0SA 2IH2A 3LIPA 3Q8KA 2PX3A 4EYEA 4R01A 3O10A 4EI8A 2XYVA 3KPVA 5KC9A 4J76A 1KVRA 2JPUA 1Y34E 4DCNA 2CDBA 3CVJA 2IEAA 4GT1A 4N0MA 1EGAA 3GC6A 4PSCA 2PRKA 3LLVA 1CS0B 4KV9A 2C9DA 2DBQA 3TQOA 3K0AA 3NHYA 4PVDA 4V0SA 3NBXX 5AWFC 3A0RB 1QOZA 3NTQA 3K1AB 3D3NA 4EA8A 2UXBB 3IAEA 3LCJA 1ZVZA 3DZIA 4GPBA 3VU9A 4G0NA 1ZD9A 2AI2A 4Q15A 1SUAA 2AL7A 1BXZA 3V2UA 4ZVSA 3BCRA 1HFEL 3CX4A 4UFOA 2HM7A 4PYOA 2XDWA 4MSUA 1ZRSA 2F59A 1KERA 3IRUA 4FUQA 1GOTA 3AINA 4D8VA 5E4YA 3CKKA 1D04A 4LWOA 3UKOA 1QZZA 2I8AA 3PRKE 4TS4A 4ZOLF 4D4GA 3ZIUA 3U4HA 4JLAA 4F3NA 3RIEA 3M5CA 3EZFA 4CNBA 2HYDA 3V8PA 3SI7A 1O6BA 1QIFA 2DHRA 2ODWA 4IRXA 3D3WB 3H1AA 1L9KA 1HE1C 4K28A 2YBEA 3M79A 2ZYGA 2VCBA 3OF3A 3HJTA 1E6MA 5E2IA 1IFXA 4FNAA 4HK4A 1JEQB 1A9YA 3AZPA 4JI8B 2P6OA 3PD0A 4I3HA 2HBQA 4C21A 1C1HA 3D54D 4LXUA 5JYEA 4BB6A 2BGKA 1BDIA 4DJ9A 5JWHA 1PJTA 4CT5A 5HG0A 5CB0A 4XGQA 4Q1DA 1LQUA 2XT6A 3OOWA 4J4BA 3HNOA 5BW4A 3NV9A 1NMSA 2V96A 1HLGA 3HUTA 4M1KA 1JLKA 3JU3A 1P1CA 1XCGB 1EFPB 4I5FA 1A8PA 4E0BA 2VAMA 1T0PA 1ZNYA 2G9QA 5AXBA 3BAFA 1H69A 1YJ8A 1GTL1 4OQNA 4UEOA 2EX1A 4AL0A 1ORHA 4JLJA 3MXTA 2WWWA 1QP4A 1GZ3A 3TK1A 1WASA 5KSOA 1BFUA 4LOHA 2C9CA 4QEDA 5ICEA 5T4FA 5FB3A 2P2GA 4RFSA 3CS3A 2CGEA 4NAUA 2OEVA 1I9CA 2CYDA 1AKEA 4AKIA 1PFGA 4N6CA 5GPBA 2B2CA 3CRQA 4LYAA 4MIOA 5JCXA 5JO0A 2Q3HA 4QBKA 2WJ3A 3QE3A 3TOMA 1PZHA 4LI0A 2QRVB 3HM9A 1E79D 2AD1A 4IF6A 1DEAA 3L8EA 3UJBA 3DAGA 1PDVA 4NYJR 1D0SA 1N36B 2XT0A 3K5HA 3QVGA 1ZMXA 4IL5A 4ZQCB 5CDFA 3AL0C 1NIPA 3EVDA 4Z3DA 3OD5A 3NOOA 4MVRA 1OLXB 1WNFA 3C7DB 1CZLA 1V45E 3B8HA 4F60A 1OF1A 5GJVC 1YR8A 1PV4A 4IVRA 3I2YX 2K2QB 3N7TA 1L6RA 1TW2A 2WVGA 2WHYA 3FCYA 5IKPA 2C4TA 1ZXXA 1UJ5A 3DAPA 1NW3A 3HCWA 2DSNA 1E9EA 4PNEA 3DS8A 4BLUA 5IVDA 4YMWA 3B8EA 4X91A 3EGXB 4H0NA 5BWMA 1W36D 2ZAGA 1JU9A 3BBLA 4BKQA 3N86A 1HK7A 2P11A 1XRNA 2XJ4A 4R1PA 2OD7A 2J3KA 4PICA 1MDFA 1DGQA 2VJQA 4KSYA 3CVVA