4AK9A

Structure of chloroplast ftsy from physcomitrella patens
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
308
structure length
302
Chain Sequence
SQDPDIQLLFSGFSKTRENLAVVDELLTYWNLDESESILDELEEVLLVSDFGPKTALKIVDTIRKDILAGRLKSGPQIKEALKKNIFKLLTERVTTTELQLGNSRPAVLMIVGVNGGGKTTTLGKLANRFKKEGVKVLMAAGDTAAAGEQLEVWAQRTGSEIVMAPRPAAVLSQAVRRAVEEDFDVVLCDTSGRLHTNYNLMEELRGCKRAVSKALSSAPNEVLLVLDGTTGLNMLAQAREFNQVIGVTGFILTKLDGTARGGCVVSVVDELSIPVKFVGVGEGIDDLQPFDAQSFVDALFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CPFTSY
publication title Evolution from the Prokaryotic to the Higher Plant Chloroplast Signal Recognition Particle: The Signal Recognition Particle RNA is Conserved in Plastids of a Wide Range of Photosynthetic Organisms.
pubmed doi rcsb
source organism Physcomitrella patens
molecule tags Protein transport
total genus 119
structure length 302
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ak9A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ak9A02
4M1SA 1L4UA 1VPLA 2YWFA 4EAQA 1E0AA 5AK0A 1VCIA 4MRVA 1T8TA 3MRSA 4S2EA 5JJKA 4LJ4A 4GBMA 1UFQA 2ZI7A 1F48A 3IBYA 2VF8A 3GLFA 4JL8A 1W4CA 3RHFA 4A2PA 2ORWA 2V6IA 1R8QA 1ZM2A 1JXOA 2CK3A 2QP3A 5JZVA 3SQWA 3HJNA 4GT1A 5BN3A 2AXNA 2GTPA 4Q9JA 4OYHA 1XPUA 1IJEA 5JJLA 1OXUA 4NCHA 3CR7A 4BLTA 4L9WA 1E9CA 2QI9C 3AUXA 3GJ8A 3NBXX 3KTAA 3A4LA 2VF7A 2WHXA 3Q3JB 1KZ7B 3VMFA 3LW8A 4F38A 4DLSA 3LV8A 4MRNA 3Q8XB 1TU4A 4EJSC 4YMVA 4LBVA 3ZIAA 2ZJYA 2OBNA 2W2TA 4TYQA 1Z83A 2IX3A 3TQFA 4KSBA 3UMFA 2UKDA 1DPFA 4BZQA 4DUGD 2ZEJA 1II8B 1AZSC 3B8HA 3LXRA 4JBWA 621PA 3LQQA 3GLIB 1Z3IX 3LH5A 4B3XA 3KFXA 4QC2A 4WOPA 2RGCA 5JCPA 3ICQB 2BMDA 2KBEA 1QHYA 1YRBA 2ZI9A 2HJVA 1T5LA 1HH4A 3L0OA 4A2WA 4JL5A 1E98A 3H84A 3A1TA 2IXFA 4KO8A 3RS5A 1U81A 1II8A 1XWIA 3IDQA 3ZZ0A 3PFIA 3I1FA 5EP4A 2J46A 3ZZUA 1XZQA 1TQ4A 4OHWA 1WMSA 2B8WA 4AYWA 3SJCA 4DC9A 1E0KA 1RYHA 5CDFA 2P65A 2EYQA 2IUTA 3QF4B 4X8LA 5SZHB 3N5CA 1GZSA 1SVWA 1WXQA 4WVFA 3G82C 4MRPA 4QFMA 2IYQA 4KJZA 4TN1A 3TVTA 2QTFA 1IN6A 4NE2A 3K70C 1MRSA 4PC3A 1SXJE 3TJZA 121PA 1NN1A 1ZM9A 5KUTA 1EG7A 3TKLA 2F3TA 1OB5A 1ZCAA 4AKHA 5E95A 1G16A 4AG6A 1GL9B 3OEHA 1IJFA 4QHYA 3CH5A 4GMXA 1E9EA 3CO5A 4V03A 4R71A 2R2AA 4X8HA 3K09C 4URXR 1ZIOA 4RFSB 1NN0A 3WY9A 1FTSA 2R9VA 1BIFA 1ZNWA 4WXPA 5FPHA 4G5OA 1HQYE 1ZC4A 5FBVB 4KFUA 3SC3A 5HKKA 1YZGA 4GOKA 3AF0A 3KXLA 3NHBA 1C4OA 1Z22A 2G88A 4LJYA 4Q18A 4CT5A 2O8EB 3MAAC 3AVXA 5KHOC 1G1MA 1N6KA 2C9CA 4DVGA 1CULC 2IWHA 2ZM5A 4DLUA 1E2GA 1CJMA 1ZAKA 1OT3A 4PHGA 5JWOA 2WICA 3EWSA 5HE9A 4N0EA 4LUCA 3WRXC 3GLGB 4IOMA 4ZCLA 1Q21A 2ZJBA 1D6JA 1N3BA 3BBPA 5HZHA 3V4RA 1ZCBA 2O8EA 2GDJA 5IRCD 5FTMA 5J5CA 4LPKA 4CZ2A 3IIKA 4ZDWA 3U7FB 2FDCA 2PBRA 2VP6A 3MD0A 1XTRA 4FD2A 4WW0A 3CRMA 3MG9A 2UZ3A 2BKUA 2QSZA 2ZI5A 4EFMA 5FTKA 4NYJQ 4MGYR 3RAPR 2ZAMA 1NVVR 4M1YA 4NCJA 4FCVA 3FMOB 4UXIA 4EQ6B 1UKEA 3GFPA 1Q22A 3GJXC 1CKEA 5FBWB 5JS8A 2OG2A 1G7SA 4Q1FA 3QBVA 4JYCA 4U5XA 3TSOA 1BO6A 1FX0B 1KO7A 1ZM4A 2GK7A 4N1AA 1UDXA 1M8PA 4JYBA 3LBHA 2QRZA 1Q57A 4EQ6A 1COWD 4D26A 3TSZA 1YQTA 1YZUA 2Q9AA 1KI8A 4YONB 1G3RA 4KFTA 5CIQA 3REGA 2QORA 3P27A 4EKDA 1E9FA 1VG9B 1ZUNB 1IHUA 2JLZA 2AFHE 1FX0A 1UAAA 2QE7D 3PQCA 2YC2C 3KQNA 1GNQA 1KDPA 1R5NA 1NL3A 3CZPA 1W47A 4JVSB 3DOFA 4LJ5A 2GXAA 3EPKA 1KI1A 2XEXA 2KBFA 3AUYA 5FOVA 2V3CC 2XAUA 4UNPA 2C2HA 3DDCA 1ZM7A 2XNDD 2ZJAA 2GRJA 3LLMA 1GKUB 2QAGB 4LYJA 2W6JD 5TV2A 1J2JA 3IPXA 2OLKA 2G1KA 2FPLA 2JLSA 4GI7A 4DKXA 1U0HC 2ZRGA 1SVMA 1CR2A 5LD2B 3M4YA 4D82A 4PO8A 1K5GA 1G8PA 4I99A 3WHKA 5GJVC 5CB6A 4B75A 4G0NA 1Z0KA 2HJGA 5SZIA 4KYUA 3VAAA 4M21A 1FFHA 4M9ZA 5FBRB 1EX6A 4PQYA 1NMYA 1X3SA 2QAGA 1CR1A 3NTUA 4D80A 4DCSA 2OFXA 2GJSA 4ZKEA 1FNNA 2DYKA 1FMLA 3TUJC 2J7PA 3REFA 2BBOA 1VCMA 4EJSB 4ABYA 4MGIR 2GAAA 5AJYA 1P9NA 3U3KA 3EPJA 2FE4A 1XD2B 5ANRB 4PXAA 1NF3A 3VKGA 3OEEA 3Q85A 4YMTA 1E32A 3TSWA 4GZMA 4UJ5A 4JLBA 3KDSE 4ASUD 1CR4A 2FSFA 3QEJA 4YDHB 3B1WA 5SZKB 3UG6A 2G3YA 4EJSA 4LJ8A 2QT1A 1S8FA 2A30A 3I8XA 4Q1BA 4Q9KA 1GUAA 1XD2A 5FOSA 1DVRA 4LHYA 5CITA 2W6ID 1AJEA 3ASYA 3TQCA 1MRNA 4JL6A 3KQUA 1G4AE 2RAPA 5GJCA 4B6EA 4CRWB 5K8IA 4GP7A 4I1UA 1N5JA 1XCPA 2HLDD 1KKMA 1A2KC 2GESA 2XOKA 4AY2A 3LO5A 3SZRA 2CVHA 1DG3A 1YR6A 1ZINA 4HLUC 4M2LA 4V0ME 4DIDA 4NYMR 3U6KA 5D3QA 2ZRNA 2MMGA 5L3QB 1QHGA 3QKRB 2PH1A 2DFTA 4FW9A 1XXHE 3C15C 4QBHA 4K46A 1VKJA 2QPAA 1W1WA 1XB2A 1KI6A 1XU4A 5L3SB 1IXZA 1F5NA 5AJWA 3BB1A 4PAQA 4UNNA 1EFCA 3B9PA 3CW2A 3QE0A 1RRPA 1IQPA 3DVLA 5GJWC 4JLMA 2NOAA 5FTLA 1H8EA 2GBLA 5L3QA 4FMDF 5JFGA 4W9MC 3AVPA 3QKRA 4HLQB 1SKQA 1TEVA 2IYZA 4LRWA 4Q9IA 5LB2A 5F3WB 5FUYA 1E1RD 2BHRA 5DYGA 2F1IA 1ELOA 4PO1A 2P3SA 5TB5A 4XSGA 4IDPA 3VR5A 1GKIA 3PUYA 5BQ5A 4CDGA 3NDBB 1VMAA 2D7CA 4JKIA 2HYIC 1PLLA 1E1QA 2GETA 1HQCA 4PHFA 4IVPA 4JVMA 3D31A 4HB3A 1A4RA 4W5JA 4A8JB 1EGAA 2D2FA 3B6EA 2GJ8A 4RZUA 3T5GA 2ZS9A 4P4TA 1CJTC 1QZXA 3X2SA 1GG2A 2VP4A 3FMIA 4YDSA 5LB4A 4LC1A 3S1AA 1P75A 3WYFA 4B6FA 1GM5A 1MKYA 4Q7MB 1DEKA 2AWNA 1U2RA 3NXSA 4QG7A 4DLVA 2GHIA 2JJ2D 5JI2E 1JR3A 1SQ5A 2JLYA 4RZXA 3BERA 5DN6D 4TMTA 2YC4C 2BJVA 2A2ZA 3SEAA 3SN6A 4A8JA 1OFHA 1FZQA 3U60B 1IN5A 2GEUA 3THXA 4LZZA 1YZNA 1SVIA 1WDTA 4BE7B 2XSZA 1LW7A 1N5IA 1OXVA 2IHYA 3K0EA 4JBYA 4TL8A 3CONA 1P9WA 3EA0A 5CJ2A 4ACAA 2F6RA 2C03A 3PITA 4EPYA 1OE0A 3NDPA 3CPHA 4QGFA 1IN7A 4R7ZA 3K53A 3P4XA 2FH5B 3I92A 3SHWA 1W48A 2O8CB 4HSEA 4D2IA 1HT1E 3PUVA 1E96A 4EPRA 1TX4B 1QDEA 1T91A 4M1TA 3TR5A 4TSFD 3ZYCA 1VIYA 1HYQA 4FINA 5HCNA 2ZRMA 4Y0AA 5DI3B 2GXQA 4LK2A 3B85A 4AYXA 1LF5A 1UEJA 1BS1A 2QRNA 4HB2A 3EC2A 2NO9A 3EZ7A 2BMEA 2VYFA 2DY1A 4TMZA 2O8CA 1JB1A 4NH0A 2FGJA 2RB4A 1NKSA 2WIAA 2YWEA 3FWYA 3QY0A 4ZPXA 1DBSA 1EWRA 3RC3A 3KZ1E 3FVQA 2IK8A 1M34E 2QPOA 2IYWA 3DZDA 4Q9LA 5JCZA 2I3BA 3QVVA 4NTZA 2AR7A 3WMFA 4DT1A 5J40A 2ZJOA 2REBA 4DDVA 2ODBA 4QM7A 1W5SA 4K8OA 2VP5A 1XMSA 3MCAA 4JJZA 4PANA 1ONBA 2IT1A 5DYIA 5M04A 1HT2E 4DZZA 5E7JA 1ESNA 3A36A 4O2LA 1SXJC 2WPDD 4HZUB 5G3ZA 3QI2A 4M53A 4QJ5A 3SQXA 2QMUA 3LLUA 4MKGA 4QGAA 4KV9A 2KE5A 4IEEA 4HEJA 2EFEB 3KKNA 4M9XA 3DMDA 1MR3F 4OHXA 2W83A 4ON9A 2P0EA 4WAUA 4PAOA 4ZCIA 4QHTA 4RKEA 4Z1MA 2IYXA 4HZUA 3SDZA 3WNCA 1Q1QA 3HU1A 4NKRA 4UJ3A 2NG1A 1GRQA 2X2FA 1XMVA 2OCYC 4RCZA 4M1KA 3V4FA 2RMKA 3DHWC 3VR6A 5H8WA 2HXSA 4C0LA 1NG9A 3C5CA 4QBFA 2BCGY 1UKZA 4Q02A 4QGHA 4MUAA 2WV9A 3MUFA 1E2FA 3V00A 4V0NA 3B1YA 3FMFA 2XZLA 5EE9A 2LCFA 3A8TA 1XEXB 1F2UB 1KZGB 3IILA 4M4SA 3GEEA 3SI7A 2Z4SA 1T5IA 3NIBA 4FXPA 1DE0A 2WWYA 3R9WA 4MYCA 1ZC3A 1Q3HA 1RRCA 5C4GB 2GZHA 3ZQ6A 2ODEA 2ZJ8A 1T3SA 4TQAA 5A0FA 5J4HA 2LKDA 4IJMA 2GZDA 4CYMA 1EWQA 5JRJA 1WBBA 4IOLA 1CLUA 1XTJA 3L0IB 1OIWA 3AVYA 3EZ2A 2YZ2A 4KODA 4U7DA 3RDPA 3BH0A 1GITA 3T06B 2CNWD 3LWNA 3A6PC 4QBGB 3IEUA 3U3MA 3CBQA 4TTPA 4A0FA 1V5WA 4C0HA 1VYVA 1E2KA 1VHTA 5P21A 5FI0B 3KJGA 2R6CA 2XITA 1G17A 2ECKA 1NMZA 2AK2A 2ZRFA 4IRUB 3D3QA 3TW8B 4P33A 1OSNA 4KFRA 5D3MB 4GRAA 3PJRA 1S4QA 2AX4A 1HE1C 1M1YE 4LJ7A 4B2LA 2F1HA 2QZ4A 4IFEA 2ZJZA 4Q03A 2B6HA 2V1UA 3IGFA 4FWTA 3ECCA 1G7RA 1TPZA 3EZ9A 4Q4AB 5KSPA 2GWHA 4WIAA 3WNDA 3P20A 4YQFA 5KDOA 5FPTA 4HLUA 4JLVA 3FHCB 2BBWA 3K1JA 3H4MA 3JVVA 4KFSA 2PMDA 5D3MA 3B13B 4CW7A 4DCTA 2ZVQX 3T35A 5TMPA 2RKOA 2BMJA 1OHHA 1G7CA 4TMWA 1KK1A 4LX0A 4BWYA 2WVJA 4Q5IA 1JECA 1KK3A 4Q4AA 2OV2A 1XEFA 3MMPA 3VR2A 4GMDA 3EX7C 4QNMA 1B0UA 2NPFA 3KB1A 1FQKA 3VKHA 2W00A 3NH9A 2Z43A 1N2CE 4BLRA 1IXRC 2DCUA 2VHUA 3QXSA 2IF2A 2ZU6A 2JJ1D 2OXCA 2LKCA 3P4YA 1T3LA 5DHFA 1NNEA 1GRRA 3MFYA 1S9DA 2AD1A 2JA1A 2AHOA 1TQ2A 2WTUA 3DM5A 3PENA 3R7WA 4DLZA 4CT4B 1MABB 4YMUA 4TYWA 3OIVA 1A2BA 2WSSD 4D0NA 3RRNA 4JMPA 3MWJA 4GOJA 1G8HA 3IIJA 1D5CA 3HDTA 5FPYA 1W0JD 4OHYA 4BPBA 2DR3A 3ADKA 1Z2CA 2QL6A 2P5TB 5B2ZA 3C41J 1MABA 1PJRA 1U94A 5B57C 2FWRA 1N6HA 2Q21A 2ZSBA 3TE6A 5FOXA 1E2QA 2IYLD 5IT5A 2NZ8A 1AS2A 2F7SA 1JALA 4P31A 2FA9A 1ZYUA 3VX3A 2Q6TA 3W6PA 3VR1A 2DPXA 1ZJ6A 2VHJA 5KNCA 2IEZA 1SGWA 1E79D 2WJGA 1G9XA 5CK4A 3OAAA 4V0LA 5FR1A 2O8BB 1DAEA 2ZUBA 1YVDA 2HUPA 5LDDC 4GPTA 4DCNA 1G18A 3RS2A 1I4TD 4Z51A 1N25A 5DGXA 4ZKDA 1XJ0A 8OHMA 4CEHB 1VCNA 3GEIA 1MV5A 3CF6R 4KVGA 4TTQA 1KSGA 3FOZA 3R8FA 5JJIA 2EQBA 1AQUA 1NLYA 3BB4A 3SBEA 1XTSA 2GF0A 2JLXA 4R98A 2IS4A 1Z2AA 5EXSA 3K9LA 4PSAA 4F4CA 2O8BA 2ANCA 4Q01A 1CS4C 2G1JA 2TMKA 2R6FA 4PZZA 2YYZA 3PR1A 5B58C 4URUR 3W5IA 5JBQA 4YXWA 1M6NA 1G6HA 2ZE5A 4TYPA 4C30A 2ANBA 1GP2A 4BFZA 2FSGA 2FFBA 3SU8A 3C8UA 3QG5A 4OQNA 1KI3A 1SHZA 4Q1DA 3SNHA 1DARA 2JEOA 3M1IA 3ZH9B 2QBYA 1SXJA 3DM9B 2JLWA 3CRW1 3W6OA 3P1JA 2XJ4A 4JLJA 2PZFA 4DXAA 4CVNA 4JLOA 3IPYA 1BMFA 4LYFA 5FOTA 1ESMA 4RFVA 3LD9A 3CR8A 3SFVA 1J99A 3GJ4A 2Z5FA 3NWJA 2CK3D 4H1UA 4BECA 3Q72A 2WOJA 4A2QA 1Z6XA 1EFHA 2BMFA 2V1XA 1CR0A 1G3IA 2ZE6A 3M0EA 2F1RA 2QAGC 1VTKA 3N2EA 3ND9A 5AJZA 5EXXA 5TXGA 3UWKA 1QVRA 1OFUX 2RGNC 2X77A 3WP0A 5LD2C 2PLRA 2WJIA 1AA9A 2RGXA 1NVVQ 1V43A 2PCJA 1ZMXA 3EZFA 4XD7A 4O3MA 721PA 1UF9A 5EUQB 2GJAA 2QMHA 4TMXA 4L5BA 3TR0A 2QNRA 1GAJA 4G5RA 3ZVLA 1VCOA 3Q7PA 4L15A 1W49A 1BOFA 2GKSA 3VU9B 4GDFA 4MRRA 3GP8A 1KMHB 421PA 1T0JB 3RSLA 2QN6A 2IF0A 3W90A 1G291 1KI2A 4GOXA 4TT3A 5JS7A 3T61A 4EDHA 2ZE7A 4A0GA 3ADBA 5GADl 4WBSA 4HDQB 3EPHA 4GFDA 3F3YA 4KVAA 2J0VA 1KMHA 1R7RA 1RJ9B 1WRBA 4WA7A 1R5OA 2ORIA 2ZRIA 4UXHA 4WZ6A 2AD5A 3FMPB 1NBME 4YLGA 5KPJA 2HDNB 3DEFA 3VTKA 2NMVA 2MSEB 2OUKA 3IHLA 3ZVRA 4AI6A 3UANA 3CUEF 3AVOA 2C98A 5KSZA 2QAJA 2QM7A 2OXRA 4N3NA 3GLIA 1E2IA 3A4NA 1S96A 1U99A 2YOFA 3QUSA 4LDJA 3KX2A 1RE0A 4MGZR 1LB1B 1RJ9A 2VIIA 4BGDA 1R4AA 1F2TB 2FZLA 2R62A 4LJ9A 5HE8A 2R65A 3AKCA 1IY2A 2DWQA 4Q1CA 5E7MA 4MYUA 2GBLC 2Y8EA 2BBSA 2W0SA 4B3CA 1FL9A 4UNSA 4NDZA 4B74A 2JLRA 2NO0A 1G41A 4HUTA 2GF9A 5C2JB 5KTYA 2QTVB 4DLYA 3OEHD 2YNMA 4LHXA 2B8TA 5K8TA 1TAGA 4Q7JB 3CKLA 2XXAB 4BRWA 3BS4A 2ZRKA 3U2QA 4BZPA 2CLSA 2PJZA 2GEVA 3QXHA 1F2TA 1B23P 3Q9LA 4ARZB 1G8GA 3QF4A 4IHQA 4L8GA 1D9XA 2CCGA 5G41A 4NHOA 3MJHA 2HV8A 3IQXA 2IYUA 2PX0A 2ZYVX 1GILA 1RFLA 4YC7A 3CNNA 2QQ0A 2FG5A 2XXAA 1NSFA 3KUCA 5DIFA 2HF9A 5DE3A 2CL6X 3EC1A 4ARZA 4YMSA 3L0PA 5C4MA 4A8JC 5DI9A 2O0JA 3DL0A 6Q21A 1G5TA 4OK3A 2RHMA 1ZU5A 2RCNA 2KSQA 1FQJA 1BYIA 1MO6A 4C4PA 1Z47A 1II9A 2FEMA 4Q19A 1Z6GA 1KK2A 2LWIA 4Q7KA 4QNRA 4URWR 1S3GA 2REOA 3IKJA 3NVAA 2QENA 1P4SA 2Q3HA 4OBEA 3PUXA 3UG7A 2CXXA 3ZJYA 1EFRA 4RFSA 1HA3A 4IDNA 3IEVA 3QENA 4URVR 4LSGA 3VR4A 2P6UA 2PCLA 4EUNA 4A82A 3GLFE 2RHDA 4KU4A 1AGPA 1H8HD 2BIFA 3B1VA 3D6TB 2ZYWX 3BIFA 3QVUA 4LC0A 3M6AA 1CU1A 4W5WA 4E22A 5B64A 2I1VB 1G7TA 2VL7A 4PQRA 5FFMA 2PZEA 1L7VC 3GLGA 4B34A 4MUBA 2JIZA 1LY1A 2E87A 2ZI3A 1E9SA 3A4MA 4AD8A 1XXHB 2F55A 1NRJB 4OQLA 3QSYA 3EXAA 1DO2A 4W7SA 4NCIA 1KJZA 4L9SA 2R6GA 1E94E 2CCKA 5FTJA 4ESHA 1G6OA 3KJEA 3ZD7A 3U7GA 3AP2A 3NC0C 2QEQA 2REXB 3U3JA 3PEUA 1JQLB 1RZ3A 1UEIA 3CPJB 5G3YA 3UKDA 2BOVA 5JLJA 1XXHA 1U8ZA 4P32A 4OQMA 2A5GA 3PCRB 3OF5A 3GFTA 3LQRA 2IHBA 3IQWA 3ONWA 5DH9A 3THWB 1XJQA 1FUKA 1IN8A 5CLLA 4C0JA 3PUWA 3B82A 1JXMA 4JJKA 4U00A 4DLWA 1E9AA 2CCJA 4PHTA 4XVRA 3UWOA 1IONA 1OKKA 1UDWA 1R5BA 1BYUA 3QQ5A 3G5UA 2ZU0C 2CL0X 4A92A 1Q1ZA 3VHLB 4OHZA 1JEDA 4BFTA 2ODNA 2WWFA 1G3QA 4BFVA 4HAYA 3F5FA 4JT2A 3GLHE 5C46F 2FSHA 5JMTA 4MH0R 1JAHA 2QSYA 3KJHA 3B2EA 3EARA 4KBGA 2L0XA 5JHHB 4PC1A 2OO7A 1CP2A 1FUUA 3VNUA 3Q7QA 4BFUA 2ATVA 3EIQA 2VEDA 4PFSA 3OEED 4Q00A 1XF9A 3FYHA 4C0BA 1W36B 1JI0A 4MA4A 2VSFA 2CHGA 4O0MA 4Q9HA 2RGNA 5JSZB 1VG0B 3C4JA 4QKQA 5EJEA 1E3MA 1RKBA 4JBXA 4POAA 1F3OA 5TY0A 3IO5A 3RWMB 4A6XA 4Y0VA 5EUMA 4B73A 1DAMA 1N5KA 4DDWA 3U44B 2A7QA 1DADA 2BKEA 3OE7D 3AVUA 4ZDIA 4KYIB 3PEYA 3F0TA 1E9DA 2EW1A 2NZJA 3K0AB 1SVLA 4FMDB 2XOKD 1Q1BA 2ZSAA 2O8DB 1JPNA 3I61A 2GXSA 1K8RA 1YZKA 4Q21A 2PJRA 4LV8B 4B2IA 1MO5A 1R0ZA 4MKIA 4O2RA 3VX4A 2EWVA 4URYR 1KY3A 1I4DD 2C5LA 5FPSA 3X1YA 3X1ZA 1SVKA 2H8KA 1OLOA 3K0SA 1P9RA 3B5JA 3CH4B 1NY5A 1OH8A 3KL4A 3PV0A 1SKYE 2O8DA 1LV7A 4H9GA 2H1LA 4XTRA 2FOLA 4MGKR 5LBIA 1XTIA 4LCBA 3SS8A 2N1BA 4LOAA 4D6PA 1H8ED 1XEWY 5EE1A 4IDQA 1U8AA 3THYB 1WBDA 1TF7A 1MO4A 1JJVA 2NIPA 1S2MA 1KO4A 5CYPA 2A3RA 3NEJA 4MKFA 1Z29A 2JJ8A 3J81k 3MJRA 2UZIR 1E1QD 4P3YA 4R9UC 5DLQC 3K70D 4US2R 2VHCA 1Q44A 4M0LA 1S3SA 2AKYA 2YOHA 5F9HA 1S9HA 1NVWQ 3UXMA 2OT3B 1I2MA 4I1SA 1M7GA 1Y63A 2Q9BA 2AXPA 4BEBA 1K6MA 2EFHB 2XB2A 1Q3TA 4X8OA 2PZGA 2VBCA 3AVQA 1LS1A 5DSZA 2G83A 3D8BA 1OIXA 2D62A 3CNOA 4B48A 2CVFA 1YR9A 1QHIA 1OFTA 2PEZA 3BRWD 1JAIA 1R2QA 1Q20A 2KI5A 1RVDA 2DWOA 2PX3A 2XSZD 1WQ1R 3AB3A 2HT1A 4A36A 4FIDA 2ZSEA 2HF8A 4DRZA 3O8BA 2OCBA 3CRRA 1QF9A 4XWAA 3T34A 3W34A 2OCPA 1W44A 4IXNA 4PX9A 1R0XA 1QRAA 2R44A 1S0UA 2EFCB 4EPTA 1XTKA 3WBKA 2WAYA 1TMKA 2F3RA 3FKSA 2YJTD 1O3YA 1LTQA 1KIMA 3LBNA 1HURA 1CTQA 1TF2A 2OLJA 3CIOA 1E1RA 2VH5R 3AH8A 4OI0A 3AGQA 5DO9A 2FFQA 2AN9A 1W2GA 2H7VA 3AF2A 3FB4A 5FL7A 1G5PA 1YJ5A 3VKWA 2O8FB 1N0VC 3R9XA 2GJKA 1P73A 1KI9A 4C0SA 5CB8A 4PSVA 4AK9A 4UQOA 4C9BA 3IO3A 1JR6A 2D4HA 4OL0A 4C0QC 3ZZTA 3SJAA 4ZV4A 5KOYA 3L43A 2DFNA 3ZVMA 1AK2A 2WMOB 4PC7A 1CJKC 1GTVA 5C18A 2AL7A 5KNDA 1PV4A 5JWRA 3U7EB 4PPNA 3SHFA 4DLTA 1QHNA 3KJIA 4JLAA 4NMMA 2F9LA 2JDIA 3AF3A 5DI3A 5EXPA 5FUXA 4M8NE 5KU1A 1YZLA 4OQXA 3HYTA 3AF4A 4TLDA 4HDOB 3IIMA 3VR3A 1QG4A 1GVNB 1OXXK 4HI0E 3OIWA 1FP7A 2PMKA 3BB3A 2MSCB 1I4LD 3T1TA 3E70C 2ZJ2A 1R10A 4B2PA 1KNQA 1Z08A 3D7MA 4Q48A 1RYFA 3PG5A 4II7A 4IW3B 1E2EA 1KO5A 2CDNA 3CX8A 1SVSA 1T6NA 1U90A 4Z1MD 1AKYA 5EE5B 2NO7A 2P6RA 3KKPA 2XX3A 4S35A 3HR7A 1WP9A 3KKOA 2IC5A 1EESA 2KJQA 1C1YA 3K8YA 2RH5A 3RS7A 1MT0A 5FL3A 4OJKA 5FOUA 5L3VA 4LJAA 1FMJA 2GEDA 3GPLA 5DISB 1OH6A 2GXUA 5UKDA 1JPJA 2ZJ5A 3TH5A 1EFUA 4JT4A 4AYTA 3WBJA 1IBRA 1RRGA 2ODWA 4ZDJA 4FWIB 1E9RA 4I4LA 3BJIC 1GL6A 4LYHA 5JWHA 2D7DA 1XP8A 3QKUA 3QKTA 5F9FA 1HTWA 1KGDA 4B71A 4DJTA 2ZSDA 3GJ5A 3CWQA 3MWKA 1JQJC 1Z0JA 3B9QA 2I1QA 2H16A 3Q5EA 4Z8YA 2FU5C 4LBZA 1X8JA 4ZI3A 4DSNA 4UNRA 4P4SB 3W8RA 1US8B 2B92A 4RJLA 4ZCMA 4GZLA 3WMGA 2XTZA 3BORA 3QEOA 3VHXA 4DSTA 2CEAA 1NSTA 1GL7A 3O8CA 3H0KA 1E9BA 2A5JA 2OFOA 1UPTA 3AQ4A 3NC1C 1CEEA 4G5QA 2ZITA 2QUZA 4CEIB 4C7OB 1XEXA 5FR2A 1F2UA 4P4SA 2VPPA 4V0OA 4V02A 1T4GA 1XJCA 2YKGA 3CRQA 4M1MA 2OE2A 2AFIE 1ETUA 4TMVA 3RSOA 4AIIA 1KOFA 1W46A 4HLDA 3EPLA 1N5LA 1N6NA 2FFHA 1KDTA 1ZNZA 2J7KA 1P5ZB 1UBFA 4DLRA 4HB4A 4MITA 1NKTA 2BM1A 5IHPA 3ADDA 2ZSFA 2NPIA 1W4BA 2YWHA 1FTNA 4CEIA 2FV8A 4OI2A 3ZLJA 5EQTA 2XGJA 2KWIA 1OJLA 3TGPA 1OHHD 1AIPA 1II0A 1UKYA 5IK2A 4TYYA 4DIEA 2OM2A 1ODFA 3EASA 4HB0A 4E03A 3FHTA 1KKLA 3SJBA 3LVRE 2DWPA 4IKEA 1WCV1 2X19A 2Q3FA 1QBKC 5E7IA 5BW8A 5FH9A 1IXSB 2ZE8A 1IOZA 3C14C 1E2MA 2J41A 2IYVA 4QM6A 4RZ2A 2GAOA 1IY0A 3LX5A 4TLAA 4DEXA 3AP3A 5EE0A 4DCVA 4DSOA 1NN3A 1LVGA 3A1UA 4HDCA 3AEZA 3T1VA 1CBUA 3O47A 1TUIA 2B21A 1E0JA 4G1UC 2HT6A 3GJ6A 2IYYA 4KI0A 2W58A 3I62A 1UKVY 4GNKA 4Q4HB 1UBGA 1VDZA 5FBLB 5K8UA 4HAXA 2HXYA 3AKDA 3BH7A 3NBYC 1KI4A 1ZRHA 4YMWA 3A1VA 3BAFA 3OZXA 3PUZA 1DTSA 4LWZA 2EYUA 2EVWX 2JATA 3LAWA 4WZBE 3UATA 3CZQA 1W0KA 4DSUA 2F43B 3U4QB 4Q4HA 3MSXA 2A5YB 3PEWA 2VA8A 1VIAA 4M1WA 1E99A 3B1XA 3O8RA 3JVUA 4F91B 4NZYA 2N42A 1X6VA 5CIWA 3QPWA 3TUIC 3H2YA 4J0QA 1N0UA 1OW3B 1DELA 4Q1EA 1G3UA 5HTKA 3NKVA 3U4QA 2B7CA 1RIFA 2OBMA 2ZUCA 1P6XA 5G53C 3LBIA 3OAAD 5FTNA 1XMJA 2C99A 3I32A 2HYDA 3HR8A 1RC8A 2O52A 3OHMA 3R8CA 3PVSA 4EPXA 3GEHA 4RZ3A 4BFYA 5AUPB 3KFVA 3SFZA 2ZRPA 4AKGA 3ZQJA 1Z0AA 2IYSA 2ZUDA 4RD2A 3GJ0A 1G8YA 1P72A 1G19A 3LFUA 1T3HA 4PQFA 1P2SA 4OKSA 4B33A 2DHRA 1NBMA 2WKPA 4BLSA 4ILEA 5AJVB 5E4FA 2AKAB 3LA6A 5A4JA 4MRSA 4BUJA 3O8DA 1I2DA 2DFLA 1R8SA 2ZR9A 1KO1A 2P67A 4B47A 3CB4A 1YR7A 2GJ9A 2WJJA 4LY6A 4TL6A 2XTNA 4ITRC 4NBSA 4LYAA 3PIRA 5HCIA 4BQSA 2Q3MA 3TW4A 5AR1A 2FNAA 1YE8A 3B78A 1AM4D 5EP3A 3UIEA 1JNYA 2ZI4A 4CEHA 1SXJD 4MQBA 5E3HA 2EWWA 5TARA 2JAQA 1LFDB 5DHAA 1QHXA 2JLQA 4E5UA 1BMFD 1OFIA 4A1FA 2P5SA 1SHKA 2VHQA 2ZRCA 4NPHA 4HAUA 4N0DA 1OXSC 2GCPA 1K5DA 1TF5A 1CXZA 4KBFA 1KSFX 1XX6A 2VTKA 3LX8A 3ZIAD 2FX3A 2YWGA 2ZI6A 4GL2A 2GNOA 2QMEA 1AQYA 1XD9A 3KQKA 4A4DA 3OFNA 3GFOA 3L0SA 3DZ8A 4XIGS 2C8VA 2ERYA 1X8LA 2IYRA 2OZEA 1S1MA 2WSMA 4XTCS 1HV8A 4QXAA 4XD7D 2XZPA 3DPUA 2IA5A 1AZTA 1G5RA 1GNPA 1YU9A 3TLXA 4C0KA 5EZ6B 4FI3C 2Q0HA 3EG5A 5KDDA 1DG1G 2GCOB 5JEDA 2SHKA 1Z0FA 2FEOA 3GLFB 1KI7A 3I72A 2ZS8A 3MWLA 3WP1B 1BH2A 1SZPA 3L82B 4NCKA 5BYJA 4DLXA 1MOZA 2ZIAA 3CLVA 4TT3D 1NIJA 3K9GA 1J70A 1Z07A 4M9SA 3LXXA 1TNDA 4PAMA 3VFDA 3FDIA 1W36C 1A1VA 2V7QA 4GP6A 4TLCA 2CLDX 2FMXA 2GCOA 3KTAB 2J0UB 3QPVA 3C7KA 1U0JA 2R8RA 4RD0A 2MSDB 1DS6A 3RLFA 4L4UA 3GMTA 1P62B 1N6OA 4A6PA 4ACBA 1U0LA 2XB4A 2BV3A 1P3JA 4TYNA 1Z63A 1R0WA 1F60A 1G3MA 1Q12A 3QXCA 4JZKA 4LPSA 3PXGA 3VU9A 2J0UA 4D4KA 5HPYB 3SR0A 4TLEA 1W2HA 2WJYA 3T1QA 3WMEA 5FOWA 2XJ9A 4QJ3A 4B3GA 1IY1A 1P2TA 3JZAA 4B3FX 3EZ6A 4TQ9A 4Q1AA 1YKSA 4B44A 4US1R 1GKYA 3AV0B 2G6BA 2GILA 4BLOA 1KY2A 1M7BA 3CX7A 4TTRA 2G0TA 2FPMA 5L3RA 2PL3A 2J0QA 4L16A 4QGGA 2VQSA 5KDLA 3U6BA 1FW6A 3QIAA 1T9HA 3QF7A 4UKDA 1Q0UA 3QKSB 1AKEA 1D2MA 3A37A 4HATA 4AURA 4DUGA 3KQHA 1E2DA 1PVOA 3GLHB 1KSJA 4MYHA 3BOSA 5LPNA 5GVRA 1Z6AA 1C9KA 4KLZA 4AWXA 3GJ3A 2GCNA 5FUVA 1M74A 4NYIR 1OIVA 4DEYA 3AM1A 4QBIA 2VP2A 3CNLA 5J4KA 4W5HA 3QKSA 3K9HA 1ZUIA 1UJ2A 1WB9A 4D0GA 3KUDA 3T1OA 1NVXQ 4F7WA 3HU2A 5HKKD 4DB4A 1DAFA 3GLHA 2IS6A 1PLJA 1KK0A 3A1SA 3P32A 3JZMA 4B32A 2OBLA 2H18A 4LBWA 5EXTA 3HPRA 3K0CC 1EFRD 3E5HA 1LS6A 3MWYW 1NP6A 4JVLA 2VP0A 4UNQA 1NIPA 2FZ4A 2ZR7A 1P61B 3OIUA 4CGZA 3U3OA 4D0LB 2WMNB 4Q4LA 3PEVA 5AUOB 4KSCA 2D2EA 1Z06A 1J90A 2ONJA 4MDFA 1KJYA 1FPMA 4NL4H 3IHWA 1ZM3A 3I5YA 3E1SA 1XPOA 4NYMQ 2QGZA 2EFGA 5AUNB 5ELXA 2VO1A 3HP1A 3I8SA 3UMSA 4JSYA 2VHTA 4URZR 1PUJA 4D81A 2OFWA 5EP2A 1YRAA 2JIZD 3GQBA 5IDVA 1D2EA 2WWGA 4UXJA 5CK5A 221PA 3WNBA 4C0AC 3NBFA 2ZRAA 4QJ4A 2YHSA 1CJVC 1SKYB 2QQEA 1N6IA 2HEIA 3EIHA 1AGRA 1F6BA 1G20E 1XD8A 4TL9A 2PT7A 2NO1A 1FNMA 1QHHB 2YINC 4H1VA 3FKQA 4BRUA 2Z4RA 2JCSA 1NLZA 1Z5ZA 3HYRA 4OI4A 1PZNA 1X8KA 4PPGA 2IXGA 1M2OB 1XEWX 1WA5A 2QP9X 3BD9A 4IDOA 5F98A 2WJHA 4EPWA 4V0MA 2AK3A 2G77B 4LHZA 5GVSA 4GSYA 1Y3AA 2IL1A 3BGWA 3OIYA 5IF9A 4FMCB 1XPRA 3ZS9A 3FE2A 1CF4A 1QHHA 1NLFA 3RWOA 3CPEA 1OKKD 3Q5DA 4O25A 2O0HA 4PPQA 1ZIPA 1P2UA 3CF0A 4ZI2A 4NCNA 3FFAA 1QHSA 1H8HA 3EWAA 4F93B 1ZNYA 2OHFA 3U3RA 5DNYB 2CL7X 4LI0A 2OESA 2ZRDA 3U7HB 1W5TA 4G01B 2Z0MA 5CYOA 3GLIE 1ZVQA 2QGNA 1TL7C 1HEIA 3ICEA 4RD4A 1ZD8A 2CJWB 3BE4A 5CLQA 1UM8A 3ZGXA 2H57A 3RNLA 5CDFE 3THWA 3DMNA 4F4IA 3AVVA 3DKVA 4DB2A 4OHVA 4OJQA 2BEKA 2Z83A 3W3AA 1VECA 5AJXA 1GSIA 1Z28A 2ATXA 5KO2A 4BFWA 2QMOA 2J0SA 3EAQA 4FMCF 2J7PD 2A5DA 4RD3A 3TUZC 1KAGA 2CJWA 3DKPA 3EIEA 4P0TA 1COWA 3UMRA 3WXMA 1A5TA 2QTHA 4XOIA 4DHEA 1HY3A 1XTQA 2FFAA 2IS1A 4TZ0A 1W36D 2RGBA 1AN0A 3I4LA 2QE7A 4Z54A 1OH5A 1TQ6A 2ZYTX 4D4JA 2XNSA 3L2OB 1PLKA 1ZD1A 2K5UA 3KKQA 2ZETA 2WKQA 3FGNA 1JBKA 3WHLA 1E0SA 4RSGA 4V0KA 4C3ZA 5FUWA 4XVQA 2JASA 2O0KA 1XBTA 2BJWA 3AP1A 1EFTA 1HE8B 1OYYA 2UVQA 4EFNA 2XNDA 2J5XA 3H1TA 1YZQA 2W0MA 3AKEA 2W6JA 4QOSA 4US0R 5JSZA 3AVWA 2CMKA 1OV4A 2AWOA 1ZW6A 4PC6A 2F9MA 2P6NA 2JLVA 2WBLC 3WRYC 3RYTC 2WJVA 1U9IC 1H65A 4B3BA 1RW4A 4JLNA 2J9RA 1RRFA 3FTQA 4ZIRB 2F1JA 1HUQA 3CX6A 3U44A 2WWXA 2NQ2C 2BBTA 5BXQC 2ZYUX 3AGPA 3K0AA 1YR8A 4HLCA 3LY5A 2W2VA 1WGWA 1O87A 5SZJA 5KSYA 1X86B 5KYKA 1EK0A 2VP9A 3EW9A 4HAZA 3FFBA 4M9QA 4ZIRA 2C96A 4PR0A 4IVRA 4QRHA 1TEXA 2RGDA 4BLQA 3RANA 3CWZA 3A58B 4R2HA 5BN4A 3GLGE 2EU8A 1GNRA 3OE7A 3SYKA 3MLEA 3BWDD 4BLPA 2WKRA 4JLKA 4I1OA 4ASUA 4OQFA 1R0YA 4MDEA 4PZLA 1KI6B 2GA8A 2ZTSA 2V8OA 3KB2A 2B7BA 3TVDA 3BH6A 2WIBA 2ZANA 2ZRLA 3CF2A 3THYA 2ZRBA 4KAXA 2V6JA 4RKFA 1SVOA 2W6IA 4G3XA 1OXTA 4QHSA 2GVZC 2PT5A 1DAIA 2R6DA 2ZRHA 4X8MA 5FPKA 4QL3A 5J4LA 1E2PA 3RRZA 4HAVA 2HLDA 4PC2A 1P60A 1JR3D 3G0HA 1KYIA 1MH1A 3IBGA 3K70B 3W8NA 3QOFA 1E2NA 1W4AA 4JS0A 4KITB 2G9NA 2BVNA 1NJGA 2DFKB 2ZR0A 3UK6A 5KSOA 3FKSD 3ASZA 4NYJR 3MGCA 3I5XA 1OH7A 4CIDA 5B30A 2X8AA 3S1AB 1EX7A 3KKMA 4DCUA 1G21E 3RRYA 2N46A 3K0CA 2QA5A 1CJUC 2ZREA 2VSOA 5FL7D 4PTLA 1ZUHA 1L8QA 1P2VA 3THXB 1W7AA 4B76A 4A15A 2CLCX 2V9PA 4F4JA 2OILA 1E6CA 1N6LA 1WF3A 1KTVA 2QPTA 2X2EA 4LV5B 4AKIA 1ZNXA 3A1WA 4BFSA 1M7HA 3K09A 4NONA 4FCWA 4PHHA 2CBZA 5EZ5A 2IBMA 2YVUA 2NTYC 3U61B 1FOEB 2JDID 4IFBA 4XH9B 3BFKA 3KXKA 2NO6A 5TVKA 1GDDA 2ZROA 3RVBA 4LBYA 3TBKA 3U5ZB 2JJ2A 2QT0A 1N6PA 2CHVA 2OSBA 3GD7A 5L8VA 2RGGA 5DN6A 3THOA 5JI3E 4CEJB 2O8FA 4I1VA 2D74A 2NGRA 1OYWA 3ZD6A 1KDRA 1PUIA 1S1CA 2OAQ1 5CJPA 1E2LA 2CE2X 3QNUA 2BEJA 4Z8XA 1CIPA 4AKEA 5J4YA 2JGNA 1ZP6A 4DWJA 3AVTA 4CEJA 3LVQE 5TDHA 2KB0A 2XTMA 4FMBB 1BKDR 3ETLA 3H86A 4DT1B 1G64A 1XZPA 3I3SR 2ZVPX 4TSFA 1NN5A 4NU0A 4Q4JB 2OCAA 1DAHA 1E2HA 1KSHA 1YZTA 3I73A 2A78A 2VLIA 2QP4A 5K8LA 3W5JA 2V54A 4A0HA 1JEEA 3SE0A 1R6BX 2OAP1 3QXXA 4D4MA 1AS3A 2WOOA 2CHQA 5BWMA 3TAUA 4D4LA 4M1OA 1X1SA 3F8TA 2BWJA 2Z6VA 3VNVA 4OK5A 3K9NA 4XWKA 2YV5A 4HAWA 3FHOA 1Z6YA 2FN4A 4B35A 2OEPA 4Q4JA 4TWZA 5H70A 4BZXA 2EFDB 2BC9A 2ZPTX 1NJFA 3QPUA 2E9SA 4NP6A 1EXMA 2ASEA 2WWWA 4LHWA 3T12A 1A82A 3VQTA 4C2TA 2E1RA 1LF0A 4RY2A 4TQUS 1TTTA 1QVAA 4BEJA 1CRPA 1UBCA 2RGAA 3SOPA 3N2IA 2QU8A 2GK6A 3LNCA 2IWRA 3X1XA 5KNBA 4A9AA 5J47A 2WPDA 2C9YA 3B1ZA 3L8ZA 1L2TA 1W4RA 1NVUQ 4JLDA 4JKYA 4M22A 3BC1A 4JIMA 3ZVNA 2JLUA 3TK1A 4TZ6A 3HU3A 4ESVA 2O5VA 3LW7A 3TNFA 3WYAA 1US8A 3SYLA 5L3SA 1JR3E 4AG5A 3WYGA 2QY9A 1CRQA 4P4UA 1OF1A 4LGMA 4JLPA 5AUQA 5IK2D 1IM2A 5FBQB 3RC8A 2ZXUA 4IEIA 1OB2A 3UPUA 1NG1A 4C7OA 4RCYA 2A9KA 1T8UA 1U9IA 5AWFC 1ZD9A 2H92A 3EA5A 3CRVA 3ADCA 3SBDA 3R9IA 1VYUA 3BFVA 1E4VA 4JVNA 3NBZC 4AC9A 4LHVA 4XWOA 4KHZA 1NY6A 4RD6A 4EPVA 2QG6A 2QM8A 4R2IA 2H17A 2WZQA 2IW3A 2ZRJA 1XDBA 2R6AA 2WWHA 3T5DA 3BFXA 1DAGA 5JHGB 5GJBA 3SYNA 2FGKA 2WWIA 1VG8A 1UADA 4IOKA 4OK6A 2P2LA 3QBTA 2D3WA 2CNWA 2ONKA 4TMKA 5J4VA 2FJUA 4A0RA 2I4IA 4FN5A 3X1DA 3NG1A 4F92B 4U02A 3X1WA 4KLNA 3FPAA 4G5GA 5EP1A 1A7JA 2WM9B 1QG2A 2A5FA 3LDAA 1E69A 1D2NA 1TADA 1GRNA 3DOEA 1W0KD 3R20A 5F2EA 4DBLC 4G5SA 4IVQA 2ZS7A 4HYYA 4LV6A 4BFXA 1TU3A 3E2IA 4KCGA 3TMKA 1D9ZA 4ZDKA 4Q7LA 1G8FA 1TQDA 3K0FB 2BM0A 2ZAOA 5G40A 2C04A 5A5GA 3R7WB 1FP6A 1XCGB 1GOTA 1KO8A 2V55B 1J8MF 3W9YA 1U98A 1E2JA 2Q9CA 5H68A 2QROA 3ZS8A 2FF7A 5HR5A 4IOJA 2BCJQ 3AF1A 4XJXA 3L8YA 3NH6A 4ZO4A 5FI1B 1AS0A 3W6NA 2V4ZA 1OPXA 1KAOA 1KJWA 1J7KA 1J8YF 3KXIA 4OI1A 5CM9C 1VYTA 3SJZA 1T0HB 3GJ7A 3K0FA 5JEEA 4B43A 2G0NA 2F43A 4TLBA 1NI3A 2JJ1A 4FCTA 4I81A 1KMQA 4RD1A 3QJYA 2H5EA 1L4YA 4B3DA 4XVUA 5EE3A 3DO6A 5H1YA 1KNXA 2C95A 1U8YA 2IUUA 1NBMD 3RS3A 2X1VA 1TUEA 3TRFA 5HZKA 4KXFB 1RPZA 2IXEA 2HCJB 3HWSA 3QG1A 2J59A 2WSSA 1MO3A 1XNJA 4PZYA 2ERXA 3RRMA 3T15A 4TL7A 3KQLA 1GFIA 2DB3A 2PEYA 4MYTA 3QXJA 4HZIA 2C77A 4PPFA 3NHAA 4IXMA 2W2XA 2GVDC 1W0JA 2J45A 2MMCA 1XCMA 2RGEA 3IUYA 4RVCA 3B7GA 4MKHA 4NYIQ 3RS4A 4YXWD 3P26A 1VHLA 5KPDA 1XMIA 5BYKA 3RABA 521PA 4JSTA 3C5HA 1Z6TA 4WZAE 1DO0A 1IAQA 2ORVA 2VRWA 2WAXA 4E07A 1DAKA 1UBEA 3AKYA 1KHTA 3BK7A 2J1LA 1GWNA 4Q47A 1VG1A 4WXRA 4IDHA 2J3EA 5JRZA 1G4UR 2HCBA 4LJ6A 3HPQA 4DDUA 2BDTA 1WE2A 1JJ7A 4DDTA 3GCGA 3W3ZB 1Z0IA 2C78A 2GZAA 3OFND 2D06A 4ERNA 5C1BA 4E09A 4C2UA 3B60A 1E79A 821PA 2XZOA 1XRJA 5JECA 1ZU4A 2VSXA 1P7CA 1ZBDA 2FPKA 5CM8B 4BASA 4PO9A 3TIFA 4EFLA 1E4YA 3V9PA 1NMXA 1Z0DA 3LRPA 2QBYB 1SXJB 4CF7A 2IEYA 3BXZA 1IN4A 4PSKA 5BN5A 1LNZA 1N0WA 1DOAA 4HUQB 1ANKA 1XFAA 1Z8FA 2ZQ5A 2YOGA 2CE7A 3ND8A 1N6RA 3N70A 2J87A 4Q66C 2C9OA 2PLFA 1GIAA 3ZDQA 2DBYA 3OESA 1YHNA 4D25A 2IYTA 1SULA 3TAHA 2V7QD 3C16C 2FSIA 3RS0A 4K81B 1X1RA 4XSHA 2IUSA 2IS2A 3NEYA 4EIWA 3CM0A 1D8TA 4HUQA 1KDOA 1Q1EA
chains in the Genus database with same CATH superfamily
2EX1A 4BN5A 2ES4A 3MRSA 1V0JA 2OP1A 2PKYX 3ZE2B 1D03A 1LM3B 3ENZA 1UK7A 3E81A 2DF8A 3AUXA 2AJ8A 3KTAA 3IA2A 3Q8XB 5COGA 3FPCA 3TQFA 5I7FA 3M6IA 1JKXA 1L7CA 1SXHA 1EXVA 2VXYA 1FYDA 4F4DA 1ZL0A 5JTUA 2G72A 2FPSA 3DDSA 5CDSA 4RMHA 3I1FA 3WWCA 2HU2A 2X0FA 1KZYC 3C6YA 1GZSA 5FBHA 3G82C 1LFAA 1YJBA 5BQOA 1XP5A 1FNBA 1KVTA 1JH8A 2B30A 1JQEA 5DHUA 3OEHA 1IJFA 3C48A 2WVHA 1TJ5A 4UAGA 5LQDA 1ZNWA 4V39A 4DV2B 2IXDA 4EJ2A 3LVBA 2ZM5A 4IOMA 1D6JA 3BWMA 4JQSA 1RWXA 4D41A 5AW6A 2EP7A 3G8CA 4ZDWA 3D54D 4HDSB 3WLOA 5GAJA 2DBVO 1UKEA 1VSQA 1UJCA 4OINF 1VL6A 1MTOA 1X42A 3PFCA 3P27A 2YC2C 2M6SA 2LR0A 4H16A 1GKKA 4QU9A 2Z58A 3IUSA 1V4VA 1O54A 1O9GA 1SUWA 2W7TA 1CR2A 5JAOA 3W0LB 2VYNA 3LF2A 4B75A 1TCBA 2JGMA 1EX6A 4QDXA 1G4WR 4BNWA 4RA9A 2GAAA 3QLUC 4Y30A 3I1JA 4L8FA 2YL7A 3PIIA 3CUUA 1DX6A 1KZ4A 2MSWA 5JYCA 1NJ6A 1PR9A 2GO7A 5CITA 2FN7A 3UH0A 1MRNA 3KQUA 4UAJA 3T7JA 3GGGA 4B8WA 4V0ME 4NYMR 1VLQA 1T5SA 4PR3A 2FPWA 2FSPA 2BGNA 2ICAA 2B0JA 4NTBA 1C2TA 4CLEA 1H8EA 2P9ZA 5L3QA 3AVPA 3QKRA 2P9EA 4ZAWA 3AEQB 5C32A 2NXEA 3ZVKA 2JFOA 3GGPA 1RWBA 1PK9A 4G41A 2IU0A 4P4TA 4YJFB 2NV6A 4K9NA 3WYFA 3LY7A 3KU1A 3L84A 2OC4A 1N9KA 1YZNA 1SVIA 2F90A 3WAGA 1LW7A 1QQ5A 4YJGB 2O1SA 1ZHTA 2GYYA 3P4XA 5KEIA 1CIJA 2ZLBA 1TX4B 2HLNA 1JPUA 1ZOSA 4AYXA 1UBOS 4HB2A 1A9PA 2WYIA 3GDFA 3FVQA 1L5NA 2PG3A 1FQWA 3P9KA 2CXNA 2ODTX 4E7OA 1MW8X 3DOOA 4WINA 4K8OA 3VR4H 3JD3A 1F8YA 3VRCA 2EW8A 5HM6A 4EDFA 2DLCX 1DINA 4G7HF 1XQ9A 1Y4ZA 3VR6A 3S5JA 1XQXA 5I01A 3I6IA 2VJBA 3MUFA 1UBMS 4AY5A 2XZLA 1JDVA 4YH1A 3I04A 1WPGA 5C4GB 4TQAA 2GZDA 3SX4A 4U7DA 5EUBA 3GODA 4CR6A 3PXBA 2J4DA 4A0FA 1V8ZA 5BOSB 1FJHA 5FI0B 3PLAE 4D3ZA 2AC4A 4RE6A 3D6HA 2QZ4A 3H9JA 1N1DA 2PKQO 3R6GA 3UWDA 3IGFA 4FWTA 4M87A 1TPZA 3PWZA 1RYDA 3OHPA 2VQEB 3FHCB 1Q1GA 4PYJA 5L6LB 4WTOA 5TMEA 3RCBA 3JRNA 3TEMA 1UMDB 2BFWA 1FQKA 2I7VA 1IPFA 4EYKA 3L7OA 2ZYRA 1BD3A 2OXCA 2E4UA 5AKZA 4B46A 5CCXA 3BA1A 2B3TA 2AHOA 2WPNA 1P7YA 3JWEA 3PENA 1RQXA 3D6VA 3KYCB 1W29A 2O50A 3Q88A 2I80A 4RXUA 2FWRA 2QRVB 1N6HA 1DJNA 1G0NA 5FOXA 2KYRA 2JRLA 3F8SA 1GUFA 1KF0A 4JI5B 3S2EA 1ISHA 2VHJA 4KVFA 2NAFA 2LE0A 5AM4A 1BFDA 5FR1A 3I83A 2ZUBA 5FLXA 3HKBB 3GZTB 5EMLA 3RS2A 1LTKA 1Q0QA 4EZBA 2HWYA 4ZKDA 4KVGA 2AJLI 4KIJA 5JJIA 4J49A 2ANCA 4NMWA 3PUKA 5H4HA 1X87A 2C4TA 2F17A 4C30A 4ZVOA 2WF6A 3M1IA 4IP0A 2M1XA 4DXAA 4DE5A 2E48A 1ECGA 1LWOA 4Q3EA 3W9SA 4BBJA 3LKDA 3LD9A 3P9RA 1PVDA 4BECA 2IHUA 4F5EA 3V7OA 1QJCA 2HNBA 2RGNC 2Z9DA 3WP0A 4QDOA 5AXCA 2PVPA 4Y67A 1UF9A 3VF0A 3RSHA 2WR8A 4GLLA 3F3KA 4AJJA 5MFPA 4Z0NA 3BXPA 5DHPA 1TVMA 1RXWA 4GFDA 4KVAA 4WA7A 4RANA 3TFQA 2FLWA 4KP7A 3RVZA 5D5PA 4FZ3A 4JZYA 4IAQA 2YOFA 3MT7A 5JQWA 3RRJA 1BSVA 4KWIA 4I8IA 5BUOA 5KTYA 1WV0A 2XXAB 4BDSA 4FLFA 3U2QA 4Q3BA 4R3WA 5TC4A 5T3YA 1X92A 1GR1A 1OVMA 4KPGA 1ZU5A 1M72A 1MO6A 4JI0B 3UK0A 2O3UA 4FZRA 5JR3A 4IF4A 2QENA 5DBFA 3VDRA 4DCPA 1N2EA 1G38A 3ZXYA 4G8DA 3NIFB 1CV2A 2WNIA 3B1VA 3WFZA 4ARSA 4ZVKA 4UOQA 1G7TA 3QW1A 3UJPA 4ZGWA 2JKVA 4A7PA 2F55A 3MJ4A 2BMAA 4F5YA 1ILWA 3AP2A 3UZUA 4CKZA 1MXFA 4G4IA 5JBIA 3ZCQA 2W4MA 2G80A 3AYZB 4NJMB 3HRHA 3THWB 4DLWA 4GICA 4WN9B 1BWPA 4PHTA 2A57A 3WGHA 3CINA 1UH5A 3ZWKA 1HMDA 3NNNA 1AMUA 1UC4B 3VHLB 2X14A 2AF4C 1ZZGA 4DFDA 2DTEA 3I4UA 2Q4EA 4P81A 5CRIA 1AUXA 3DBLA 4I2NA 4LIPD 1G5IA 2MR5A 1LPBB 3AJ8A 2MJLA 3JWJA 1T3GA 5JSZB 1WZ2A 2HD4A 3RRBA 3WQSB 4Y0VA 2GHQA 2VHXA 4FD3A 1CJCA 4DF3A 1IIBA 4FMDB 4HYQA 2XH8A 2GAIA 1G66A 3ICVA 2G36A 1I4DD 4MVJD 3CH4B 2JAPA 1U9YA 3F6PA 3JYYA 4XGRA 3UCFA 3S4YA 4N0MA 4IDQA 2AG5A 2UVDA 3D3NA 2ACEA 3KUKA 1JG7A 3DSRA 1E1QD 2BFBB 4RK0A 1RS0A 3TG8A 5AKKA 2Q9BA 2HNAA 2HZ7A 2XB2A 1X38A 1Y1LA 4HQRA 1UL1X 2D62A 3RVQA 3Q8MA 4B48A 4DJ5X 4BVFA 1G5QA 4LAFA 4TT8A 1WQ1R 3PHCA 4GGPA 2Z1DA 1U0OC 1JQBA 3T34A 3AU9A 1W44A 4IUBS 2EFCB 1KL7A 4YCBA 5DQZA 3K66A 4DL9A 1WM1A 4IGFA 3VYWA 4LYEA 2MYUA 2O8FB 1GZ7A 1M1YB 4TSRA 4WT7A 1JR2A 1BGXT 1JR6A 3T0GA 5IXJA 1T29A 3MJDA 4E3WA 4XLTA 3ZVMA 4O0LA 3C3KA 3W9BA 5C18A 3TM5A 3SZOA 3PQFA 5K6RA 1GY8A 3C98A 5LC1A 2P2SA 2PO5A 3BBLA 3LPNA 3FNGA 3V55A 4TLDA 4HDOB 3RVKA 1QK4A 1Z5GA 3BB3A 4LVUA 3AUAA 1GNSA 3PG5A 1E2EA 3BZUA 2OEVA 2IHVA 4S35A 3KKOA 2QN7A 3K6KA 3IDZA 3B6KA 3KZKA 4GMKA 1RRGA 5H81A 2H9IA 4QOIA 2OFFA 1UXGA 4MS3A 1QO9A 2PFGA 3GA5A 5DS4A 2F48A 2YXBA 3AQ4A 2QUZA 2ATEA 1RNLA 4TGLA 4O2BA 5C8XA 1XMPA 2JCYA 5ENZA 3W6UA 1TZ2A 3WJ2A 4UM8B 2YW9A 2WKWA 2X23A 2JARA 1SXIA 3LUKA 2W6QA 1YCDA 3EEBA 1QK5A 1B16A 4HB0A 3FHTA 1WB6A 1EK6A 1J2EA 4HX5A 1PT5A 3M4NA 5KBYA 2B1JA 2GAOA 1X7DA 3R5KA 1DV2A 4OJNA 2NO5A 3N8KA 2R7LA 3ISTA 4CM7A 4C4RA 3NBYC 3IXQA 1T2VA 3X1MA 3FCEA 4R1MA 1XQWA 3SM3A 2POQX 1QGZA 2H48A 4NZYA 3H2YA 4BPMA 1LPOA 2PRJA 1A4UA 1JKMA 2ZUCA 5FTNA 1QCYA 4KPEC 3EEOA 2XUGA 1VLJA 3KFVA 2ZRPA 2FOIA 4L7VA 1TU0A 5HF6A 4ZHQA 4X90A 5JZOA 2YW2A 4BLSA 2WZCA 2ZIWB 3UXEA 4B47A 2FPUA 2XTNA 1FNDA 1MVNA 3NTQA 5IFLA 2VT6A 4CEHA 4G0UA 4MYSA 5HFNA 1EVLA 4QDZA 1WCIB 2MT9A 1TF5A 2DY0A 4U9UA 4FVTA 1JHQA 5FZTA 2PZ8A 1SUCA 2R7AA 4QXAA 3DMGA 3DPUA 2P2YA 4MPRA 3VMMA 2VT2A 3CLTC 3UW3A 5EZ6B 3RU7A 3RLIA 3ZWBA 3SLGA 1I1HA 2ZIAA 3SDBA 1Y9JA 1Z07A 4JLSA 4B87A 2CLDX 1BWRA 1CDZA 2MSDB 1DS6A 4JHXA 4KR9A 3PWKA 3M3PA 4BLUA 1XROA 3G9QA 4D4KA 1T3ZA 2C1XA 1DBPA 2PD6A 2A0UA 4JSRA 2Y1OA 5TPWB 1KY2A 1QAQA 1B6TA 4ND2A 1OLSA 5KDLA 4LVCA 1VBNA 3HRIA 4ES6A 5CW2A 3VDMA 4O4LB 3FN4A 1C9KA 5GV7A 1YVRA 3C3DA 4BIMA 3EF3A 4AULA 5J4KA 1O6BA 3Q5GA 3JAMA 1RCUA 1U3GA 3HU2A 2HSEA 4N82A 1Z36A 2XBUA 3P32A 4F56A 4L4YA 3K0CC 4ZODA 1XVAA 4U5HA 3ZTZA 3DAGA 3VYVA 5KB3A 2PMEA 2FW1A 4WK2B 3L8FA 1ETHA 3FB1A 5C4IA 4MS1A 4ND3A 4O4LF 2WFLB 1PUJA 1UJNA 3AHDA 4Y1EA 2PTGA 3MB5A 2XE6A 3SBOA 2X5OA 1SKYB 3GYBA 3CYFA 1AGRA 3CW9A 1RIIA 1VMIA 5EJIA 4H1VA 1X8KA 3FDFA 4X60A 1XRPA 3TCXB 2JI9A 3U0CA 3W4YA 1DFHA 3TEJA 4I8XA 1CHNA 3FPEA 4M99A 3PXUA 1WUKS 4HFJA 1ZVQA 2J0WA 2JPDA 3A1EA 5LXTB 2Q1WA 4OBBA 4BFWA 4KMSA 1JWBB 2A5DA 2WFAA 1MU0A 2AC7A 4YJKA 3PBKA 1XTQA 2M6KA 1LQTA 1ZD1A 1SU4A 3UB3A 4MIEA 4GKAA 1TZCA 1XBTA 3H1TA 5FULA 1SD2A 3O10A 3EYAA 2WJVA 3P2JA 5LXTF 3VC2A 1N3LA 2LUOA 1WGWA 4QWMA 5SZJA 3BA6A 3S84A 1CNMA 4GLBA 3GLGE 2EU8A 3RTCA 3MLEA 1FBNA 1EH5A 4CQLA 2NADA 1HXHA 5CNMA 3CF2A 5A0TA 3THYA 4EVSA 1WXHA 4RKFA 4G3XA 4N8DA 1SJ9A 5TT1A 4PC2A 1CD5A 2BFEB 3OZSA 5KSOA 3LDFA 2XLOA 3GGDA 1YB7A 1G4US 3MJVA 1L0BA 5A06A 1GKLA 4MULA 1W7AA 3PHIA 2ZBFA 1N6LA 2G9RA 3OKFA 2AZ4A 1M7HA 1E7MA 3O0DA 2E4XA 4MI9A 1V8OA 1MGPA 3K09A 1ZPDA 3O1JC 1NQWA 3Q11A 4G7ZF 2I7DA 3KXKA 3EEIA 4R7TA 1ZH8A 3CQ9A 3P2EA 4LFCB 1E1CB 4XEUA 3VZRA 1ODKA 2XECA 2QDKA 4DWJA 2OEXA 1DEOA 3ASNC 3FHDA 4R05A 3KT6A 3OO0A 3I73A 4KN5A 1H2FA 2R7RA 1HDCA 1JEEA 1U04A 2CNOA 5CX4A 4D4LA 1H85A 1QFSA 4WZBB 4B35A 4Q4JA 5IARA 1NF8A 3LP5A 1VJDA 1X74A 3FTDA 2VZ9A 1XRRA 3V1KA 3SOPA 3N2IA 1VLLA 4N8EA 4Y6SA 4EGQA 2C9YA 4QO7A 2GM4A 2JLUA 2ID7A 4ABTA 1U0NA 4D8XA 1GA6A 4C78A 2X1HA 2W2KB 4Q7QA 2QY9A 2IH5A 4JLPA 5JISA 4V0SA 2H92A 4P0PB 1VE3A 1UKCA 2G08A 1BDHA 4MW8A 4KYTA 4L6CA 1W6RA 4EPVA 5I7EA 3S44A 4FYWA 3WLTA 5JHGB 2FDXA 4NX2A 2QMZA 2FGKA 2ZUFA 4OK6A 2CNWA 5J4VA 4JRZA 5HF5A 3ANSA 5BSRA 3DL2A 2FW0A 2A5FA 1E69A 2RHWA 1IOLA 2L17A 1TO1E 2FW6A 5A4KA 2GX6A 4Q24A 3E2IA 4Q7LA 1QQ3A 2ZAOA 4Y2TA 3GCXA 5J5VA 4ZVTA 3WLNA 5H82A 4YRZA 4TVOA 4DTIA 4L6AA 1NPDA 2B5VA 4CFZA 3LY9A 5AW3A 5EE3A 1EUDB 3JZ0A 1H6DA 1U8YA 2Q3DA 4CUJA 2X1VA 3KQWA 3BFJA 2I29A 4X00A 3H18A 1V3VA 5AK6A 3VTAA 3NHAA 3DHVA 4WK4B 3G2OA 1XCMA 3QIVA 4KQ9A 2HEGA 4DNXA 4GKJB 3EW7A 3H3XA 1A4IA 1DO0A 2B61A 1J0XO 1W1UA 4OIOF 3HPQA 3VISA 2JHFA 5HJ7A 1UC8A 4N5HX 2XZOA 5HRAA 2ZIXA 1QRTA 4EL0A 5BQFA 2EIKC 1PFUA 3B3JA 2QBYB 1RPTA 2P30A 1I5OA 3H75A 1FDOA 3PNPA 1QNLA 2NT4A 4U7PB 3TSYA 4WA8A 2IS2A 2W6MA 4MS4B 4UASA 3W8IA 2J3QA 1G20B 1E0AA 4MLPA 1T8TA 4OUKX 1GQYA 2RI1A 5KX5B 3JSEO 4JYMA 1W4CA 4UUAA 3F6SA 1Y1PA 2ORWA 4CMIB 3ZTMA 1XDSA 2PIDA 2YZSA 1W5AA 4BVKA 1KIAA 3CR7A 2QX4A 2QI9C 3WYDA 3VMFA 3OJ0A 1A76A 3LW8A 3EUAA 2FJ0A 5E2BA 1VKNA 4C4SA 5BUSA 1RYNA 3OQHA 4XYLA 5DCUA 4BZQA 4NOJA 1QGYA 2HJVA 5KX5F 1R0KA 2R1ZA 1UMCA 2WNHA 3H84A 4DSAA 1GNTA 4R32A 5IVKA 1Q17A 1D2CA 2VRCD 2J07A 1E0KA 3HL0A 1SVWA 3H2BA 4QXQA 2IYQA 3KVNA 3TVTA 1MRSA 5B55A 4QDUA 3QJGA 3QSGA 4ZYZA 4RFSB 1K27A 4L4XA 2PSHA 3DC7A 5HCUA 3KXLA 4JJAA 5D3KA 2G88A 3MAAC 3P96A 5C0OE 1W85B 2WICA 3T4UA 3WB9A 1N3BA 2V9CA 4MW3A 1FP4B 5IRCD 3R5JA 1VOMA 2EBHX 5EHHA 5FA6A 2QSZA 1E1YA 2DRIA 4ONSA 1AU9A 3W2WA 1DFGA 2XL8A 3FMOB 1CKEA 1DC7A 1Y5MA 5K4GA 3TBHA 3UJ8A 4J90A 2Y77A 5ALZA 3KYJA 3M6UA 3OQVA 1KI8A 1G3RA 4OUDB 1TC1A 3CZ9A 3DBHB 4PNPA 1GXSA 1J09A 1FX0A 1PT6A 1IU9A 2WY2D 2J9XB 4LGYA 1KI1A 3SHOA 1KU6A 2XAUA 2C2HA 2O4UX 1R18A 2PUTA 4OV6B 4G63A 4HQ0A 4EWCA 1G8PA 1A9XA 2C57A 1YA7O 1X2EA 1NURA 3NTUA 2DSTA 1FMLA 3TUJC 2BBOA 4ABYA 1K88A 2OB1A 2Y1FA 3KG2A 5SZKB 2G3YA 2PUBA 4IMRA 1H3FA 5GV8A 5MFZA 1KAHA 5G4LA 5K8IA 5AHWA 3U6KA 2DBQA 2J9ZB 4LLCA 2A84A 4YALA 1ZD3A 4QBHA 3DHEA 4K46A 4BRZA 4CKBA 2HB6A 2IZ0A 2YCBA 5FTLA 1FNCA 3KL2A 3KFLA 5F3WB 4BO2A 3OFSA 1B6RA 4CSAA 8ADHA 4IVPA 5BNTA 2Q1XA 2LIGA 1LGYA 2VPWA 4L95C 1S2DA 3U7JA 4WN3A 1WLSA 3HA3A 1C30A 1HDGO 3T7TA 4ZCSA 3ZWQA 2VDRB 1DWUA 2JLYA 5C7IO 1X0XA 3T3GA 2F8LA 2XUZA 4EB8A 4LWOA 1I7SB 2FMUA 4DGQA 4OD0A 3ND7A 1ZK2A 1BCSA 1IN7A 3K53A 4P22A 3SHWA 3WYNA 4HSEA 1E84A 3TR5A 3PC8C 2B4TO 1KFEB 2IKSA 4OQQA 4F86A 1V95A 3NC4A 3ZGZA 2VNAA 1EQAA 2YWEA 5K0EA 1HW1A 1BEUB 3B7PA 4S1TA 1PV2A 5J40A 2ODBA 2VP5A 4WFQA 1V8BA 2UUPA 5L7WA 4OQYA 3NJ4A 5E4YA 1IZ7A 4IQGA 5TNXA 4EHDA 3MBOA 3GN2A 2IYXA 2RAFA 2HIHA 4ZICA 4NKRA 1XQYA 3VU1A 3N53A 5G4KA 5EE9A 2LCFA 1XEXB 5AVVA 5HEKA 1L5LA 3P71T 5A0FA 3RJTA 4C3UA 4HTFB 3WVNA 1OXKB 3IE0A 1OTYA 3RDPA 4QEKA 5LLSA 1VRWA 4RLSA 2ZJFA 3RFCA 4QU0A 3JQAB 3GLKA 3QGMA 2F1HA 4KUEA 2V1UA 4HWGA 3WGUA 1Y9AA 3DCIA 5KDOA 3BCRA 1CY8A 5BQGA 4IMJB 2FUG1 5BSVA 4ZRMA 1KK3A 3MMPA 1HL3A 1DWPA 1OWMA 4ZXPA 4EHBA 1T3LA 1J23A 2AD1A 2YYAA 3VZPA 1UIMA 3R7WA 3DVRX 4QELA 2H59A 1GTRA 4R1PA 5A9SA 4XR4A 5HYVA 4WLOA 2YV3A 2P1AA 5EWLA 2Y0DA 2YZ7A 1OQAA 5SYAA 1U9CA 2F7SA 2NXJA 4ZZ2A 1P19A 3R09A 3CEXA 3JQGA 1ADFA 1MNEA 3V9AA 3AR7A 1CRLA 3EFOB 4Z7QB 1CYEA 1VCNA 3U1TA 2X7HA 3BB4A 1YE3A 4NULA 2J3KA 2FTKE 3TOZA 1O5HA 2IS4A 5EXSA 3K9LA 5IULC 1OBVA 1LBEA 4BQQA 1P77A 5T1DB 4IDAA 3B3AA 1HKHA 3QLJA 4Q1DA 4KPUB 6ADHA 5ECDA 1U3WA 3GXOA 4P53A 1U2QA 1CRWG 1FDWA 3GPIA 1QVRA 1RWQA 3QVMA 5LD2C 3ZC3A 2QZPA 2RGXA 2OV1A 1UXJA 2PCJA 1Z13A 1CUSA 1TQ8A 5EUQB 2H7OA 3OCJA 4F96A 5DM0A 1YFKA 5DNDA 2R8PA 3VU9B 3JPWA 3V5YA 4CG3A 3W90A 2DOKA 5ICMA 3PUIA 3ETGA 5GADl 1VL5A 3EWNA 3HCEA 2PLNA 1KMHA 1UFKA 4UM9D 1PJLA 5ALUA 3LDUA 3VTKA 1LUAA 3IHLA 3TRJA 1D1BA 2MSKA 1XTVA 3OKPA 3OHSX 4YCLA 3KX2A 3OPYI 4EA9A 2WVNA 3L9XA 2OA0A 1F38A 3SSNA 2GBLC 3QY9A 2ZSKA 4MKRA 3AGUA 4DILA 1UDCA 1VPDA 2UZ1A 4TQGA 3RIXA 2X6QA 4O6MA 2D1SA 4JR2A 5ESRA 3C63A 2JVIA 1A2OA 1Z5VA 4K03A 3ORFA 1Z47A 1I4WA 1WMEA 4MVQA 4H77A 5C1PA 3MCZA 4J7UA 1FNTc 2CBXA 4ROSA 3WL6A 4RETA 1U7DA 1JFLA 1T36B 4LC0A 1H6GA 1SCAA 3GVXA 4JXKA 2EXXA 2HQ1A 3NYQA 1F1BA 1SPXA 2VJDA 3IAS6 2HC9A 3Q2KA 1EVKA 4FCCA 1WEKA 3OLVA 2F3SA 5ALHA 5JYBA 2GDZA 4BATA 5LSAA 3PNKA 3V4PB 2EWMA 4UHCA 1P5JA 3UJ6A 2ZCVA 4UATA 3PCRB 1E6KA 2A9RA 5IXYA 3KK0A 1WULS 1E9AA 3E05A 1PZGA 5K4HA 4A92A 3DFMA 1HE4A 1JIXA 2J9BA 2XA2A 1U2GA 4J16C 1RJEA 5JJ5A 1ISMA 4OL9A 4JT2A 2I4LA 2OM6A 3S70A 4JIOA 2FSHA 1VHJA 2QSYA 1TFRA 5CTJA 2G5CA 4DBLE 5K0SA 4GWLA 1K3FA 2OO7A 2F2TA 3OEED 3FWHA 1X77A 3CS3A 4O0MA 4C4OA 1LQUA 3GEPA 1ZZEA 5TY0A 4LF5B 3BICA 3BN3A 1KVQA 3QV2A 5ECWA 2XOKD 4JJFA 1JPNA 3AVTA 1ZKMA 4B2IA 3VX4A 5CLGA 3LUPA 2O1XA 4CKEA 4BG0A 2O8DA 4CS7A 3SS8A 1XTIA 1O57A 3IESA 1X0VA 2Y76A 1YCGA 3G9TA 1RM5A 4HDAA 3PYLA 1U1DA 2H0RA 2R4UA 2Y1WA 4J2HA 4BEBA 5AC4A 5CVVA 3V7UA 1GUYA 2N3ZA 3L4JA 4FGWA 4WBXC 4U2BA 3BMQA 5EQJB 2XSZD 1PQYA 3AB3A 1EAYA 2ZSEA 3E5RA 2H7CA 4TTIA 2W8BB 4D92A 1AKMA 5EKUA 3QMVA 2WWVD 2QG9A 2HRRA 2GZ2A 1FYFA 3EZIA 3EY9A 1ZL2A 5K2OA 4D02A 4N7BA 5ALRA 4DMMA 4H7PA 4ND1A 2FQYA 5TE9A 1CY0A 1KEVA 1QHNA 2JDIA 3F67A 4J2OA 5KU1A 1R9JA 1BD4A 1QG4A 1GVNB 3HSSA 3ZBQA 3AG2C 3HVRA 1EKXA 1FFCA 3AHEA 4B2PA 3Q1LA 1N5OX 2BEWA 4P7FA 3WIDA 2QPLA 1Z7EA 2P6RA 3D0KA 2H1CA 4KOEC 3SEZA 1NI4A 3LQFA 3EZYA 4M7PA 1JMWA 1DHTA 3K0HA 1N7GA 4J0DA 1LDBA 2A92A 5JWHA 4U8GA 1XP8A 5EYPB 2I1LA 1E5TA 4PSDA 4KN6A 1US8B 3TGWA 4JEMA 4PINA 4YREA 3TLGB 3EXG1 3PHJA 3B1JA 3P2YA 4XWTA 2OE2A 1WB5A 3NFRA 4KQ1A 1PR5A 1JIJA 3K2BA 4CQMB 1OZAA 2EEZA 2HCFA 1U2SA 4TYYA 2OM2A 1ODFA 4MQEB 1FX1A 3UA4A 2GSDA 3LVRE 2CEKA 4RHYA 1F2VA 5FH9A 2CLMB 3T3EA 3ZY2A 4QM6A 4I3GA 3LC2O 2JLAA 4DEXA 4UTXA 1M0EA 2HT6A 4WHMA 4KTVE 3S8MA 1P39A 5FWXB 3SF8A 5CCEA 2HXYA 3AKDA 1V9LA 2R8ZA 2A67A 4K9SA 1HBJA 4PLTA 3DE9A 3IHUA 2AXEA 1B8UA 1R0LA 2EYUA 4DSUA 4X6LA 4BN4A 4PZPA 2DJIA 1UINA 3UJCA 3JVUA 4F91B 4NMHA 3U4QA 3M6WA 4C08A 1NJSA 2SBTA 4WLFA 1KH1A 1RC8A 3ABKC 3D5QA 5IU6A 3L4SO 1Z0AA 1Z37A 3EZXA 3C6XA 3JWIA 3WIVA 3O4IA 3V2HA 1DIAA 3G1UA 3W5UA 3ND6A 3CB4A 4TL6A 3ZHYA 4C21A 3TW4A 3I9OA 4GYYA 5EMHA 1EAMA 3H1GA 1SHKA 1YYJA 4EHLA 2C7GA 3DR5A 4XLZA 1HW2A 2FX3A 4GL2A 3BZWA 1SA0A 5ITZB 4CU2A 4BJHB 4B09A 5JSFA 2YVQA 1IZ9A 1EBFA 2AUNA 3EZHA 1DI0A 2IA5A 5DLPA 4CDMA 1E60A 2OFPA 5JEDA 1Z0FA 3AETA 2MOKA 4F8JA 2Q5QA 4TT3D 1N0HA 4AZTA 1R0RE 1BA3A 2HQOA 3BTSA 3HVJA 1VJGA 3RJ5A 3NVMB 5AVYA 2VDJA 4LTMA 3UH1A 2DWUA 2BV3A 3NQ41 1OW6A 2V98A 2XGOA 2XMCA 3C8GD 2XDQA 1O94A 1VLHA 3NHMA 2H00A 4OXYA 3A14A 4H0FA 2HUJA 3U6BA 2XWBF 2Z5LA 3QKSB 4AURA 4HATA 2DHQA 5JDIA 1MQVA 5GVRA 3JVEA 4AWXA 2XB8A 3KJNA 1OIVA 4W5HA 2XW6A 4HVTA 4G8BA 4D0GA 4CCYB 3Q7SA 3KUDA 3T1OA 4UCWA 1U0BB 3N24A 1YI8A 1Z5PA 3E8SA 3QK7A 1UBTS 3IBCA 1Z4PX 1F8XA 1LE2A 4MR7A 1IPEA 3E5HA 1LS6A 1E4EA 4UTRA 2A58A 2E5LB 2PQ0A 5AUOB 2ODQA 4MDFA 4NL4H 1ZM3A 5CNJA 3J81A 2W2NA 4JSYA 5A9RA 2PIAA 1CG6A 3ZXXA 3D4LA 4QJ4A 1XDZA 4OFZA 3DE4X 2VWQA 3ZV3A 1N36B 3EIWA 2PT7A 1N2OA 1QGOA 1PZNA 5A6BA 3S27A 2WJHA 1MA0A 1VBKA 3QMKA 4RA6A 1AEPA 2D5RB 1KYXA 3NIGB 4PLHA 2YVLA 1L5HA 2BFFA 2HMQA 4PPQA 5AC5A 5JCXA 4WEOA 2ZRDA 3R75A 3N39C 4C07A 3AOGA 2Z0MA 4JCOA 3NP7A 4LKRA 5BR7A 3ICEA 4RD4A 3BE4A 2H57A 3RSCA 3ZV7A 2P9YA 1BOOA 2J9WA 3MJTA 5AJXA 4YPFA 3INTA 3NATA 4YAUA 3UAYA 1DAOA 2NQ8A 1TWGA 4RK1A 2I4TA 1H2XA 4C3ZA 4DA6A 1X1EA 1EWVA 1SCJA 3AKEA 4QOSA 4HVLA 2IE0A 3WIBA 3QA3E 2E4WA 3F5DA 3TWOA 3U44A 1KH3A 3K0AA 2DUUA 2YYSA 1RKEA 1V9SA 4YL0A 2C96A 2C0CA 4N0PA 4R2HA 1H42A 1GNRA 2V4UA 1SCDA 3IURA 1RU3A 2I8CA 1HZZC 4ASUA 3SKVA 3TVDA 4JC7A 3UJBA 1OXTA 3DTVD 2A35A 1E2PA 1RFGE 1HEUA 3TO5A 4MV7A 4AG3A 4YCMA 2YXNA 3HB9A 2ZBVA 5T8KC 3K70B 2VRNA 5BQHA 3L1KA 4IGAA 2Y99A 3FKSD 4R40A 1OH7A 4BE9A 2EILC 3WLRA 1XDGA 3L0BA 3ZGVA 3UFBA 4WNYA 1ZOOA 3RGWS 1JFVA 4G0HA 4BNGA 1BJKA 1PS8A 2TSYB 1H5UA 4AKIA 4BFSA 4QAQA 1KFJB 3O31A 2C4UA 4PHHA 4KQXA 1MNDA 1WXEA 3U61B 3ZC4A 1OX4A 4XH9B 1OZGA 9ABPA 3D5EA 5H02A 3S1LA 1SM4A 2RGGA 1ID1A 2D74A 2IXMA 5HV9A 3RASA 3ZJ4A 1U7TA 1MVLA 1Y42X 2GM9A 4X6XA 3NNSA 4YX9A 1B8NA 4UU1A 1E63A 2BWJA 1ISPA 2BZ0A 3HBAA 2C2OA 4RAOA 2BC9A 4P54A 2FRVA 3ROFA 2DH6A 4Q3KA 2VA9A 4BNIA 4TQUS 2BFDA 3BD7A 1QVAA 1UBCA 4ZQHA 2VJOA 3NVDA 3RFFA 2NP6A 4JTAB 4M22A 3HY6A 1D8AA 1N3YA 2B0CA 2C5EA 3UHPA 4O2AB 2WB4A 3MRXA 4GI5A 1NWHA 5AUQA 4BNNA 4F3TA 4CMJA 1MMDA 2BDUA 3ATPA 2OOSA 3D3WB 1ONSA 1GCIA 1ZMTA 4CODB 3SKXA 4GYTA 3EQ9A 1EVEA 4JW1A 5KYYA 3SMVA 3NBZC 4AC9A 4J07A 2ZFUA 3R24A 3CJRA 4OCZA 2ADMA 2H17A 3I0NA 1XDBA 2WWHA 1RE1A 1MAVA 2O2DA 1QOQB 4TMKA 3SG0A 4JLWA 3V7FA 4O2AF 3O38A 2HMZA 5AQEA 1XIVA 4AIRA 3DOEA 4I5IA 2XCOA 4G5SA 1TU3A 4BNYA 1DIOB 4ZDKA 2ZXWC 2VUIB 3TJMA 2VJNA 3B89A 3V8EA 1RAGA 2FPPA 4A5SA 3JRTA 4I44A 2ASVA 4G1VA 2B94A 3B2NA 5CH3A 3X2EA 2GB4A 3VNQA 2ZDQA 2HO5A 4L4RA 5IJ0B 2J59A 2DB3A 1KWGA 4IXMA 1EA8A 1R15A 1OROA 1L3BA 3ZWDA 3NP9A 1N2BA 2ZSHA 1RHKA 2WA2A 3WKBA 4MHTA 3TJ6A 4DADA 4S05A 5I9IA 4E2YA 5CH8A 3LKZA 4K9RA 1HDZA 1WE2A 1QDLB 2BF4A 1X9GA 4DREA 3NIWA 3R3XA 1HE3A 1H1TA 1Z0DA 4HDNA 3EXFB 1OLUB 5HGXA 1YA9A 1AXRA 3GRPA 2P75A 3TQIA 5EZQA 4QX6A 3GFRA 3N70A 3ZDQA 4YCJA 4EB3A 4HUQA 3WGJA 4P98A 3HKDB 4M1SA 2HSGA 1BCRA 3TAXA 1PGQA 3ZCSA 3DWWA 2V6IA 1IG3A 1PZFA 2WABA 1LZLA 3LT1A 1TU4A 4EJSC 4DR1B 5F4ZA 1Z83A 2WJPA 4YPVA 3VPBA 5JAIA 4FZ5A 4ZVSA 3RSFA 3ANYB 4HCJA 3EISA 4K0DA 3ICCA 4AXBA 1U81A 2VS1A 5FO0A 5DM60 1SCUA 2Q3CA 1ZQ9A 5CDFA 3GRZA 3NGXA 4ZAVA 2JHAA 3KZCA 1U0SY 1T43A 2EOAA 1Q7BA 4NE2A 3C85A 5AVWA 3TJZA 3TKLA 4PLFA 4C6HA 1UZMA 4GXNA 4AKHA 5E95A 2FPXA 4GMXA 4S1OA 2ASRA 1E9EA 2PL5A 4M0PA 1UBKS 2CLHB 1PJ8A 3T9EA 3UQYS 3SIRA 2SCUB 1Y8CA 3E15A 3HJHA 5EOVA 5ER6A 5JT4A 3ZV4A 2YQ5A 3GMIA 4YJ3B 3U5SA 3G13A 2PSDA 2XS8A 1FE8A 3D0RA 4MARA 4KXLA 5HJ5A 5C8YB 4MV1A 4X7RA 3F1LA 2P7IA 5DHQA 2QN3A 2F3PA 1Q2XA 3PNLA 1UP4A 1CGOA 4PPYA 5EZSA 1K05A 1WS6A 2RONA 3ZWXA 1MXHA 1G7SA 2KPOA 2Q3LA 1KO7A 3TJRA 1M5TA 4YJ3F 3IHKA 5E3JA 5TSDA 1CUUA 5HQTA 1SH7A 3V8NA 2IY9A 3TSZA 5D7BA 1N34B 2NU7B 1VG9B 5C8YF 3ZZNA 1EP1B 1NVBA 3MINA 2CY0A 2EPOA 5AKEA 4IDEA 4ND8A 2FZ5A 1LLCA 1ZM7A 3KSMA 5HIAA 3SC6A 4ARIA 2ZPUA 4XDYA 5CB6A 4XLPF 1BXKA 2OBXA 1RHQA 3LAYA 5JV5A 3F71A 4D9JA 3ZHVA 2CLFB 5T6MA 2HFKA 1XKQA 2WG0A 3PR3A 2COEA 2HA4A 4GOOD 1M2WA 4YMTA 1IVSA 4I55B 4GZMA 5L0DA 4JKOA 3TLAA 1GPKA 1UZUA 4FBLA 2WAMA 1CUEA 1DVRA 4AMGA 3ZDYB 2F8TA 1JL3A 4CMCA 1G4AE 4UMEA 2V8BA 2XNCA 3OT4A 2GT1A 4GP7A 3RTGA 4LWQA 1DG3A 4M2LA 4HLUC 4H1WA 1QU2A 4C7VA 5TJ5E 3E48A 1E64A 2DFTA 1JHRA 2QPAA 2E49A 3QW2A 4I55F 2SECE 1JG2A 4IO1A 5HQ3B 4CMHA 3O1IC 4FMDF 4KZPA 3CIFA 3KSZO 5DYGA 4PO1A 3O3CA 2H7BA 1EGAA 1P7WA 2PSEA 4ENVA 2WVAA 4Q7MB 2XVAA 2J5BA 1JR3A 4TKMA 2I3GA 3QVZA 1FZQA 3U60B 2WHYA 3GA0A 2JFFA 2I2CA 1WOMA 4TL8A 1RQLA 1D0SA 1P9WA 3HGQA 4LQ4A 2X0RA 3QYJA 4M1TA 3ZEAA 2B2XA 3LQ4A 2R25A 1Y34E 2GXQA 5CA0B 1YCFA 1BS1A 2QRNA 1KP9A 2POCA 3BJMA 4ZVMA 2JCXA 2FWJA 2BMWA 1WUJS 1H0HA 5E6RB 4HNHA 1THTA 4WMLA 4O2LA 2GN1A 5CA0F 4FKZA 4H27A 4ON9A 4R51A 4PAOA 1DC8A 4QHTA 3Q0EA 1CUFA 4CIVA 3UWMA 5JCJD