4AK9A

Structure of chloroplast ftsy from physcomitrella patens
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
308
structure length
302
Chain Sequence
SQDPDIQLLFSGFSKTRENLAVVDELLTYWNLDESESILDELEEVLLVSDFGPKTALKIVDTIRKDILAGRLKSGPQIKEALKKNIFKLLTERVTTTELQLGNSRPAVLMIVGVNGGGKTTTLGKLANRFKKEGVKVLMAAGDTAAAGEQLEVWAQRTGSEIVMAPRPAAVLSQAVRRAVEEDFDVVLCDTSGRLHTNYNLMEELRGCKRAVSKALSSAPNEVLLVLDGTTGLNMLAQAREFNQVIGVTGFILTKLDGTARGGCVVSVVDELSIPVKFVGVGEGIDDLQPFDAQSFVDALFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution from the Prokaryotic to the Higher Plant Chloroplast Signal Recognition Particle: The Signal Recognition Particle RNA is Conserved in Plastids of a Wide Range of Photosynthetic Organisms.
pubmed doi rcsb
source organism Physcomitrella patens
molecule tags Protein transport
molecule keywords CPFTSY
total genus 119
structure length 302
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ak9A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ak9A02
1JR6A 3GD7A 1F2UA 3PXGA 5CB6A 4O3MA 4KI0A 4QGHA 2N1BA 3TUIC 3U6BA 3KKMA 4LYAA 3EARA 5JECA 1KI7A 2DBYA 5DYIA 4OI0A 1MO6A 2A5DA 3DL0A 3NWJA 1KK0A 4ZDWA 4HB2A 1ZIOA 4WXRA 2BVNA 2ZE8A 5CJ2A 3RC3A 2D7CA 4B48A 1P5ZB 1HT1E 1EX7A 3OFNA 4JYCA 2VHTA 4PQFA 4RKFA 1Z08A 4W5JA 3NBXX 4BECA 2HYIC 4EPTA 1W7AA 2WMNB 2NO9A 3M1IA 3SI7A 1VHTA 2GAAA 3I73A 2REXB 2ZETA 3B8HA 1KI2A 2J3EA 2HLDD 3I8XA 5E95A 3WBJA 1JAHA 4QBFA 1C1YA 2BEKA 5P21A 2IYQA 3CM0A 4U02A 4N0DA 4FWIB 1TUIA 4R2IA 3SFVA 4LV8B 3SHWA 4URUR 1ELOA 2EVWX 1W44A 1TADA 4M1MA 3EPLA 2GVDC 5UKDA 1JALA 5FPHA 3K70B 1E2DA 1G9XA 4NYJQ 1KK3A 3S1AA 4FINA 4IRUB 4IXMA 1SXJE 4RD1A 2W2XA 1FP7A 2OO7A 5FBWB 4HUQB 5C46F 1OPXA 3TW4A 2P67A 5LB4A 3Q72A 3KXLA 4B3GA 5J5CA 1DEKA 4E03A 1ZD9A 3B1WA 4JVMA 3WMGA 4BLTA 4LHZA 3HPQA 1W46A 2QU8A 1OXTA 1D2NA 2FU5C 1NG1A 2QTFA 3LW7A 4OI1A 1VDZA 3P4YA 1YZLA 5EE9A 5FOTA 1NN5A 3SBDA 1XPRA 1KDRA 5FH9A 3U3MA 2HCJB 4NBSA 2B8WA 5FOVA 1ZW6A 1U8ZA 2G3YA 1FFHA 2ERXA 2GXQA 4C2TA 4N0EA 3LNCA 4ON9A 4Q1FA 4Q00A 4R7ZA 2ZUBA 1U0JA 1MH1A 5C18A 4B35A 2O8BA 2R6AA 3OE7D 2B92A 2ONJA 5FL3A 4Q4HA 1V5WA 1LF5A 2YYZA 3CNOA 5EXXA 3E1SA 4KBGA 2J87A 4DLRA 3VKWA 1OH5A 2HDNB 1FMLA 1Z3IX 4QGGA 5DHFA 2QY9A 1ZIPA 1R8QA 2O0KA 1ZNYA 3QI2A 2VA8A 2WAXA 3GFPA 3K70D 1F3OA 5AK0A 1ZUNB 3BFXA 4JLJA 4HZUB 4L16A 4KSBA 4TWZA 2Z5FA 4TMWA 1S96A 2F3TA 4M21A 4Q48A 4FMCF 2C96A 4A0RA 2HT1A 1G64A 1WMSA 2OG2A 1CKEA 1E0JA 2GAOA 2VSXA 1DAEA 3GFOA 3SJCA 4O2RA 3Q9LA 3TSWA 3AB3A 3H1TA 3HDTA 4KBFA 3VU9A 2P0EA 1VG0B 2FFBA 3BBPA 4BFYA 3SU8A 2R65A 3K0SA 3CBQA 1M74A 2QT1A 4AYTA 3A1TA 1MKYA 4QL3A 2ZI5A 1E2KA 5A4JA 2QMUA 1XDBA 5JZVA 2ZSAA 4E5UA 2CXXA 3QEJA 4A0GA 2O52A 4DSOA 3FWYA 1VMAA 2GZAA 3EIQA 2GKSA 2NZ8A 3BAFA 4HB3A 2NTYC 3OAAD 3QF4A 2XEXA 3OIUA 4PFSA 4OYHA 3GLHE 4URZR 5DNYB 4M9QA 1OH8A 3PENA 4Q9JA 4BPBA 3VU9B 3WMEA 2LKCA 2WMOB 3KDSE 1XEWX 1KSFX 4GOKA 4FI3C 3I72A 1N6IA 2FOLA 3K0EA 1OH7A 3FPAA 5ANRB 2V3CC 4Q1CA 2F1RA 2WJIA 4HDOB 4NZYA 1KJWA 4RVCA 5EE3A 2QT0A 1JECA 2J0UB 3I4LA 5J4YA 3DMNA 2PEZA 3CRVA 1Q22A 2NG1A 1OJLA 3HWSA 4TMXA 5JHHB 4B71A 2DFKB 4I1OA 2C9YA 5CIQA 4DSNA 4DRZA 4OK5A 2J7PA 3SQWA 1OF1A 4GZLA 3B85A 3EWAA 1OXSC 4P32A 5J40A 4B3XA 1NBMA 4DDTA 4OHWA 1BO6A 3FMIA 4C0KA 1VIYA 1G7CA 1H8EA 3A4NA 4Z51A 2ZAMA 4MDFA 1FUKA 2BM1A 4PO1A 3AVPA 4C3ZA 1Q1EA 1AZSC 2ZRKA 4Z1MA 4LJAA 1E32A 5SZHB 2VEDA 4LJ4A 3W8NA 3BFKA 3BC1A 1E2EA 1DOAA 1ZM2A 4POAA 1F2TB 3NBFA 5D3MA 5JSZA 4RFVA 4MRRA 2L0XA 4DEXA 3LQRA 1Z07A 4DBLC 1NY6A 2IS6A 4BFZA 3KB2A 3H2YA 4DEYA 1OFHA 3GEEA 2ZSDA 4LOAA 4Q4JA 1KO4A 5TY0A 4ESHA 1IHUA 3D31A 4M1WA 4P31A 1ETUA 5JRZA 3AUXA 1YRBA 2D2EA 4KFSA 4L9SA 1IM2A 1II0A 1AM4D 1CRQA 1OE0A 1X8KA 4LCBA 1SXJB 1W5SA 2QBYB 3BORA 2GF9A 2QI9C 4OI4A 3SYNA 1EFTA 4Q03A 2AK2A 2WWXA 3OEED 3EC1A 2ODWA 4IDOA 4BRUA 2BBOA 2O8BB 2P6NA 3TLXA 4JT4A 4R71A 4V0LA 4KU4A 3VFDA 3AGQA 3HU3A 1FQKA 2WJJA 1KJYA 1GDDA 1KDTA 3OESA 4I1UA 3THXB 3W6OA 3W6NA 2JASA 4IHQA 1OFUX 4US0R 1XD2A 1RC8A 1T3HA 5KSZA 4LZZA 2QBYA 2QE7A 2C03A 4KYUA 1V43A 5BQ5A 3TUJC 3X1DA 2SHKA 1Y63A 5B64A 1T5IA 4LYHA 3WP1B 3MG9A 2JCSA 4UKDA 4PQRA 3P4XA 4GOXA 4HAXA 4URWR 3ZD7A 2PZFA 3TQCA 3QKRA 3P32A 2QQ0A 4HUQA 8OHMA 3WNCA 4XWKA 3ZVLA 1GKUB 4H1UA 4XOIA 2WPDD 2KSQA 2Z83A 3T5GA 4QM6A 1J8MF 1E2IA 2OCPA 2O0JA 5H1YA 4LYFA 1S2MA 4M9SA 3RS7A 2XNSA 1L7VC 2G1JA 2P5TB 1BMFD 3PFIA 3TKLA 3BB1A 3OF5A 2OBLA 4UQOA 5BN3A 5HCNA 1E79D 5JWRA 1WXQA 4XVQA 1E4VA 4E09A 3PV0A 4V0NA 5A5GA 2FN4A 2YKGA 1XBTA 2ORVA 2CEAA 3QKRB 2V8OA 5D3QA 5FBRB 3N2EA 5DH9A 1ESMA 2GCPA 1CJTC 4QBGB 4FW9A 2XXAB 1FX0B 3TBKA 3DVLA 2O5VA 4C0QC 1ZCAA 1T6NA 4PHGA 2ZS7A 2ZXUA 2OAP1 1E4YA 1M1YE 2V1XA 2ZRFA 2EQBA 3EA5A 1U9IA 5EUQB 2FE4A 3CPJB 2ZR9A 1W1WA 2GF0A 4B2IA 1I2DA 2QP3A 3UANA 4F91B 1CEEA 1KI9A 3O8BA 3OEEA 2QNRA 1RIFA 1GL7A 2WICA 1GM5A 3QNUA 3MUFA 4TL8A 4OHZA 4YMTA 4FCTA 1VYTA 3C5CA 4MKIA 1YR6A 1Z0IA 2XJ4A 1JXMA 4OKSA 5EE1A 3UWOA 3CKLA 2IEYA 3THOA 1RJ9A 3NG1A 3I5YA 1P60A 3OEHD 3THWA 4F93B 2GA8A 3FTQA 1QDEA 4DSTA 4GRAA 2EYUA 1SVIA 2PT7A 3RRZA 1DAKA 1W4BA 5HR5A 4BQSA 1UEJA 1ZD8A 2PX3A 1G20E 1MABA 3L8YA 1RKBA 1VHLA 3SFZA 3LA6A 2ZJYA 4CT5A 1KI1A 5G3YA 1WF3A 5FBLB 3A1UA 5K8LA 1CJMA 1N6RA 1QHSA 3L8ZA 4F4IA 3U4QA 2IYTA 3R7WA 3REFA 1G5RA 3SYKA 4S2EA 4DUGA 1GILA 2QM8A 3L82B 3DM9B 5KDDA 421PA 1EWQA 3DKPA 1KTVA 4MITA 5HKKA 2X2FA 1D2MA 3PUYA 3QKSB 1KSGA 821PA 3AUYA 2J9RA 4J0QA 2WHXA 1A2BA 4MYTA 3ECCA 4Q21A 4QRHA 3U3KA 3GCGA 1NVVQ 1Z6TA 3RWOA 2J0UA 3NH6A 1SKYB 3RVBA 1G4AE 1UJ2A 3U44B 4MA4A 4DLUA 1KKMA 1RJ9B 2FSIA 4B34A 1T8UA 4B6FA 3EG5A 5HTKA 3CR7A 2KE5A 3WRYC 1G19A 4JKYA 3AP3A 3PG5A 3PQCA 3R9IA 2VLIA 1GTVA 3PJRA 1MO5A 3VR3A 1US8A 1IY2A 2HF9A 3T1VA 1YE8A 1KMHB 2QPOA 2BM0A 2Q3MA 4BFUA 2EU8A 1EX6A 2P5SA 1M8PA 4II7A 2EYQA 2H8KA 3B78A 1R0YA 4EUNA 3GJ6A 1P3JA 4C0HA 1KKLA 4IVRA 1Z6GA 3LXRA 2RHDA 3ZZUA 3ZS9A 2KBFA 1N5IA 1S1CA 3FYHA 3G5UA 1VIAA 1AQUA 1U81A 2H17A 2R6DA 3B82A 5LD2B 4TLCA 2ZJOA 5DLQC 3CX6A 4DCSA 2RB4A 3V9PA 2EWWA 1YRAA 1XXHA 2C78A 2D4HA 3DO6A 1ZCBA 1E3MA 3JZAA 1KJZA 2AKAB 1KI4A 1MO3A 3K53A 3K70C 3GLFB 4A2PA 4MGKR 2A5YB 4JZKA 3AF2A 4DJTA 2P3SA 4QJ3A 3K1JA 1R5NA 1H8HD 2ZRJA 2YOGA 4TZ0A 4TL9A 2ZQ5A 4PC7A 5FUYA 1GVNB 4WZ6A 3VR2A 3OE7A 4BFTA 4JSYA 3O8DA 3RS2A 1IN6A 1GRNA 1TU3A 4K46A 1G3MA 1S4QA 3C41J 1ESNA 4H1VA 4RZUA 5KSPA 3WYAA 5AUPB 2NMVA 1YZQA 2JLSA 2V4ZA 3BS4A 3GLGE 3QUSA 3SZRA 2R2AA 5HKKD 4WXPA 1IY1A 2OT3B 4XD7D 4BFVA 5BN4A 4ZO4A 2QSYA 3Q85A 2BCGY 4JT2A 1KI6A 3B5JA 1GAJA 4NYMQ 4WAUA 3B9QA 5CM9C 2PEYA 4B3BA 1DE0A 2NIPA 2ZRBA 1GFIA 1T5LA 2NPFA 4JBXA 5CDFA 4ZDKA 5BW8A 2QENA 1PV4A 1H65A 4NCNA 5FR1A 2IYWA 3T15A 3SS8A 3UMRA 5KOYA 1NVUQ 1RRFA 5JWOA 2PJRA 3T61A 4W5WA 3R9XA 3IIMA 1YHNA 2NZJA 2KBEA 2YOFA 1ONBA 3QJYA 1E1RD 3RSLA 4ZCIA 2IXGA 1R8SA 3U5ZB 4C0SA 3KJIA 1AN0A 3LAWA 4D4MA 5C2JB 3DKVA 3KZ1E 2J7PD 4CGZA 4LPKA 5EP3A 4DB2A 3THYA 1IXSB 2IYXA 3IUYA 4TMVA 2WZQA 2K5UA 3SQXA 1QBKC 3MJRA 4EDHA 4QOSA 1VCIA 3OIVA 2D2FA 3AVTA 2FNAA 2FSFA 4PSVA 1X8JA 3QVVA 3G0HA 1ZM9A 3ADBA 2FF7A 4KODA 5EXSA 1AGRA 3SYLA 3ZGXA 1KO5A 1W0KA 3ZVNA 2FPKA 1R2QA 1QHHB 3BB4A 2EFDB 2HT6A 3GJ7A 3OFND 2ZJ8A 4OQLA 3T12A 4UNNA 4LJ5A 5F98A 4Q47A 2FSGA 3GJ8A 3NEJA 3THYB 4PPNA 2IBMA 4JKIA 4OQFA 2J0SA 4YMVA 4QHSA 5KHOC 2PJZA 4HLQB 2FG5A 1MT0A 2FA9A 2R6CA 3T06B 3QSYA 4IFEA 4AKIA 4G5OA 5JSZB 5DSZA 3FDIA 4RJLA 2D74A 4HLDA 1MO4A 4Q4LA 1G8GA 1VG9B 4RD0A 1QHYA 4HLUC 3D3QA 1JEDA 4OQXA 1Q12A 3ICEA 1NMYA 4A92A 2EFCB 2RGDA 1RRGA 4Q66C 1N6LA 2ZI4A 4A8JB 3QY0A 4DVGA 1XXHB 2F1HA 2MSCB 1AJEA 1S8FA 2CNWA 4IW3B 3TVDA 4H9GA 5KTYA 3ZIAA 1CP2A 4IDQA 4EFLA 4NMMA 5JCPA 2FZ4A 1G1MA 5F2EA 3UXMA 5E7MA 3LDAA 1KO8A 1FOEB 1E2PA 1DAFA 1RRPA 4I1SA 3FFBA 4ZIRA 4CIDA 4KYIB 2FFHA 2W6JD 3PIRA 2GEUA 2OBMA 4BE7B 2ZI3A 1GKYA 1XD2B 4MKGA 1XMSA 4FXPA 4NYMR 3THXA 1SHZA 1Z47A 2IT1A 2OILA 2G77B 4QBIA 4HAWA 3NXSA 3QF7A 1DG1G 3WY9A 4DKXA 1G6OA 3CIOA 3O8CA 1M7BA 4AYWA 1MABB 4F7WA 3CO5A 1KO1A 3IDQA 2ONKA 1X86B 3IPXA 2QRZA 4JYBA 1RZ3A 1NNEA 3H84A 1L8QA 3PCRB 1MRNA 5G3ZA 2J5XA 2CJWA 3WYFA 4UXJA 1G16A 3I8SA 4OI2A 1IJEA 2G1KA 2V6JA 1CR2A 3TK1A 1S3GA 1VCNA 1WBDA 4MDEA 4IJMA 4NYJR 1WGWA 3U3JA 2RGXA 3L43A 1NSFA 3H86A 3NIBA 4Y0VA 4IVPA 1S9HA 5HZHA 1KIMA 121PA 1XU4A 5FFMA 1XZPA 2D62A 2DPXA 2BJVA 4D6PA 2BMEA 2G88A 3GQBA 4GNKA 1B23P 4ZCLA 1KMHA 2A7QA 1CS4C 4W7SA 1ZBDA 2YZ2A 2VL7A 3F5FA 1VTKA 4RD3A 2GHIA 2RMKA 1T0HB 4Q18A 4TLDA 4WVFA 3BJIC 2ZS8A 4TLEA 1HT2E 4P4SA 4Z8XA 5G40A 2QAGA 3TNFA 4BUJA 2DFLA 2IXEA 3QXXA 5TMPA 2BV3A 4ZI2A 2XSZA 2IF0A 1RRCA 4RD2A 4P4UA 4KITB 4NL4H 4QFMA 4A2QA 5GJWC 1II9A 2OBNA 1YVDA 2WIAA 2FJUA 3P1JA 3AVYA 1SXJA 1NKTA 2GXSA 4RSGA 5KPJA 1TUEA 4NE2A 4YC7A 2BMDA 3B1ZA 4MRNA 3GLIA 2YWHA 2A5JA 2C95A 2WWIA 4M4SA 4YMUA 3AKYA 1A1VA 1UAAA 2XB2A 1IOZA 3OZXA 5GVRA 3EIEA 3QPVA 4Q9LA 2Y8EA 2WSSD 1YR7A 4XVRA 1XMIA 2IUTA 1AS2A 3CPHA 4HUTA 4JJZA 4DCNA 2ZYUX 4UNRA 1AZTA 1E1RA 1T3LA 3DOFA 5JJIA 2X1VA 4AI6A 2XITA 4A8JC 3MWKA 3MWJA 2FPMA 2AR7A 3GPLA 3K0FB 5AJYA 2DWOA 4JBYA 1CF4A 3CPEA 5AUQA 4ITRC 4DLWA 3IGFA 5JI3E 3CNNA 3KTAA 4LUCA 3ND8A 2F43A 3MAAC 2VHUA 5CK4A 4BEBA 3AF4A 4GSYA 2NGRA 3KKPA 3P26A 3KQLA 2WWYA 2R62A 2WJHA 1E9DA 3TR0A 5DI9A 4L9WA 3CW2A 2PL3A 1N25A 2JLYA 4LX0A 1QHIA 1T0JB 3SNHA 2ZSFA 3X1YA 1HV8A 4EQ6B 4D0NA 3LRPA 1Z29A 4A15A 2EFEB 2RCNA 2NO0A 1Z28A 1M7GA 1SVWA 3A58B 4TSFD 3LQQA 3SR0A 2JLUA 2XTNA 4ZCMA 2FX3A 2JLRA 3LWNA 4JLNA 3OIYA 4W5HA 3BIFA 5J47A 2GCOA 4AURA 1U0HC 1X1SA 3BK7A 2VIIA 2OXCA 4V0MA 3VQTA 3QXHA 2XTZA 3FGNA 5KDOA 1PLJA 1NF3A 3X1XA 1FQJA 1BYIA 2F6RA 2ZYWX 1BMFA 4ZIRB 2FPLA 5EP1A 3LFUA 2IYVA 3RANA 5JEEA 4RCYA 2CL0X 3DHWC 2BMFA 1U8AA 1DAGA 1BS1A 1UKZA 1AA9A 1TQ2A 4US1R 1J8YF 4Q1DA 4EFNA 4LJ9A 3KJHA 1R4AA 3P20A 2CVFA 3AVUA 2O8EB 4HSEA 1L4YA 3BH7A 1W0JA 4GL2A 5EE0A 3UG7A 3DDCA 2ZUDA 4TT3A 4V0OA 4EPYA 5BN5A 1MOZA 1E2HA 4FIDA 1GSIA 4ABYA 2ATXA 1SVKA 4YXWA 3EPKA 1Z0JA 2ZU0C 3ZQ6A 1J70A 3ADDA 3IO3A 4Q7JB 1Y3AA 1COWD 1KZ7B 4B32A 4DUGD 5IF9A 3BGWA 3V4FA 621PA 1XD8A 1RE0A 2WAYA 4KAXA 1W0KD 1QZXA 4PQYA 4K8OA 4YDSA 2G83A 5J4LA 3L0PA 5J4VA 2CK3D 3KQNA 1YR9A 1N6NA 4LYJA 3LXXA 2H57A 1CU1A 1JR3D 1Q20A 4JBWA 4EPRA 5LPNA 3GLIB 2AD1A 1X6VA 2F3RA 1LW7A 3L2OB 2V54A 1ZMXA 1XPOA 1G291 1TU4A 4MRPA 3RABA 3A6PC 2IS2A 1Z6YA 1ZNZA 1JBKA 4EPVA 1P2VA 4WZBE 5SZJA 3K9HA 3GMTA 1QHGA 2G0TA 5KU1A 4MYUA 4V03A 1I4TD 5AJVB 5SZKB 5EJEA 5K8IA 1RYFA 3A8TA 2JEOA 1E96A 2O8FB 1OH6A 4EPXA 2ZI9A 1XB2A 4NU0A 5IT5A 2DWQA 1XFAA 1UBGA 5EE5B 4ZDJA 1EXMA 1KI6B 3ONWA 1GOTA 1QRAA 1TF5A 3HJNA 4LC1A 4YQFA 2B8TA 2HJGA 1NJFA 1XCPA 4RZ2A 4CEHB 4CEJA 1E2JA 1XEXA 3MJHA 1Z0KA 4PZYA 1R0ZA 1UEIA 4TMZA 3TQFA 4RKEA 3U7GA 3TUZC 2BBSA 1OT3A 2YC2C 5LBIA 1XEWY 1SULA 2VSOA 4BFXA 4KVGA 3EC2A 3DM5A 1C9KA 2GBLA 4A0FA 3E5HA 4ILEA 1ZU4A 2QGNA 3IHLA 4CVNA 1KYIA 1W0JD 3K8YA 4PO8A 5LD2C 2V1UA 1E98A 2Q9BA 4Q1EA 1P75A 4C0AC 2BIFA 1XTRA 1KK2A 3ZD6A 3FHCB 1OFIA 3AKEA 2IEZA 2OLJA 2YOHA 1AIPA 5KSOA 4HYYA 4JLBA 3QPUA 1COWA 2ZVPX 3QBVA 5JWHA 1W4CA 3FKQA 4Q19A 4LSGA 4AD8A 3W6PA 1OW3B 4GPTA 4C30A 2ZRDA 3CH5A 4NKRA 3LLUA 3RAPR 2O8FA 4KVAA 1MRSA 1G8YA 1OLOA 4HAYA 1SVMA 4QHYA 5BYJA 1W49A 1WCV1 2V6IA 3BERA 1XCMA 2ZYTX 4LY6A 3O8RA 3AVXA 1SVLA 4LJYA 1DELA 3Q8XB 1HE8B 5L3RA 1VECA 4QKQA 2G0NA 4OQNA 3EAQA 2QG6A 2W6ID 4ZV4A 2CL6X 2OUKA 3Q7QA 4CEJB 1U98A 1E6CA 4CYMA 1ZNXA 1NG9A 1S1MA 3K9LA 4KFRA 3UMSA 2QL6A 1ZU5A 1Z2AA 3KKQA 3R7WB 4AKEA 3K0AB 4XTCS 3QVUA 4Q5IA 5IK2D 3UPUA 1M34E 4KV9A 2FGJA 2HV8A 2JAQA 5TDHA 3CX7A 1BH2A 4LBVA 2BEJA 3QKSA 3W9YA 3ZVRA 2VHCA 2AN9A 2PLRA 1QVAA 3UWKA 4LV5B 4IDPA 2UKDA 1NJGA 2JLQA 2AFIE 4PAOA 2N42A 5DN6D 5HPYB 4EIWA 2ZR0A 3VR5A 5FTKA 2ZJBA 5G53C 3W34A 1QG2A 4UJ3A 1W2GA 2IW3A 2J59A 5KDLA 5J4HA 3O47A 3IEVA 5JMTA 3BH6A 2AHOA 2NOAA 3AGPA 3K0FA 1PVOA 4JL5A 4B75A 2FFQA 3SDZA 4Z54A 2IYSA 4OHYA 3U3RA 3THWB 1CJVC 2Z6VA 2VO1A 1ZD1A 5JS7A 2PH1A 3C8UA 2OLKA 1VYVA 3V00A 2ZSBA 1XP8A 4RCZA 4X8HA 3U7HB 1HQYE 3E70C 3B1YA 4BWYA 6Q21A 2N46A 3WYGA 1UDWA 1CLUA 1E9SA 2AKYA 3CWZA 5FUVA 1AK2A 2ERYA 3VNVA 1JEEA 1GWNA 2IC5A 2GWHA 4C4PA 1E9CA 1UBFA 1TNDA 3HU1A 2QPAA 1JR3A 3TMKA 3RS4A 4CEIB 1XJQA 2OHFA 3FVQA 1NN1A 3K09A 1MR3F 2RKOA 2VTKA 4IDHA 1N0UA 1CR0A 1U94A 3KB1A 4I1VA 1OIXA 4NONA 2D3WA 3BH0A 1ZP6A 5FPSA 4DCVA 1SKQA 1KY3A 1EFRA 5EXPA 3KKOA 1LF0A 1E1QD 3LX5A 4OQMA 4EFMA 1OYYA 4QXAA 3I3SR 3K0CA 4TLAA 2ZE5A 5DISB 2GK6A 4MUBA 5E7JA 4PAMA 3FKSA 3VAAA 4DHEA 3KXKA 3FE2A 2F1JA 4OHVA 3IBYA 1P9NA 3LLMA 4A1FA 1K8RA 2W58A 1YZNA 3C16C 5AR1A 2RGGA 3L0SA 1FX0A 4FD2A 3MSXA 4TYYA 3MMPA 2W2VA 4RD4A 3TSZA 3OHMA 1Z6XA 2VH5R 2XTMA 1K5GA 1T3SA 4GP7A 2Q3FA 1TPZA 3EASA 2OFXA 1N3BA 1NIPA 3VX3A 2DB3A 3SJBA 4MGYR 2HF8A 5KYKA 4DLZA 1PUIA 3K0CC 2WBLC 4XTRA 4OHXA 1VYUA 2GJ8A 1NIJA 4QNRA 3CR8A 3B9PA 2IYUA 3OEHA 2D7DA 1R0WA 1XMJA 4A6PA 1VKJA 3AM1A 1WBBA 4B3FX 4A82A 1SKYE 2FEMA 1UM8A 3N2IA 5DI3A 2YHSA 5KNBA 3KQUA 2DY1A 2H5EA 4JLAA 4O25A 4YMSA 4DCTA 5FOUA 1EFCA 1S9DA 3WHKA 4ESVA 2H92A 5FTLA 2QE7D 3FHOA 1ANKA 2QORA 2ZANA 5EZ5A 3BE4A 2AL7A 5AUNB 2OFWA 4PPGA 5C4GB 4DC9A 4DDUA 5CLLA 2XGJA 2JLZA 3K9GA 2CVHA 3CONA 3D7MA 1SXJC 3MFYA 2FV8A 4M9ZA 5JRJA 1XRJA 1G5TA 4M9XA 4FCVA 4DLVA 2WPDA 1I4LD 1XJ0A 4A6XA 1F2UB 3Q3JB 4ARZB 3NBZC 1Z63A 2GZHA 5LDDC 1YQTA 1I2MA 3RS5A 1P2TA 1CRPA 2QN6A 1E9FA 1VPLA 1PLKA 2NQ2C 3ZS8A 4MRVA 3AVVA 4OJKA 1XTJA 1O87A 2ZE6A 2BMJA 3AVOA 3QXCA 3CF0A 3ZQJA 3VX4A 2AWNA 4LWZA 3I5XA 4HAUA 1CTQA 1UKYA 2BOVA 4DXAA 5FTNA 1KK1A 2NO1A 4AG6A 3T35A 1WP9A 4AKGA 1JPJA 1E2FA 2I1QA 2OESA 1HYQA 4ACBA 1GP2A 3EWSA 2VF8A 3IILA 4AY2A 4EAQA 4L4UA 1PLLA 1GITA 2EFGA 2YVUA 1XCGB 3GJXC 3QQ5A 3WBKA 1SXJD 1TL7C 1WDTA 5FBQB 5CDFE 3KUDA 3PITA 1XNJA 5L3SA 2WIBA 2I4IA 4DDWA 1FTNA 4ASUD 1OIVA 1E0KA 2PMDA 3U7EB 2IX3A 3U4QB 3UKDA 4Q7LA 1GRQA 1NI3A 5JI2E 3PEYA 4Q01A 2CHGA 2RGEA 2TMKA 4ZKEA 1Z2CA 1XTIA 4EJSA 1E9BA 2XZLA 1YZTA 2BCJQ 2AX4A 4DLTA 4C0LA 3CRW1 3VHLB 1OFTA 3QOFA 2VP5A 1PUJA 4M2LA 3CF6R 3EA0A 4Q9IA 1G6HA 1S0UA 3S1AB 2VQSA 1WA5A 4GDFA 1KHTA 1OHHA 3SC3A 2ATVA 2IWRA 1YKSA 3TH5A 5GADl 3EZFA 1TF2A 2X19A 4UNQA 1FNMA 3RRMA 3VTKA 1Z06A 4Q1BA 4BFSA 5EP4A 1UFQA 4JJKA 3PUZA 1Q0UA 2IK8A 3TVTA 4KLNA 5IK2A 2ZRAA 1UKEA 2QTHA 4FMCB 1CR1A 2RH5A 3H4MA 3WXMA 1DAIA 4WBSA 1R6BX 3GLFA 1G3RA 4A8JA 4CF7A 1BIFA 4QJ4A 2WOOA 2ZS9A 1QHNA 4E22A 1GNQA 1NLYA 4YXWD 1QHXA 4OJQA 5CITA 2W6IA 3HYRA 2GJKA 4N1AA 1IN8A 1TMKA 1SQ5A 5L3QB 1UADA 1Z0FA 2QP9X 2ZROA 1DAHA 2FZLA 2RAPA 4JLPA 4M53A 2BC9A 2R9VA 2VRWA 2JDID 1G3IA 2WJGA 2C9OA 2C99A 4CW7A 2I1VB 4TYWA 3GJ4A 2ZITA 5FOSA 4ZI3A 3TE6A 1NMXA 4DWJA 1ZUIA 2C9CA 2YWGA 4Q7KA 2CNWD 1WE2A 2QAJA 2JJ2A 3C4JA 3Q5DA 1GIAA 2QP4A 2VSFA 2WVJA 3A37A 5HZKA 2PMKA 1W4RA 2ODBA 3CF2A 5EQTA 2YV5A 2ZYVX 1Q57A 3W8RA 3DZ8A 1Z5ZA 5TB5A 4C9BA 5FR2A 2QMEA 5GJBA 3VHXA 1F48A 4TQUS 1W36C 4TTRA 4HB0A 3I61A 1J2JA 1N6HA 1XTQA 1YZUA 2W00A 1LVGA 3BB3A 1AKYA 2Q6TA 4ZKDA 4IDNA 2GEVA 4Q02A 2LCFA 3R8FA 3A4LA 1J99A 1H8ED 4Q4AB 2QA5A 1X3SA 221PA 3LW8A 5KPDA 4ACAA 2PX0A 4XWAA 3W3ZB 1M7HA 3QF4B 2O8CB 1VCMA 2AFHE 5HE8A 4XWOA 2IXFA 4KO8A 1IXRC 2ZRIA 4PSKA 3WP0A 1XTSA 3C7KA 2HYDA 4GBMA 1ODFA 1CULC 4TN1A 2ZAOA 2VF7A 1G17A 2DR3A 3AH8A 3QIAA 2IF2A 2QUZA 5L3VA 2ZEJA 3SHFA 2E9SA 1XTKA 2ODEA 2XNDA 2QAGB 1NN0A 3NBYC 1W2HA 4BGDA 3MD0A 1HA3A 2UVQA 1FTSA 4IOKA 1J7KA 3FKSD 2C2HA 2FDCA 4JLVA 4EQ6A 1U90A 3VR1A 5IHPA 4L5BA 1I4DD 3FMFA 5KO2A 4LHXA 1ZC4A 1DO2A 2O8CA 1ZAKA 4GI7A 2P65A 4QG7A 4NCJA 1N0WA 3JVUA 5F9HA 1NSTA 1O3YA 2WTUA 5F3WB 4DT1A 3AVWA 3W3AA 4HATA 4JS0A 1HTWA 4RFSB 5GJCA 3GLGA 2VP0A 3K09C 4AK9A 2GESA 2ZJZA 3WNDA 3TR5A 2WKQA 1JQJC 2HLDA 2RGAA 4Q4HB 1FP6A 2WKPA 1U2RA 3SBEA 3ZVMA 4DB4A 3NDBB 2OE2A 1GKIA 2A30A 1N2CE 2V7QD 2F9LA 4RZ3A 4M8NE 4V0KA 5A0FA 3PUVA 1G7RA 4MKFA 2V9PA 2CL7X 4XSHA 1EG7A 5JEDA 2W2TA 3OAAA 4I81A 1F5NA 1G3QA 1L2TA 1M2OB 4URVR 3ZLJA 3MRSA 2ZRLA 3BRWD 3EZ9A 5TVKA 3WRXC 1AGPA 3VMFA 2ZRCA 2FEOA 4EJSC 5DN6A 4UXIA 3IPYA 2ZSEA 3CH4B 5AUOB 3PUWA 4JVNA 2CCGA 1SHKA 2Z0MA 5CM8B 2GVZC 3NC0C 2AWOA 5CK5A 1E0AA 1OSNA 4TYNA 3W5JA 3ASZA 1N6OA 2EWVA 4LJ7A 1N0VC 4XH9B 1DAMA 4GOJA 4OK6A 4LBYA 3UK6A 2KB0A 2BDTA 1TQDA 3ETLA 3R9WA 3IBGA 2JJ1A 2ODNA 1G8PA 2B7BA 3I92A 4A0HA 1D5CA 2J46A 3HR8A 4D26A 5TXGA 3QG1A 3VNUA 2QQEA 3IQXA 3QEOA 4QM7A 1XMVA 3LY5A 1KI8A 2XX3A 3KJEA 4L8GA 4M1YA 1H8HA 2F7SA 1XZQA 1P62B 3PEVA 2QGZA 5FPKA 2W83A 1SZPA 1ZM7A 2F43B 3X1ZA 4GMDA 4JMPA 2QM7A 4NPHA 3RDPA 2B7CA 2PBRA 3D6TB 1P2SA 3BD9A 2R6FA 1X1RA 1YZGA 2Q9AA 3CZPA 1NVWQ 5BYKA 1A5TA 5AJXA 2OCBA 1G7TA 4F4CA 3GLIE 1C4OA 4AKHA 2G9NA 1G3UA 3C15C 4GT1A 5M04A 1OXVA 2AXPA 1B0UA 1Z22A 4HDCA 2VPPA 2J7KA 1YR8A 2ZVQX 1LFDB 1HURA 2J45A 3A1VA 4E07A 2FSHA 1JR3E 4D4KA 3VKGA 2DWPA 4BZPA 2JDIA 4YDHB 3FOZA 1R5OA 1G41A 4LGMA 5JFGA 1NVVR 4FMDB 4M0LA 2GRJA 4B73A 4LK2A 2GBLC 4IEIA 4KFUA 2HCBA 4AYXA 2XZPA 4BZQA 2OV2A 1BOFA 2OM2A 1NVXQ 4JVSB 1ZM3A 2IYLD 4PC3A 2ZE7A 3RSOA 4LHYA 1RYHA 3Q7PA 4OK3A 4OL0A 1S3SA 4WOPA 3EZ6A 2IS4A 1N5KA 3DMDA 2VP6A 2R8RA 5GVSA 2IUUA 1G18A 1W5TA 1Z0DA 4P4SB 4G0NA 1N5JA 3F8TA 5FL7A 1DBSA 2RGCA 4BEJA 4UNPA 3L0OA 5LB2A 1NN3A 4GMXA 2ZJ2A 2IYZA 5AWFC 4TSFA 4JLKA 1N6PA 1HEIA 2Z4SA 5HCIA 5FBVB 3N5CA 3BOSA 4NP6A 5FTMA 3EXAA 1T91A 2AD5A 3K0AA 4DSUA 4JSTA 4ZDIA 4MGIR 2QROA 2Q3HA 4O2LA 4NYIQ 4TQ9A 4PHTA 1XF9A 4WZAE 3T1TA 2R6GA 5BXQC 3ASYA 1ZUHA 4QBHA 2HJVA 3EPJA 5CB8A 2ZRPA 3LVRE 1VG1A 4D0LB 1K6MA 4FN5A 4U7DA 1KZGB 4TZ6A 4B76A 1LB1B 4QGFA 2HUPA 2A5FA 5B57C 3CLVA 1F60A 5SZIA 1FMJA 1XEFA 3DPUA 4HLCA 3T5DA 4DIEA 2ZR7A 3UIEA 1T4GA 4IOMA 2C5LA 1GUAA 3EW9A 2J41A 4A4DA 2D06A 1T9HA 4Q7MB 4YONB 2F9MA 4W9MC 4JL6A 3DEFA 3ZZTA 721PA 3MWLA 4BLRA 1E69A 3BWDD 4NYIR 1GL9B 2LKDA 2WV9A 1YJ5A 1R7RA 3CWQA 2A5GA 2NO7A 4PC1A 2GCOB 2QEQA 3GLFE 4Q9KA 2JLWA 2WKRA 4HAZA 4WA7A 4BASA 4R9UC 4Q1AA 1WQ1R 2KI5A 2REBA 5E7IA 1TQ6A 1HE1C 2BKEA 5F9FA 4X8MA 2ZRHA 4PX9A 2H18A 2NPIA 3TRFA 3H0KA 1UBEA 4JIMA 1KOFA 2OXRA 4JLMA 2HXSA 4UXHA 2P6RA 3X2SA 2QRNA 1LS1A 3NVAA 3UATA 2ANCA 4D80A 1NY5A 4BLPA 2JIZA 4RD6A 1Q1ZA 1X8LA 2IA5A 4U5XA 4OBEA 5ELXA 1NBMD 3ZYCA 4CDGA 1E2NA 3M0EA 2P6UA 1P72A 1GNPA 3GLGB 2YINC 4PXAA 5B2ZA 4DT1B 3B6EA 3AVQA 5TARA 2GETA 1DS6A 3CX8A 2CHVA 4HZUA 3LV8A 1T8TA 4LBZA 2ZI6A 2YWEA 5L3QA 2YJTD 1DADA 1VG8A 3AP2A 3QKTA 3CNLA 5K8UA 4WIAA 3LBHA 4LRWA 3BXZA 1E99A 1IN7A 4P0TA 4C0JA 2Q9CA 1A82A 1L4UA 3FMPB 4F92B 4C0BA 1XWIA 2GEDA 4G1UC 5CYOA 1KAOA 4B6EA 2ZI7A 5FPTA 2X2EA 3QENA 3CZQA 3KTAB 3E2IA 3IO5A 2GILA 3U3OA 2OEPA 3RC8A 2XNDD 4G5RA 2IYYA 1CBUA 2GJAA 4B3CA 1D8TA 1QHHA 2P2LA 1P7CA 3HYTA 5DGXA 2PCLA 1OXXK 4B74A 4HLUA 4MYCA 1D9XA 1UPTA 4XSGA 2W6JA 2IHBA 1NLZA 4K81B 1KY2A 3LD9A 3EIHA 1UF9A 1Q21A 4KCGA 2QAGC 1P9WA 1KI3A 5FI1B 3FB4A 2ZRMA 2WSSA 3VKHA 1KAGA 3AKCA 3LBNA 2VP2A 4D4LA 1RVDA 1ZC3A 2X8AA 4F4JA 5JS8A 2CMKA 3QE0A 1D2EA 2MSDB 4LJ6A 4IFBA 2YC4C 3A4MA 1KMQA 1IN4A 3RRNA 1R0XA 4ASUA 3TIFA 3TAHA 2RGNA 1CR4A 2E87A 2VHJA 2ORIA 4I4LA 1EGAA 3Q5EA 4QGAA 1BYUA 4Q4AA 2PLFA 2XXAA 3GEHA 2Q21A 4UJ5A 3NH9A 1XXHE 3C5HA 5HE9A 1E94E 2QMHA 1JNYA 4D82A 4XD7A 1ZM4A 4A36A 1SGWA 5EXTA 1F2TA 1IY0A 4PHHA 3G82C 2BJWA 2O0HA 2WWGA 4QC2A 4TTPA 4LV6A 2XAUA 1TF7A 4B47A 3KKNA 2MSEB 2JA1A 2QPTA 4KJZA 2EFHB 4QNMA 3EPHA 3CRQA 4PC2A 1P6XA 3OIWA 4EKDA 1EFHA 1G8HA 2WJYA 5CLQA 3LH5A 1JXOA 4D2IA 2QSZA 4TYQA 3MLEA 3KUCA 3A1WA 3W90A 3QKUA 4P4TA 2DYKA 5FTJA 4EPWA 3M6AA 4F38A 3LO5A 3MGCA 5AJZA 1Q1QA 3JZMA 4TL6A 3T1OA 2QTVB 2LWIA 1OKKD 2CCKA 4TL7A 1U9IC 4LC0A 2PT5A 4DLSA 5JLJA 4HI0E 1E9EA 5FOXA 3I1FA 4KHZA 1OV4A 1ZRHA 5JJLA 2RGBA 2YWFA 3QXJA 5DE3A 2OAQ1 4TT3D 3B7GA 4D25A 4AG5A 2ZIAA 4RY2A 4LI0A 4XVUA 1CJKC 2CE7A 3NKVA 4PTLA 1NMZA 1P9RA 1Z83A 4D4JA 2IL1A 4FMBB 5FI0B 3PEWA 3KQHA 2IYRA 4PSAA 2RHMA 3EX7C 4IOLA 1JJ7A 2DCUA 2WWWA 5G41A 1G8FA 1IQPA 1KDOA 4CEHA 5CJPA 4PZLA 1J90A 2NO6A 4M1TA 2O8DA 3U44A 2DHRA 4JVLA 3ADKA 4S35A 4M1KA 3KFXA 1Q3TA 1NP6A 2MMCA 4TYPA 5DI3B 2W0SA 1OXUA 1GRRA 1FL9A 3MWYW 3WNBA 2RGNC 1TX4B 1Q44A 1E79A 3AF0A 3DOEA 2C04A 3EZ2A 4AIIA 3NDPA 4RFSA 3K9NA 5H68A 3SE0A 2OSBA 5JHGB 4IXNA 2PZEA 1IXZA 2XOKD 4QJ5A 2FGKA 2A2ZA 5D3MB 4LJ8A 3AF1A 3U6KA 5BWMA 2ZRGA 3HR7A 2H7VA 5JBQA 1MV5A 4X8OA 2O8DB 3B13B 5IRCD 2ASEA 3AP1A 3ICQB 3IIJA 4DCUA 2GCNA 2ZM5A 2J1LA 3AV0B 1SVSA 3I62A 2QMOA 4FWTA 1PJRA 1OB2A 1II8B 1KDPA 4B33A 3KJGA 1OB5A 4O0MA 4CEIA 1KNQA 5EUMA 2REOA 2PZGA 2FFAA 1W36D 4BLSA 2A3RA 1ZJ6A 1AS3A 4DLYA 4PHFA 5DO9A 3CRMA 5JCZA 2UZ3A 1QVRA 5DIFA 3FFAA 2XSZD 5IDVA 1NRJB 4MRSA 2DFNA 3KXIA 1A2KC 2ZREA 4JL8A 1EFRD 1KSJA 1DG3A 1U0LA 3R20A 2WWFA 4MKHA 1W48A 2BWJA 2JJ1D 1TTTA 3TAUA 4A2WA 4B2PA 2XJ9A 1UBCA 1N5LA 2WM9B 2GJ9A 1P4SA 4MGZR 1OIWA 5J4KA 1II8A 5CYPA 2OFOA 3IHWA 2ZRNA 3KX2A 4KLZA 2OCAA 2EW1A 4G01B 1YZKA 4V02A 1JI0A 2AXNA 1NBME 1UDXA 5E3HA 2ZUCA 2GNOA 3ND9A 1NLFA 3ADCA 4G5GA 3T1QA 1E1QA 4PR0A 1BKDR 1LTQA 4CZ2A 4JLOA 1NKSA 1SVOA 5AJWA 4GP6A 4TTQA 3QPWA 3GP8A 4TMKA 3KL4A 3FMOB 3GEIA 3REGA 3PR1A 4PPQA 5EZ6B 1Z6AA 2BKUA 3NTUA 1E2LA 3CB4A 3GJ3A 4FCWA 5C1BA 1U99A 3QXSA 2VBCA 1NL3A 3B2EA 1A4RA 2GXAA 1U8YA 1XEXB 1IN5A 1EWRA 5L8VA 2QZ4A 1RW4A 3RLFA 4BZXA 3U2QA 4M1OA 4D0GA 4C2UA 5KNCA 2F55A 2I3BA 1JQLB 4XIGS 5KUTA 2MMGA 1GNRA 3RS0A 1D9ZA 2G6BA 4MUAA 5K8TA 2Q0HA 4Q4JB 1TEVA 1JB1A 2VP4A 521PA 3LVQE 4P33A 3HP1A 1DARA 4MH0R 2JGNA 1FPMA 4G3XA 1DVRA 5B58C 3TGPA 3GLHB 2JLVA 1ZYUA 4DZZA 2JJ2D 2JLXA 1DTSA 1E0SA 1PZNA 4ERNA 1Z8FA 5L3SB 2KWIA 2XB4A 3A36A 4G5QA 4YMWA 1XPUA 5FPYA 1XD9A 1UKVY 4LDJA 5H8WA 4ARZA 1FNNA 2GXUA 1HY3A 1GZSA 2CLDX 2IHYA 4CT4B 2WJVA 2BBTA 2IWHA 2UZIR 2JATA 2WOJA 3F0TA 4GZMA 1M6NA 3GFTA 3FHTA 1D6JA 1IBRA 3DZDA 3QG5A 5KSYA 1F6BA 3L0IB 4HZIA 2J0VA 2A78A 5GJVC 4PAQA 1OYWA 1HH4A 4KFTA 4D81A 3NEYA 1Q3HA 1AS0A 4M22A 1P2UA 4URXR 1TQ4A 3U60B 4ZPXA 3GJ5A 1LV7A 4PO9A 3NHAA 4IKEA 4KXFB 4XJXA 4EJSB 3PVSA 2ZJ5A 4BRWA 3SN6A 1TEXA 4HDQB 4R2HA 1FUUA 3RWMB 1YU9A 2J0QA 2O8EA 4NTZA 1R10A 4LHWA 1IONA 1E9RA 2ECKA 1EK0A 5DHAA 3TJZA 3PUXA 2F1IA 1FZQA 2C8VA 3U61B 3UG6A 3F3YA 3AEZA 1OHHD 1QF9A 4R98A 4A9AA 1US8B 4NCHA 3CUEF 5EP2A 4GFDA 1R5BA 4LPSA 4NH0A 3VR4A 3ZZ0A 4AC9A 4PZZA 2FMXA 4U00A 2CDNA 3BFVA 2VP9A 4LHVA 4HEJA 4IOJA 4N3NA 2CBZA 1OKKA 1RFLA 5H70A 3V4RA 4G5SA 4DDVA 3AKDA 2DFTA 5JJKA 2JIZD 2ORWA 4BFWA 2CJWB 3LBIA 4HB4A 4NHOA 1GL6A 3ZH9B 4QHTA 2HEIA 3B60A 2V7QA 2W0MA 1KGDA 4Q9HA 3RNLA 1KSHA 3PEUA 4Y0AA 2GDJA 4BLOA 3RRYA 1KO7A 1LY1A 2ANBA 4C7OA 1E2QA 2Z4RA 4B2LA 2H16A 1Q1BA 1W36B 3B1XA 5DYGA 3HU2A 2A9KA 2ZU6A 2ZPTX 5E4FA 1HUQA 1W47A 3KFVA 3WMFA 3MCAA 4LBWA 2XZOA 4YLGA 3N70A 2CCJA 1AQYA 4V0ME 3SJAA 3SEAA 3HPRA 1HQCA 1CJUC 2BHRA 2AK3A 4PPFA 1IAQA 1P61B 2E1RA 1JAIA 3NC1C 2GZDA 3WHLA 3TW8B 4TLBA 1WRBA 4X8LA 4FMDF 3M4YA 2Z43A 2BBWA 5C4MA 3KQKA 1EESA 1IJFA 4PANA 2ZJAA 4C7OB 3GJ0A 3IKJA 2WSMA 2VYFA 3AF3A 1FW6A 3NHBA 4I99A 2CK3A 1CXZA 2IUSA 4PC6A 1LNZA 4TMTA 4B3DA 3VR6A 2H1LA 3IQWA 4JLDA 4Z1MD 2IS1A 3A1SA 4MYHA 4NCKA 3ZDQA 2YNMA 5KNDA 5FOWA 4URYR 2WWHA 1E2GA 2XOKA 1N6KA 4RZXA 4IVQA 1QG4A 1WB9A 4B44A 2ZTSA 4Z8YA 4US2R 1VCOA 4M1SA 2C98A 2PCJA 4IEEA 3RHFA 3EZ7A 3U7FB 1KNXA 3B1VA 1DPFA 1GG2A 4NCIA 2V55B 2B21A 3CRRA 3RS3A 3W5IA 1JPNA 2CHQA 3LX8A 3QBTA 4HAVA 3SJZA 4BLQA 3SOPA 3C14C 2KJQA 3IEUA 3P27A 1A7JA 3RYTC 5B30A 3J81k 4P3YA 2CLSA 1W4AA 3IIKA 2C77A 2CLCX 1ZINA 2GK7A 4TQAA 5FUXA 3GLHA 1G4UR 4MQBA 5FUWA 3JVVA 4AWXA 4NDZA 1G7SA 3I32A 1G5PA 2CE2X 5CIWA 3AQ4A 4DIDA 5TV2A 1AKEA 4WW0A 4UNSA 1CIPA 2HXYA 1XX6A 3TSOA 2FWRA 3D8BA 1JJVA 1K5DA 2B6HA 2JJ8A 3ZJYA 4DLXA 3R8CA 2FH5B 2GTPA 2GJSA 1DO0A 2X77A 1LS6A 1XJCA 3ZIAD 2OCYC 4KSCA 2OZEA 3X1WA 1E2MA 3UMFA 1RPZA 2VHQA 1P73A 2R44A 1EFUA 3T34A 5FL7D 4B43A 4L15A 1ZVQA 4CRWB 1TAGA 1G21E 1E9AA 1Z0AA 1ZNWA
chains in the Genus database with same CATH superfamily
4YALA 3GD7A 3PXGA 1KDYA 4CM6A 4F6RB 1HDEA 3D1JA 4O3MA 4LCEA 1YMVA 2H1HA 2N1BA 4FYJA 4QGHA 1UJ6A 3KR0A 4IR7A 4LYAA 5CGQB 3TUIC 5HS4A 1KI7A 1Y6GA 4R54A 1D07A 1U11A 3ZD8A 1KK0A 1X77A 1GXSB 5AVJA 1FTGA 4JXXA 5CJ2A 4EABA 3A05A 4NK5A 8GPBA 4GKAA 4B48A 4RE5A 1EX7A 3OFNA 1RWWA 2IGBA 4JYCA 4ZT4A 3VR0A 2N3ZA 4W5JA 1NX9A 4B09A 4FXOA 3MPUA 1V11A 4M8SA 2JI6A 1E6WA 1RAEA 4R1MA 1ZCFA 2YJ6A 4O4JA 2XRYA 1GNLA 4EB6B 4GECA 1KI2A 2N0SA 3BE6A 3DR3A 4X6YA 3T4EA 1I6WA 2X5KO 2O0MA 1J0EA 2V96A 1OXBB 1JAHA 3FWKA 5E95A 3FZNA 4E5MA 4HQFA 4N0DA 1HW1A 3QTLA 4DIBA 3HY4A 5KC9A 4LV8B 3SHWA 4R0MA 2EVWX 1TK2A 1Y4SA 5FJJA 4ND7A 3GFSA 3P9QA 2GVDC 5J3JA 4A3SA 5IVHA 2UYYA 5UKDA 2XLEA 1JGTA 3K70B 1G9XA 1PHRA 1UPAA 4L27A 5SYAA 3WS7A 4WOBA 2EW8A 4L8VA 1ZJYA 2EX0A 3S1AA 2EIKC 2HPAA 1UK9A 2C5GA 4BAZA 4IXMA 3G79A 1SXJE 4RD1A 2HSQA 5IHXA 2O9XA 1XC7A 1S3FA 1Y7HA 1SU6A 2IXTA 2D8MA 2OO7A 2UUPA 2Y9PB 1CJCA 1KPIA 3KPVA 3Q87B 4JEIA 1H2BA 1OPXA 3TW4A 2YL7A 1A9RA 5KS2A 3AL0C 1IG3A 3Q72A 4XSVA 1KVQA 4AZTA 2J09A 3JQFC 3P0FA 1O6GA 3ZN2A 1D1QA 1XAHA 3BWEA 4HBGA 1ZD9A 4I3HA 4BNGA 2JEZA 1Q1GA 3INYA 1ABFA 1YKGA 2OAEA 4P34A 2GN2A 4DLBA 3TFWA 5HF8A 4FLMA 3ENKA 3UAWA 3ICWA 5DPMA 5CNIA 2H1IA 1UJ4A 3P4YA 4JC0A 5BORA 4ZGWA 4QZVA 3C8HA 1QSGA 1XPRA 3DLAA 3L6EA 2QTZA 1ZFNA 5FH9A 3F6CA 4Y2YA 4M1QA 4NBSA 1FFDA 3PFKA 5AD1A 4I19A 2C2MA 1J56A 2VF2A 1WKBA 3BMOA 4C2TA 1Y82A 2A1UA 3LZCA 2V98A 4IQFA 3CZMA 1XYGA 3IMEA 4Q00A 2BEVB 4JOBA 2ZUBA 1ZW2A 1MH1A 3IB6A 1WHTB 2PSHA 4LVNA 5D6OA 4MVXA 3K1ZA 2BFFA 4F8YA 4RA9A 4IGIA 3SLGA 1V5WA 1WHSA 4GGOA 4B17A 3T9OA 2GA0A 3MWFA 4WJKB 4KUEA 4WLNA 2KLBA 4JYZA 2HDNB 1K5PA 1Z3IX 4G5XA 3PJGA 2YJ3A 1VQ1A 3RUAA 4RQUA 4B7UA 5AHWA 2WAXA 1TJ4A 2HJ9A 4FE4A 2I71A 1T9ZA 5HCUA 3BXEA 4JENA 4FDTA 1F3OA 2CLFB 4UBJA 1ZUNB 3VO2A 1CDOA 5TVGA 4WGZA 1FJXA 4LZPA 4U2KA 5LQJA 2B25A 5KYUB 4XGIA 3JU3A 4UTNA 4JR0A 2ZAYA 4TMWA 5I9MA 5JAUA 5AMXA 3SZGA 4M21A 5HOQA 5IJZA 3RF6A 4FMCF 2C96A 1XQ1A 2AE1A 2IPMA 4B46A 5F7XA 4BU1A 4L8FA 1CKEA 1DAEA 3SJCA 4O2RA 2VZ9A 3Q9LA 4BC1A 4FFOA 3NV9A 2ZYGA 1TTPB 3QLEA 3DL7A 4Q6BA 3Q41A 1GGKA 3CISA 4HGNA 3TQSA 3VU9A 4AQDA 3ZCTA 3FNRA 1EP2B 3P96A 3PQ7A 1YB7A 1DUVG 2AJTA 3CBQA 4Q16A 3H5WA 5LNK6 1M74A 4W82A 4Z9YA 4AL4A 2HWWA 3A1TA 5TQ2B 3RFCA 3ZY4A 1L5NA 1BD4A 2ZI5A 5C8YF 3ZDBA 5A4JA 1FEZA 1XDWA 1S7ZA 2AF4C 5B3AA 2H4FA 4HFMA 2VT6A 2QTVA 2FMIA 3L0ZA 2HW8A 4OM8A 2QVCA 2LR0A 2CXXA 3ETJA 3QEJA 4O1HA 3WL6A 4NARA 1XNGA 3PKIA 1O5OA 4LDZA 1NX6A 1XROA 3I1IA 3QX9A 4DSOA 1R4MA 1KVRA 3P0EA 2FEWB 3PUKA 4FGSA 1ZVKA 1CS0A 3O4JA 4G25A 1JDPA 4CM9D 4EBJA 2NZ8A 3DE1X 3NHMA 2ERCA 4G8BA 4H0CA 2NTYC 3WGMA 4PE5B 3GLHE 4GZ6A 4Q9JA 2C1XA 2JGMA 3D3EA 4IHJB 3KDSE 4G1EB 1XEWX 4FOPA 5FXMA 4TVSA 4MW3A 2OVFA 3I72A 1U2DA 3VR6D 1YF3A 1JZQA 5D6NA 3O9VA 5JO0A 5ANRB 4XDGA 2DQSA 5JTUA 4H3VA 1JIIA 2V3CC 4AN4A 3TFOA 1S2GA 3D02A 4KQ6A 4ER3A 1KJWA 3ZU3A 1OZAA 1UBTS 2CXHA 2QGFA 2QT0A 1Q16A 1JECA 1JFLA 3KPJA 4HGQA 2JS7A 4AZ0A 1KZHA 4JI5B 4D97A 2OSVA 3L92A 2EIMC 3HWSA 2PUVA 2V03A 5D5QA 2IELA 3NHJA 4UHDA 4CV2A 3N2ZB 3IMFA 1M0TA 4OK5A 2V3WA 4UD6A 4K05A 3B85A 4ZQBA 1OQAA 1SXGA 4FK8A 4GPD1 1NBMA 4N7BA 4P32A 5J40A 1VE1A 4CL3A 1BO6A 4D9HA 2B2NA 2VZ0A 3COVA 1RU3A 1TUBB 1FUKA 4HCJA 5CDYA 1A8PA 1IZ7A 2C3OA 1RAHA 3AVPA 2FY8A 3GJZA 1E32A 1NQOA 3O1LA 3OCXA 4RF5A 4Z1MA 5J59A 3W8NA 3BFKA 1R4TA 1MC5A 5DM1A 4XX1A 3WFIA 3LTNC 7MHTA 1JIQA 1JJFA 2W48A 3Q9NA 4UHCA 5D3MA 1NZDA 1VOTA 1L4NA 3NRBA 3P9SA 5ICGA 5ALEA 2IS6A 6NULA 4BFZA 4ZI5A 2I2DA 3OCVA 3H2YA 4K1XA 4OB6A 1EK6A 1JKIA 1L8AA 2FYTA 3GAFA 4RL6A 3V2GA 1RHRA 1FMWA 2IKSA 4LOAA 4ESHA 4CDAA 2J3JA 3N9IA 5A6JA 2O2IA 3KLMX 4P31A 1ETUA 4HY3A 1QQ6A 1Z5PA 1U6IA 3LL7A 4G2TA 2NVBA 1IM2A 1II0A 1P77A 2YL2A 2J9XB 4L5CA 4OU5A 1W5SA 4P81A 1IOVA 3R6DA 3PR3A 5F5XA 4BUZA 4BQIA 2QBYB 1OY1A 1ZJJA 3FYDA 5GY7A 3SS7X 1WO8A 3JRWA 1E0DA 4N0QA 4XIJA 1GFSA 1SIBE 4Q03A 1GDHA 2AK2A 2WWXA 3FJ1A 4C7XA 2GEBA 4OGGA 4BRUA 2P6NA 3KNZA 4LJLA 4KQMA 3KUKA 1L7DA 4KU4A 4MS3A 3SF8A 2VJNA 5A69A 4RNDB 1FQKA 1YL6A 2ATEA 3UB4A 1Q91A 1E8DA 2W6OA 3H9CA 3AJAA 4R83A 4XJVA 2P62A 1U7WA 1H5QA 1ND6A 1XD2A 1JQDA 4C30A 3TDNA 1T3HA 2W37A 5KSZA 1RNLA 1GAWA 4O2BA 4LEIA 1AXEA 1U5CA 3HB1A 3I6IA 4IS3A 4K6KA 4PAGA 4MQLA 2IFTA 3AHFA 5H16A 3ZV6A 4RDCA 1U28A 3MTGA 4CM3A 2CW0F 1OR2A 2C03A 2J5RA 1ZMOA 3GHHA 3KZCA 1FNBA 1ULUA 4KYUA 5AHOA 4MULA 1R8YA 3PNQA 1FDRA 5BQ5A 3N6RA 3TUJC 4ZAYA 4YTEA 4L8YA 4IWXA 1X1DA 3ESZA 1HG0A 3WLHA 1JWAB 4UKDA 3P4XA 1MB0A 2O8VA 2AOVA 2PWPA 4HAXA 2PX4A 1JHRA 3HVUA 4IH9A 2I6GA 4RGBA 3GRCA 2BN4A 3WX0A 1QNFA 1N7GA 1R0SA 2QQ0A 8OHMA 3WNCA 4KIWA 3F9RA 3FX2A 1UM9A 2B6NA 4C01A 3SSMA 4IRMA 2NYUA 3P9XA 4PCVA 1J5EB 2Z83A 1Y3IA 5I3ZA 3D3WB 5C81A 2X42A 3M4JA 3A6HA 3N7AA 2X5NA 2O0JA 5C37A 1FNDA 5H1YA 4PSCA 2PV7A 1M2JA 5BR4A 2DECA 4XM0A 4N5HX 1OU0A 3PFIA 4HMQA 4NPCA 1D4OA 2NTNA 2F22A 5BN3A 1CERA 4YHBA 1SUWA 1ZAYA 1NDHA 3PV0A 1TYZA 4V0NA 5A5GA 1GPLA 2HV9A 2CXTA 2IVZA 4GUDA 4QQNA 3V7FA 3WHPA 2DULA 5GONB 4QUAA 3L93A 3JSEO 5TRTA 3BD8A 2XE8A 3DAHA 5D3QA 3NEPX 1AQLA 1MJNA 1R4NA 3JYLA 1ESMA 2GCPA 2ICAA 4FE7A 4XIFA 5K0EA 3D4OA 2CD9A 4TUYB 3TBKA 3DVLA 4C0QC 2HA6A 2WPNA 4NJOA 3S2FA 3IKLA 1ZCAA 1L5FA 1FLVA 3EMBA 4KXXA 1E4YA 4Y9UA 5K4HA 4KIGA 2EQBA 1PS8A 3E53A 5C7LO 3WB1A 4L6RA 4O1IA 3VPFA 1GFWA 1IHXA 3DEHA 2ZDGA 1CYEA 3GCXA 3H75A 2JK0A 3O8BA 1LJLA 5A1TA 3MM4A 1QR2A 2QNRA 1RIFA 2ROQA 3IAHA 3LLSA 1KY5A 1W29A 1FUEA 2ZWVA 3ETNA 3MUFA 3Q3VA 3R6WA 2OKGA 3A3PA 5DBHX 4OHZA 2A88A 1J2EA 4FCCA 4H0NA 4LOIA 3VM6A 2IYNA 1JXMA 2GCIA 3C3CA 4WKBA 1EXVA 5JYEA 5JJCA 1W8IA 1N2JA 1V2HE 3THRA 3OQ6A 2R7SA 1SQGA 2GA8A 4YRPA 4D9EA 1BR4A 1EK2A 3K4HA 4GRAA 5E9JA 4H3HB 3RRZA 5AJTA 3VISA 1SUPA 3ZWVA 5HR5A 5IANA 2WYOA 4FYWA 3EE6A 1VK5A 2PX3A 3DV0B 5GOZA 1GADO 4GQBA 2BT4A 3L8YA 1T4CA 4R2LA 2E55A 4QATA 3RSHA 1M1XB 3PJDA 3OE1A 3PDCA 2G72A 4E70A 4CT5A 2E4XA 3ZLBA 3OM8A 5IC4A 1WF3A 4QQFA 4E3WA 4NBUA 2WJ3A 3UQZA 4EKGA 1N6RA 2AN5A 4F4IA 3UUFA 1DKOA 4EGCB 1XYVA 2IV3A 4S2EA 1EVIA 3T4PA 4CL8A 4UFPA 1OROA 2QM8A 3SQLA 2CB9A 3DM9B 2XM0A 1ODCA 3B38A 3U8PA 4E14A 1XR3A 2YY5A 1RCUA 3BA6A 3TKYA 3PUYA 3QKSB 4WEQA 4YMHA 3QW2A 3JARB 2Y27A 1F1JA 3EEIA 5AXBA 2PD3A 1TD1A 2QRKA 4MVRA 4MYTA 4P2GA 3ECCA 4OA5A 1FMVA 5B7NA 4G8CA 3I45A 3LPDA 1NP7A 4RX1A 3ENQA 4M0EA 1KFJB 1JDUA 1NVVQ 3PTAA 4G0WA 4H15A 3RWOA 2OCCC 1CLEA 3NH6A 5LZ8A 2PX8A 4F84A 1T6UA 2O3UA 3SMVA 2OO5A 3HFSA 5IX8A 5DBFA 3CJTA 4CG2A 1FLNA 1OLXB 2CC2A 3LG2A 2PH5A 2ID4A 2WYWA 4JBNA 4ND1A 1RMYA 4O33A 2AXQA 3VRHA 3W6ZA 4PW0A 3C6KA 3HO8A 5I4BA 5LP6B 1A41A 5SY9A 2VLIA 2ZXEA 3M15A 1XQVA 2C88A 4Q3AA 2FSPA 3AR3A 3LOQA 2B98A 4UOEA 4JW1A 4P7BA 3T1VA 5KQMA 1KMHB 1JB9A 4OH1A 2QRGA 4KMMA 1MUUA 1FFAA 2EU8A 3AY7A 1TGYA 1M8PA 3CWCA 1H23A 4II7A 4V2UA 2WQZA 3P9RA 2GX6A 2VQ3A 5ENDA 2ZIUB 5ALGA 1NA5A 4BNFA 1N5IA 4QBTA 3G5UA 1NQWA 4PFOA 3PFCA 2O4UX 1VIAA 1U80A 2GAFA 2GUGA 3B82A 3MIZA 1EIZA 2O07A 5DLQC 2D2IA 3TLAA 1OR3A 4G36A 3CX6A 3C7JA 5E2QA 3VVCA 4DCSA 4RIHA 5JISA 3LZ6A 3PVZA 2C4KA 1XXHA 2AOTA 1P0FA 3HNKA 3DO6A 3DXXA 3F8SA 2CF6A 3PHJA 2BI8A 4IICA 4P3OA 4R1OA 3U4GA 1HSZA 2OVBA 4DREA 2DUNA 3ZY2A 1VPVA 3JD4A 4Z9XA 3ZTMA 5AK6A 3VC7A 5KOHB 1V74B 2A5YB 2BPOA 3R3HA 2AWYA 4HWSA 1A77A 1YH3A 2WFAA 4XQGA 3UUEA 4Z7OB 3E35A 1ULAA 1S3IA 1RQXA 5T3WA 1R5NA 3WG7C 1T9BA 1H8HD 4N49A 5CMLA 5JSYA 2YOGA 3OLZA 2POQX 4TL9A 2ZQ5A 4PC7A 4V1CB 4MCJA 2HWYA 2O1XA 2JFHA 3WAGA 3VR2A 4AJLA 3I1JA 1GV0A 1NASA 1XQ9A 2P9TA 1Y3DE 5E8JA 2WF5A 4MRAA 2GAJA 3I01M 4QJIA 3B53X 4X95A 1WEKA 4ZVPA 3LKZA 4AZ3B 4K46A 3BQMB 1ONOA 2B2CA 1XL1A 4UAGA 1G3MA 4D9KA 3QX3A 3IE2A 4JQZA 4XWWA 3C41J 1ESNA 3IPAA 2QTBA 4H1VA 1PT9A 5KSPA 2DY0A 2X2OA 3WIUA 4AUKA 5LUBA 3G2JA 3DC2A 1RI4A 3ZWOA 4ZT5A 3GJYA 3HDGA 3X3HA 3KUXA 3O1IC 1C3XA 4LSZA 5D5HA 3TTVA 3RAFC 3KKEA 3O2NA 2PF4E 3B6ZA 3KIPA 5KNBD 4W1SA 3HKDB 4TMYA 2C57A 5DKFA 4ZO4A 5BN4A 2QVLA 1JR8A 3RUFA 4C03A 1KI6A 1W85B 5JZSA 1F1MA 2AJ8A 1J06A 2C00A 1JFSA 1AHHA 3B9QA 4CKWA 4H4EA 2ASVA 1E6KA 2DX7A 5CTJA 1T5LA 2NPFA 3AKZA 3PC8A 2Q1XA 3OOEA 4HT3B 2O5EA 1F20A 1Y8QB 2QENA 2WJWA 2VASA 1NMEA 4FFMA 4AL1A 4ZO6A 2IIQA 5KOYA 1H0KA 2V7UA 5BR1A 2EXXA 1E89A 4W5WA 2R9RB 1PQYA 3F46A 1RLTA 2KBEA 2YYYA 3IIMA 1ONBA 4PM4A 1E1RD 1IHDA 5C51B 2EPKX 3KAKA 4KE8A 3OLVA 2IXGA 2O57A 4C0SA 3C43A 1IL0A 5EIWA 2WUGA 3HNRA 2XT9A 4BAUA 3LAWA 4D4MA 3EGWA 3EBPA 1GGHA 5K3FB 5C2JB 5JC8A 2FLVA 1ZMBA 3DV0A 4IJQA 1HZZA 1O0SA 2Z3WA 3LF1A 1N1CA 4C3EA 2YFHA 3EDOA 4FS8A 1L5MA 4FYKA 1JT9A 4NECA 3RT9A 5F52A 1FNTc 3SQXA 1VLLA 2OB1A 4QOSA 4EDHA 2VT2A 3OIVA 3UFBA 2W43A 4FGUA 2PD4A 2W2QA 1S2DA 1ZM9A 4IGAA 4KODA 1Q1AA 3KLBA 1DSSG 1TZKA 2WNIA 4ND2A 5ER6A 4KXYA 3ZVNA 3IQDB 5EJ2A 2FVYA 2HT6A 1IHOA 3EXHC 3GJ7A 3OFND 4OQLA 4P4GA 3T12A 1JIVA 3UQYS 5LOVF 5IAAA 4X45A 1E1NA 2GGSA 4G0XA 2Q5JA 3MAGA 5AOVA 5F98A 1BSVA 2VP3A 3CPSA 3HQ4O 3AF5A 4ANFA 2XDYA 3THYB 3H13A 1GV1A 3A04A 1POXA 4PPNA 2IBMA 5DYWA 4YT5A 4RANA 4HSGA 2ZCJA 4EL0A 2JFYA 5GZ1A 2FA9A 3NMIA 2R6CA 2FXVA 1B8UA 3GZTB 1SUEA 3QSYA 1ZY2A 4IFEA 3HCAA 4PRLA 3F90A 4D8WA 3PS9A 2LVBA 2JG3A 1JNXX 2QUHA 3QOYA 1MO4A 2G71A 3MK31 4PG7A 3ICEA 2WG1A 4H60A 2YASA 3JZDA 2VK2A 3TBFA 4R9RA 4X63A 3TO5A 4A92A 2EFCB 3UJBA 4DMCA 2LFDA 3F1KA 2ZI4A 2W2KA 3QY0A 2MSCB 1ICIA 1S8FA 4GBGA 4L0CA 1AJEA 3OPQA 4H9GA 1UAYA 4N0MA 1EG2A 4V2IA 1CUCA 2BGGA 4R84A 4XCQA 5AM4A 2H65A 4BHTA 2FZ4A 1G1MA 2G06A 1OU4A 3WK8A 3T0GA 1YLMA 2PX6A 2F8SA 4G0VA 4G7ZF 1HEUA 1ZOSA 5E7MA 1V0JA 1FOEB 4YN3A 2ZP1A 3W7BA 2PZBA 2LP4A 4DC0A 1E2PA 4DANA 1DAFA 3ULKA 2TMDA 2ZWIA 3WOVA 4ZIRA 5K09A 4N8EA 3US6A 3PIRA 1TW3A 4BE7B 3KZMA 1M6EX 2D5AA 2XWBF 3IRUA 1GKYA 2HRCA 4MKGA 4FXPA 1VE5A 3NCHA 1JSZA 4YS6A 1UM9B 3KDAA 1VL6A 2OILA 3K8OE 1HLGA 3HACA 1QV6A 4IHJA 4BCDA 2NVUB 2FE1A 3NXSA 3QF7A 1NBBA 2HLHA 4BQNA 2C54A 1XCBA 1PBTA 1SKBA 2V4MA 1G6OA 3IVGA 3L7CA 3CIOA 2C2YA 2D1FA 4MGHA 1XLTC 4AYWA 2FPUA 3JW8A 3OZIA 1KWKA 3A1EA 1KPHA 3V1TC 5I4IA 2ONKA 1QH8A 2IPOA 2VJAA 5L7TA 2PQ0A 4JYBA 4LYGA 5C1PA 4OFBA 4Y7CA 1J2YA 4AQYB 1Y9JA 4BVAA 4Z3OA 1L7NA 2J5XA 3S2ZA 1K9SA 3A6GA 4UEWA 4OXIA 5E4JA 1G16A 5CG1A 3ENZA 3OLCX 2GVNA 3I8SA 1IJEA 1H4VB 3GWZA 4OI2A 4TS1A 1SC9A 1TCVA 2BCEA 2X8JB 5D7NA 1XLTA 3GQVA 2YVLA 3IERA 4UDYX 2ENWA 2EBWA 4G0YA 4ML3A 4OYLA 1NSFA 3NIBA 1U0NA 4G1MB 3SGLA 7ABPA 1KIMA 121PA 5KJ6A 2E37A 4I6EA 4UUAA 4B82A 3TOXA 3UUWA 4ZRNA 2G88A 4D6PA 3BHNA 2EOAA 4ND8B 2FI1A 5CT6A 4YRSA 4CQMA 2NT4A 2YZ2A 1XJ5A 2X5XA 4RD3A 5I7AA 1Z18A 1D1SA 4TLEA 4Z8XA 5G40A 4K7JA 1GRCA 1KE1A 3JRTA 1Z23A 3U9TA 3OT1A 3GNQA 3T94A 2DFLA 2WHEA 3WLLA 2IXEA 3QXXA 5TMPA 1H2AS 2BV3A 3CVYA 2XSZA 2J9YB 1VJTA 1RRCA 1JYSA 4RD2A 4EG3A 4KITB 4UUMA 5GJWC 1R4NB 4QWMA 1NFFA 2OBNA 4WOKA 3QFHA 3O6XA 2FJUA 2TMYA 4MQ5A 2Y1EA 3QX8A 2R5FA 3VJMA 3AVYA 3ZWIA 5AKEA 1NKTA 2XCIA 3H5IA 4RSGA 2YRXA 1NF8A 3BYZA 3TOMA 3QFTA 2A5JA 1T2FA 2ZYSA 4H3KB 3HVIA 1IOZA 2IH5A 1KAEA 5WRFA 4J90A 9GPBA 2W90A 2XVMA 2XTAA 2VCEA 2CN1A 3ELBA 1FJ2A 1MCZA 2CJYA 3N6XA 3OIFA 4PPYA 4DMMA 5KTNA 3FOPA 2WSSD 5BWCA 4KG7A 1KXZA 1WJGA 2Y3IA 3IXMA 4XVRA 2FG7C 1D0SA 2WNSA 4H6XA 1P2BA 5CHEA 2REQB 4NV3A 4XUCA 4DCNA 4HUTA 3SIRA 5BY2A 3RVQA 4I8XA 3TM4A 2BEVA 3U37A 3IOCA 4UNRA 4AJ9A 1OAKA 2BE7A 3OOYA 3RPEA 1EH5A 1E1RA 1BG6A 2I7CA 4RMGA 1O96B 4YJGA 4O2BB 1JH8A 1Y89A 3C8GB 4J0CA 4LZNA 3MWKA 1O97C 2X4DA 3EIOA 3GYGA 1BJRE 3PDIA 4C6SA 1H6GA 3ORHA 5CEEA 2VWGA 5JQGB 3GPLA 3ZHYA 2HZBA 2D13A 3FBGA 3GT0A 2I6SA 3AOEA 4ILKA 4LUCA 1YUNA 1IE3A 1P1HA 3F6PA 2F43A 2BE5F 3GGPA 3MOSA 4PNHA 5FWYB 4EP1A 1RRKA 3T3DA 1NSGB 2RHWA 3R7LA 4D4IA 4EECA 1E9DA 3DTNA 3LMKA 2BZSA 2C84A 1OAAA 2PL3A 1BWPA 4QUEA 1PFKA 3ESBA 4DILA 3O10A 4WBNF 3TLEA 2Q3DA 2P2ZA 3WIBA 1XTZA 4JI4B 4D0NA 1WNFA 3GIWA 2OQRA 4TSFD 1SVWA 3B6MA 3CVWA 1HE4A 2HR1A 2R8EA 4ENVA 1BWQA 2QN8A 4HWKA 2P7IA 4ETNA 1E6UA 4JLNA 2EZTA 3OIYA 1ZG3A 5J47A 3HUFA 2GCOA 4AURA 1Z6ZA 2F1KA 3BK7A 3RC1A 4M87A 2OXCA 4V0MA 3CEAA 4BBZA 1AT1A 1HZJA 3BILA 1RE1A 3FGNA 3NEAA 5K0FA 3MQ2A 3RROA 2DLCX 4FWBA 4R3WA 1JQ5A 2ZYWX 3IMCA 4L51A 4U8GA 1FS6A 1RFGE 5JE8A 1QH0A 2VNSA 1YNSA 8ATCA 5TNXA 4GPIB 4HDNA 2NYVA 3LFUA 3MWGA 1VM6A 1R6XA 1V7QA 2CL0X 1KEEB 2BMFA 2DH6A 1R64A 5D01A 5ALWA 1BS1A 5AQEA 4LDAA 1AA9A 4UE2A 4JUCA 4CTNA 2VDJA 4JP1A 2RJNA 4EFNA 4LJ9A 3WLTA 3KJHA 5EQDA 1R4AA 2W6CX 2WEKA 2DTDA 3AVUA 4MJ7A 4EA6A 1EPUA 4MB0A 4RKYA 4RPJA 2ZUDA 2DKFA 5BN5A 2CFCA 1E2HA 3GRFA 1GDTA 3ZWCA 5KZMB 4RFLA 1TMOA 3QVLA 1U7DA 4YXWA 4XLNF 4F7WA 1Z0JA 2HMSA 5IULC 4B4WA 2VSYA 3IO3A 5CCEA 3GX1A 3H7IA 3ICOA 1MC1A 4CM5A 3LGAA 4Y9SA 4BZZA 1C8VB 2QUPA 4EHFA 4NMHA 2IBFA 3GC6A 3OFKA 3OQBA 3UAXA 4M88A 2KW3C 1UZLA 2WAYA 4D8XA 1QZXA 2PFSA 1J97A 5DBGA 1PNVA 1R4MB 4TZKA 5ALLA 3I4FA 4NU6A 2EHJA 3L0PA 4QXRA 3KQNA 2WJZB 1YR9A 1N6NA 4M0UA 2D6FA 1NC1A 2JLBA 4U6QA 1M2FA 2E49A 1Q20A 3C45A 3WXBA 3QEAZ 3LQ4A 4KE6A 1EK1A 2XS8A 3L2OB 4JI8B 4OFZA 1E5VA 4W6ZA 3ODPA 1QYIA 5FBHA 4BVFA 3FPLA 4DR5B 1P5HA 4G1BA 4OMDA 3A1FA 1G291 1TU4A 2HS5A 4N3CA 3RABA 1KWGA 4DV4B 1KR5A 4ZHQF 2NYRA 1Z6YA 1XTUA 2XNJA 4YL1A 2DP4E 3L7JA 1P2VA 3Q2IA 4X84A 4NZMA 3ZWKA 1ITZA 5DLEA 2FQ1A 3TOZA 3EW7A 1QHGA 2G0TA 5KU1A 3LCUA 2P4UA 2FMKA 3HCDA 3NHLA 4GIBA 4ISBA 1VSBA 3FCEA 4IYRA 5DHSA 1HDRA 2D0PB 2D1TA 1QAOA 2VI5A 1I4TD 4RMHA 1YRYE 5SZKB 2FGYA 3SEFA 4D9CA 5K8IA 1RCTE 1WPQA 2JEOA 1E96A 1L6IA 1OH6A 4AG3A 2ZI9A 1NSYA 1XB2A 5D1NA 3Q3EA 3R7AA 3IT1A 4EPXA 1XFAA 5F12A 3QVWA 5IN5A 1UBGA 2Y71A 1E5LA 3H0CA 4ID9A 5CA1B 3IL2A 2V9ZA 1JLHA 2H0QA 3IBFA 3HJNA 5K3FA 3VSBA 4LC1A 1A50B 2P9ZA 1T3TA 3RW9A 4LRUA 2GZ3A 5KX5A 3HK2A 2HJGA 3RVYA 1XRSB 4GI2A 2GZSA 3DE7X 1ZOIA 1RPTA 4QUHA 1Z0KA 4P4NA 5BO5A 3R75A 3WWYA 1NJ1A 1NDUA 1UEIA 2ATCA 4TMZA 4OQYA 1RKVA 3AUKA 3D5EA 5CX1A 3WWOA 5JZOA 5JNSA 3U7GA 4TS4A 2IOYA 5DW3A 1ID8A 1XZ8A 2OZLA 2YC2C 5EERA 2X3YA 1XEWY 3V7UA 2VSOA 3EC2A 4HDMA 3ANLA 4R68A 3M4BA 4WKCA 1W0JD 2FW9A 5KOHA 1QZ3A 4OGFA 2Q9BA 1UUFA 5IC5A 3NTQA 3WGUA 4GMGA 3V2UA 3X1KA 4IMPA 1QZZA 4MHOA 3W8IA 1KK2A 4Z7JA 3MFNA 1EUCA 2NPUA 3H2IA 2ZBPA 4RWEA 2IEZA 2OLJA 3QTHA 3HC7A 2VJQA 3NKLA 4L85A 3H2GA 1XPJA 3QPUA 4N7RA 1KC3A 4RLFA 5IJWA 2A3NA 4UM9D 3TLBA 1ECPA 4YCAA 5JJBA 3GODA 2A7XA 3QBVA 4JVSA 2A9FA 3GZNA 4Q19A 4QRIA 3B1JA 3W6PA 1UT8A 4GPTA 3AXSA 1L9KA 1OX4B 2ALJA 2XXJA 3CH5A 2GOYA 2H51A 3ETCA 2O8FA 3BERA 2E6KA 3O8RA 4LXIA 4LY6A 4IG4A 4JR1A 2G17A 4HO1X 1I7DA 2UUBB 4HMPA 3NB0A 4EX7A 2O6HA 1HE8B 1VECA 1ORRA 2BP7B 2ACWA 4ZO8A 2QG6A 3C3JA 3OKPA 3RBZA 3E9YA 4CEJB 1JFTA 2W2LD 1X2BA 3HCOA 1O8BA 2FZWA 4I1PA 1NG9A 4KW7A 3G0BA 3K9LA 4J7XA 3RREA 1FSPA 4O5AA 1PFGA 3GLQA 1XZMA 4MGEA 5M29A 2QL6A 1ZU5A 2EJBA 1A9PA 1V8PA 2Q4DA 3KKQA 3KTFA 4HR7A 4R9SA 4AMVA 2J07A 3G0DA 3K2BA 3QVUA 2FPSA 4XTCS 1QP4A 4KV9A 2DGJA 2HV8A 4BNDA 4U2CA 3EXHB 2UV8A 4OI0A 5TDHA 1QORA 1W19A 3ANXA 3FZQA 5IASA 4XQEA 5BNWA 4ZARA 1E3WA 1ZGAA 2FX2A 2HJRA 4FFRA 1QVAA 2V0CA 3U3BA 1K0UA 3UWKA 1QC5B 5HOEA 1ORDA 2WTAA 3LT5A 3N7UA 2HMTA 2UKDA 1NJGA 1JKXA 2QTCA 4I1YA 4YR9A 3REQB 1WXFA 5HPYB 1J42A 2QJFA 4X20B 1A71A 5FTKA 4CUJA 1N7JA 2RONA 1KL7A 1QG2A 3TJ5A 4UJ3A 2VDQB 2P61A 3L46A 2HIGA 4JOCA 3EG9A 1JG6A 2BGTA 2J59A 1ZQ9A 4Y9DA 5J4HA 2O0LA 4HPJB 2ZXPA 3A27A 3O47A 4QDJA 3IEVA 2BGJA 5C5CA 1KBOA 1UXIA 4K03A 2AHOA 2NOAA 1X87A 3DS8A 4IDDA 3Q15C 5FNZA 4JL5A 4LIPD 1DMRA 3KV1A 1WCYA 4ND3A 2FFQA 5DHUA 2H1FA 2H7CA 2BAGA 2IYSA 3UJCA 3U3RA 3O2QB 3QMPA 2ZYAA 2BKLA 2GR9A 1HDYA 3ABMC 2GO1A 2HOQA 3CO0S 1AHPA 5E1MA 3REQA 3JQ7B 3P52A 4ARCA 1DWQA 1DV2A 1RAAA 3U7HB 1Z4MA 6Q21A 3B1YA 1LSSA 4OSEA 3WR5A 4AQ7A 5LP6C 2VNIA 4B3TB 1JW9B 2AKYA 2P35A 3CWZA 5FUVA 1Z45A 4YT4A 3TJRA 4E4TA 4YPFA 2ERYA 1JFVA 3ZBQA 1T36A 1JXAA 5D00A 1JSRA 5FCLA 3HU1A 4Q7QA 1OI7A 5K8VA 3GP5A 1EQ1A 4WNCA 1V16A 2WC1A 2Y4OA 5AOAA 1E1DA 2BKXA 2YW9A 2CYDA 3B6JA 3PUJA 4RQBA 3QJGA 5DLPA 1F4VA 3RS4A 4V39A 1XJQA 3TMKA 2GHQA 1NN1A 4DBQA 5LKRA 2RKOA 3OWXA 2DH5A 2VTKA 3L0YA 3KB1A 3QYJA 1DUSA 2FR8A 5ICCA 1OFGA 2X14A 5JXWA 3DL2A 1CSEE 3P0IA 4JYPA 4BWVA 4ZVVA 2XRMA 1ZP6A 3UGKA 1AV6A 1UZMA 2DKNA 3OT1B 4UPEA 1KY3A 5REQB 1U3DA 1EFRA 1V45E 3HDQA 3MWDA 4E08A 1LE2A 3KKOA 1E1QD 5ALJA 4UM9B 3DCIA 1OYYA 3G8AA 4KACA 5E7JA 2GK6A 3RASA 2JIOA 2JD0A 3CW9A 2B5WA 3FF4A 1QIGA 4UC0A 4TKMA 1Z7WA 4OHVA 2PFDA 4YRBA 2BR3A 2XRFA 2OCGA 3NRJA 3CUSA 1JHYA 3PDWA 2PQMA 1RVV1 2FPIB 2B36A 2R5WA 4U6NA 3ZI4A 4ZZ1A 1Y6FA 1OBOA 3I0ZA 4Q82A 1HGXA 3ZG1A 4XOUA 4ZVKA 1ZXXA 1YZNA 5EHQA 4U5CE 2BRUC 2RGGA 1U63A 4LVCA 5DTMA 2XLHA 2C97A 3FAKA 4RD4A 4WKNA 1CUVA 5EUBA 3TSZA 1F9AA 3BT7A 4GP7A 1MNAA 1K8YB 1GUBA 1NIPA 2HA7A 4HFJA 4OOEA 4KR9A 3VNBA 1TK3A 3MBOA 5JT4A 2WRZA 3GEPA 4J1SA 4XTRA 1VYUA 5CFLA 4LHSA 1A9TA 1CUBA 3LT4A 1TD9A 3CR8A 3EQ2A 2X76A 3B9PA 4GQAA 3S2IA 4CCAA 4GKKB 4JXJA 3EFBA 4A6PA 1NYQA 1VKJA 4CM9A 2XLWA 2HU2A 5I8ZA 3BVPA 3IJRA 3TQOA 1SKYE 1UM8A 3N2IA 3VZCA 2QD3A 1VXRA 5LQAA 2DY1A 4GH5A 4YMSA 4C06A 3KQUA 3W5DA 1KBQA 2FUCA 1M67A 1M2WA 1MU0A 1YDEA 4I50B 3WHKA 3OU7A 2XCTB 1KIFA 3VVMA 3U40A 3BE4A 4CL2A 2HI0A 3KQVA 4QPDA 4M38A 4B8ZA 4F56A 5H9VA 5FFFA 2G5GX 3GEDA 2EERA 3BMCA 3IP6A 2KSFA 1ZGZA 3K72B 1XZFA 2FWIA 5AM5A 3I0NA 1U5BA 2FAXA 3CONA 1NBAA 2HCFA 4I8IA 3D7MA 1ZZPA 3R3YA 3SG0A 4M9ZA 1SWWA 3WA6A 2YJNA 2IJGX 5CW1A 3EVBA 4AXXA 1AXRA 3M6UA 1P2DA 5JRJA 2Y3BA 3M6LA 3L8JA 2OAGA 2QRLA 3KQWA 5JMWA 3C8GD 3MWEB 2XIJA 3AHHA 1NU9C 1C2YA 4J0JA 1Z63A 5G1PA 3UW1A 4ARZB 2W4BA 1I1QB 3TTWA 4KQHA 4BMDA 5C3MA 3NNNA 1SUDA 1PSWA 1OA0A 1P2TA 3E9DA 1CRPA 1Y6ZA 1MB2A 1T9CA 2EBHX 2FPPA 1W9MA 1PLKA 3GFFA 4Q3CA 4DMFA 3D4LA 2RBGA 1T4MA 3I30X 3R1IA 4RBNA 3FVWA 3TKAA 2H0RA 5T41A 3AVVA 1Q11A 1O87A 1CUHA 1NJSA 2BMJA 3EFHA 2MYNA 3GU3A 3LPCA 4WADA 3USES 1PT6A 3CF0A 4ONEA 5CNKA 4B6JA 3ACDA 1WVMA 5D2CA 3CLHA 3C39A 1OI4A 5B4UA 2G40A 3O3NB 4FJ2A 1DFGA 2QLJA 5H4HA 1KJNA 2WYIA 4HDKA 8MHTA 1NXWA 1IM5A 1E2FA 1U3FA 1UJBA 1PWHA 2I1QA 2B2XA 1JKJA 3IHTA 4LE2A 1HYQA 3T3HA 4DZTA 2DR2A 2TRSB 2HRDA 4X54A 1GP2A 3TQQA 2YZSA 4REOA 1SJ9A 4J1TA 4OBWA 1YMQA 3WL8A 4O4LB 1RMVA 1XCGB 2X0RA 5LA6A 2HK9A 2W22A 5TEVA