4YL1A

Crystal structures of mpges-1 inhibitor complexes
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
148
structure length
148
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Prostaglandin E synthase
publication title Crystal Structures of mPGES-1 Inhibitor Complexes Form a Basis for the Rational Design of Potent Analgesic and Anti-Inflammatory Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 148
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4yl1A00
4YK5A 4JC7A 2H8AA 3HKKA 2UUHA 4WABA 5BQIA 5K0IA 4J7TA 3B29A 4NTFA 4NTBA 4YL0A 5BQGA 4AL0A 2PNOA 4NTAA 4AL1A 4BPMA 5HV9A 3PCVA 4JCZA 4J7YA 2UUIA 5BQHA 3LEOA 4JRZA 2Q7RA 4YL3A 4YL1A 3DWWA
chains in the Genus database with same CATH superfamily
3VYWA 4U9DA 1L3PA 4ZLCA 4CBEA 4XLNF 3C8GA 3EGDB 4IGGA 3V5XA 3A11A 1CPQA 4EBKA 3FMSA 2PBEA 3VM6A 3U0CA 3F46A 4NTFA 4IRUA 4LDQA 2LIGA 4E17A 3GM2A 1H9TA 2GWWA 2W4BA 3Q7LA 3DD7A 3QW1A 1TWHA 2Y3BA 2Y69C 3AJMA 4BJ1A 1CGOA 5D91A 1FR0A 4ULWA 4U5CE 3OEOA 3EZHA 2L6FA 5DVWA 5T1DB 3VF0A 5KYWB 1I4YA 4EWCA 2HMQA 3IQ6A 1KTMA 1LIHA 1OKKD 1Y4CA 1OR2A 3RFYA 4CS8A 4P9FA 1NLXA 4JRZA 5COFA 3UGPA 2WVOA 3KH2A 2A0BA 1OCRC 1HW1A 4CDYA 1N1CA 1NU7D 1O3UA 1WN0A 2NUPB 3M15A 4XTKA 2NSFA 4XPWA 2Y3DA 2NUTB 2Q00A 1E85A 3Q7GA 2HV7A 3ZTMA 5KYUB 4B6IA 4C7OB 4IWBA 4U5DE 1PV3A 5DLJA 2IXOA 3B9QA 3S90A 3H2UA 4IJJA 4N4WA 2KGOA 4DRHB 4AL1A 4CIPA 2WZLA 1A7VA 4E0IA 4R32A 4NTAA 3B0PA 3CZ6A 1VB5A 2XM0A 4N06A 4U5FE 4OD5A 4XLPF 5T3WA 1GM5A 4CS9A 5AGFA 2V3CC 2IOQA 2YZSA 4NY3A 5JUAA 4YT8A 2HMZA 1H6GA 2VC9A 2EIJC 2YRFA 3HNJA 1FNTc 2Y39A 4ZLDA 2XLDA 4BG0A 4QI0A 3ATPA 5JLIA 1Z3IX 1OXBA 2L6HA 2XLWA 3LEOA 1BBHA 2L9JA 3CQZA 2P1AA 4O7GA 1YARO 3K7DA 5CI8A 3WG7C 3TJ6A 2RSEB 4PJJA 4BJTA 1A7EA 1Q0GA 5D92A 1SYQA 3E70C 4DOZA 2R7OA 3EGXB 1Z5ZA 2RD9A 2P61A 1YJGA 4OD4A 5AC5A 5BQIA 3JYHA 2YKZA 3UGOA 1XWJA 3L1MA 2HZ8A 3T9OA 2W45A 1FFHA 1EA8A 1OCZC 1S7ZA 2MYSA 3S29A 4F4BA 2R7RA 1RJ9B 2J7PA 2HSBA 1PD0A 4BJ5C 2OKUA 1RXQA 2LFDA 1D1BA 1K40A 2QUPA 2YL7A 1QVXA 4OIOF 2OQMA 1T01A 4XEVA 3AG1C 3MX3A 1YZAA 2LD6A 4W8PA 5DQZA 3ZG1A 2FAPB 4AE4A 5B3SC 5BUOA 3NMIA 4JW1A 3LLIA 4CDAA 4ER9A 4U5EE 1A41A 4KNVA 4XEFA 3R7CA 3U3FA 2DGJA 4QDLA 4JC7A 4X0RA 5B3IA 1FFTC 4CJOA 3KYIA 3T6GB 2XL6A 1YA7O 3FAJA 1ST6A 5K0IA 2B0HA 1V54C 2H7VC 2A69F 1SF8A 256BA 3B29A 2IBFA 3EH2A 3DJUB 4NTBA 2WVNA 3DMDA 4XWJA 1RCPA 2OG2A 2CW0F 3E9VA 3SXZA 1ZHTA 5JSLA 5CIVA 1JAFA 5JS5A 4J7YA 1D1AA 4H54A 1A7DA 2J45A 2XS8A 2YWAA 3GWNA 1NFNA 2PFDA 3KKBA 4O6NA 1GS9A 5EK0A 3FDQA 2TMVP 1VLSA 2DYRC 1TFKB 1Y6DA 3K1IC 1OW7A 1UFBA 1HE1A 1YVIA 2FFHA 2KK1A 1NZEA 4YL1A 4JIOA 2CNWA 4IAOA 3ZQVA 4Q5SF 3TJ5A 3I4UA 3LESA 3L8IA 4PACA 2LK4A 4DVYP 3EFOA 1NFOA 2LP4A 4PJMA 2YEVA 2Q3TA 1PCXA 2PX0A 1G4US 1D0XA 2A0UA 3ZTZA 1LPEA 2VB6A 1RKEB 4KNWA 4LERA 4M63A 1ORJA 3ZSUA 1OW8A 4JCZA 1WTYA 3QVZA 2MHRA 4JTDB 2ZD9A 3M4BA 4WJ0A 1MQVA 4UDVA 3NDBB 4U5GA 4CX9A 1ZW2A 2XXAB 1ORSC 1TFOB 3T4RA 3O6XA 4PK4A 2Q9CA 1XZPA 2J0XA 2O9XA 3I5QA 4JCHA 3GEIA 4H4KC 3X1OA 4CDVA 2YHSA 3IQTA 3C62A 2WB7A 3JRMO 5IY5C 3GWLA 3AGTA 2J9UA 3HKKA 2XL8A 1KNYA 1Q0DA 1OCOC 5DS6A 1XZQA 4MTFA 3B71A 4PFOA 1AUEA 1OKKA 2J9BA 1D0YA 3ABKC 1QQ3A 2P0NA 1PD1A 3M79A 3F47A 3K1HA 3FOPA 2XLEA 3GANA 4BJ6C 2VCCA 2OEVA 3ABLC 3C8GB 3HJCA 4A2NB 1HW2A 3G50A 3MLGA 4JVSA 3SP1A 1VTMP 2VASA 2Q9BA 4DBQA 4HFFB 2R7SA 2Q4FA 1ZYRF 3DM9B 1ZHYA 4IAQA 1Q0MA 4JJFA 2A1DD 1T9KA 1QLEC 1KU2A 4EIYA 1QZXA 3QVYA 1T6IA 2A68F 2YVKA 3NYJA 4I1OB 4K7BA 5KYYA 4FAPB 1BDJB 4BJ5A 3EZIA 2OOCA 1ZHZA 2W9YA 3LJBA 3U5SA 5A6BA 2R7TA 2P7VA 2R7UA 3NMJA 2F22A 3K66A 3V5YA 2OCCC 1J8YF 3EHMA 1VOMA 4AL0A 3K6BA 3N24A 2A6EF 1VYKA 2CYDA 2KC3A 3LS0A 3Q6MA 3HLZA 3NKEA 3C8GD 1BR2A 4EKWA 3JT1A 3ZQYA 3NRHA 2W4MA 4A4AA 4O6MA 4PJNA 1LS4A 1TWGA 3AG4C 3KPHA 2YL1A 2EPLX 3RQEA 3EG9A 3QZCA 2ASRA 4RBNA 3U9JA 1V4AA 3JRTA 2AWYA 2ICWG 3EHNA 1YAUO 5A6JA 1TWCA 4YL3A 3S0XA 3G4ZA 1LE4A 5F5FA 3DE9A 2R05A 1U0BB 4JKVA 4PJLA 3WODF 4YK5A 3U9MA 1BR1A 1MMNA 5COMA 1QKRA 2CCYA 1TKNA 4DBRA 2M64A 2YLDA 4W8KA 3NYLA 2MWQA 1VYIA 3LAYA 1YDIA 1RKCA 2CDQA 2WZGA 3QMKA 1OCCC 5BQGA 3RF3A 1A0BA 3ASOC 3DXJF 3CAXA 3PCVA 1ORYA 1E86A 4MVRA 1Z63A 2EPMX 3O55A 2AU5A 3IQCA 1AVOB 2HJMA 3SEOA 4MW8A 3PMRA 2UUIA 1M2VA 2XSEA 1MMDA 4P9TA 1JR8A 4MVZA 3U3BA 3UNGC 2J9VA 4G7OF 2JD3A 1AEPA 4JTAB 4LDRA 1V55C 1JRAA 4MQ9F 4MTOA 2EIKC 3W8IA 1E84A 1TWAA 1O87A 4OINF 2B0JA 2IXNA 1JOGA 2XLVA 2XLMA 3ECSA 3FXHA 4WGYA 5TJ5E 3SYNA 3S84A 4CSAA 2IYLD 3LEVA 1C02A 2H7OA 2R25A 4HFKB 4LDKA 4J32B 1SMYF 1YYJA 2KYHA 5E2QA 1L7CA 1ZU4A 3V5ZA 3HNIA 3DAFA 1ZVZA 2FGYA 4CS8C 5L0HA 2DB4A 4EHPA 1Q0KA 5T3TA 3BEHA 2EINC 2PX3A 1B68A 2KSFA 4JJGA 4AE4B 1U89A 5A6KA 2EILC 2NSGA 4C3EA 1J8MF 2OEXA 4DXWA 1FAPB 1G4WR 3L8JA 3ABMC 4Z9IA 2WVQA 4IARA 1HMOA 1NG1A 3T6JA 5EGYA 3JYYA 5JP7A 3WAQA 1YA9A 1WWPA 2KNHA 2D5RB 2QLAA 4PFPA 3S27A 1VMAA 2ZXRA 1GQAA 2J7PD 3UMKA 2PP4A 5KYXA 1LI7A 4CS9C 4Q4ZF 1C17M 3KYJA 4BEJA 5A6AA 3DZAA 1APCA 2YL3A 3TK0A 1ZW3A 4JZAA 4D4NA 4KC9A 3X2QC 3UR3C 4NQFA 3DKAA 1FMVA 2J8WA 3OWTA 5GPGB 3O10A 3ZDLA 3C8ZA 1MMAA 5L3VA 5F28E 2PNOA 1EI7A 1M2OA 2HV6A 4MW3A 3RVYA 2QTVA 3ZVRA 4OIQF 4JE9A 4G0HA 4MTGA 1YYXA 1SZIA 3EFOB 4ULVA 1WOLA 3V7OA 5JVEA 3EJNA 2Y3HA 3ASNC 4NC3A 3FHDA 3LNMB 3W4YA 1K05A 2AVKA 4HE8D 4C3BA 4YJWA 3UMHA 1DOVA 2XS1A 2EPOA 2XL4A 2EPKX 3M4CA 4XEKA 2Q7RA 2OJQA 1EKYA 3TOLA 2D4UA 2ZXOA 4Z9HA 5F5HA 1LM3B 3DM5A 1QPUA 2LCHA 4DRJB 2J46A 2C03A 2L7AA 3S28A 4GEHA 3B0UX 4OIPF 3US6A 4JEAA 3TOMA 3AG3C 1Z7Qc 1MMGA 5L0DA 4XQ1A 1T6UA 2ZXWC 3DJNB 2OU6A 3OA1A 4FX5A 1RMVA 2VCAA 2CNWD 5HV9A 4GQHA 1HY5A 2HKVA 3IPMO 1OXKA 1ZU5A 4LLEA 2L81A 2DYSC 2R02A 2Z15A 3L34A 4PR9A 5JT4A 2BL2A 2CGEA 2I15A 4MVSA 2X0CA 4MNDA 3JTLO 3B0VC 2XRHA 2LQGA 3EGDA 2BE5F 1Z6AA 4MVOA 2NG1A 3HNKA 1T6QA 3EH1A 5FZTA 3TD7A 4EBBA 4YT4A 3IHUA 1I5NA 1EQ1A 1I4ZA 3UMIA 2QY9A 2VCBA 4MVMA 2ETSA 3MYFA 1UG7A 1D0ZA 1GGQA 3QTHA 4JEBA 5B1AC 2G3KA 1FTSA 4Z9JA 4WABA 3W8HA 3MBGA 3NYMA 5KYWA 1YZCA 1IW7F 3SXKA 3PDMP 1ZHWA 1E2XA 3A9CA 3DE8A 3N2ZB 3N0TA 2Y3GA 5L0CA 2XM4A 5B1BC 1DOWA 3Q6NA 4U5HA 3KMIA 2PF4E 3GODA 2YLIA 4N6HA 4K1OA 5KYYB 2NUPA 1ZZPA 5E3CA 4DJ9A 3RYLA 1ZHXA 2R7QA 2NUTA 2BC5A 4L6RA 4MS2A 2HFIA 5KYUA 4C7OA 2R7VA 2R03A 1LI5A 3GEEA 4ONSA 4Q7CA 5KYNA 4JTCB 1V74B 5E33A 2QNLA 1R5ID 3NMKA 2GFHA 2YLGA 3GEHA 3NG1A 2JPUA 3C18A 2I8BA 4FWVA 3CEXA 4MVUA 1NU9C 1TR2A 3BRJA 4DVZA 4MVQA 2H8AA 3EG9B 3H65A 3L0IA 1G5ZA 4XPXA 5A69A 5L0GA 2J9WA 2R7XA 3RQFA 1WASA 2XLHA 2WL8A 3JZ0A 3MFNA 3O39A 3SXYA 3AQBA 4BEMJ 5L3QA 1CGNA 2DI3A 4J7TA 2LFFA 1K04A 1BR4A 3RW0A 4E18A 2VH3A 3K1IA 3H2VA 1T5OA 1U6HA 5A6BD 1D1CA 2YL0A 1OQCA 4E7SA 3C63A 4YT5A 2M4EA 5COGA 3ZWIA 5EHHA 1OR3A 3I5PA 3VAYA 1LKXA 4LACB 1BZ4A 3EGXA 3RIPA 1C03A 4P6IC 4U5BE 3RQGA 2ZXPA 4I1MA 3RVZA 3VRCA 3J06A 1SR2A 1LVKA 1M2VB 1VLTA 2J0WA 3ZIBA 3LS1A 1RJ9A 5FCLA 3KL4A 1YLMA 2P6VA 4C3DA 3CSKA 2IXMA 1NSGB 5JRAA 5AC4A 2G62A 5DS5A 1JPNA 2LSEA 4YL0A 5HSWA 4CIHA 4EBJA 3AGUA 1E83A 3MYIA 4KBLA 4CJGA 3AQCA 3U8VA 3LUTB 5DS4A 3GORA 3AG2C 4J30B 2R7WA 2OJED 1QSPA 1Q0FA 3DAGA 3EPVA 3LNRA 4EUKB 4G78A 4RDAA 3HNLA 1IZMA 2IXPA 3PHF2 2IM8A 3M1CB 1NBBA 5E3AA 4HEAJ 1CGME 1R4TA 5L0IA 4OIRF 2GA0A 3EQLF 3NKDA 3IEEA 2KW3C 3QW0A 1OW6A 4I44A 2QE9A 4G7HF 4BJ6A 3T6BA 3SXMA 3SZRA 4LLCA 3TULA 5DQTA 2AP3A 2EIMC 2NPUA 4DRIB 1JPJA 5KYXB 1M6TA 2JX0A 4N6CA 2A6HF 4BPMA 4K0DA 2AWCA 1VK5A 3FAPB 1HE9A 1Z23A 2KJGA 1WATA 3LLKA 3FVYA 1MNDA 5L0FA 2GDCA 3HTKC 2GAQA 3S9OA 3IQ5A 5BQHA 2L6GA 4E7ZA 1M57C 3U2LA 3POVA 1MNEA 3GM1A 4KI2A 3U8PA 3GM3A 3JSZA 1F1MA 3JCUQ 4YT2A 2KQ9A 1RKEA 2HJ3A 1WGWA 2R9RB 1LS1A 4RD9A 3RKOF 3ITFA 2WZFA 4G7ZF 2H7BA 1HMDA 4XPYA 1S05A 3TQOA 2C04A 2UUHA 3JSEO 4O6YA 1FMWA 4D4XA 3W2VA 3G4XA 1JMWA 2V26A 4CSAC 4O79A 2XXAA 2E87A 1H7IA 3DI5A 3R2PA 3C7JA 3ZC4A 4AK9A 5CI9A 2HUJA 3W2WA 3WHNA 4IB4A 5L0JA 1CPRA 4YN0B 4CS7A 2EPNA 3AOUA 3RH3A 4AX2A 4GYTA 3U2MA 4E0HA 4YWQA 4JURI 2Q9AA 2X51A 2HSQA 2YQYA 3K33A 1M56C 4QI2A 1LE2A 2ZPAA 4FESA 1W2WA 2XLOA 3FOOA 4U9EA 4WGZA 3SNHA 1TQGA 1G8XA 4NCQA 4ANJA 4I3MA 2HS5A 1H9GA 1O5HA 3DWWA 2G3VA
chains in the Genus database with same CATH topology
4YK5A 4JC7A 2H8AA 3HKKA 2UUHA 4WABA 5BQIA 5K0IA 4J7TA 3B29A 4NTFA 4NTBA 4YL0A 5BQGA 4AL0A 2PNOA 4NTAA 4AL1A 4BPMA 5HV9A 3PCVA 4JCZA 4J7YA 2UUIA 5BQHA 3LEOA 4JRZA 2Q7RA 4YL3A 4YL1A 3DWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YK5 A;  4JC7 A;  2H8A A;  3HKK A;  2UUH A;  4WAB A;  5BQI A;  5K0I A;  4J7T A;  3B29 A;  4NTF A;  4NTB A;  4YL0 A;  5BQG A;  4AL0 A;  2PNO A;  4NTA A;  4AL1 A;  4BPM A;  5HV9 A;  3PCV A;  4JCZ A;  4J7Y A;  2UUI A;  5BQH A;  3LEO A;  4JRZ A;  2Q7R A;  4YL3 A;  4YL1 A;  3DWW A; 
#chains in the Genus database with same CATH topology
 3VYW A;  4U9D A;  1L3P A;  4ZLC A;  4CBE A;  4XLN F;  3C8G A;  3EGD B;  4IGG A;  3V5X A;  3A11 A;  1CPQ A;  4EBK A;  3FMS A;  2PBE A;  3VM6 A;  3U0C A;  3F46 A;  4NTF A;  4IRU A;  4LDQ A;  2LIG A;  4E17 A;  3GM2 A;  1H9T A;  2GWW A;  2W4B A;  3Q7L A;  3DD7 A;  3QW1 A;  1TWH A;  2Y3B A;  2Y69 C;  3AJM A;  4BJ1 A;  1CGO A;  5D91 A;  1FR0 A;  4ULW A;  4U5C E;  3OEO A;  3EZH A;  2L6F A;  5DVW A;  5T1D B;  3VF0 A;  5KYW B;  1I4Y A;  4EWC A;  2HMQ A;  3IQ6 A;  1KTM A;  1LIH A;  1OKK D;  1Y4C A;  1OR2 A;  3RFY A;  4CS8 A;  4P9F A;  1NLX A;  4JRZ A;  5COF A;  3UGP A;  2WVO A;  3KH2 A;  2A0B A;  1OCR C;  1HW1 A;  4CDY A;  1N1C A;  1NU7 D;  1O3U A;  1WN0 A;  2NUP B;  3M15 A;  4XTK A;  2NSF A;  4XPW A;  2Y3D A;  2NUT B;  2Q00 A;  1E85 A;  3Q7G A;  2HV7 A;  3ZTM A;  5KYU B;  4B6I A;  4C7O B;  4IWB A;  4U5D E;  1PV3 A;  5DLJ A;  2IXO A;  3B9Q A;  3S90 A;  3H2U A;  4IJJ A;  4N4W A;  2KGO A;  4DRH B;  4AL1 A;  4CIP A;  2WZL A;  1A7V A;  4E0I A;  4R32 A;  4NTA A;  3B0P A;  3CZ6 A;  1VB5 A;  2XM0 A;  4N06 A;  4U5F E;  4OD5 A;  4XLP F;  5T3W A;  1GM5 A;  4CS9 A;  5AGF A;  2V3C C;  2IOQ A;  2YZS A;  4NY3 A;  5JUA A;  4YT8 A;  2HMZ A;  1H6G A;  2VC9 A;  2EIJ C;  2YRF A;  3HNJ A;  1FNT c;  2Y39 A;  4ZLD A;  2XLD A;  4BG0 A;  4QI0 A;  3ATP A;  5JLI A;  1Z3I X;  1OXB A;  2L6H A;  2XLW A;  3LEO A;  1BBH A;  2L9J A;  3CQZ A;  2P1A A;  4O7G A;  1YAR O;  3K7D A;  5CI8 A;  3WG7 C;  3TJ6 A;  2RSE B;  4PJJ A;  4BJT A;  1A7E A;  1Q0G A;  5D92 A;  1SYQ A;  3E70 C;  4DOZ A;  2R7O A;  3EGX B;  1Z5Z A;  2RD9 A;  2P61 A;  1YJG A;  4OD4 A;  5AC5 A;  5BQI A;  3JYH A;  2YKZ A;  3UGO A;  1XWJ A;  3L1M A;  2HZ8 A;  3T9O A;  2W45 A;  1FFH A;  1EA8 A;  1OCZ C;  1S7Z A;  2MYS A;  3S29 A;  4F4B A;  2R7R A;  1RJ9 B;  2J7P A;  2HSB A;  1PD0 A;  4BJ5 C;  2OKU A;  1RXQ A;  2LFD A;  1D1B A;  1K40 A;  2QUP A;  2YL7 A;  1QVX A;  4OIO F;  2OQM A;  1T01 A;  4XEV A;  3AG1 C;  3MX3 A;  1YZA A;  2LD6 A;  4W8P A;  5DQZ A;  3ZG1 A;  2FAP B;  4AE4 A;  5B3S C;  5BUO A;  3NMI A;  4JW1 A;  3LLI A;  4CDA A;  4ER9 A;  4U5E E;  1A41 A;  4KNV A;  4XEF A;  3R7C A;  3U3F A;  2DGJ A;  4QDL A;  4JC7 A;  4X0R A;  5B3I A;  1FFT C;  4CJO A;  3KYI A;  3T6G B;  2XL6 A;  1YA7 O;  3FAJ A;  1ST6 A;  5K0I A;  2B0H A;  1V54 C;  2H7V C;  2A69 F;  1SF8 A;  256B A;  3B29 A;  2IBF A;  3EH2 A;  3DJU B;  4NTB A;  2WVN A;  3DMD A;  4XWJ A;  1RCP A;  2OG2 A;  2CW0 F;  3E9V A;  3SXZ A;  1ZHT A;  5JSL A;  5CIV A;  1JAF A;  5JS5 A;  4J7Y A;  1D1A A;  4H54 A;  1A7D A;  2J45 A;  2XS8 A;  2YWA A;  3GWN A;  1NFN A;  2PFD A;  3KKB A;  4O6N A;  1GS9 A;  5EK0 A;  3FDQ A;  2TMV P;  1VLS A;  2DYR C;  1TFK B;  1Y6D A;  3K1I C;  1OW7 A;  1UFB A;  1HE1 A;  1YVI A;  2FFH A;  2KK1 A;  1NZE A;  4YL1 A;  4JIO A;  2CNW A;  4IAO A;  3ZQV A;  4Q5S F;  3TJ5 A;  3I4U A;  3LES A;  3L8I A;  4PAC A;  2LK4 A;  4DVY P;  3EFO A;  1NFO A;  2LP4 A;  4PJM A;  2YEV A;  2Q3T A;  1PCX A;  2PX0 A;  1G4U S;  1D0X A;  2A0U A;  3ZTZ A;  1LPE A;  2VB6 A;  1RKE B;  4KNW A;  4LER A;  4M63 A;  1ORJ A;  3ZSU A;  1OW8 A;  4JCZ A;  1WTY A;  3QVZ A;  2MHR A;  4JTD B;  2ZD9 A;  3M4B A;  4WJ0 A;  1MQV A;  4UDV A;  3NDB B;  4U5G A;  4CX9 A;  1ZW2 A;  2XXA B;  1ORS C;  1TFO B;  3T4R A;  3O6X A;  4PK4 A;  2Q9C A;  1XZP A;  2J0X A;  2O9X A;  3I5Q A;  4JCH A;  3GEI A;  4H4K C;  3X1O A;  4CDV A;  2YHS A;  3IQT A;  3C62 A;  2WB7 A;  3JRM O;  5IY5 C;  3GWL A;  3AGT A;  2J9U A;  3HKK A;  2XL8 A;  1KNY A;  1Q0D A;  1OCO C;  5DS6 A;  1XZQ A;  4MTF A;  3B71 A;  4PFO A;  1AUE A;  1OKK A;  2J9B A;  1D0Y A;  3ABK C;  1QQ3 A;  2P0N A;  1PD1 A;  3M79 A;  3F47 A;  3K1H A;  3FOP A;  2XLE A;  3GAN A;  4BJ6 C;  2VCC A;  2OEV A;  3ABL C;  3C8G B;  3HJC A;  4A2N B;  1HW2 A;  3G50 A;  3MLG A;  4JVS A;  3SP1 A;  1VTM P;  2VAS A;  2Q9B A;  4DBQ A;  4HFF B;  2R7S A;  2Q4F A;  1ZYR F;  3DM9 B;  1ZHY A;  4IAQ A;  1Q0M A;  4JJF A;  2A1D D;  1T9K A;  1QLE C;  1KU2 A;  4EIY A;  1QZX A;  3QVY A;  1T6I A;  2A68 F;  2YVK A;  3NYJ A;  4I1O B;  4K7B A;  5KYY A;  4FAP B;  1BDJ B;  4BJ5 A;  3EZI A;  2OOC A;  1ZHZ A;  2W9Y A;  3LJB A;  3U5S A;  5A6B A;  2R7T A;  2P7V A;  2R7U A;  3NMJ A;  2F22 A;  3K66 A;  3V5Y A;  2OCC C;  1J8Y F;  3EHM A;  1VOM A;  4AL0 A;  3K6B A;  3N24 A;  2A6E F;  1VYK A;  2CYD A;  2KC3 A;  3LS0 A;  3Q6M A;  3HLZ A;  3NKE A;  3C8G D;  1BR2 A;  4EKW A;  3JT1 A;  3ZQY A;  3NRH A;  2W4M A;  4A4A A;  4O6M A;  4PJN A;  1LS4 A;  1TWG A;  3AG4 C;  3KPH A;  2YL1 A;  2EPL X;  3RQE A;  3EG9 A;  3QZC A;  2ASR A;  4RBN A;  3U9J A;  1V4A A;  3JRT A;  2AWY A;  2ICW G;  3EHN A;  1YAU O;  5A6J A;  1TWC A;  4YL3 A;  3S0X A;  3G4Z A;  1LE4 A;  5F5F A;  3DE9 A;  2R05 A;  1U0B B;  4JKV A;  4PJL A;  3WOD F;  4YK5 A;  3U9M A;  1BR1 A;  1MMN A;  5COM A;  1QKR A;  2CCY A;  1TKN A;  4DBR A;  2M64 A;  2YLD A;  4W8K A;  3NYL A;  2MWQ A;  1VYI A;  3LAY A;  1YDI A;  1RKC A;  2CDQ A;  2WZG A;  3QMK A;  1OCC C;  5BQG A;  3RF3 A;  1A0B A;  3ASO C;  3DXJ F;  3CAX A;  3PCV A;  1ORY A;  1E86 A;  4MVR A;  1Z63 A;  2EPM X;  3O55 A;  2AU5 A;  3IQC A;  1AVO B;  2HJM A;  3SEO A;  4MW8 A;  3PMR A;  2UUI A;  1M2V A;  2XSE A;  1MMD A;  4P9T A;  1JR8 A;  4MVZ A;  3U3B A;  3UNG C;  2J9V A;  4G7O F;  2JD3 A;  1AEP A;  4JTA B;  4LDR A;  1V55 C;  1JRA A;  4MQ9 F;  4MTO A;  2EIK C;  3W8I A;  1E84 A;  1TWA A;  1O87 A;  4OIN F;  2B0J A;  2IXN A;  1JOG A;  2XLV A;  2XLM A;  3ECS A;  3FXH A;  4WGY A;  5TJ5 E;  3SYN A;  3S84 A;  4CSA A;  2IYL D;  3LEV A;  1C02 A;  2H7O A;  2R25 A;  4HFK B;  4LDK A;  4J32 B;  1SMY F;  1YYJ A;  2KYH A;  5E2Q A;  1L7C A;  1ZU4 A;  3V5Z A;  3HNI A;  3DAF A;  1ZVZ A;  2FGY A;  4CS8 C;  5L0H A;  2DB4 A;  4EHP A;  1Q0K A;  5T3T A;  3BEH A;  2EIN C;  2PX3 A;  1B68 A;  2KSF A;  4JJG A;  4AE4 B;  1U89 A;  5A6K A;  2EIL C;  2NSG A;  4C3E A;  1J8M F;  2OEX A;  4DXW A;  1FAP B;  1G4W R;  3L8J A;  3ABM C;  4Z9I A;  2WVQ A;  4IAR A;  1HMO A;  1NG1 A;  3T6J A;  5EGY A;  3JYY A;  5JP7 A;  3WAQ A;  1YA9 A;  1WWP A;  2KNH A;  2D5R B;  2QLA A;  4PFP A;  3S27 A;  1VMA A;  2ZXR A;  1GQA A;  2J7P D;  3UMK A;  2PP4 A;  5KYX A;  1LI7 A;  4CS9 C;  4Q4Z F;  1C17 M;  3KYJ A;  4BEJ A;  5A6A A;  3DZA A;  1APC A;  2YL3 A;  3TK0 A;  1ZW3 A;  4JZA A;  4D4N A;  4KC9 A;  3X2Q C;  3UR3 C;  4NQF A;  3DKA A;  1FMV A;  2J8W A;  3OWT A;  5GPG B;  3O10 A;  3ZDL A;  3C8Z A;  1MMA A;  5L3V A;  5F28 E;  2PNO A;  1EI7 A;  1M2O A;  2HV6 A;  4MW3 A;  3RVY A;  2QTV A;  3ZVR A;  4OIQ F;  4JE9 A;  4G0H A;  4MTG A;  1YYX A;  1SZI A;  3EFO B;  4ULV A;  1WOL A;  3V7O A;  5JVE A;  3EJN A;  2Y3H A;  3ASN C;  4NC3 A;  3FHD A;  3LNM B;  3W4Y A;  1K05 A;  2AVK A;  4HE8 D;  4C3B A;  4YJW A;  3UMH A;  1DOV A;  2XS1 A;  2EPO A;  2XL4 A;  2EPK X;  3M4C A;  4XEK A;  2Q7R A;  2OJQ A;  1EKY A;  3TOL A;  2D4U A;  2ZXO A;  4Z9H A;  5F5H A;  1LM3 B;  3DM5 A;  1QPU A;  2LCH A;  4DRJ B;  2J46 A;  2C03 A;  2L7A A;  3S28 A;  4GEH A;  3B0U X;  4OIP F;  3US6 A;  4JEA A;  3TOM A;  3AG3 C;  1Z7Q c;  1MMG A;  5L0D A;  4XQ1 A;  1T6U A;  2ZXW C;  3DJN B;  2OU6 A;  3OA1 A;  4FX5 A;  1RMV A;  2VCA A;  2CNW D;  5HV9 A;  4GQH A;  1HY5 A;  2HKV A;  3IPM O;  1OXK A;  1ZU5 A;  4LLE A;  2L81 A;  2DYS C;  2R02 A;  2Z15 A;  3L34 A;  4PR9 A;  5JT4 A;  2BL2 A;  2CGE A;  2I15 A;  4MVS A;  2X0C A;  4MND A;  3JTL O;  3B0V C;  2XRH A;  2LQG A;  3EGD A;  2BE5 F;  1Z6A A;  4MVO A;  2NG1 A;  3HNK A;  1T6Q A;  3EH1 A;  5FZT A;  3TD7 A;  4EBB A;  4YT4 A;  3IHU A;  1I5N A;  1EQ1 A;  1I4Z A;  3UMI A;  2QY9 A;  2VCB A;  4MVM A;  2ETS A;  3MYF A;  1UG7 A;  1D0Z A;  1GGQ A;  3QTH A;  4JEB A;  5B1A C;  2G3K A;  1FTS A;  4Z9J A;  4WAB A;  3W8H A;  3MBG A;  3NYM A;  5KYW A;  1YZC A;  1IW7 F;  3SXK A;  3PDM P;  1ZHW A;  1E2X A;  3A9C A;  3DE8 A;  3N2Z B;  3N0T A;  2Y3G A;  5L0C A;  2XM4 A;  5B1B C;  1DOW A;  3Q6N A;  4U5H A;  3KMI A;  2PF4 E;  3GOD A;  2YLI A;  4N6H A;  4K1O A;  5KYY B;  2NUP A;  1ZZP A;  5E3C A;  4DJ9 A;  3RYL A;  1ZHX A;  2R7Q A;  2NUT A;  2BC5 A;  4L6R A;  4MS2 A;  2HFI A;  5KYU A;  4C7O A;  2R7V A;  2R03 A;  1LI5 A;  3GEE A;  4ONS A;  4Q7C A;  5KYN A;  4JTC B;  1V74 B;  5E33 A;  2QNL A;  1R5I D;  3NMK A;  2GFH A;  2YLG A;  3GEH A;  3NG1 A;  2JPU A;  3C18 A;  2I8B A;  4FWV A;  3CEX A;  4MVU A;  1NU9 C;  1TR2 A;  3BRJ A;  4DVZ A;  4MVQ A;  2H8A A;  3EG9 B;  3H65 A;  3L0I A;  1G5Z A;  4XPX A;  5A69 A;  5L0G A;  2J9W A;  2R7X A;  3RQF A;  1WAS A;  2XLH A;  2WL8 A;  3JZ0 A;  3MFN A;  3O39 A;  3SXY A;  3AQB A;  4BEM J;  5L3Q A;  1CGN A;  2DI3 A;  4J7T A;  2LFF A;  1K04 A;  1BR4 A;  3RW0 A;  4E18 A;  2VH3 A;  3K1I A;  3H2V A;  1T5O A;  1U6H A;  5A6B D;  1D1C A;  2YL0 A;  1OQC A;  4E7S A;  3C63 A;  4YT5 A;  2M4E A;  5COG A;  3ZWI A;  5EHH A;  1OR3 A;  3I5P A;  3VAY A;  1LKX A;  4LAC B;  1BZ4 A;  3EGX A;  3RIP A;  1C03 A;  4P6I C;  4U5B E;  3RQG A;  2ZXP A;  4I1M A;  3RVZ A;  3VRC A;  3J06 A;  1SR2 A;  1LVK A;  1M2V B;  1VLT A;  2J0W A;  3ZIB A;  3LS1 A;  1RJ9 A;  5FCL A;  3KL4 A;  1YLM A;  2P6V A;  4C3D A;  3CSK A;  2IXM A;  1NSG B;  5JRA A;  5AC4 A;  2G62 A;  5DS5 A;  1JPN A;  2LSE A;  4YL0 A;  5HSW A;  4CIH A;  4EBJ A;  3AGU A;  1E83 A;  3MYI A;  4KBL A;  4CJG A;  3AQC A;  3U8V A;  3LUT B;  5DS4 A;  3GOR A;  3AG2 C;  4J30 B;  2R7W A;  2OJE D;  1QSP A;  1Q0F A;  3DAG A;  3EPV A;  3LNR A;  4EUK B;  4G78 A;  4RDA A;  3HNL A;  1IZM A;  2IXP A;  3PHF 2;  2IM8 A;  3M1C B;  1NBB A;  5E3A A;  4HEA J;  1CGM E;  1R4T A;  5L0I A;  4OIR F;  2GA0 A;  3EQL F;  3NKD A;  3IEE A;  2KW3 C;  3QW0 A;  1OW6 A;  4I44 A;  2QE9 A;  4G7H F;  4BJ6 A;  3T6B A;  3SXM A;  3SZR A;  4LLC A;  3TUL A;  5DQT A;  2AP3 A;  2EIM C;  2NPU A;  4DRI B;  1JPJ A;  5KYX B;  1M6T A;  2JX0 A;  4N6C A;  2A6H F;  4BPM A;  4K0D A;  2AWC A;  1VK5 A;  3FAP B;  1HE9 A;  1Z23 A;  2KJG A;  1WAT A;  3LLK A;  3FVY A;  1MND A;  5L0F A;  2GDC A;  3HTK C;  2GAQ A;  3S9O A;  3IQ5 A;  5BQH A;  2L6G A;  4E7Z A;  1M57 C;  3U2L A;  3POV A;  1MNE A;  3GM1 A;  4KI2 A;  3U8P A;  3GM3 A;  3JSZ A;  1F1M A;  3JCU Q;  4YT2 A;  2KQ9 A;  1RKE A;  2HJ3 A;  1WGW A;  2R9R B;  1LS1 A;  4RD9 A;  3RKO F;  3ITF A;  2WZF A;  4G7Z F;  2H7B A;  1HMD A;  4XPY A;  1S05 A;  3TQO A;  2C04 A;  2UUH A;  3JSE O;  4O6Y A;  1FMW A;  4D4X A;  3W2V A;  3G4X A;  1JMW A;  2V26 A;  4CSA C;  4O79 A;  2XXA A;  2E87 A;  1H7I A;  3DI5 A;  3R2P A;  3C7J A;  3ZC4 A;  4AK9 A;  5CI9 A;  2HUJ A;  3W2W A;  3WHN A;  4IB4 A;  5L0J A;  1CPR A;  4YN0 B;  4CS7 A;  2EPN A;  3AOU A;  3RH3 A;  4AX2 A;  4GYT A;  3U2M A;  4E0H A;  4YWQ A;  4JUR I;  2Q9A A;  2X51 A;  2HSQ A;  2YQY A;  3K33 A;  1M56 C;  4QI2 A;  1LE2 A;  2ZPA A;  4FES A;  1W2W A;  2XLO A;  3FOO A;  4U9E A;  4WGZ A;  3SNH A;  1TQG A;  1G8X A;  4NCQ A;  4ANJ A;  4I3M A;  2HS5 A;  1H9G A;  1O5H A;  3DWW A;  2G3V A; 
#chains in the Genus database with same CATH homology
 4YK5 A;  4JC7 A;  2H8A A;  3HKK A;  2UUH A;  4WAB A;  5BQI A;  5K0I A;  4J7T A;  3B29 A;  4NTF A;  4NTB A;  4YL0 A;  5BQG A;  4AL0 A;  2PNO A;  4NTA A;  4AL1 A;  4BPM A;  5HV9 A;  3PCV A;  4JCZ A;  4J7Y A;  2UUI A;  5BQH A;  3LEO A;  4JRZ A;  2Q7R A;  4YL3 A;  4YL1 A;  3DWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...