4YL1A

Crystal structures of mpges-1 inhibitor complexes
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
148
structure length
148
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Crystal Structures of mPGES-1 Inhibitor Complexes Form a Basis for the Rational Design of Potent Analgesic and Anti-Inflammatory Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 65
structure length 148
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4yl1A00
3HKKA 4YL0A 5BQIA 4WABA 4AL0A 4NTFA 4YL3A 4J7TA 5BQGA 4BPMA 4JRZA 2Q7RA 2UUHA 3LEOA 4YL1A 5K0IA 4NTAA 4YK5A 4JC7A 5BQHA 2UUIA 4J7YA 2H8AA 4NTBA 4AL1A 2PNOA 3DWWA 5HV9A 3B29A 3PCVA 4JCZA
chains in the Genus database with same CATH superfamily
3R2PA 4G7OF 2CYDA 1OQCA 4Q4ZF 1K05A 2DYRC 2R7XA 2YVKA 4ULVA 3E70C 3EFOB 1HY5A 2XM0A 1VYIA 3JTLO 3UMIA 4LERA 2EPLX 1UFBA 4JRZA 4CDYA 1WN0A 1V74B 2CDQA 3PDMP 1Y6DA 3CQZA 2G62A 3HNJA 5JLIA 1E86A 1YJGA 2IYLD 1MMAA 3IQCA 1A41A 1WASA 3I5QA 3VYWA 2NG1A 3W8HA 1T5OA 4LACB 2YL0A 3ZQVA 5BUOA 1VLTA 2I15A 3K7DA 1A0BA 1FFHA 3JYHA 1Q0GA 2L9JA 3N24A 5T1DB 3Q7LA 4IJJA 2G3KA 2EIMC 2HV6A 2R7QA 3BRJA 4H54A 2LD6A 4YWQA 5A6AA 1RJ9B 1YZCA 1XZQA 1L7CA 5KYXB 2YL1A 3S28A 3S0XA 3JYYA 4MNDA 1NBBA 4N6HA 2XSEA 3EG9B 4XWJA 1LS1A 3Q6NA 5E3CA 5COFA 1Y4CA 3M79A 3OA1A 3OWTA 4GYTA 4GEHA 4IB4A 4LLCA 4CSAC 1I4ZA 4HEAJ 3KYJA 2BC5A 3FVYA 4JTAB 5F28E 4RDAA 3U8PA 1ZVZA 3FAJA 4IWBA 4Z9IA 3UMKA 2W45A 4I3MA 4YK5A 3WG7C 1V55C 3U5SA 3WHNA 3EGDA 2R7WA 2TMVP 1EQ1A 2YKZA 3H2UA 1AEPA 3QVYA 4XPWA 1Z7Qc 5L0JA 5L0CA 1CGOA 1SMYF 3DE8A 4MVUA 2XLEA 2XXAA 4HFKB 1NU9C 2E87A 5T3WA 1R4TA 2ZXPA 2Q00A 4IRUA 4AE4B 2DB4A 1C03A 2OEXA 3MYFA 1JR8A 3LS1A 4C7OA 2R03A 2CW0F 5L0DA 3ZG1A 1LE2A 4QI2A 3RYLA 1D0ZA 4JJFA 5KYNA 5T3TA 4YT4A 3DMDA 1K04A 3H2VA 5BQGA 1TKNA 2HFIA 1QPUA 1DOVA 4ER9A 1YZAA 1LKXA 5E2QA 3DE9A 2HZ8A 1H6GA 4C3DA 2FFHA 3AG3C 1Z63A 4JE9A 1PD1A 2Y3GA 1GGQA 3S9OA 3ZTMA 5KYUA 3SZRA 4WGYA 4BJ6A 1ZHXA 5DLJA 4CJOA 2BL2A 4P9FA 5EHHA 1HE9A 4PJMA 4G7HF 3FOPA 4OIPF 2I8BA 3FHDA 4WJ0A 3RQFA 5BQHA 3L0IA 3T6GB 3B71A 1JOGA 3W2WA 1RJ9A 1OR2A 2F22A 3S90A 4JTCB 4O6MA 4JCZA 1LE4A 5E33A 3AG4C 3C8ZA 5E3AA 3EG9A 2KK1A 3O6XA 4CBEA 4OIQF 1I5NA 1Q0MA 1ZHZA 5D92A 2CNWD 5L0IA 3LNRA 2GFHA 2JX0A 1GQAA 3UGPA 1QLEC 4MVOA 4A4AA 3B0VC 1ZHYA 3NG1A 4PACA 1ZU5A 3V5ZA 1JMWA 1FNTc 5D91A 1NU7D 5A69A 3KMIA 2B0HA 4BEMJ 2Q4FA 4J30B 2OCCC 2D4UA 2OOCA 1HE1A 3DJNB 5TJ5E 2NSFA 3QVZA 3U3BA 3ZIBA 4C3EA 3V7OA 2W4BA 2J45A 4MW3A 1ZU4A 2AWCA 1T01A 4OD5A 4AE4A 3O55A 1QVXA 4XPYA 5KYWB 2EIJC 4MS2A 2GWWA 4XQ1A 4PFPA 2VCAA 3A11A 4YL0A 1E84A 4C3BA 3W4YA 1M57C 4OIRF 3FDQA 2J7PA 4PJLA 2RSEB 3NYMA 2HUJA 1RKEB 4EUKB 1VLSA 4FESA 3UMHA 2IXNA 2Y39A 3AJMA 4CS8A 2AP3A 2PX0A 3K1IC 1FTSA 3M4CA 1U0BB 2XRHA 2Q9CA 5JRAA 1CGNA 2KGOA 2Y3HA 5EK0A 1EKYA 3EH1A 3TJ5A 1FMVA 5DVWA 2WVNA 3U8VA 4ZLDA 2YHSA 4CS9A 3UGOA 2W9YA 4JIOA 5BQIA 3CAXA 1KTMA 4K1OA 3AOUA 1NFNA 4E0HA 4NTFA 2WZLA 3DKAA 3EJNA 2J9UA 1JPNA 3QZCA 2J0XA 4U5CE 1Q0FA 2J9WA 3V5XA 1M56C 2HV7A 3LESA 5L0FA 1OKKD 2R7OA 4JZAA 1S7ZA 1Z23A 1OCRC 3EHNA 2WVQA 3C8GD 3SNHA 3ZDLA 4YN0B 2IBFA 3ABMC 1AVOB 1D0YA 1UG7A 1JPJA 3LLKA 3DI5A 3MX3A 4FX5A 2DYSC 2NPUA 3BEHA 3ZTZA 4DJ9A 4G7ZF 1NLXA 2CGEA 3G4ZA 1OCCC 4YJWA 2X0CA 3DXJF 1NFOA 1YLMA 4CIHA 3KPHA 2L7AA 2VC9A 5JSLA 1NG1A 4P9TA 5KYWA 3TULA 3J06A 1SF8A 1S05A 4W8KA 3RF3A 4JTDB 4BJ6C 4UDVA 2XLDA 3EHMA 4IAOA 4YT8A 2A6HF 2YQYA 4NY3A 3JT1A 2IXOA 5A6BD 3S27A 3C7JA 3QMKA 3ATPA 2OJED 2A68F 1RKEA 4Q5SF 1CGME 1PCXA 1WOLA 2PFDA 2XLVA 3EQLF 2J9VA 1L3PA 5CIVA 2KJGA 3VAYA 2MYSA 4CX9A 5L0GA 2JPUA 3ECSA 5F5FA 3B0UX 3RVYA 2J8WA 2VCCA 1OCZC 2M64A 2A1DD 2XLMA 4FAPB 2R05A 2C03A 4U5EE 4BJ1A 4J7YA 4NTBA 4BJ5A 2QLAA 3TQOA 1OXBA 3DJUB 4PK4A 3QTHA 4OIOF 3VM6A 3RQGA 1LI7A 4MVRA 2NSGA 2ZD9A 4XPXA 3HNLA 3RKOF 1RKCA 3AQBA 2NUTB 3G50A 4YL3A 3RFYA 3EFOA 3KKBA 1MQVA 3SXYA 3SXZA 4E7SA 1TWHA 1JAFA 3O10A 3NYLA 5JT4A 3AQCA 1YA9A 4QDLA 1G4US 3DM9B 2HSBA 2R7TA 3HNKA 1MNDA 1FR0A 4PFOA 2XLHA 3GWNA 3IQTA 1U89A 2V26A 3LNMB 4KNWA 4MVMA 4XLNF 2ETSA 2R25A 1LM3B 4Z9JA 1LS4A 3RIPA 1VOMA 2EINC 2R9RB 4E17A 1PD0A 4W8PA 3ASNC 2CNWA 2L6GA 4ONSA 3RH3A 4OD4A 3QW1A 3LUTB 2A6EF 2PNOA 4L6RA 3US6A 5HV9A 5KYXA 3EGXB 5L3VA 3F46A 1ZW3A 3T4RA 1TWGA 4A2NB 1O3UA 1H7IA 3JRTA 4ANJA 1RMVA 3C8GB 5B3IA 2YEVA 3CZ6A 2YZSA 1MMDA 4MQ9F 4CIPA 2AVKA 5B1BC 3W8IA 3S84A 1OR3A 4JW1A 3ZC4A 1U6HA 2ICWG 4FWVA 1SYQA 3LEOA 2V3CC 4JURI 5KYYB 3EH2A 2H7VC 3NKEA 5CI9A 1BR1A 4X0RA 2HSQA 2XL8A 2P7VA 2RD9A 3IQ6A 3K33A 3X2QC 2OKUA 1C17M 1YVIA 2AWYA 3IHUA 3N2ZB 1NZEA 4NTAA 4ULWA 1XZPA 2EPNA 3DZAA 4HE8D 1B68A 3ZSUA 4EBKA 3ABKC 2P6VA 1H9TA 4N4WA 1IZMA 2QE9A 2YLIA 3NRHA 4G0HA 2LSEA 4O6YA 3SYNA 1VTMP 2HJ3A 1PV3A 3FMSA 1QSPA 1VYKA 4I1MA 3JRMO 3PHF2 4KC9A 4DRJB 4MTOA 1T6QA 2BE5F 3PCVA 4U5GA 2IOQA 1A7VA 5COMA 1SZIA 3RVZA 1MMNA 3DM5A 4CJGA 1BZ4A 2G3VA 2M4EA 4EIYA 1TWCA 4JEAA 4O79A 2FAPB 1D1AA 2Q3TA 3DD7A 4BG0A 2OU6A 2XS1A 3L8IA 4E0IA 2L81A 3WAQA 2A0BA 4H4KC 4YT2A 1RCPA 3GWLA 3SEOA 1V54C 1VMAA 2XLOA 3K6BA 1ZYRF 3AG2C 4J32B 4U5FE 3U3FA 1V4AA 4M63A 4O7GA 4ZLCA 1YDIA 3C18A 1HMOA 3FXHA 2Y69C 4CDAA 2LFFA 4PR9A 2HJMA 2GAQA 1M2OA 5DS5A 2Q9BA 4RBNA 3POVA 1A7DA 2XL6A 3KL4A 3SP1A 5L0HA 3NMKA 1MNEA 1D0XA 5JS5A 1LPEA 3RW0A 1YYXA 3NYJA 3EGXA 3B29A 4XTKA 2J9BA 4IGGA 4E18A 1OKKA 1K40A 1WWPA 1IW7F 1H9GA 4MVQA 4AL0A 3W2VA 3C8GA 4EWCA 5A6KA 3HNIA 4Q7CA 2IXPA 3B9QA 2NUPB 3K66A 2YL7A 4I1OB 3HJCA 4EHPA 1EI7A 5KYYA 2R7VA 2A0UA 1E2XA 2HMQA 2LQGA 2R7SA 3U2MA 4YL1A 2Q9AA 1FFTC 5K0IA 1VK5A 4JVSA 2KQ9A 2H7BA 3Q7GA 3VRCA 2P1AA 1Z3IX 1Z5ZA 1F1MA 2XXAB 4JC7A 1OCOC 4U5BE 1YA7O 2H8AA 3B0PA 4Z9HA 4EBBA 4I44A 3UNGC 5AC5A 4RD9A 3GEEA 2KSFA 4WGZA 5A6BA 2A69F 2WZGA 2W4MA 2OJQA 3AGTA 1DOWA 4LDQA 3X1OA 1EA8A 3HKKA 2EIKC 1HMDA 3JSEO 1R5ID 3GM1A 4IARA 4MVSA 1O87A 4U5HA 5DS6A 4NC3A 3DAFA 3GM2A 4DVYP 3FAPB 5DQTA 2LK4A 4XLPF 3IPMO 3S29A 1I4YA 4KI2A 2DGJA 2PBEA 5KYUB 3A9CA 2YRFA 2VCBA 2PX3A 4MVZA 2WB7A 4LLEA 5CI8A 1C02A 1BR4A 1WATA 4N06A 2WL8A 5GPGB 1GM5A 3U9JA 1HW2A 2ZPAA 1QKRA 2UUIA 2QUPA 2IM8A 2YL3A 2LP4A 1WTYA 1RXQA 4DBRA 4JEBA 3GEHA 1KNYA 2OEVA 4P6IC 3HTKC 3K1IA 256BA 1G5ZA 1N1CA 1T9KA 3NMIA 1XWJA 2OG2A 3EPVA 3JSZA 4WABA 4O6NA 3PMRA 2XL4A 2P61A 2MWQA 2XM4A 5AC4A 2JD3A 3GODA 1TFOB 2NUPA 2EILC 4XEKA 3M1CB 1ORJA 3QW0A 3F47A 4B6IA 5A6JA 2ZXRA 5L3QA 4KNVA 3V5YA 2PF4E 5EGYA 1VB5A 4U5DE 1CPQA 1LI5A 3JZ0A 4PJJA 5HSWA 2LIGA 1APCA 3NMJA 4EKWA 1OXKA 3ITFA 4MW8A 2J46A 5JP7A 1ZHTA 2LCHA 2WVOA 2VH3A 2GA0A 3C62A 3MLGA 4XEFA 3EZIA 5F5HA 2Z15A 1NSGB 3WODF 2HS5A 4OINF 4R32A 1CPRA 1TWAA 3JCUQ 4QI0A 2PP4A 3KYIA 3SXKA 3TK0A 4AL1A 4BJTA 4F4BA 4CDVA 1OW6A 3U2LA 4D4NA 1LVKA 2ZXWC 2KC3A 1QQ3A 1YARO 3L1MA 2WZFA 4CS8C 1T6IA 3ZWIA 4LDKA 1Q0KA 3MFNA 1G4WR 3TD7A 1QZXA 3T9OA 3C63A 4PJNA 3I5PA 4JKVA 2ZXOA 3L8JA 3RQEA 1FMWA 5FCLA 5IY5C 3K1HA 3GORA 4CS9C 3E9VA 2HKVA 1BDJB 3VF0A 2R7UA 1OW8A 2CCYA 3U0CA 2FGYA 1E85A 1Q0DA 1M2VB 2X51A 1J8YF 2KNHA 4N6CA 4CSAA 3NKDA 2QNLA 3GEIA 3H65A 2L6FA 1W2WA 5B1AC 3NDBB 2QY9A 4D4XA 1WGWA 1JRAA 3Q6MA 3UR3C 3DWWA 1D1CA 1ZW2A 2YWAA 4DRIB 1E83A 3MBGA 3L34A 3M15A 2YLGA 1TFKB 1OW7A 5FZTA 4MTFA 2KW3C 2D5RB 4NQFA 2B0JA 3LEVA 3EZHA 3OEOA 2NUTA 2LFDA 2Y3BA 1GS9A 1ST6A 3AGUA 4K0DA 5JUAA 4XEVA 5AGFA 1TQGA 2Q7RA 2Y3DA 2EPMX 2UUHA 4AK9A 3R7CA 1M6TA 3TOMA 2P0NA 3LAYA 4DVZA 3CEXA 3DAGA 3M4BA 2KYHA 1D1BA 3ZQYA 3ASOC 1MMGA 1YAUO 4E7ZA 4IAQA 1HW1A 2DI3A 4YT5A 2GDCA 2HMZA 1ZHWA 4U9EA 3MYIA 1FAPB 2XLWA 4EBJA 3O39A 4LDRA 3LJBA 1A7EA 1LIHA 1ZZPA 4CS7A 1O5HA 2J0WA 3N0TA 3TOLA 3FOOA 1ORSC 2C04A 4GQHA 3TJ6A 5DQZA 3CSKA 4DBQA 1SR2A 1BBHA 3T6BA 3HLZA 4DOZA 2H7OA 5COGA 2AU5A 5DS4A 3U9MA 4U9DA 1ORYA 1AUEA 3KH2A 4AX2A 4G78A 4J7TA 4DXWA 2YLDA 4KBLA 3IQ5A 4NCQA 1Z6AA 4BPMA 5JVEA 4HFFB 1YYJA 4BEJA 3IEEA 4MTGA 3ZVRA 4BJ5C 4JJGA 3T6JA 3I4UA 2J7PD 4DRHB 1J8MF 2XS8A 4K7BA 2O9XA 1M2VA 1BR2A 3EGDB 4JCHA 2VB6A 5B3SC 3ABLC 1G8XA 2QTVA 2ASRA 2EPOA 3AG1C 3G4XA 2OQMA 3GM3A 3LS0A 1TR2A 2EPKX 2R02A 2VASA 3SXMA 1T6UA 2MHRA 2R7RA 4C7OB 3GANA 3LLIA 2IXMA 1KU2A 2L6HA
chains in the Genus database with same CATH topology
3HKKA 4YL0A 5BQIA 4WABA 4AL0A 4NTFA 4YL3A 4J7TA 5BQGA 4BPMA 4JRZA 2Q7RA 2UUHA 3LEOA 4YL1A 5K0IA 4NTAA 4YK5A 4JC7A 5BQHA 2UUIA 4J7YA 2H8AA 4NTBA 4AL1A 2PNOA 3DWWA 5HV9A 3B29A 3PCVA 4JCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKK A;  4YL0 A;  5BQI A;  4WAB A;  4AL0 A;  4NTF A;  4YL3 A;  4J7T A;  5BQG A;  4BPM A;  4JRZ A;  2Q7R A;  2UUH A;  3LEO A;  4YL1 A;  5K0I A;  4NTA A;  4YK5 A;  4JC7 A;  5BQH A;  2UUI A;  4J7Y A;  2H8A A;  4NTB A;  4AL1 A;  2PNO A;  3DWW A;  5HV9 A;  3B29 A;  3PCV A;  4JCZ A; 
#chains in the Genus database with same CATH topology
 3R2P A;  4G7O F;  2CYD A;  1OQC A;  4Q4Z F;  1K05 A;  2DYR C;  2R7X A;  2YVK A;  4ULV A;  3E70 C;  3EFO B;  1HY5 A;  2XM0 A;  1VYI A;  3JTL O;  3UMI A;  4LER A;  2EPL X;  1UFB A;  4JRZ A;  4CDY A;  1WN0 A;  1V74 B;  2CDQ A;  3PDM P;  1Y6D A;  3CQZ A;  2G62 A;  3HNJ A;  5JLI A;  1E86 A;  1YJG A;  2IYL D;  1MMA A;  3IQC A;  1A41 A;  1WAS A;  3I5Q A;  3VYW A;  2NG1 A;  3W8H A;  1T5O A;  4LAC B;  2YL0 A;  3ZQV A;  5BUO A;  1VLT A;  2I15 A;  3K7D A;  1A0B A;  1FFH A;  3JYH A;  1Q0G A;  2L9J A;  3N24 A;  5T1D B;  3Q7L A;  4IJJ A;  2G3K A;  2EIM C;  2HV6 A;  2R7Q A;  3BRJ A;  4H54 A;  2LD6 A;  4YWQ A;  5A6A A;  1RJ9 B;  1YZC A;  1XZQ A;  1L7C A;  5KYX B;  2YL1 A;  3S28 A;  3S0X A;  3JYY A;  4MND A;  1NBB A;  4N6H A;  2XSE A;  3EG9 B;  4XWJ A;  1LS1 A;  3Q6N A;  5E3C A;  5COF A;  1Y4C A;  3M79 A;  3OA1 A;  3OWT A;  4GYT A;  4GEH A;  4IB4 A;  4LLC A;  4CSA C;  1I4Z A;  4HEA J;  3KYJ A;  2BC5 A;  3FVY A;  4JTA B;  5F28 E;  4RDA A;  3U8P A;  1ZVZ A;  3FAJ A;  4IWB A;  4Z9I A;  3UMK A;  2W45 A;  4I3M A;  4YK5 A;  3WG7 C;  1V55 C;  3U5S A;  3WHN A;  3EGD A;  2R7W A;  2TMV P;  1EQ1 A;  2YKZ A;  3H2U A;  1AEP A;  3QVY A;  4XPW A;  1Z7Q c;  5L0J A;  5L0C A;  1CGO A;  1SMY F;  3DE8 A;  4MVU A;  2XLE A;  2XXA A;  4HFK B;  1NU9 C;  2E87 A;  5T3W A;  1R4T A;  2ZXP A;  2Q00 A;  4IRU A;  4AE4 B;  2DB4 A;  1C03 A;  2OEX A;  3MYF A;  1JR8 A;  3LS1 A;  4C7O A;  2R03 A;  2CW0 F;  5L0D A;  3ZG1 A;  1LE2 A;  4QI2 A;  3RYL A;  1D0Z A;  4JJF A;  5KYN A;  5T3T A;  4YT4 A;  3DMD A;  1K04 A;  3H2V A;  5BQG A;  1TKN A;  2HFI A;  1QPU A;  1DOV A;  4ER9 A;  1YZA A;  1LKX A;  5E2Q A;  3DE9 A;  2HZ8 A;  1H6G A;  4C3D A;  2FFH A;  3AG3 C;  1Z63 A;  4JE9 A;  1PD1 A;  2Y3G A;  1GGQ A;  3S9O A;  3ZTM A;  5KYU A;  3SZR A;  4WGY A;  4BJ6 A;  1ZHX A;  5DLJ A;  4CJO A;  2BL2 A;  4P9F A;  5EHH A;  1HE9 A;  4PJM A;  4G7H F;  3FOP A;  4OIP F;  2I8B A;  3FHD A;  4WJ0 A;  3RQF A;  5BQH A;  3L0I A;  3T6G B;  3B71 A;  1JOG A;  3W2W A;  1RJ9 A;  1OR2 A;  2F22 A;  3S90 A;  4JTC B;  4O6M A;  4JCZ A;  1LE4 A;  5E33 A;  3AG4 C;  3C8Z A;  5E3A A;  3EG9 A;  2KK1 A;  3O6X A;  4CBE A;  4OIQ F;  1I5N A;  1Q0M A;  1ZHZ A;  5D92 A;  2CNW D;  5L0I A;  3LNR A;  2GFH A;  2JX0 A;  1GQA A;  3UGP A;  1QLE C;  4MVO A;  4A4A A;  3B0V C;  1ZHY A;  3NG1 A;  4PAC A;  1ZU5 A;  3V5Z A;  1JMW A;  1FNT c;  5D91 A;  1NU7 D;  5A69 A;  3KMI A;  2B0H A;  4BEM J;  2Q4F A;  4J30 B;  2OCC C;  2D4U A;  2OOC A;  1HE1 A;  3DJN B;  5TJ5 E;  2NSF A;  3QVZ A;  3U3B A;  3ZIB A;  4C3E A;  3V7O A;  2W4B A;  2J45 A;  4MW3 A;  1ZU4 A;  2AWC A;  1T01 A;  4OD5 A;  4AE4 A;  3O55 A;  1QVX A;  4XPY A;  5KYW B;  2EIJ C;  4MS2 A;  2GWW A;  4XQ1 A;  4PFP A;  2VCA A;  3A11 A;  4YL0 A;  1E84 A;  4C3B A;  3W4Y A;  1M57 C;  4OIR F;  3FDQ A;  2J7P A;  4PJL A;  2RSE B;  3NYM A;  2HUJ A;  1RKE B;  4EUK B;  1VLS A;  4FES A;  3UMH A;  2IXN A;  2Y39 A;  3AJM A;  4CS8 A;  2AP3 A;  2PX0 A;  3K1I C;  1FTS A;  3M4C A;  1U0B B;  2XRH A;  2Q9C A;  5JRA A;  1CGN A;  2KGO A;  2Y3H A;  5EK0 A;  1EKY A;  3EH1 A;  3TJ5 A;  1FMV A;  5DVW A;  2WVN A;  3U8V A;  4ZLD A;  2YHS A;  4CS9 A;  3UGO A;  2W9Y A;  4JIO A;  5BQI A;  3CAX A;  1KTM A;  4K1O A;  3AOU A;  1NFN A;  4E0H A;  4NTF A;  2WZL A;  3DKA A;  3EJN A;  2J9U A;  1JPN A;  3QZC A;  2J0X A;  4U5C E;  1Q0F A;  2J9W A;  3V5X A;  1M56 C;  2HV7 A;  3LES A;  5L0F A;  1OKK D;  2R7O A;  4JZA A;  1S7Z A;  1Z23 A;  1OCR C;  3EHN A;  2WVQ A;  3C8G D;  3SNH A;  3ZDL A;  4YN0 B;  2IBF A;  3ABM C;  1AVO B;  1D0Y A;  1UG7 A;  1JPJ A;  3LLK A;  3DI5 A;  3MX3 A;  4FX5 A;  2DYS C;  2NPU A;  3BEH A;  3ZTZ A;  4DJ9 A;  4G7Z F;  1NLX A;  2CGE A;  3G4Z A;  1OCC C;  4YJW A;  2X0C A;  3DXJ F;  1NFO A;  1YLM A;  4CIH A;  3KPH A;  2L7A A;  2VC9 A;  5JSL A;  1NG1 A;  4P9T A;  5KYW A;  3TUL A;  3J06 A;  1SF8 A;  1S05 A;  4W8K A;  3RF3 A;  4JTD B;  4BJ6 C;  4UDV A;  2XLD A;  3EHM A;  4IAO A;  4YT8 A;  2A6H F;  2YQY A;  4NY3 A;  3JT1 A;  2IXO A;  5A6B D;  3S27 A;  3C7J A;  3QMK A;  3ATP A;  2OJE D;  2A68 F;  1RKE A;  4Q5S F;  1CGM E;  1PCX A;  1WOL A;  2PFD A;  2XLV A;  3EQL F;  2J9V A;  1L3P A;  5CIV A;  2KJG A;  3VAY A;  2MYS A;  4CX9 A;  5L0G A;  2JPU A;  3ECS A;  5F5F A;  3B0U X;  3RVY A;  2J8W A;  2VCC A;  1OCZ C;  2M64 A;  2A1D D;  2XLM A;  4FAP B;  2R05 A;  2C03 A;  4U5E E;  4BJ1 A;  4J7Y A;  4NTB A;  4BJ5 A;  2QLA A;  3TQO A;  1OXB A;  3DJU B;  4PK4 A;  3QTH A;  4OIO F;  3VM6 A;  3RQG A;  1LI7 A;  4MVR A;  2NSG A;  2ZD9 A;  4XPX A;  3HNL A;  3RKO F;  1RKC A;  3AQB A;  2NUT B;  3G50 A;  4YL3 A;  3RFY A;  3EFO A;  3KKB A;  1MQV A;  3SXY A;  3SXZ A;  4E7S A;  1TWH A;  1JAF A;  3O10 A;  3NYL A;  5JT4 A;  3AQC A;  1YA9 A;  4QDL A;  1G4U S;  3DM9 B;  2HSB A;  2R7T A;  3HNK A;  1MND A;  1FR0 A;  4PFO A;  2XLH A;  3GWN A;  3IQT A;  1U89 A;  2V26 A;  3LNM B;  4KNW A;  4MVM A;  4XLN F;  2ETS A;  2R25 A;  1LM3 B;  4Z9J A;  1LS4 A;  3RIP A;  1VOM A;  2EIN C;  2R9R B;  4E17 A;  1PD0 A;  4W8P A;  3ASN C;  2CNW A;  2L6G A;  4ONS A;  3RH3 A;  4OD4 A;  3QW1 A;  3LUT B;  2A6E F;  2PNO A;  4L6R A;  3US6 A;  5HV9 A;  5KYX A;  3EGX B;  5L3V A;  3F46 A;  1ZW3 A;  3T4R A;  1TWG A;  4A2N B;  1O3U A;  1H7I A;  3JRT A;  4ANJ A;  1RMV A;  3C8G B;  5B3I A;  2YEV A;  3CZ6 A;  2YZS A;  1MMD A;  4MQ9 F;  4CIP A;  2AVK A;  5B1B C;  3W8I A;  3S84 A;  1OR3 A;  4JW1 A;  3ZC4 A;  1U6H A;  2ICW G;  4FWV A;  1SYQ A;  3LEO A;  2V3C C;  4JUR I;  5KYY B;  3EH2 A;  2H7V C;  3NKE A;  5CI9 A;  1BR1 A;  4X0R A;  2HSQ A;  2XL8 A;  2P7V A;  2RD9 A;  3IQ6 A;  3K33 A;  3X2Q C;  2OKU A;  1C17 M;  1YVI A;  2AWY A;  3IHU A;  3N2Z B;  1NZE A;  4NTA A;  4ULW A;  1XZP A;  2EPN A;  3DZA A;  4HE8 D;  1B68 A;  3ZSU A;  4EBK A;  3ABK C;  2P6V A;  1H9T A;  4N4W A;  1IZM A;  2QE9 A;  2YLI A;  3NRH A;  4G0H A;  2LSE A;  4O6Y A;  3SYN A;  1VTM P;  2HJ3 A;  1PV3 A;  3FMS A;  1QSP A;  1VYK A;  4I1M A;  3JRM O;  3PHF 2;  4KC9 A;  4DRJ B;  4MTO A;  1T6Q A;  2BE5 F;  3PCV A;  4U5G A;  2IOQ A;  1A7V A;  5COM A;  1SZI A;  3RVZ A;  1MMN A;  3DM5 A;  4CJG A;  1BZ4 A;  2G3V A;  2M4E A;  4EIY A;  1TWC A;  4JEA A;  4O79 A;  2FAP B;  1D1A A;  2Q3T A;  3DD7 A;  4BG0 A;  2OU6 A;  2XS1 A;  3L8I A;  4E0I A;  2L81 A;  3WAQ A;  2A0B A;  4H4K C;  4YT2 A;  1RCP A;  3GWL A;  3SEO A;  1V54 C;  1VMA A;  2XLO A;  3K6B A;  1ZYR F;  3AG2 C;  4J32 B;  4U5F E;  3U3F A;  1V4A A;  4M63 A;  4O7G A;  4ZLC A;  1YDI A;  3C18 A;  1HMO A;  3FXH A;  2Y69 C;  4CDA A;  2LFF A;  4PR9 A;  2HJM A;  2GAQ A;  1M2O A;  5DS5 A;  2Q9B A;  4RBN A;  3POV A;  1A7D A;  2XL6 A;  3KL4 A;  3SP1 A;  5L0H A;  3NMK A;  1MNE A;  1D0X A;  5JS5 A;  1LPE A;  3RW0 A;  1YYX A;  3NYJ A;  3EGX A;  3B29 A;  4XTK A;  2J9B A;  4IGG A;  4E18 A;  1OKK A;  1K40 A;  1WWP A;  1IW7 F;  1H9G A;  4MVQ A;  4AL0 A;  3W2V A;  3C8G A;  4EWC A;  5A6K A;  3HNI A;  4Q7C A;  2IXP A;  3B9Q A;  2NUP B;  3K66 A;  2YL7 A;  4I1O B;  3HJC A;  4EHP A;  1EI7 A;  5KYY A;  2R7V A;  2A0U A;  1E2X A;  2HMQ A;  2LQG A;  2R7S A;  3U2M A;  4YL1 A;  2Q9A A;  1FFT C;  5K0I A;  1VK5 A;  4JVS A;  2KQ9 A;  2H7B A;  3Q7G A;  3VRC A;  2P1A A;  1Z3I X;  1Z5Z A;  1F1M A;  2XXA B;  4JC7 A;  1OCO C;  4U5B E;  1YA7 O;  2H8A A;  3B0P A;  4Z9H A;  4EBB A;  4I44 A;  3UNG C;  5AC5 A;  4RD9 A;  3GEE A;  2KSF A;  4WGZ A;  5A6B A;  2A69 F;  2WZG A;  2W4M A;  2OJQ A;  3AGT A;  1DOW A;  4LDQ A;  3X1O A;  1EA8 A;  3HKK A;  2EIK C;  1HMD A;  3JSE O;  1R5I D;  3GM1 A;  4IAR A;  4MVS A;  1O87 A;  4U5H A;  5DS6 A;  4NC3 A;  3DAF A;  3GM2 A;  4DVY P;  3FAP B;  5DQT A;  2LK4 A;  4XLP F;  3IPM O;  3S29 A;  1I4Y A;  4KI2 A;  2DGJ A;  2PBE A;  5KYU B;  3A9C A;  2YRF A;  2VCB A;  2PX3 A;  4MVZ A;  2WB7 A;  4LLE A;  5CI8 A;  1C02 A;  1BR4 A;  1WAT A;  4N06 A;  2WL8 A;  5GPG B;  1GM5 A;  3U9J A;  1HW2 A;  2ZPA A;  1QKR A;  2UUI A;  2QUP A;  2IM8 A;  2YL3 A;  2LP4 A;  1WTY A;  1RXQ A;  4DBR A;  4JEB A;  3GEH A;  1KNY A;  2OEV A;  4P6I C;  3HTK C;  3K1I A;  256B A;  1G5Z A;  1N1C A;  1T9K A;  3NMI A;  1XWJ A;  2OG2 A;  3EPV A;  3JSZ A;  4WAB A;  4O6N A;  3PMR A;  2XL4 A;  2P61 A;  2MWQ A;  2XM4 A;  5AC4 A;  2JD3 A;  3GOD A;  1TFO B;  2NUP A;  2EIL C;  4XEK A;  3M1C B;  1ORJ A;  3QW0 A;  3F47 A;  4B6I A;  5A6J A;  2ZXR A;  5L3Q A;  4KNV A;  3V5Y A;  2PF4 E;  5EGY A;  1VB5 A;  4U5D E;  1CPQ A;  1LI5 A;  3JZ0 A;  4PJJ A;  5HSW A;  2LIG A;  1APC A;  3NMJ A;  4EKW A;  1OXK A;  3ITF A;  4MW8 A;  2J46 A;  5JP7 A;  1ZHT A;  2LCH A;  2WVO A;  2VH3 A;  2GA0 A;  3C62 A;  3MLG A;  4XEF A;  3EZI A;  5F5H A;  2Z15 A;  1NSG B;  3WOD F;  2HS5 A;  4OIN F;  4R32 A;  1CPR A;  1TWA A;  3JCU Q;  4QI0 A;  2PP4 A;  3KYI A;  3SXK A;  3TK0 A;  4AL1 A;  4BJT A;  4F4B A;  4CDV A;  1OW6 A;  3U2L A;  4D4N A;  1LVK A;  2ZXW C;  2KC3 A;  1QQ3 A;  1YAR O;  3L1M A;  2WZF A;  4CS8 C;  1T6I A;  3ZWI A;  4LDK A;  1Q0K A;  3MFN A;  1G4W R;  3TD7 A;  1QZX A;  3T9O A;  3C63 A;  4PJN A;  3I5P A;  4JKV A;  2ZXO A;  3L8J A;  3RQE A;  1FMW A;  5FCL A;  5IY5 C;  3K1H A;  3GOR A;  4CS9 C;  3E9V A;  2HKV A;  1BDJ B;  3VF0 A;  2R7U A;  1OW8 A;  2CCY A;  3U0C A;  2FGY A;  1E85 A;  1Q0D A;  1M2V B;  2X51 A;  1J8Y F;  2KNH A;  4N6C A;  4CSA A;  3NKD A;  2QNL A;  3GEI A;  3H65 A;  2L6F A;  1W2W A;  5B1A C;  3NDB B;  2QY9 A;  4D4X A;  1WGW A;  1JRA A;  3Q6M A;  3UR3 C;  3DWW A;  1D1C A;  1ZW2 A;  2YWA A;  4DRI B;  1E83 A;  3MBG A;  3L34 A;  3M15 A;  2YLG A;  1TFK B;  1OW7 A;  5FZT A;  4MTF A;  2KW3 C;  2D5R B;  4NQF A;  2B0J A;  3LEV A;  3EZH A;  3OEO A;  2NUT A;  2LFD A;  2Y3B A;  1GS9 A;  1ST6 A;  3AGU A;  4K0D A;  5JUA A;  4XEV A;  5AGF A;  1TQG A;  2Q7R A;  2Y3D A;  2EPM X;  2UUH A;  4AK9 A;  3R7C A;  1M6T A;  3TOM A;  2P0N A;  3LAY A;  4DVZ A;  3CEX A;  3DAG A;  3M4B A;  2KYH A;  1D1B A;  3ZQY A;  3ASO C;  1MMG A;  1YAU O;  4E7Z A;  4IAQ A;  1HW1 A;  2DI3 A;  4YT5 A;  2GDC A;  2HMZ A;  1ZHW A;  4U9E A;  3MYI A;  1FAP B;  2XLW A;  4EBJ A;  3O39 A;  4LDR A;  3LJB A;  1A7E A;  1LIH A;  1ZZP A;  4CS7 A;  1O5H A;  2J0W A;  3N0T A;  3TOL A;  3FOO A;  1ORS C;  2C04 A;  4GQH A;  3TJ6 A;  5DQZ A;  3CSK A;  4DBQ A;  1SR2 A;  1BBH A;  3T6B A;  3HLZ A;  4DOZ A;  2H7O A;  5COG A;  2AU5 A;  5DS4 A;  3U9M A;  4U9D A;  1ORY A;  1AUE A;  3KH2 A;  4AX2 A;  4G78 A;  4J7T A;  4DXW A;  2YLD A;  4KBL A;  3IQ5 A;  4NCQ A;  1Z6A A;  4BPM A;  5JVE A;  4HFF B;  1YYJ A;  4BEJ A;  3IEE A;  4MTG A;  3ZVR A;  4BJ5 C;  4JJG A;  3T6J A;  3I4U A;  2J7P D;  4DRH B;  1J8M F;  2XS8 A;  4K7B A;  2O9X A;  1M2V A;  1BR2 A;  3EGD B;  4JCH A;  2VB6 A;  5B3S C;  3ABL C;  1G8X A;  2QTV A;  2ASR A;  2EPO A;  3AG1 C;  3G4X A;  2OQM A;  3GM3 A;  3LS0 A;  1TR2 A;  2EPK X;  2R02 A;  2VAS A;  3SXM A;  1T6U A;  2MHR A;  2R7R A;  4C7O B;  3GAN A;  3LLI A;  2IXM A;  1KU2 A;  2L6H A; 
#chains in the Genus database with same CATH homology
 3HKK A;  4YL0 A;  5BQI A;  4WAB A;  4AL0 A;  4NTF A;  4YL3 A;  4J7T A;  5BQG A;  4BPM A;  4JRZ A;  2Q7R A;  2UUH A;  3LEO A;  4YL1 A;  5K0I A;  4NTA A;  4YK5 A;  4JC7 A;  5BQH A;  2UUI A;  4J7Y A;  2H8A A;  4NTB A;  4AL1 A;  2PNO A;  3DWW A;  5HV9 A;  3B29 A;  3PCV A;  4JCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...