2KSFA

Backbone structure of the membrane domain of e. coli histidine kinase receptor kdpd, center for structures of membrane proteins (csmp) target 4312c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
MVQIQGSVVAAALSAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVSFDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein kdpD
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 32
structure length 107
sequence length 107
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Backbone structure of the membrane domain of e. Coli histidine kinase receptor kdpd, 2ksfA00
2KSFA
chains in the Genus database with same CATH superfamily
1VYIA 3NMIA 2D4UA 1BDJB 3L1MA 2P6VA 3KPHA 2EPOA 1HE9A 4IARA 3LESA 1TWCA 4B6IA 4A4AA 4KNVA 2W45A 1OKKD 4YL0A 5HV9A 1G5ZA 2R7SA 2R03A 2HV7A 5D91A 2H8AA 1VLSA 3LAYA 3AGTA 3QW1A 2G62A 2HMQA 3DAGA 2KNHA 2XLDA 5EGYA 2MWQA 3KYIA 4HFKB 1FMVA 1L7CA 1TWGA 2H7VC 2WL8A 3K7DA 4IGGA 4RDAA 5TJ5E 4C3EA 3ABLC 5JLIA 2Q9CA 2VC9A 3G4XA 3KKBA 1Z63A 3EQLF 3SXYA 1W2WA 5BQGA 3I5PA 3B29A 1A0BA 5F5HA 2EPNA 2L6FA 3NKEA 3N0TA 3PHF2 5E33A 3HJCA 1AEPA 4NTBA 4YT4A 3I5QA 4BJTA 3S27A 3SZRA 3AQBA 1VTMP 1ZU5A 1LI7A 2EPKX 2VCCA 1K04A 1FFTC 1TQGA 3EJNA 4Z9HA 4IJJA 3LEVA 2X0CA 2EPLX 3K1IA 2ZD9A 3VRCA 3WAQA 3WG7C 2NUTA 4EBJA 1H9TA 2LFDA 3EH1A 5F28E 1ZU4A 1U0BB 2YHSA 1S05A 1YARO 3R2PA 4C7OA 2XLVA 2OOCA 1V74B 3C8GD 4AL0A 2EILC 4HEAJ 4CDVA 4Z9IA 2ZXOA 3FHDA 1E86A 1LM3B 5CI9A 2HZ8A 3DXJF 3G50A 1XZQA 1SF8A 3E9VA 3EZIA 3GM3A 3GORA 4KC9A 4DRIB 2BE5F 3DE9A 3UGPA 1QPUA 1TWHA 5JS5A 3E70C 3ZSUA 4DVZA 2I8BA 2IXMA 1HMOA 4P9TA 4BJ5A 4BEJA 4JEBA 1PD0A 4BJ1A 1Q0DA 4CBEA 2GDCA 5JVEA 2HMZA 1NFOA 3HNKA 2Q3TA 4MVUA 3US6A 1V4AA 2J0XA 2YLGA 3WODF 1OW6A 2GA0A 2PFDA 2WZGA 4YK5A 4OIQF 4IAQA 2NG1A 4U5BE 3W2WA 4J32B 5BUOA 3A9CA 1NG1A 2XL6A 1WOLA 2XL8A 2XM0A 4MVOA 1M56C 1OCRC 2Q9AA 3ATPA 3BRJA 3SP1A 4BG0A 2XS1A 4JZAA 3K33A 3A11A 1ZW2A 4AL1A 4O7GA 1HW2A 4KI2A 1LIHA 1NZEA 1O87A 1H9GA 2GFHA 1MNEA 4N6CA 3JYHA 1BR2A 4G0HA 2G3VA 2PBEA 3NRHA 2XM4A 4DRHB 1E2XA 3CSKA 4KBLA 1R4TA 4XPXA 2P0NA 2B0HA 2C03A 3KMIA 4JCHA 4MS2A 4MVQA 4ZLCA 2J46A 5L3QA 2OEXA 4AE4A 4PJMA 1GM5A 3RW0A 1KNYA 2A69F 2BC5A 4MVMA 4RD9A 2XLHA 2VCAA 2EINC 2OEVA 4LACB 3SEOA 1YAUO 2XLEA 3VF0A 3EFOA 5KYUB 4XQ1A 4NCQA 3RKOF 4CS9C 3FAPB 1FAPB 4MTFA 3GWLA 1LE4A 3X2QC 4CS8C 1OCCC 4QDLA 4J30B 2WVNA 4AE4B 2NSFA 5KYUA 5KYXB 3G4ZA 1YYJA 2HJMA 5IY5C 5GPGB 2L6HA 4OIRF 4PR9A 1MNDA 3V5XA 4I3MA 4WGYA 1C17M 1D1CA 2NUPA 2W9YA 3VYWA 2RSEB 3NYLA 2HUJA 3BEHA 3NMKA 2R7QA 1T01A 3OA1A 3QVYA 3U5SA 4G7ZF 2EPMX 3DZAA 2XXAB 3LEOA 2MHRA 2TMVP 2KC3A 1O3UA 4EWCA 3ABMC 1SZIA 3L8IA 1FMWA 4U5FE 2J7PA 4IRUA 4PJNA 4K1OA 1RCPA 2L7AA 2QNLA 4U5CE 3HNLA 1D1BA 4ANJA 4CJOA 1F1MA 4E7SA 4O6YA 1MMNA 2JX0A 5BQIA 2YL3A 3DJNB 2ICWG 3EGXB 5KYYB 3JRMO 4BJ6C 4F4BA 1QLEC 2I15A 1FFHA 2UUHA 3JCUQ 2WZFA 3ASNC 4ONSA 2CW0F 1YA7O 3NMJA 5B1BC 1OR2A 3L0IA 2JD3A 4C3DA 5HSWA 4JKVA 4DBRA 1MQVA 4JTAB 2KGOA 2YRFA 3Q6NA 4U5DE 1IZMA 2XSEA 3IQCA 3RVYA 3CEXA 3ZIBA 1M2VB 1Z6AA 3H2VA 1HE1A 3L34A 4MVZA 3TJ6A 4PACA 4JIOA 4DXWA 4FX5A 4JEAA 1RJ9B 2HJ3A 4MVRA 2Q9BA 1I5NA 4BPMA 3B0VC 1MMAA 4O6NA 4CSAA 2R7UA 3SYNA 3QW0A 3GANA 3UNGC 2YWAA 3C63A 3ZTMA 4CJGA 2LD6A 3O39A 4AK9A 2IYLD 2QY9A 3O6XA 1NU7D 2YEVA 3GEIA 4NQFA 4EBBA 4JVSA 1H7IA 2CCYA 3DE8A 4KNWA 3EG9B 2YL0A 2KQ9A 2ZPAA 3U9JA 2HSQA 4DVYP 2A1DD 4GYTA 1OKKA 2Q00A 3LNMB 5DS4A 1A7EA 2CYDA 3S84A 4MNDA 4CX9A 1FR0A 1RKEB 1FNTc 4LDKA 2R7TA 3EG9A 1KU2A 4N06A 2R7WA 2IM8A 4XPYA 3LLIA 2KSFA 4O6MA 4U5GA 1Z3IX 3MFNA 5FCLA 1MMGA 2R25A 3SXZA 5DVWA 2R05A 4Q5SF 1VLTA 3O55A 3QVZA 2OU6A 2VH3A 1WWPA 1NLXA 3M79A 2J9WA 2LP4A 4R32A 2DI3A 4GEHA 1YVIA 4LDQA 2W4BA 4JTDB 4MTOA 4PK4A 1TFOB 4YWQA 4NC3A 4YL1A 5DS6A 1A41A 2Y69C 1ZZPA 3AG2C 1E85A 5L3VA 2YL1A 2XLWA 4MW3A 5E3CA 5K0IA 4G7OF 1YJGA 2GWWA 1G8XA 3X1OA 1EQ1A 1ST6A 3M1CB 2YQYA 4CDAA 5KYNA 5KYWB 3H2UA 2R7OA 3FMSA 1CGME 1JRAA 3RFYA 3MBGA 3C7JA 3W8IA 1CGNA 4D4NA 1PV3A 1TR2A 3C8GB 3T6BA 3ITFA 3ZQYA 4LLCA 3M4CA 1HMDA 3NG1A 3RVZA 4U5EE 3JT1A 2H7OA 1QKRA 5JT4A 3UR3C 3C8GA 3UGOA 1E83A 3RQEA 1BR1A 2QLAA 4E0IA 1GGQA 1JOGA 3UMKA 1IW7F 1YA9A 3Q7LA 4G78A 2KK1A 3U9MA 4HFFB 2XLOA 3GEEA 1RXQA 3PCVA 1GQAA 3AG3C 5DQTA 4U9DA 4JJFA 2JPUA 1QZXA 1MMDA 1VMAA 3UMIA 5A6BD 3C8ZA 3NKDA 4E18A 1OQCA 3IHUA 2YZSA 1SYQA 5L0DA 4PFPA 1OCOC 2IBFA 3W4YA 4FWVA 3GEHA 2VCBA 5B1AC 2IXNA 1WN0A 1NFNA 2J9BA 4J7TA 3DJUB 3T6JA 4WABA 1NSGB 3S90A 3DI5A 4N6HA 256BA 1NU9C 3LLKA 1R5ID 3HNJA 2YLDA 2ZXPA 3U3BA 4ZLDA 4IB4A 1JAFA 3CQZA 3EHNA 4YJWA 1AUEA 1WTYA 2AP3A 2R7RA 3OWTA 3U8PA 3DAFA 3K6BA 2J45A 3CAXA 1AVOB 4I44A 4ULVA 2HS5A 1DOWA 3JTLO 3V7OA 2ASRA 3RYLA 1YZAA 5JRAA 1Z23A 3SNHA 4E17A 4MW8A 5COFA 1S7ZA 2V26A 3POVA 3QZCA 3K1IC 2E87A 5JSLA 1CPRA 4MQ9F 1CPQA 1V55C 3JSZA 2BL2A 2UUIA 4W8PA 3ZDLA 4DJ9A 5KYXA 5L0FA 2ZXRA 1D0YA 3S0XA 2L6GA 3TOMA 1U89A 1QVXA 2CNWD 4K0DA 4HE8D 3RQGA 1Z5ZA 3B71A 3NDBB 5A6KA 4PJLA 4OINF 5COMA 1YZCA 2LSEA 4Q4ZF 4PFOA 2WVOA 5F5FA 4XEFA 3DM5A 3LJBA 3LS1A 5E2QA 1M57C 3DD7A 1UG7A 2CDQA 2J9UA 3KL4A 1EI7A 3DMDA 1K05A 4Z9JA 2J0WA 1EKYA 1DOVA 2IXPA 3HNIA 4BJ5C 1T6QA 5AC4A 4D4XA 4EBKA 1JR8A 3LUTB 4QI0A 1VB5A 2LK4A 4DRJB 1ZHXA 2DYRC 4EHPA 1YYXA 4YT8A 4RBNA 1TWAA 2EIMC 3EGXA 5E3AA 4FAPB 5KYYA 3F46A 1WATA 2LFFA 1QSPA 4ULWA 1XWJA 1VYKA 3IEEA 5DS5A 1V54C 5DQZA 1ORYA 3UMHA 4A2NB 2L9JA 2DGJA 2WZLA 4U9EA 2A6EF 2Y39A 2NPUA 4JURI 1J8MF 3FOOA 3JRTA 4IWBA 3U2LA 3B9QA 3EGDB 4WGZA 2J8WA 1BBHA 1RKCA 1VOMA 2XXAA 1M2VA 1E84A 1OW8A 4MTGA 2GAQA 2XLMA 2Q7RA 3NYJA 3TJ5A 2B0JA 2YKZA 2VB6A 1RJ9A 1Q0MA 3VM6A 3ZWIA 4MVSA 5A6JA 2ETSA 2FAPB 1VK5A 2PX3A 5T3WA 1G4WR 2IOQA 1I4ZA 1WASA 4E0HA 2IXOA 1LI5A 2ZXWC 3ASOC 2R7XA 2L81A 2OG2A 2WB7A 3ECSA 3RQFA 5AC5A 5L0HA 1PD1A 1TFKB 2Q4FA 3EH2A 4JW1A 3T4RA 2DB4A 2KW3C 1C02A 3OEOA 5JP7A 5L0CA 4P9FA 3LS0A 1RKEA 3EPVA 2EIKC 4H54A 3ABKC 3MYFA 4NTAA 3TQOA 4IAOA 1J8YF 3J06A 1LE2A 3FOPA 4YT2A 3DM9B 1B68A 4UDVA 2OJQA 4DOZA 4DBQA 3H65A 4QI2A 2F22A 3IQTA 2A68F 3SXKA 4C3BA 1N1CA 5CI8A 4G7HF 3JZ0A 3TOLA 4JJGA 2AVKA 3ZVRA 2A0UA 1APCA 1JMWA 2Y3GA 3KH2A 4EKWA 2P7VA 1OCZC 5AGFA 5D92A 2W4MA 2FGYA 3VAYA 3FVYA 2A6HF 3EHMA 2R9RB 3L8JA 4JC7A 2OCCC 3AG1C 2OQMA 4CS8A 5KYWA 2YLIA 2YL7A 1EA8A 2NUTB 2PX0A 3N24A 4XPWA 1OXKA 1Q0GA 2LCHA 1ZW3A 1YDIA 3S29A 3TK0A 4OD5A 4C7OB 1HY5A 3GODA 4WJ0A 4OIPF 2HKVA 2Y3BA 3QMKA 4GQHA 5A69A 2HFIA 3JSEO 2H7BA 4CIHA 2YVKA 3C62A 1YLMA 2A0BA 4YT5A 4NTFA 2Y3HA 1BZ4A 1LPEA 3AOUA 3AGUA 1JPJA 2V3CC 2QUPA 3RH3A 3GM1A 3IPMO 4BEMJ 1Y6DA 1SMYF 3K1HA 3M4BA 3O10A 4O79A 3T6GB 2O9XA 2QTVA 1UFBA 4FESA 1I4YA 4ER9A 2PF4E 3ZG1A 4PJJA 4JRZA 4CS7A 3FAJA 4YL3A 4K7BA 1U6HA 3V5ZA 4CSAC 3MX3A 2XS8A 3AJMA 3DKAA 4I1MA 4BJ6A 2RD9A 1A7VA 2MYSA 1LVKA 1L3PA 2FFHA 1XZPA 1ORJA 3C18A 3F47A 3I4UA 3PMRA 2J9VA 3HLZA 1D0XA 2XRHA 1QQ3A 2XL4A 4J7YA 5A6BA 5JUAA 3TULA 1Q0KA 3SXMA 4LDRA 4CS9A 4JCZA 3ZC4A 4H4KC 2HV6A 3LNRA 1A7DA 3U0CA 4XLPF 4OIOF 1SR2A 1G4US 4XLNF 1RMVA 3W2VA 2QE9A 2HSBA 4XTKA 5L0IA 1Q0FA 3NYMA 1T5OA 3S28A 1K40A 4E7ZA 2NSGA 4XWJA 1ZHWA 1O5HA 4JTCB 4LLEA 5B3IA 1WGWA 1GS9A 2P61A 3EFOB 1LS1A 5EK0A 2Y3DA 1OR3A 3ZTZA 3B0UX 5A6AA 3JYYA 4EIYA 4U5HA 3RF3A 3V5YA 5CIVA 1M2OA 1JPNA 3HKKA 1CGOA 1Z7Qc 5T3TA 4L6RA 1ZVZA 2CGEA 2M64A 4XEVA 1ZYRF 1FTSA 1H6GA 3S9OA 2D5RB 3R7CA 1NBBA 2P1AA 1ORSC 4XEKA 3WHNA 2NUPB 4CIPA 3FDQA 1BR4A 3QTHA 4N4WA 4NY3A 3ZQVA 3KYJA 2LIGA 2CNWA 4OD4A 3N2ZB 2M4EA 1ZHTA 5B3SC 2KJGA 5BQHA 3Q7GA 2J7PD 5FZTA 2R7VA 2Z15A 1TKNA 1OXBA 4M63A 1LKXA 4LERA 4AX2A 1PCXA 3B0PA 3T9OA 4CDYA 1KTMA 3IQ5A 2KYHA 4EUKB 1LS4A 2C04A 2PNOA 3W8HA 1D0ZA 3DWWA 4JE9A 1ZHZA 2AWYA 3U2MA 3EZHA 1T6IA 2DYSC 3TD7A 5L0JA 4P6IC 3MYIA 3PDMP 2R02A 2AU5A 5DLJA 4W8KA 3MLGA 1M6TA 3Q6MA 3U8VA 1T9KA 1Y4CA 2PP4A 2EIJC 1T6UA 1ZHYA 1C03A 2AWCA 2OKUA 2WVQA 3AQCA 3CZ6A 3GWNA 3IQ6A 4Q7CA 3AG4C 5EHHA 2OJED 5L0GA 3FXHA 3K66A 2G3KA 1OW7A 3GM2A 4X0RA 3HTKC 4YN0B 3EGDA 1D1AA 4I1OB 3M15A 3RIPA 2LQGA 2VASA 3U3FA 5COGA 5T1DB 1HW1A 2X51A
chains in the Genus database with same CATH topology
2KSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSF A; 
#chains in the Genus database with same CATH topology
 1VYI A;  3NMI A;  2D4U A;  1BDJ B;  3L1M A;  2P6V A;  3KPH A;  2EPO A;  1HE9 A;  4IAR A;  3LES A;  1TWC A;  4B6I A;  4A4A A;  4KNV A;  2W45 A;  1OKK D;  4YL0 A;  5HV9 A;  1G5Z A;  2R7S A;  2R03 A;  2HV7 A;  5D91 A;  2H8A A;  1VLS A;  3LAY A;  3AGT A;  3QW1 A;  2G62 A;  2HMQ A;  3DAG A;  2KNH A;  2XLD A;  5EGY A;  2MWQ A;  3KYI A;  4HFK B;  1FMV A;  1L7C A;  1TWG A;  2H7V C;  2WL8 A;  3K7D A;  4IGG A;  4RDA A;  5TJ5 E;  4C3E A;  3ABL C;  5JLI A;  2Q9C A;  2VC9 A;  3G4X A;  3KKB A;  1Z63 A;  3EQL F;  3SXY A;  1W2W A;  5BQG A;  3I5P A;  3B29 A;  1A0B A;  5F5H A;  2EPN A;  2L6F A;  3NKE A;  3N0T A;  3PHF 2;  5E33 A;  3HJC A;  1AEP A;  4NTB A;  4YT4 A;  3I5Q A;  4BJT A;  3S27 A;  3SZR A;  3AQB A;  1VTM P;  1ZU5 A;  1LI7 A;  2EPK X;  2VCC A;  1K04 A;  1FFT C;  1TQG A;  3EJN A;  4Z9H A;  4IJJ A;  3LEV A;  2X0C A;  2EPL X;  3K1I A;  2ZD9 A;  3VRC A;  3WAQ A;  3WG7 C;  2NUT A;  4EBJ A;  1H9T A;  2LFD A;  3EH1 A;  5F28 E;  1ZU4 A;  1U0B B;  2YHS A;  1S05 A;  1YAR O;  3R2P A;  4C7O A;  2XLV A;  2OOC A;  1V74 B;  3C8G D;  4AL0 A;  2EIL C;  4HEA J;  4CDV A;  4Z9I A;  2ZXO A;  3FHD A;  1E86 A;  1LM3 B;  5CI9 A;  2HZ8 A;  3DXJ F;  3G50 A;  1XZQ A;  1SF8 A;  3E9V A;  3EZI A;  3GM3 A;  3GOR A;  4KC9 A;  4DRI B;  2BE5 F;  3DE9 A;  3UGP A;  1QPU A;  1TWH A;  5JS5 A;  3E70 C;  3ZSU A;  4DVZ A;  2I8B A;  2IXM A;  1HMO A;  4P9T A;  4BJ5 A;  4BEJ A;  4JEB A;  1PD0 A;  4BJ1 A;  1Q0D A;  4CBE A;  2GDC A;  5JVE A;  2HMZ A;  1NFO A;  3HNK A;  2Q3T A;  4MVU A;  3US6 A;  1V4A A;  2J0X A;  2YLG A;  3WOD F;  1OW6 A;  2GA0 A;  2PFD A;  2WZG A;  4YK5 A;  4OIQ F;  4IAQ A;  2NG1 A;  4U5B E;  3W2W A;  4J32 B;  5BUO A;  3A9C A;  1NG1 A;  2XL6 A;  1WOL A;  2XL8 A;  2XM0 A;  4MVO A;  1M56 C;  1OCR C;  2Q9A A;  3ATP A;  3BRJ A;  3SP1 A;  4BG0 A;  2XS1 A;  4JZA A;  3K33 A;  3A11 A;  1ZW2 A;  4AL1 A;  4O7G A;  1HW2 A;  4KI2 A;  1LIH A;  1NZE A;  1O87 A;  1H9G A;  2GFH A;  1MNE A;  4N6C A;  3JYH A;  1BR2 A;  4G0H A;  2G3V A;  2PBE A;  3NRH A;  2XM4 A;  4DRH B;  1E2X A;  3CSK A;  4KBL A;  1R4T A;  4XPX A;  2P0N A;  2B0H A;  2C03 A;  3KMI A;  4JCH A;  4MS2 A;  4MVQ A;  4ZLC A;  2J46 A;  5L3Q A;  2OEX A;  4AE4 A;  4PJM A;  1GM5 A;  3RW0 A;  1KNY A;  2A69 F;  2BC5 A;  4MVM A;  4RD9 A;  2XLH A;  2VCA A;  2EIN C;  2OEV A;  4LAC B;  3SEO A;  1YAU O;  2XLE A;  3VF0 A;  3EFO A;  5KYU B;  4XQ1 A;  4NCQ A;  3RKO F;  4CS9 C;  3FAP B;  1FAP B;  4MTF A;  3GWL A;  1LE4 A;  3X2Q C;  4CS8 C;  1OCC C;  4QDL A;  4J30 B;  2WVN A;  4AE4 B;  2NSF A;  5KYU A;  5KYX B;  3G4Z A;  1YYJ A;  2HJM A;  5IY5 C;  5GPG B;  2L6H A;  4OIR F;  4PR9 A;  1MND A;  3V5X A;  4I3M A;  4WGY A;  1C17 M;  1D1C A;  2NUP A;  2W9Y A;  3VYW A;  2RSE B;  3NYL A;  2HUJ A;  3BEH A;  3NMK A;  2R7Q A;  1T01 A;  3OA1 A;  3QVY A;  3U5S A;  4G7Z F;  2EPM X;  3DZA A;  2XXA B;  3LEO A;  2MHR A;  2TMV P;  2KC3 A;  1O3U A;  4EWC A;  3ABM C;  1SZI A;  3L8I A;  1FMW A;  4U5F E;  2J7P A;  4IRU A;  4PJN A;  4K1O A;  1RCP A;  2L7A A;  2QNL A;  4U5C E;  3HNL A;  1D1B A;  4ANJ A;  4CJO A;  1F1M A;  4E7S A;  4O6Y A;  1MMN A;  2JX0 A;  5BQI A;  2YL3 A;  3DJN B;  2ICW G;  3EGX B;  5KYY B;  3JRM O;  4BJ6 C;  4F4B A;  1QLE C;  2I15 A;  1FFH A;  2UUH A;  3JCU Q;  2WZF A;  3ASN C;  4ONS A;  2CW0 F;  1YA7 O;  3NMJ A;  5B1B C;  1OR2 A;  3L0I A;  2JD3 A;  4C3D A;  5HSW A;  4JKV A;  4DBR A;  1MQV A;  4JTA B;  2KGO A;  2YRF A;  3Q6N A;  4U5D E;  1IZM A;  2XSE A;  3IQC A;  3RVY A;  3CEX A;  3ZIB A;  1M2V B;  1Z6A A;  3H2V A;  1HE1 A;  3L34 A;  4MVZ A;  3TJ6 A;  4PAC A;  4JIO A;  4DXW A;  4FX5 A;  4JEA A;  1RJ9 B;  2HJ3 A;  4MVR A;  2Q9B A;  1I5N A;  4BPM A;  3B0V C;  1MMA A;  4O6N A;  4CSA A;  2R7U A;  3SYN A;  3QW0 A;  3GAN A;  3UNG C;  2YWA A;  3C63 A;  3ZTM A;  4CJG A;  2LD6 A;  3O39 A;  4AK9 A;  2IYL D;  2QY9 A;  3O6X A;  1NU7 D;  2YEV A;  3GEI A;  4NQF A;  4EBB A;  4JVS A;  1H7I A;  2CCY A;  3DE8 A;  4KNW A;  3EG9 B;  2YL0 A;  2KQ9 A;  2ZPA A;  3U9J A;  2HSQ A;  4DVY P;  2A1D D;  4GYT A;  1OKK A;  2Q00 A;  3LNM B;  5DS4 A;  1A7E A;  2CYD A;  3S84 A;  4MND A;  4CX9 A;  1FR0 A;  1RKE B;  1FNT c;  4LDK A;  2R7T A;  3EG9 A;  1KU2 A;  4N06 A;  2R7W A;  2IM8 A;  4XPY A;  3LLI A;  2KSF A;  4O6M A;  4U5G A;  1Z3I X;  3MFN A;  5FCL A;  1MMG A;  2R25 A;  3SXZ A;  5DVW A;  2R05 A;  4Q5S F;  1VLT A;  3O55 A;  3QVZ A;  2OU6 A;  2VH3 A;  1WWP A;  1NLX A;  3M79 A;  2J9W A;  2LP4 A;  4R32 A;  2DI3 A;  4GEH A;  1YVI A;  4LDQ A;  2W4B A;  4JTD B;  4MTO A;  4PK4 A;  1TFO B;  4YWQ A;  4NC3 A;  4YL1 A;  5DS6 A;  1A41 A;  2Y69 C;  1ZZP A;  3AG2 C;  1E85 A;  5L3V A;  2YL1 A;  2XLW A;  4MW3 A;  5E3C A;  5K0I A;  4G7O F;  1YJG A;  2GWW A;  1G8X A;  3X1O A;  1EQ1 A;  1ST6 A;  3M1C B;  2YQY A;  4CDA A;  5KYN A;  5KYW B;  3H2U A;  2R7O A;  3FMS A;  1CGM E;  1JRA A;  3RFY A;  3MBG A;  3C7J A;  3W8I A;  1CGN A;  4D4N A;  1PV3 A;  1TR2 A;  3C8G B;  3T6B A;  3ITF A;  3ZQY A;  4LLC A;  3M4C A;  1HMD A;  3NG1 A;  3RVZ A;  4U5E E;  3JT1 A;  2H7O A;  1QKR A;  5JT4 A;  3UR3 C;  3C8G A;  3UGO A;  1E83 A;  3RQE A;  1BR1 A;  2QLA A;  4E0I A;  1GGQ A;  1JOG A;  3UMK A;  1IW7 F;  1YA9 A;  3Q7L A;  4G78 A;  2KK1 A;  3U9M A;  4HFF B;  2XLO A;  3GEE A;  1RXQ A;  3PCV A;  1GQA A;  3AG3 C;  5DQT A;  4U9D A;  4JJF A;  2JPU A;  1QZX A;  1MMD A;  1VMA A;  3UMI A;  5A6B D;  3C8Z A;  3NKD A;  4E18 A;  1OQC A;  3IHU A;  2YZS A;  1SYQ A;  5L0D A;  4PFP A;  1OCO C;  2IBF A;  3W4Y A;  4FWV A;  3GEH A;  2VCB A;  5B1A C;  2IXN A;  1WN0 A;  1NFN A;  2J9B A;  4J7T A;  3DJU B;  3T6J A;  4WAB A;  1NSG B;  3S90 A;  3DI5 A;  4N6H A;  256B A;  1NU9 C;  3LLK A;  1R5I D;  3HNJ A;  2YLD A;  2ZXP A;  3U3B A;  4ZLD A;  4IB4 A;  1JAF A;  3CQZ A;  3EHN A;  4YJW A;  1AUE A;  1WTY A;  2AP3 A;  2R7R A;  3OWT A;  3U8P A;  3DAF A;  3K6B A;  2J45 A;  3CAX A;  1AVO B;  4I44 A;  4ULV A;  2HS5 A;  1DOW A;  3JTL O;  3V7O A;  2ASR A;  3RYL A;  1YZA A;  5JRA A;  1Z23 A;  3SNH A;  4E17 A;  4MW8 A;  5COF A;  1S7Z A;  2V26 A;  3POV A;  3QZC A;  3K1I C;  2E87 A;  5JSL A;  1CPR A;  4MQ9 F;  1CPQ A;  1V55 C;  3JSZ A;  2BL2 A;  2UUI A;  4W8P A;  3ZDL A;  4DJ9 A;  5KYX A;  5L0F A;  2ZXR A;  1D0Y A;  3S0X A;  2L6G A;  3TOM A;  1U89 A;  1QVX A;  2CNW D;  4K0D A;  4HE8 D;  3RQG A;  1Z5Z A;  3B71 A;  3NDB B;  5A6K A;  4PJL A;  4OIN F;  5COM A;  1YZC A;  2LSE A;  4Q4Z F;  4PFO A;  2WVO A;  5F5F A;  4XEF A;  3DM5 A;  3LJB A;  3LS1 A;  5E2Q A;  1M57 C;  3DD7 A;  1UG7 A;  2CDQ A;  2J9U A;  3KL4 A;  1EI7 A;  3DMD A;  1K05 A;  4Z9J A;  2J0W A;  1EKY A;  1DOV A;  2IXP A;  3HNI A;  4BJ5 C;  1T6Q A;  5AC4 A;  4D4X A;  4EBK A;  1JR8 A;  3LUT B;  4QI0 A;  1VB5 A;  2LK4 A;  4DRJ B;  1ZHX A;  2DYR C;  4EHP A;  1YYX A;  4YT8 A;  4RBN A;  1TWA A;  2EIM C;  3EGX A;  5E3A A;  4FAP B;  5KYY A;  3F46 A;  1WAT A;  2LFF A;  1QSP A;  4ULW A;  1XWJ A;  1VYK A;  3IEE A;  5DS5 A;  1V54 C;  5DQZ A;  1ORY A;  3UMH A;  4A2N B;  2L9J A;  2DGJ A;  2WZL A;  4U9E A;  2A6E F;  2Y39 A;  2NPU A;  4JUR I;  1J8M F;  3FOO A;  3JRT A;  4IWB A;  3U2L A;  3B9Q A;  3EGD B;  4WGZ A;  2J8W A;  1BBH A;  1RKC A;  1VOM A;  2XXA A;  1M2V A;  1E84 A;  1OW8 A;  4MTG A;  2GAQ A;  2XLM A;  2Q7R A;  3NYJ A;  3TJ5 A;  2B0J A;  2YKZ A;  2VB6 A;  1RJ9 A;  1Q0M A;  3VM6 A;  3ZWI A;  4MVS A;  5A6J A;  2ETS A;  2FAP B;  1VK5 A;  2PX3 A;  5T3W A;  1G4W R;  2IOQ A;  1I4Z A;  1WAS A;  4E0H A;  2IXO A;  1LI5 A;  2ZXW C;  3ASO C;  2R7X A;  2L81 A;  2OG2 A;  2WB7 A;  3ECS A;  3RQF A;  5AC5 A;  5L0H A;  1PD1 A;  1TFK B;  2Q4F A;  3EH2 A;  4JW1 A;  3T4R A;  2DB4 A;  2KW3 C;  1C02 A;  3OEO A;  5JP7 A;  5L0C A;  4P9F A;  3LS0 A;  1RKE A;  3EPV A;  2EIK C;  4H54 A;  3ABK C;  3MYF A;  4NTA A;  3TQO A;  4IAO A;  1J8Y F;  3J06 A;  1LE2 A;  3FOP A;  4YT2 A;  3DM9 B;  1B68 A;  4UDV A;  2OJQ A;  4DOZ A;  4DBQ A;  3H65 A;  4QI2 A;  2F22 A;  3IQT A;  2A68 F;  3SXK A;  4C3B A;  1N1C A;  5CI8 A;  4G7H F;  3JZ0 A;  3TOL A;  4JJG A;  2AVK A;  3ZVR A;  2A0U A;  1APC A;  1JMW A;  2Y3G A;  3KH2 A;  4EKW A;  2P7V A;  1OCZ C;  5AGF A;  5D92 A;  2W4M A;  2FGY A;  3VAY A;  3FVY A;  2A6H F;  3EHM A;  2R9R B;  3L8J A;  4JC7 A;  2OCC C;  3AG1 C;  2OQM A;  4CS8 A;  5KYW A;  2YLI A;  2YL7 A;  1EA8 A;  2NUT B;  2PX0 A;  3N24 A;  4XPW A;  1OXK A;  1Q0G A;  2LCH A;  1ZW3 A;  1YDI A;  3S29 A;  3TK0 A;  4OD5 A;  4C7O B;  1HY5 A;  3GOD A;  4WJ0 A;  4OIP F;  2HKV A;  2Y3B A;  3QMK A;  4GQH A;  5A69 A;  2HFI A;  3JSE O;  2H7B A;  4CIH A;  2YVK A;  3C62 A;  1YLM A;  2A0B A;  4YT5 A;  4NTF A;  2Y3H A;  1BZ4 A;  1LPE A;  3AOU A;  3AGU A;  1JPJ A;  2V3C C;  2QUP A;  3RH3 A;  3GM1 A;  3IPM O;  4BEM J;  1Y6D A;  1SMY F;  3K1H A;  3M4B A;  3O10 A;  4O79 A;  3T6G B;  2O9X A;  2QTV A;  1UFB A;  4FES A;  1I4Y A;  4ER9 A;  2PF4 E;  3ZG1 A;  4PJJ A;  4JRZ A;  4CS7 A;  3FAJ A;  4YL3 A;  4K7B A;  1U6H A;  3V5Z A;  4CSA C;  3MX3 A;  2XS8 A;  3AJM A;  3DKA A;  4I1M A;  4BJ6 A;  2RD9 A;  1A7V A;  2MYS A;  1LVK A;  1L3P A;  2FFH A;  1XZP A;  1ORJ A;  3C18 A;  3F47 A;  3I4U A;  3PMR A;  2J9V A;  3HLZ A;  1D0X A;  2XRH A;  1QQ3 A;  2XL4 A;  4J7Y A;  5A6B A;  5JUA A;  3TUL A;  1Q0K A;  3SXM A;  4LDR A;  4CS9 A;  4JCZ A;  3ZC4 A;  4H4K C;  2HV6 A;  3LNR A;  1A7D A;  3U0C A;  4XLP F;  4OIO F;  1SR2 A;  1G4U S;  4XLN F;  1RMV A;  3W2V A;  2QE9 A;  2HSB A;  4XTK A;  5L0I A;  1Q0F A;  3NYM A;  1T5O A;  3S28 A;  1K40 A;  4E7Z A;  2NSG A;  4XWJ A;  1ZHW A;  1O5H A;  4JTC B;  4LLE A;  5B3I A;  1WGW A;  1GS9 A;  2P61 A;  3EFO B;  1LS1 A;  5EK0 A;  2Y3D A;  1OR3 A;  3ZTZ A;  3B0U X;  5A6A A;  3JYY A;  4EIY A;  4U5H A;  3RF3 A;  3V5Y A;  5CIV A;  1M2O A;  1JPN A;  3HKK A;  1CGO A;  1Z7Q c;  5T3T A;  4L6R A;  1ZVZ A;  2CGE A;  2M64 A;  4XEV A;  1ZYR F;  1FTS A;  1H6G A;  3S9O A;  2D5R B;  3R7C A;  1NBB A;  2P1A A;  1ORS C;  4XEK A;  3WHN A;  2NUP B;  4CIP A;  3FDQ A;  1BR4 A;  3QTH A;  4N4W A;  4NY3 A;  3ZQV A;  3KYJ A;  2LIG A;  2CNW A;  4OD4 A;  3N2Z B;  2M4E A;  1ZHT A;  5B3S C;  2KJG A;  5BQH A;  3Q7G A;  2J7P D;  5FZT A;  2R7V A;  2Z15 A;  1TKN A;  1OXB A;  4M63 A;  1LKX A;  4LER A;  4AX2 A;  1PCX A;  3B0P A;  3T9O A;  4CDY A;  1KTM A;  3IQ5 A;  2KYH A;  4EUK B;  1LS4 A;  2C04 A;  2PNO A;  3W8H A;  1D0Z A;  3DWW A;  4JE9 A;  1ZHZ A;  2AWY A;  3U2M A;  3EZH A;  1T6I A;  2DYS C;  3TD7 A;  5L0J A;  4P6I C;  3MYI A;  3PDM P;  2R02 A;  2AU5 A;  5DLJ A;  4W8K A;  3MLG A;  1M6T A;  3Q6M A;  3U8V A;  1T9K A;  1Y4C A;  2PP4 A;  2EIJ C;  1T6U A;  1ZHY A;  1C03 A;  2AWC A;  2OKU A;  2WVQ A;  3AQC A;  3CZ6 A;  3GWN A;  3IQ6 A;  4Q7C A;  3AG4 C;  5EHH A;  2OJE D;  5L0G A;  3FXH A;  3K66 A;  2G3K A;  1OW7 A;  3GM2 A;  4X0R A;  3HTK C;  4YN0 B;  3EGD A;  1D1A A;  4I1O B;  3M15 A;  3RIP A;  2LQG A;  2VAS A;  3U3F A;  5COG A;  5T1D B;  1HW1 A;  2X51 A; 
#chains in the Genus database with same CATH homology
 2KSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...