2KSFA

Backbone structure of the membrane domain of e. coli histidine kinase receptor kdpd, center for structures of membrane proteins (csmp) target 4312c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
MVQIQGSVVAAALSAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVSFDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein kdpD
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 32
structure length 107
sequence length 107
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Backbone structure of the membrane domain of e. Coli histidine kinase receptor kdpd, 2ksfA00
2KSFA
chains in the Genus database with same CATH superfamily
1ORYA 3FAPB 4IRUA 1O87A 5L0CA 2OG2A 3GM3A 2BL2A 1FFHA 2HS5A 1SZIA 1TWHA 3DM5A 5FZTA 4BEMJ 2JD3A 4BJ1A 2OJQA 2PX3A 1OCZC 2XM4A 2AWYA 4GEHA 5D92A 2CNWD 4RDAA 2NSFA 5T3TA 1Q0GA 3SXKA 4RD9A 3WODF 5DQZA 2QUPA 4MVSA 4C3BA 2YL3A 2WVOA 2G3VA 4BJ6A 1FMWA 2A0UA 4N6HA 1QPUA 4JCHA 1PD1A 1U0BB 3ZG1A 1BZ4A 4IAOA 4JZAA 3U2LA 4BJ6C 2BC5A 2V26A 4XEKA 4H4KC 4MVZA 3S29A 4XEVA 1JRAA 2YLDA 2R02A 2TMVP 3X1OA 4C7OB 2ICWG 2CCYA 3DAGA 1ORSC 3EFOA 3EGDB 3POVA 1Q0DA 1H7IA 1LS4A 1YYXA 2IM8A 2XM0A 4FESA 1YAUO 3CAXA 4A2NB 1IZMA 1OR3A 4U5BE 4E7ZA 1CGME 1TFOB 3NRHA 3NKDA 3R7CA 1O5HA 2A0BA 3DMDA 3SP1A 5IY5C 3LNMB 2XRHA 4DOZA 1NSGB 2P6VA 2XS1A 4I1MA 3ZDLA 1YA9A 2YQYA 4BG0A 5T1DB 1FR0A 5GPGB 2J9WA 5L0GA 4CJGA 4OD5A 3T9OA 3FAJA 3QZCA 2WVQA 4G78A 4JTDB 4O7GA 3Q6NA 3EZIA 4E7SA 1A0BA 4QDLA 1Z3IX 2C03A 2PBEA 3O10A 1TQGA 1OCOC 1W2WA 1ZU4A 2NUPB 3GANA 3I5PA 3M15A 2XL6A 1LE2A 4J7TA 1DOWA 4CIPA 1GGQA 1EA8A 2GWWA 1VYIA 2L81A 5CI8A 4PJJA 1GM5A 1LPEA 4ULVA 1VYKA 4YL1A 1QLEC 4X0RA 2KJGA 3C8GB 3K1IC 4EHPA 1QZXA 3BRJA 3OA1A 2HSQA 3OWTA 1L3PA 5B3SC 2YVKA 3U9MA 2ZXRA 1Z6AA 1D0ZA 3FHDA 4IJJA 4U5DE 1WATA 3ZQYA 2AP3A 3V5ZA 4P9TA 3FXHA 1MMGA 2YL7A 2VCCA 2YLGA 2WZFA 2CYDA 1ZHYA 2R7TA 1CGNA 3X2QC 3ZQVA 1MMDA 3QTHA 4JEAA 4CBEA 2X0CA 4YJWA 4FWVA 5D91A 5KYWB 2A6HF 3FOPA 2WL8A 4O6YA 2YRFA 3EQLF 4KNWA 1ZU5A 2XXAB 1LI5A 256BA 2DYRC 3K66A 4AL1A 3T4RA 5BUOA 1G8XA 5L3QA 3JSEO 3J06A 3GM2A 4G0HA 3DZAA 3TOMA 4G7ZF 4P9FA 2DI3A 2Y3GA 3HKKA 3DE8A 1E86A 3IEEA 4N6CA 4DJ9A 3B0PA 1NU7D 1F1MA 2XL8A 3AGTA 3MBGA 1D1BA 4D4NA 1AEPA 3GM1A 3U9JA 1YDIA 1VLSA 4PJMA 3QVZA 5KYYB 1OR2A 1K04A 2L6GA 3B0UX 4JJGA 1T01A 3C8GD 5JRAA 1MNDA 5KYUA 2AWCA 3KL4A 3O6XA 2Q9CA 3DWWA 1XWJA 2OU6A 4QI0A 4WGZA 1YYJA 3W2WA 3RQGA 5EGYA 4EBJA 2ZPAA 1JR8A 3AG2C 1FAPB 1R5ID 3ABMC 1OW8A 2QY9A 4Z9IA 2EIMC 5JSLA 2HJMA 3O39A 4O6NA 3LS0A 4O6MA 2IBFA 5E3AA 3K1HA 4I1OB 2HJ3A 2P1AA 3ATPA 1OW7A 2HKVA 3MX3A 1MMAA 1APCA 1SR2A 1VOMA 3NYLA 1Z7Qc 2LIGA 4OINF 3V5XA 3ZIBA 4DRIB 3E70C 4EBBA 1I4ZA 2CGEA 4PJLA 3T6JA 1RJ9A 2HZ8A 3L1MA 3EGXA 3EG9A 2OKUA 1JAFA 2QLAA 1H9GA 2IXMA 4KNVA 5B1BC 2PX0A 2NG1A 3S90A 2YKZA 1NLXA 4I44A 5COGA 4LDRA 1GS9A 3TK0A 4AL0A 3EH1A 2J45A 2VCBA 3EPVA 4AE4A 3L34A 4XQ1A 4JKVA 4NTBA 1V55C 4MTFA 3LLKA 3U8PA 5JS5A 3B0VC 3Q7GA 1LI7A 4N4WA 3LJBA 4LDQA 2NSGA 1KU2A 1HW1A 3KMIA 5F5FA 2UUHA 2R9RB 1T6UA 1M6TA 3H2VA 2AU5A 3DKAA 3I5QA 2EPKX 4DBQA 1CPQA 4J30B 2D5RB 1RKEA 4JTCB 4MTGA 4AK9A 2D4UA 3F46A 3EHMA 3T6GB 4B6IA 4A4AA 3JYYA 5AGFA 2WB7A 4N06A 3UMKA 2KW3C 3QVYA 4NQFA 4YN0B 4C3DA 3RVYA 3GORA 4YL3A 2PF4E 3VM6A 5B1AC 4OIPF 2H8AA 2VASA 3NKEA 1XZPA 4PFOA 2YWAA 2O9XA 3FMSA 3W8HA 4YT4A 2W4BA 5KYXA 3NDBB 1ZHWA 3DI5A 1PD0A 4FX5A 3ABKC 4XPWA 3U3FA 4IWBA 1M2VA 4J7YA 1Z63A 4JE9A 1I5NA 1BDJB 1RXQA 5BQGA 1QSPA 2VC9A 3HNIA 3ABLC 5KYNA 4OIOF 3H2UA 4MNDA 2WVNA 1OKKD 3L8IA 5L0HA 3MFNA 3S0XA 1JOGA 3PDMP 3EZHA 4WABA 4NCQA 3NYJA 1E84A 1ST6A 3CEXA 4JRZA 2OOCA 3U5SA 5DLJA 1Q0MA 1C17M 3HJCA 2OCCC 4CDAA 2Y69C 4CS8C 2J7PD 4YT8A 2OEVA 3QW0A 3U2MA 2OEXA 3FOOA 1SMYF 3LS1A 1NG1A 1SYQA 1S7ZA 2OJED 3K1IA 1O3UA 2GDCA 4K1OA 3NMKA 3JTLO 3TJ6A 1FNTc 5E2QA 1RMVA 1T6QA 1WTYA 3M4CA 2L9JA 1VB5A 2EPOA 3WHNA 4G7OF 2BE5F 1A7VA 3SEOA 3EFOB 1NZEA 3G50A 3TJ5A 3R2PA 3JYHA 1M56C 2LP4A 4XLPF 2V3CC 2GFHA 3Q7LA 2G62A 4U5FE 4EIYA 5A6BD 2Q00A 2XLMA 2XS8A 4JURI 1FMVA 1UFBA 4K7BA 4MVQA 1TWGA 2IXNA 4ULWA 5F5HA 2XLEA 4MTOA 4J32B 3I4UA 5FCLA 1C03A 5BQIA 3HNKA 1OCRC 2YZSA 3MLGA 4U5EE 2J9VA 1BBHA 1J8YF 4JEBA 1J8MF 4MVUA 1KTMA 2ZXOA 4OIRF 2Y3DA 1LKXA 1XZQA 5JT4A 2EIJC 3RQFA 1TWAA 4CDVA 1E83A 3SNHA 4CX9A 4EKWA 3TULA 3MYIA 1ZVZA 2HSBA 1QVXA 3M1CB 4MQ9F 2MYSA 4HE8D 4DRJB 1ZYRF 1R4TA 2YL1A 5CIVA 3GEIA 4WGYA 2QTVA 3LESA 4ER9A 4IARA 5T3WA 2J0WA 4H54A 2A69F 4RBNA 3S28A 1HMOA 2L6FA 4EUKB 4NTFA 2W45A 3AOUA 4OIQF 1Z5ZA 2FGYA 2JX0A 2W4MA 3AG3C 4YWQA 4BEJA 4CS7A 4P6IC 2I15A 3B9QA 1E85A 2YL0A 2CNWA 2J9UA 2J9BA 2Q4FA 4XPYA 2AVKA 3AGUA 3RQEA 1FFTC 2DB4A 4MVMA 4NC3A 3WG7C 4XLNF 3M4BA 1JMWA 1KNYA 2IYLD 2E87A 4CSAA 3IPMO 4W8KA 1ZHTA 3UR3C 2MWQA 5E3CA 5DS4A 2HUJA 3B71A 3SXZA 4CSAC 2R25A 2KC3A 3MYFA 5L0DA 2R7WA 2ASRA 2G3KA 1WWPA 1OCCC 1CPRA 3C7JA 3RF3A 2HMZA 4LERA 3CZ6A 3RH3A 5K0IA 1M57C 2IOQA 2Y3BA 1OKKA 2LQGA 2ZD9A 4GQHA 4LLCA 2KGOA 2QE9A 4MS2A 2J0XA 4G7HF 4U9EA 3JCUQ 4KC9A 3RYLA 4LACB 4AX2A 3G4ZA 4CDYA 3ASNC 3K6BA 1D0YA 3U3BA 3RKOF 3VAYA 4EWCA 1DOVA 4KBLA 1T5OA 4U9DA 3KPHA 2H7BA 2J8WA 3UNGC 5KYUB 3IQ5A 3VRCA 1OXBA 3DJNB 4HFKB 1B68A 4CS9A 1HY5A 1TWCA 1H9TA 1YZAA 1AVOB 2R03A 3EJNA 1VMAA 3L0IA 2XSEA 2NPUA 4CS9C 1FTSA 3FDQA 4QI2A 1YARO 1EQ1A 4C3EA 1LVKA 3AQCA 4MVRA 4U5GA 1K05A 2DGJA 1ZHXA 1NFNA 1SF8A 3AG4C 3ZTMA 3RIPA 5DQTA 2L6HA 3HNJA 2ZXWC 3LUTB 4Q7CA 3K7DA 3S27A 3C18A 4BPMA 1OXKA 4JVSA 1C02A 4D4XA 4E18A 4PR9A 1RJ9B 3DJUB 4JCZA 4XPXA 3EGXB 3EG9B 3V7OA 4CJOA 3JRTA 4IAQA 4C7OA 2EPLX 3NMIA 3HLZA 3RFYA 3AG1C 3EGDA 3SZRA 3TD7A 4F4BA 4JTAB 2I8BA 1NU9C 2R7RA 1CGOA 2VH3A 2R7UA 2RD9A 2YEVA 3KH2A 5DS6A 4AE4B 2CW0F 1OW6A 4YT5A 3ZVRA 2GAQA 4BJ5C 2P7VA 2Q7RA 2J46A 2KK1A 1A41A 4K0DA 1MNEA 3IHUA 3TOLA 3DM9B 1LIHA 4JIOA 3NG1A 2EIKC 2LCHA 3GODA 1IW7F 1HW2A 2XLWA 3VF0A 4DXWA 1Q0FA 3CSKA 1V74B 1PCXA 3IQ6A 2KQ9A 3JZ0A 4CS8A 5EHHA 2CDQA 1RKEB 3U0CA 2NUPA 4IB4A 5L0IA 2FAPB 3NMJA 1VLTA 4MW8A 2MHRA 3LEOA 2Q3TA 2A6EF 4Z9HA 3C8GA 1QQ3A 2XLOA 1GQAA 3A9CA 5JP7A 1BR4A 2WZGA 2Z15A 4DVYP 1U6HA 5KYXB 2P0NA 4BJTA 2NUTA 4ZLDA 2OQMA 2ETSA 3RW0A 4CIHA 5DS5A 3LLIA 1PV3A 1QKRA 1M2VB 2YHSA 2F22A 2KNHA 1MQVA 1S05A 2XLHA 3E9VA 1TR2A 4FAPB 2Y39A 1NFOA 3N24A 2EILC 3C8ZA 1E2XA 2EPMX 4L6RA 4PJNA 3RVZA 4Q4ZF 3N2ZB 1TFKB 2LSEA 3HNLA 3SXMA 2UUIA 4I3MA 5CI9A 4DRHB 5AC5A 1H6GA 3CQZA 5JLIA 3H65A 3V5YA 1U89A 4NY3A 5KYWA 3WAQA 4O79A 3B29A 3OEOA 4W8PA 5DVWA 2XXAA 2B0JA 1A7DA 1K40A 2VB6A 3O55A 1EI7A 3UGPA 3LAYA 3JSZA 5EK0A 3GWLA 2PNOA 1A7EA 4E0IA 1RKCA 1V4AA 3ITFA 4ZLCA 5L0FA 1VTMP 1D0XA 2A68F 1ORJA 2IXOA 2P61A 2LFFA 2RSEB 4WJ0A 2EINC 2NUTB 1G4US 5E33A 1Y6DA 4XWJA 2EPNA 1D1CA 3DAFA 3LNRA 3PHF2 1TKNA 2WZLA 2W9YA 3EH2A 4MVOA 4XEFA 4Z9JA 3W4YA 5KYYA 3S84A 2QNLA 1JPJA 2PFDA 4ONSA 3AJMA 1WN0A 3N0TA 3PCVA 1HMDA 2Q9BA 2Q9AA 1LS1A 1BR1A 2KYHA 5B3IA 1ZHZA 5JVEA 1OQCA 2HMQA 2KSFA 3LEVA 3L8JA 1RCPA 1WASA 3U8VA 1YA7O 2X51A 1LE4A 3ASOC 3GEEA 4GYTA 3W8IA 3ZTZA 2LD6A 2H7OA 2HFIA 2XLDA 2YLIA 5JUAA 3DD7A 5HSWA 5A6KA 1D1AA 2FFHA 2R7QA 4JC7A 1HE9A 1Q0KA 2C04A 4IGGA 5A6JA 5AC4A 4XTKA 1ZW3A 2HV7A 4YL0A 5COFA 5A69A 1ZZPA 4JW1A 2R7XA 3T6BA 1MMNA 1YVIA 3C62A 3C63A 3AQBA 2A1DD 4YK5A 3JT1A 1Y4CA 4U5CE 3IQCA 3TQOA 2R7OA 1EKYA 3S9OA 2R7VA 1YZCA 3M79A 1NBBA 1UG7A 2R05A 2B0HA 4NTAA 1V54C 1JPNA 1WGWA 3GWNA 5COMA 1AUEA 2XLVA 4JJFA 3SYNA 3A11A 3VYWA 1LM3B 1L7CA 2PP4A 3DE9A 1WOLA 4HEAJ 3SXYA 4U5HA 5L3VA 2J7PA 3W2VA 4PFPA 2LFDA 1I4YA 3ZC4A 1G4WR 5L0JA 2GA0A 5HV9A 5F28E 3HTKC 1HE1A 2H7VC 3QW1A 2DYSC 3ECSA 2Y3HA 3Q6MA 1YLMA 2JPUA 3JRMO 4KI2A 3IQTA 3UMHA 1YJGA 1BR2A 1Z23A 1ZW2A 2XL4A 4OD4A 3BEHA 3K33A 4ANJA 3GEHA 5BQHA 3F47A 2VCAA 3QMKA 3EHNA 1VK5A 4HFFB 5A6BA 4DVZA 4R32A 3PMRA 2M4EA 4LLEA 3UMIA 1N1CA 3US6A 4YT2A 4UDVA 2L7AA 2M64A 2ZXPA 3KKBA 4M63A 2IXPA 4MW3A 3UGOA 1M2OA 1T9KA 5TJ5E 3KYJA 3KYIA 2R7SA 1G5ZA 2LK4A 2HV6A 3ZSUA 4PK4A 3DXJF 4BJ5A 4E0HA 4EBKA 4LDKA 3FVYA 1T6IA 3G4XA 3NYMA 4E17A 4DBRA 4Q5SF 5A6AA 4PACA 3ZWIA
chains in the Genus database with same CATH topology
2KSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSF A; 
#chains in the Genus database with same CATH topology
 1ORY A;  3FAP B;  4IRU A;  1O87 A;  5L0C A;  2OG2 A;  3GM3 A;  2BL2 A;  1FFH A;  2HS5 A;  1SZI A;  1TWH A;  3DM5 A;  5FZT A;  4BEM J;  2JD3 A;  4BJ1 A;  2OJQ A;  2PX3 A;  1OCZ C;  2XM4 A;  2AWY A;  4GEH A;  5D92 A;  2CNW D;  4RDA A;  2NSF A;  5T3T A;  1Q0G A;  3SXK A;  4RD9 A;  3WOD F;  5DQZ A;  2QUP A;  4MVS A;  4C3B A;  2YL3 A;  2WVO A;  2G3V A;  4BJ6 A;  1FMW A;  2A0U A;  4N6H A;  1QPU A;  4JCH A;  1PD1 A;  1U0B B;  3ZG1 A;  1BZ4 A;  4IAO A;  4JZA A;  3U2L A;  4BJ6 C;  2BC5 A;  2V26 A;  4XEK A;  4H4K C;  4MVZ A;  3S29 A;  4XEV A;  1JRA A;  2YLD A;  2R02 A;  2TMV P;  3X1O A;  4C7O B;  2ICW G;  2CCY A;  3DAG A;  1ORS C;  3EFO A;  3EGD B;  3POV A;  1Q0D A;  1H7I A;  1LS4 A;  1YYX A;  2IM8 A;  2XM0 A;  4FES A;  1YAU O;  3CAX A;  4A2N B;  1IZM A;  1OR3 A;  4U5B E;  4E7Z A;  1CGM E;  1TFO B;  3NRH A;  3NKD A;  3R7C A;  1O5H A;  2A0B A;  3DMD A;  3SP1 A;  5IY5 C;  3LNM B;  2XRH A;  4DOZ A;  1NSG B;  2P6V A;  2XS1 A;  4I1M A;  3ZDL A;  1YA9 A;  2YQY A;  4BG0 A;  5T1D B;  1FR0 A;  5GPG B;  2J9W A;  5L0G A;  4CJG A;  4OD5 A;  3T9O A;  3FAJ A;  3QZC A;  2WVQ A;  4G78 A;  4JTD B;  4O7G A;  3Q6N A;  3EZI A;  4E7S A;  1A0B A;  4QDL A;  1Z3I X;  2C03 A;  2PBE A;  3O10 A;  1TQG A;  1OCO C;  1W2W A;  1ZU4 A;  2NUP B;  3GAN A;  3I5P A;  3M15 A;  2XL6 A;  1LE2 A;  4J7T A;  1DOW A;  4CIP A;  1GGQ A;  1EA8 A;  2GWW A;  1VYI A;  2L81 A;  5CI8 A;  4PJJ A;  1GM5 A;  1LPE A;  4ULV A;  1VYK A;  4YL1 A;  1QLE C;  4X0R A;  2KJG A;  3C8G B;  3K1I C;  4EHP A;  1QZX A;  3BRJ A;  3OA1 A;  2HSQ A;  3OWT A;  1L3P A;  5B3S C;  2YVK A;  3U9M A;  2ZXR A;  1Z6A A;  1D0Z A;  3FHD A;  4IJJ A;  4U5D E;  1WAT A;  3ZQY A;  2AP3 A;  3V5Z A;  4P9T A;  3FXH A;  1MMG A;  2YL7 A;  2VCC A;  2YLG A;  2WZF A;  2CYD A;  1ZHY A;  2R7T A;  1CGN A;  3X2Q C;  3ZQV A;  1MMD A;  3QTH A;  4JEA A;  4CBE A;  2X0C A;  4YJW A;  4FWV A;  5D91 A;  5KYW B;  2A6H F;  3FOP A;  2WL8 A;  4O6Y A;  2YRF A;  3EQL F;  4KNW A;  1ZU5 A;  2XXA B;  1LI5 A;  256B A;  2DYR C;  3K66 A;  4AL1 A;  3T4R A;  5BUO A;  1G8X A;  5L3Q A;  3JSE O;  3J06 A;  3GM2 A;  4G0H A;  3DZA A;  3TOM A;  4G7Z F;  4P9F A;  2DI3 A;  2Y3G A;  3HKK A;  3DE8 A;  1E86 A;  3IEE A;  4N6C A;  4DJ9 A;  3B0P A;  1NU7 D;  1F1M A;  2XL8 A;  3AGT A;  3MBG A;  1D1B A;  4D4N A;  1AEP A;  3GM1 A;  3U9J A;  1YDI A;  1VLS A;  4PJM A;  3QVZ A;  5KYY B;  1OR2 A;  1K04 A;  2L6G A;  3B0U X;  4JJG A;  1T01 A;  3C8G D;  5JRA A;  1MND A;  5KYU A;  2AWC A;  3KL4 A;  3O6X A;  2Q9C A;  3DWW A;  1XWJ A;  2OU6 A;  4QI0 A;  4WGZ A;  1YYJ A;  3W2W A;  3RQG A;  5EGY A;  4EBJ A;  2ZPA A;  1JR8 A;  3AG2 C;  1FAP B;  1R5I D;  3ABM C;  1OW8 A;  2QY9 A;  4Z9I A;  2EIM C;  5JSL A;  2HJM A;  3O39 A;  4O6N A;  3LS0 A;  4O6M A;  2IBF A;  5E3A A;  3K1H A;  4I1O B;  2HJ3 A;  2P1A A;  3ATP A;  1OW7 A;  2HKV A;  3MX3 A;  1MMA A;  1APC A;  1SR2 A;  1VOM A;  3NYL A;  1Z7Q c;  2LIG A;  4OIN F;  3V5X A;  3ZIB A;  4DRI B;  3E70 C;  4EBB A;  1I4Z A;  2CGE A;  4PJL A;  3T6J A;  1RJ9 A;  2HZ8 A;  3L1M A;  3EGX A;  3EG9 A;  2OKU A;  1JAF A;  2QLA A;  1H9G A;  2IXM A;  4KNV A;  5B1B C;  2PX0 A;  2NG1 A;  3S90 A;  2YKZ A;  1NLX A;  4I44 A;  5COG A;  4LDR A;  1GS9 A;  3TK0 A;  4AL0 A;  3EH1 A;  2J45 A;  2VCB A;  3EPV A;  4AE4 A;  3L34 A;  4XQ1 A;  4JKV A;  4NTB A;  1V55 C;  4MTF A;  3LLK A;  3U8P A;  5JS5 A;  3B0V C;  3Q7G A;  1LI7 A;  4N4W A;  3LJB A;  4LDQ A;  2NSG A;  1KU2 A;  1HW1 A;  3KMI A;  5F5F A;  2UUH A;  2R9R B;  1T6U A;  1M6T A;  3H2V A;  2AU5 A;  3DKA A;  3I5Q A;  2EPK X;  4DBQ A;  1CPQ A;  4J30 B;  2D5R B;  1RKE A;  4JTC B;  4MTG A;  4AK9 A;  2D4U A;  3F46 A;  3EHM A;  3T6G B;  4B6I A;  4A4A A;  3JYY A;  5AGF A;  2WB7 A;  4N06 A;  3UMK A;  2KW3 C;  3QVY A;  4NQF A;  4YN0 B;  4C3D A;  3RVY A;  3GOR A;  4YL3 A;  2PF4 E;  3VM6 A;  5B1A C;  4OIP F;  2H8A A;  2VAS A;  3NKE A;  1XZP A;  4PFO A;  2YWA A;  2O9X A;  3FMS A;  3W8H A;  4YT4 A;  2W4B A;  5KYX A;  3NDB B;  1ZHW A;  3DI5 A;  1PD0 A;  4FX5 A;  3ABK C;  4XPW A;  3U3F A;  4IWB A;  1M2V A;  4J7Y A;  1Z63 A;  4JE9 A;  1I5N A;  1BDJ B;  1RXQ A;  5BQG A;  1QSP A;  2VC9 A;  3HNI A;  3ABL C;  5KYN A;  4OIO F;  3H2U A;  4MND A;  2WVN A;  1OKK D;  3L8I A;  5L0H A;  3MFN A;  3S0X A;  1JOG A;  3PDM P;  3EZH A;  4WAB A;  4NCQ A;  3NYJ A;  1E84 A;  1ST6 A;  3CEX A;  4JRZ A;  2OOC A;  3U5S A;  5DLJ A;  1Q0M A;  1C17 M;  3HJC A;  2OCC C;  4CDA A;  2Y69 C;  4CS8 C;  2J7P D;  4YT8 A;  2OEV A;  3QW0 A;  3U2M A;  2OEX A;  3FOO A;  1SMY F;  3LS1 A;  1NG1 A;  1SYQ A;  1S7Z A;  2OJE D;  3K1I A;  1O3U A;  2GDC A;  4K1O A;  3NMK A;  3JTL O;  3TJ6 A;  1FNT c;  5E2Q A;  1RMV A;  1T6Q A;  1WTY A;  3M4C A;  2L9J A;  1VB5 A;  2EPO A;  3WHN A;  4G7O F;  2BE5 F;  1A7V A;  3SEO A;  3EFO B;  1NZE A;  3G50 A;  3TJ5 A;  3R2P A;  3JYH A;  1M56 C;  2LP4 A;  4XLP F;  2V3C C;  2GFH A;  3Q7L A;  2G62 A;  4U5F E;  4EIY A;  5A6B D;  2Q00 A;  2XLM A;  2XS8 A;  4JUR I;  1FMV A;  1UFB A;  4K7B A;  4MVQ A;  1TWG A;  2IXN A;  4ULW A;  5F5H A;  2XLE A;  4MTO A;  4J32 B;  3I4U A;  5FCL A;  1C03 A;  5BQI A;  3HNK A;  1OCR C;  2YZS A;  3MLG A;  4U5E E;  2J9V A;  1BBH A;  1J8Y F;  4JEB A;  1J8M F;  4MVU A;  1KTM A;  2ZXO A;  4OIR F;  2Y3D A;  1LKX A;  1XZQ A;  5JT4 A;  2EIJ C;  3RQF A;  1TWA A;  4CDV A;  1E83 A;  3SNH A;  4CX9 A;  4EKW A;  3TUL A;  3MYI A;  1ZVZ A;  2HSB A;  1QVX A;  3M1C B;  4MQ9 F;  2MYS A;  4HE8 D;  4DRJ B;  1ZYR F;  1R4T A;  2YL1 A;  5CIV A;  3GEI A;  4WGY A;  2QTV A;  3LES A;  4ER9 A;  4IAR A;  5T3W A;  2J0W A;  4H54 A;  2A69 F;  4RBN A;  3S28 A;  1HMO A;  2L6F A;  4EUK B;  4NTF A;  2W45 A;  3AOU A;  4OIQ F;  1Z5Z A;  2FGY A;  2JX0 A;  2W4M A;  3AG3 C;  4YWQ A;  4BEJ A;  4CS7 A;  4P6I C;  2I15 A;  3B9Q A;  1E85 A;  2YL0 A;  2CNW A;  2J9U A;  2J9B A;  2Q4F A;  4XPY A;  2AVK A;  3AGU A;  3RQE A;  1FFT C;  2DB4 A;  4MVM A;  4NC3 A;  3WG7 C;  4XLN F;  3M4B A;  1JMW A;  1KNY A;  2IYL D;  2E87 A;  4CSA A;  3IPM O;  4W8K A;  1ZHT A;  3UR3 C;  2MWQ A;  5E3C A;  5DS4 A;  2HUJ A;  3B71 A;  3SXZ A;  4CSA C;  2R25 A;  2KC3 A;  3MYF A;  5L0D A;  2R7W A;  2ASR A;  2G3K A;  1WWP A;  1OCC C;  1CPR A;  3C7J A;  3RF3 A;  2HMZ A;  4LER A;  3CZ6 A;  3RH3 A;  5K0I A;  1M57 C;  2IOQ A;  2Y3B A;  1OKK A;  2LQG A;  2ZD9 A;  4GQH A;  4LLC A;  2KGO A;  2QE9 A;  4MS2 A;  2J0X A;  4G7H F;  4U9E A;  3JCU Q;  4KC9 A;  3RYL A;  4LAC B;  4AX2 A;  3G4Z A;  4CDY A;  3ASN C;  3K6B A;  1D0Y A;  3U3B A;  3RKO F;  3VAY A;  4EWC A;  1DOV A;  4KBL A;  1T5O A;  4U9D A;  3KPH A;  2H7B A;  2J8W A;  3UNG C;  5KYU B;  3IQ5 A;  3VRC A;  1OXB A;  3DJN B;  4HFK B;  1B68 A;  4CS9 A;  1HY5 A;  1TWC A;  1H9T A;  1YZA A;  1AVO B;  2R03 A;  3EJN A;  1VMA A;  3L0I A;  2XSE A;  2NPU A;  4CS9 C;  1FTS A;  3FDQ A;  4QI2 A;  1YAR O;  1EQ1 A;  4C3E A;  1LVK A;  3AQC A;  4MVR A;  4U5G A;  1K05 A;  2DGJ A;  1ZHX A;  1NFN A;  1SF8 A;  3AG4 C;  3ZTM A;  3RIP A;  5DQT A;  2L6H A;  3HNJ A;  2ZXW C;  3LUT B;  4Q7C A;  3K7D A;  3S27 A;  3C18 A;  4BPM A;  1OXK A;  4JVS A;  1C02 A;  4D4X A;  4E18 A;  4PR9 A;  1RJ9 B;  3DJU B;  4JCZ A;  4XPX A;  3EGX B;  3EG9 B;  3V7O A;  4CJO A;  3JRT A;  4IAQ A;  4C7O A;  2EPL X;  3NMI A;  3HLZ A;  3RFY A;  3AG1 C;  3EGD A;  3SZR A;  3TD7 A;  4F4B A;  4JTA B;  2I8B A;  1NU9 C;  2R7R A;  1CGO A;  2VH3 A;  2R7U A;  2RD9 A;  2YEV A;  3KH2 A;  5DS6 A;  4AE4 B;  2CW0 F;  1OW6 A;  4YT5 A;  3ZVR A;  2GAQ A;  4BJ5 C;  2P7V A;  2Q7R A;  2J46 A;  2KK1 A;  1A41 A;  4K0D A;  1MNE A;  3IHU A;  3TOL A;  3DM9 B;  1LIH A;  4JIO A;  3NG1 A;  2EIK C;  2LCH A;  3GOD A;  1IW7 F;  1HW2 A;  2XLW A;  3VF0 A;  4DXW A;  1Q0F A;  3CSK A;  1V74 B;  1PCX A;  3IQ6 A;  2KQ9 A;  3JZ0 A;  4CS8 A;  5EHH A;  2CDQ A;  1RKE B;  3U0C A;  2NUP A;  4IB4 A;  5L0I A;  2FAP B;  3NMJ A;  1VLT A;  4MW8 A;  2MHR A;  3LEO A;  2Q3T A;  2A6E F;  4Z9H A;  3C8G A;  1QQ3 A;  2XLO A;  1GQA A;  3A9C A;  5JP7 A;  1BR4 A;  2WZG A;  2Z15 A;  4DVY P;  1U6H A;  5KYX B;  2P0N A;  4BJT A;  2NUT A;  4ZLD A;  2OQM A;  2ETS A;  3RW0 A;  4CIH A;  5DS5 A;  3LLI A;  1PV3 A;  1QKR A;  1M2V B;  2YHS A;  2F22 A;  2KNH A;  1MQV A;  1S05 A;  2XLH A;  3E9V A;  1TR2 A;  4FAP B;  2Y39 A;  1NFO A;  3N24 A;  2EIL C;  3C8Z A;  1E2X A;  2EPM X;  4L6R A;  4PJN A;  3RVZ A;  4Q4Z F;  3N2Z B;  1TFK B;  2LSE A;  3HNL A;  3SXM A;  2UUI A;  4I3M A;  5CI9 A;  4DRH B;  5AC5 A;  1H6G A;  3CQZ A;  5JLI A;  3H65 A;  3V5Y A;  1U89 A;  4NY3 A;  5KYW A;  3WAQ A;  4O79 A;  3B29 A;  3OEO A;  4W8P A;  5DVW A;  2XXA A;  2B0J A;  1A7D A;  1K40 A;  2VB6 A;  3O55 A;  1EI7 A;  3UGP A;  3LAY A;  3JSZ A;  5EK0 A;  3GWL A;  2PNO A;  1A7E A;  4E0I A;  1RKC A;  1V4A A;  3ITF A;  4ZLC A;  5L0F A;  1VTM P;  1D0X A;  2A68 F;  1ORJ A;  2IXO A;  2P61 A;  2LFF A;  2RSE B;  4WJ0 A;  2EIN C;  2NUT B;  1G4U S;  5E33 A;  1Y6D A;  4XWJ A;  2EPN A;  1D1C A;  3DAF A;  3LNR A;  3PHF 2;  1TKN A;  2WZL A;  2W9Y A;  3EH2 A;  4MVO A;  4XEF A;  4Z9J A;  3W4Y A;  5KYY A;  3S84 A;  2QNL A;  1JPJ A;  2PFD A;  4ONS A;  3AJM A;  1WN0 A;  3N0T A;  3PCV A;  1HMD A;  2Q9B A;  2Q9A A;  1LS1 A;  1BR1 A;  2KYH A;  5B3I A;  1ZHZ A;  5JVE A;  1OQC A;  2HMQ A;  2KSF A;  3LEV A;  3L8J A;  1RCP A;  1WAS A;  3U8V A;  1YA7 O;  2X51 A;  1LE4 A;  3ASO C;  3GEE A;  4GYT A;  3W8I A;  3ZTZ A;  2LD6 A;  2H7O A;  2HFI A;  2XLD A;  2YLI A;  5JUA A;  3DD7 A;  5HSW A;  5A6K A;  1D1A A;  2FFH A;  2R7Q A;  4JC7 A;  1HE9 A;  1Q0K A;  2C04 A;  4IGG A;  5A6J A;  5AC4 A;  4XTK A;  1ZW3 A;  2HV7 A;  4YL0 A;  5COF A;  5A69 A;  1ZZP A;  4JW1 A;  2R7X A;  3T6B A;  1MMN A;  1YVI A;  3C62 A;  3C63 A;  3AQB A;  2A1D D;  4YK5 A;  3JT1 A;  1Y4C A;  4U5C E;  3IQC A;  3TQO A;  2R7O A;  1EKY A;  3S9O A;  2R7V A;  1YZC A;  3M79 A;  1NBB A;  1UG7 A;  2R05 A;  2B0H A;  4NTA A;  1V54 C;  1JPN A;  1WGW A;  3GWN A;  5COM A;  1AUE A;  2XLV A;  4JJF A;  3SYN A;  3A11 A;  3VYW A;  1LM3 B;  1L7C A;  2PP4 A;  3DE9 A;  1WOL A;  4HEA J;  3SXY A;  4U5H A;  5L3V A;  2J7P A;  3W2V A;  4PFP A;  2LFD A;  1I4Y A;  3ZC4 A;  1G4W R;  5L0J A;  2GA0 A;  5HV9 A;  5F28 E;  3HTK C;  1HE1 A;  2H7V C;  3QW1 A;  2DYS C;  3ECS A;  2Y3H A;  3Q6M A;  1YLM A;  2JPU A;  3JRM O;  4KI2 A;  3IQT A;  3UMH A;  1YJG A;  1BR2 A;  1Z23 A;  1ZW2 A;  2XL4 A;  4OD4 A;  3BEH A;  3K33 A;  4ANJ A;  3GEH A;  5BQH A;  3F47 A;  2VCA A;  3QMK A;  3EHN A;  1VK5 A;  4HFF B;  5A6B A;  4DVZ A;  4R32 A;  3PMR A;  2M4E A;  4LLE A;  3UMI A;  1N1C A;  3US6 A;  4YT2 A;  4UDV A;  2L7A A;  2M64 A;  2ZXP A;  3KKB A;  4M63 A;  2IXP A;  4MW3 A;  3UGO A;  1M2O A;  1T9K A;  5TJ5 E;  3KYJ A;  3KYI A;  2R7S A;  1G5Z A;  2LK4 A;  2HV6 A;  3ZSU A;  4PK4 A;  3DXJ F;  4BJ5 A;  4E0H A;  4EBK A;  4LDK A;  3FVY A;  1T6I A;  3G4X A;  3NYM A;  4E17 A;  4DBR A;  4Q5S F;  5A6A A;  4PAC A;  3ZWI A; 
#chains in the Genus database with same CATH homology
 2KSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...