2KSFA

Backbone structure of the membrane domain of e. coli histidine kinase receptor kdpd, center for structures of membrane proteins (csmp) target 4312c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
MVQIQGSVVAAALSAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVSFDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein kdpD
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 107
sequence length 107
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Backbone structure of the membrane domain of e. Coli histidine kinase receptor kdpd, 2ksfA00
2KSFA
chains in the Genus database with same CATH superfamily
3VYWA 2YLGA 1QLEC 2PNOA 1YYXA 4HFKB 4BJ5A 3RW0A 4CX9A 4MTFA 2IM8A 4MVZA 2Y69C 4Q4ZF 3G4XA 1ZW2A 3DD7A 3T6BA 1K40A 3ZC4A 2QY9A 4OIRF 1MMNA 1O3UA 3LEOA 1AVOB 4J7TA 5KYUA 4DVZA 5L0CA 2XLDA 2HV7A 2KQ9A 2WVOA 5FZTA 4YL3A 1J8YF 2R7WA 2KNHA 2L6GA 3M1CB 4FAPB 2WVQA 5L0IA 4RD9A 3DXJF 4CS7A 1I4YA 4IRUA 3E9VA 1NU9C 2WZFA 3JRTA 2A1DD 3V7OA 3K1IC 2VB6A 1ZZPA 2A0BA 2W4BA 3AG2C 3NMJA 1K04A 4IWBA 1QZXA 2H7BA 1Q0GA 3NDBB 2P1AA 4DRHB 1OXKA 1TFOB 1RCPA 3LJBA 5E33A 4G7OF 2PFDA 1D1CA 2YZSA 3AJMA 1WWPA 4JW1A 5EK0A 2XLEA 3AOUA 3M79A 1Q0MA 3JCUQ 5CI8A 4K1OA 1EQ1A 3W2VA 1YA9A 4JCHA 4CBEA 5JRAA 1PV3A 3GEHA 3EZHA 3DWWA 1ZHWA 1V4AA 4JTCB 5JSLA 1T01A 3ASNC 4W8KA 1NLXA 1XZPA 2EPOA 3EG9A 4LLCA 4N4WA 4EHPA 4Q5SF 1SZIA 2MYSA 2L6FA 3DKAA 4CS8C 5F5HA 3NG1A 1K05A 1ZW3A 2VCBA 3EG9B 4JIOA 3DI5A 4PR9A 2OJED 3W8HA 2M4EA 4U5BE 1I5NA 1MMAA 1Y6DA 4DBRA 2KJGA 4O79A 1M56C 1M6TA 4YN0B 4YT5A 2EIJC 3QZCA 1PD0A 4IGGA 3AQCA 3QVZA 4GQHA 4MVOA 5DQZA 4RDAA 5DVWA 2WVNA 4IB4A 2J45A 1TR2A 3KYIA 3C18A 4J32B 4LERA 4YT8A 2PP4A 5AC4A 5KYWA 1CGME 4D4NA 4DXWA 1HE1A 2R7XA 3U3BA 2LD6A 3L0IA 4AE4B 5K0IA 5T3TA 4C3EA 3GODA 1QKRA 4DVYP 3B0UX 3EGDA 3QVYA 1JPNA 2CGEA 1WTYA 5DS5A 2R02A 4MW3A 4PJLA 5KYWB 2TMVP 2HSQA 1RMVA 3CZ6A 3RFYA 1SYQA 1V74B 3CAXA 4ZLDA 1GQAA 3OEOA 2DGJA 3U3FA 5B3SC 3GM2A 3EGDB 1F1MA 2KGOA 2EILC 2J46A 4CS9A 2J7PD 4G7ZF 4U9DA 3NMIA 5EGYA 1R4TA 4KNVA 3LS1A 4MQ9F 3EH1A 4O7GA 1VOMA 4C7OA 3F47A 3LLKA 2R05A 4E0HA 3WODF 3QTHA 5KYXA 5BQIA 3PCVA 2EPNA 4GEHA 5T1DB 3BEHA 1D0ZA 1D0XA 3DJUB 5FCLA 4C7OB 4EBJA 1UFBA 2LK4A 1E84A 5COMA 1LKXA 2IXPA 2UUHA 4ER9A 1OQCA 1ZYRF 1BR2A 5KYXB 4MVSA 1HW2A 1E85A 3DAGA 1BR1A 1EA8A 2ASRA 2AVKA 3ABMC 3HNJA 2YEVA 3EQLF 3FOPA 4CDVA 3S90A 4XLPF 4PK4A 1Z23A 2AWYA 1O5HA 1PD1A 1C17M 1QQ3A 2D4UA 2L7AA 2R9RB 3H2UA 4J30B 4U5FE 2OU6A 3TOLA 1Q0KA 2HS5A 4XEKA 4E7ZA 2G3KA 1JMWA 2HMZA 2F22A 3LAYA 4NQFA 2J0XA 3C7JA 3EHNA 1MMDA 1TWHA 1W2WA 3FMSA 2YLDA 3L8IA 3ABKC 3T6GB 4UDVA 3FAPB 4YT4A 1T6IA 3UGPA 3J06A 2YWAA 4JCZA 3IPMO 1VLSA 4XPYA 4DRIB 2OKUA 5JT4A 4MTGA 4QDLA 1ZHXA 4ULWA 1AEPA 1LI5A 1HMDA 1LPEA 2YRFA 3RH3A 3POVA 3KPHA 1L3PA 3ZQYA 1OW6A 2P6VA 3RKOF 1H6GA 1RKEB 3GEIA 3FVYA 2LIGA 5KYNA 1A41A 1LS1A 1Z5ZA 5A6AA 2A6HF 1ORSC 4E17A 2Y39A 3HNLA 3NYJA 3K1IA 4YT2A 3RYLA 5DS4A 1ZHZA 1TQGA 1KU2A 4F4BA 1AUEA 3IEEA 4MTOA 1E86A 1OR3A 2QE9A 2GFHA 3FOOA 1CPRA 2HJMA 1TWGA 3DAFA 2W4MA 3RIPA 2BC5A 4C3DA 3S84A 1A0BA 2HKVA 2WL8A 3B29A 4I1OB 3WAQA 1T9KA 3W4YA 3U2MA 3HKKA 3MFNA 1FTSA 3IQ6A 3M15A 4G78A 4HEAJ 4O6YA 4CJGA 5EHHA 3NYLA 1QPUA 4JC7A 5A6BA 2W9YA 3QW0A 4U5GA 1OCOC 2A68F 4E7SA 3AQBA 2B0HA 3Q6NA 2VCCA 4JZAA 1O87A 2R7QA 4MVQA 1YDIA 2XL4A 1NG1A 4IARA 3LNRA 1OXBA 2EIMC 3C8GD 4CS8A 3SYNA 2I8BA 1ORJA 2PBEA 4AK9A 2J0WA 2EPLX 3ATPA 3IQ5A 3K1HA 5DS6A 1RJ9A 2CNWD 2DB4A 5A69A 5KYYA 3KKBA 1SF8A 2PX0A 4U5CE 1FFHA 2A0UA 3I4UA 3DZAA 3W8IA 1SMYF 3TD7A 1ZU5A 4W8PA 1ZU4A 1TFKB 1HMOA 3LNMB 3ZTZA 1LI7A 1RJ9B 2OOCA 2UUIA 4XQ1A 1QVXA 4EKWA 5KYYB 1YZAA 2LCHA 2XL6A 3G50A 2KSFA 1E83A 1LIHA 1T5OA 1C02A 3T6JA 2R7OA 1L7CA 3ZWIA 2Q00A 4CSAC 4LDKA 2A69F 1OKKD 2XLOA 2YL7A 3CQZA 5F5FA 2BE5F 4FESA 4BEJA 3IQCA 3DMDA 3G4ZA 4I1MA 4C3BA 1U89A 1RKCA 3NMKA 5E3AA 2DI3A 4BJ5C 4XLNF 3TQOA 4ULVA 1NU7D 4J7YA 3NKEA 5E3CA 1TWAA 1ST6A 2A6EF 1OW8A 3S27A 1H7IA 1G8XA 1LE4A 2J9VA 3L8JA 5D92A 1OW7A 2Q3TA 3O55A 2QTVA 4Z9IA 1LVKA 3ZIBA 3OWTA 2AU5A 3TK0A 3JZ0A 3ZVRA 1LE2A 4N6CA 4O6NA 1QSPA 4YJWA 1GS9A 2XSEA 3C8GA 4JTAB 4AE4A 5F28E 1BZ4A 1WATA 2CDQA 4AX2A 2GAQA 2HJ3A 1M2OA 4JE9A 2YL3A 3T4RA 2ZPAA 2IOQA 1S05A 3RQFA 3C8GB 4U5DE 4OIOF 4LLEA 3CSKA 3PMRA 4MW8A 4QI0A 3S29A 3UMHA 3EH2A 3JT1A 2XLMA 4WABA 4MNDA 2HFIA 1DOWA 2IXOA 3AGTA 3C62A 5T3WA 2OQMA 4PJMA 2JD3A 2WZGA 4K0DA 2KC3A 1Q0FA 2C03A 2KW3C 2P7VA 1N1CA 3GWNA 3F46A 4U5HA 4E0IA 2Q9CA 1A7EA 1PCXA 4A4AA 5IY5C 1S7ZA 3PHF2 1XZQA 4BG0A 3HLZA 1EKYA 5L0FA 2IXNA 3MLGA 4XPWA 1MMGA 2RSEB 3DE8A 4KBLA 1FMWA 2YQYA 3EPVA 4XEVA 1A7VA 4JEAA 1Z3IX 3EJNA 4NTFA 3U8PA 3T9OA 4NTBA 3UMKA 2NSGA 5L0DA 5JLIA 2G3VA 3MX3A 2FAPB 2LFFA 4NC3A 3JYHA 2XS1A 5A6JA 1JOGA 4LDQA 1IW7F 5B1BC 3B9QA 1VK5A 4LACB 2OCCC 4JURI 2EIKC 3UGOA 3DJNB 3FAJA 2XL8A 4FWVA 2YKZA 4OINF 1Z63A 3EHMA 3CEXA 1M57C 3B0PA 3JTLO 4N6HA 1JPJA 3KMIA 5B1AC 3N2ZB 1BR4A 3SXKA 4EBBA 3L34A 3ZDLA 1C03A 4MVUA 2R03A 3ABLC 2C04A 3L1MA 3S9OA 2X51A 5AGFA 3K66A 1VYKA 3B71A 3OA1A 4MS2A 2ZD9A 2J7PA 3SP1A 2EPMX 3RVZA 3JYYA 4JJFA 2VASA 4NCQA 2J9UA 4JRZA 4WGYA 3C63A 3HNIA 4BJ6C 1RKEA 1WOLA 2H8AA 3GM1A 3DM5A 1YA7O 4B6IA 2HMQA 1E2XA 2J9BA 2NUPA 3RQEA 3A9CA 5A6KA 4YL0A 2LSEA 3HNKA 3U8VA 2EINC 2R7UA 4NTAA 1Z6AA 3AG3C 4XPXA 3ZSUA 3N24A 2VCAA 2NUPB 4ZLCA 2EPKX 5HSWA 2Q4FA 4I44A 4L6RA 2YVKA 4JJGA 3Q7GA 5GPGB 4XWJA 5BQGA 3I5PA 5B3IA 4U9EA 3ZG1A 3VRCA 5L0HA 4RBNA 5L3QA 4PFPA 1RXQA 3PDMP 3MYFA 3VM6A 2HV6A 1MQVA 2WZLA 3K33A 3BRJA 3TJ5A 4DBQA 1GGQA 4R32A 2M64A 4QI2A 3SXMA 1FR0A 4KC9A 1ZHYA 2IXMA 3AG1C 4P9TA 4WJ0A 4YL1A 4Z9HA 2P0NA 3KH2A 2Q7RA 3LLIA 3SNHA 3U5SA 1H9TA 2XXAB 3AG4C 3HTKC 2VC9A 2LQGA 3KYJA 1OCCC 2R7SA 2KYHA 1HE9A 1ORYA 3GEEA 3SZRA 3O39A 3GM3A 2CYDA 5JS5A 3K6BA 1ZVZA 3H65A 2E87A 2HZ8A 2R25A 1WN0A 1HW1A 1MNDA 3C8ZA 1NZEA 3U2LA 1FNTc 2Z15A 1YAUO 3DE9A 4KI2A 3KL4A 3V5ZA 2OJQA 5L0GA 2XM4A 2X0CA 2XLWA 4IAOA 3QW1A 3R2PA 2ETSA 5HV9A 1CGNA 1LM3B 3RQGA 2RD9A 2IBFA 2FFHA 5KYUB 3O6XA 1OR2A 1SR2A 4JEBA 4ANJA 2MHRA 1NBBA 3LUTB 2R7RA 4YK5A 4AL1A 3X2QC 4BPMA 5JUAA 1GM5A 1HY5A 4CJOA 2W45A 3GANA 1BDJB 2JPUA 5CIVA 2Y3GA 1Q0DA 1CGOA 2ZXRA 5E2QA 1EI7A 2GA0A 2AP3A 3JSEO 3ASOC 2L81A 5COFA 4XEFA 2QLAA 3RVYA 2YLIA 3Q6MA 4IJJA 4OIPF 4PJNA 3US6A 3R7CA 2CNWA 2OEXA 4G0HA 2BL2A 1T6UA 4GYTA 2ZXWC 3ZQVA 4BEMJ 1VB5A 4U5EE 2QNLA 2B0JA 2H7OA 3EGXA 4HFFB 3S28A 4YWQA 3DM9B 3TULA 5BQHA 2J8WA 3GORA 1J8MF 3FDQA 1VTMP 4PFOA 2CW0F 5JP7A 4JTDB 3LESA 3EGXB 1G4WR 2J9WA 2ZXPA 3H2VA 3LEVA 2GWWA 3V5YA 1A7DA 1YJGA 1OKKA 2ICWG 3ZTMA 3W2WA 1I4ZA 1YYJA 2XLVA 2YL1A 3SXZA 2Q9AA 1H9GA 3V5XA 1D1AA 3O10A 2OG2A 1WGWA 2OEVA 3TJ6A 4HE8D 4PJJA 2NG1A 3NRHA 5DLJA 3N0TA 5D91A 1MNEA 4CDYA 1NSGB 2NPUA 3SEOA 1OCZC 2D5RB 3M4BA 3I5QA 3Q7LA 4MVRA 4NY3A 1OCRC 2CCYA 2Y3BA 3E70C 1LS4A 4BJ1A 5L0JA 2YL0A 2KK1A 2L6HA 2XS8A 4BJ6A 2VH3A 3LS0A 3U9JA 1JR8A 4K7BA 2I15A 2XLHA 1Y4CA 4EIYA 1WASA 1KTMA 2QUPA 3UNGC 3ITFA 3A11A 3SXYA 4Z9JA 1FAPB 1YVIA 2GDCA 5BUOA 3UR3C 2R7VA 1V55C 1YZCA 4X0RA 4EUKB 1DOVA 1U6HA 2LP4A 3ECSA 2FGYA 2JX0A 4P6IC 3B0VC 3JRMO 5COGA 4EBKA 2R7TA 4CIPA 3GWLA 3MBGA 4XTKA 2G62A 1T6QA 2WB7A 2XRHA 1IZMA 1B68A 2PX3A 3EZIA 4IAQA 5DQTA 3TOMA 1D0YA 3NKDA 2DYRC 3FHDA 2P61A 3WG7C 4G7HF 1G5ZA 3K7DA 4H54A 2LFDA 3UMIA 2Q9BA 2Y3DA 3AGUA 4JVSA 5AC5A 1VYIA 5JVEA 4Q7CA 2IYLD 5TJ5E 2HSBA 1FFTC 4OD5A 4I3MA 1M2VA 2Y3HA 2PF4E 3JSZA 3MYIA 2H7VC 4N06A 5L3VA 4A2NB 1V54C 3IQTA 2XM0A 4BJTA 4DJ9A 4CS9C 1KNYA 256BA 4DRJB 2AWCA 2HUJA 1M2VB 4CIHA 3S0XA 1Z7Qc 1VLTA 4P9FA 1JRAA 3EFOA 1JAFA 5CI9A 4AL0A 2O9XA 4M63A 2NUTA 3WHNA 2V26A 5A6BD 4LDRA 2DYSC 3M4CA 1UG7A 1TWCA 1D1BA 2MWQA 3RF3A 1APCA 1YARO 1YLMA 2ZXOA 3U9MA 3EFOB 4OIQF 4D4XA 2XXAA 2L9JA 4OD4A 4JKVA 3IHUA 2NUTB 3NYMA 3VAYA 3U0CA 4FX5A 4MVMA 1G4US 4ONSA 4E18A 1ZHTA 1U0BB 4EWCA 1NFNA 2YHSA 4WGZA 4KNWA 3X1OA 4DOZA 2NSFA 1NFOA 1VMAA 3FXHA 1CPQA 3QMKA 4O6MA 4CDAA 3VF0A 4CSAA 4H4KC 3HJCA 2V3CC 1FMVA 1TKNA 4PACA 1R5ID 1XWJA 1BBHA
chains in the Genus database with same CATH topology
2KSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSF A; 
#chains in the Genus database with same CATH topology
 3VYW A;  2YLG A;  1QLE C;  2PNO A;  1YYX A;  4HFK B;  4BJ5 A;  3RW0 A;  4CX9 A;  4MTF A;  2IM8 A;  4MVZ A;  2Y69 C;  4Q4Z F;  3G4X A;  1ZW2 A;  3DD7 A;  3T6B A;  1K40 A;  3ZC4 A;  2QY9 A;  4OIR F;  1MMN A;  1O3U A;  3LEO A;  1AVO B;  4J7T A;  5KYU A;  4DVZ A;  5L0C A;  2XLD A;  2HV7 A;  2KQ9 A;  2WVO A;  5FZT A;  4YL3 A;  1J8Y F;  2R7W A;  2KNH A;  2L6G A;  3M1C B;  4FAP B;  2WVQ A;  5L0I A;  4RD9 A;  3DXJ F;  4CS7 A;  1I4Y A;  4IRU A;  3E9V A;  1NU9 C;  2WZF A;  3JRT A;  2A1D D;  3V7O A;  3K1I C;  2VB6 A;  1ZZP A;  2A0B A;  2W4B A;  3AG2 C;  3NMJ A;  1K04 A;  4IWB A;  1QZX A;  2H7B A;  1Q0G A;  3NDB B;  2P1A A;  4DRH B;  1OXK A;  1TFO B;  1RCP A;  3LJB A;  5E33 A;  4G7O F;  2PFD A;  1D1C A;  2YZS A;  3AJM A;  1WWP A;  4JW1 A;  5EK0 A;  2XLE A;  3AOU A;  3M79 A;  1Q0M A;  3JCU Q;  5CI8 A;  4K1O A;  1EQ1 A;  3W2V A;  1YA9 A;  4JCH A;  4CBE A;  5JRA A;  1PV3 A;  3GEH A;  3EZH A;  3DWW A;  1ZHW A;  1V4A A;  4JTC B;  5JSL A;  1T01 A;  3ASN C;  4W8K A;  1NLX A;  1XZP A;  2EPO A;  3EG9 A;  4LLC A;  4N4W A;  4EHP A;  4Q5S F;  1SZI A;  2MYS A;  2L6F A;  3DKA A;  4CS8 C;  5F5H A;  3NG1 A;  1K05 A;  1ZW3 A;  2VCB A;  3EG9 B;  4JIO A;  3DI5 A;  4PR9 A;  2OJE D;  3W8H A;  2M4E A;  4U5B E;  1I5N A;  1MMA A;  1Y6D A;  4DBR A;  2KJG A;  4O79 A;  1M56 C;  1M6T A;  4YN0 B;  4YT5 A;  2EIJ C;  3QZC A;  1PD0 A;  4IGG A;  3AQC A;  3QVZ A;  4GQH A;  4MVO A;  5DQZ A;  4RDA A;  5DVW A;  2WVN A;  4IB4 A;  2J45 A;  1TR2 A;  3KYI A;  3C18 A;  4J32 B;  4LER A;  4YT8 A;  2PP4 A;  5AC4 A;  5KYW A;  1CGM E;  4D4N A;  4DXW A;  1HE1 A;  2R7X A;  3U3B A;  2LD6 A;  3L0I A;  4AE4 B;  5K0I A;  5T3T A;  4C3E A;  3GOD A;  1QKR A;  4DVY P;  3B0U X;  3EGD A;  3QVY A;  1JPN A;  2CGE A;  1WTY A;  5DS5 A;  2R02 A;  4MW3 A;  4PJL A;  5KYW B;  2TMV P;  2HSQ A;  1RMV A;  3CZ6 A;  3RFY A;  1SYQ A;  1V74 B;  3CAX A;  4ZLD A;  1GQA A;  3OEO A;  2DGJ A;  3U3F A;  5B3S C;  3GM2 A;  3EGD B;  1F1M A;  2KGO A;  2EIL C;  2J46 A;  4CS9 A;  2J7P D;  4G7Z F;  4U9D A;  3NMI A;  5EGY A;  1R4T A;  4KNV A;  3LS1 A;  4MQ9 F;  3EH1 A;  4O7G A;  1VOM A;  4C7O A;  3F47 A;  3LLK A;  2R05 A;  4E0H A;  3WOD F;  3QTH A;  5KYX A;  5BQI A;  3PCV A;  2EPN A;  4GEH A;  5T1D B;  3BEH A;  1D0Z A;  1D0X A;  3DJU B;  5FCL A;  4C7O B;  4EBJ A;  1UFB A;  2LK4 A;  1E84 A;  5COM A;  1LKX A;  2IXP A;  2UUH A;  4ER9 A;  1OQC A;  1ZYR F;  1BR2 A;  5KYX B;  4MVS A;  1HW2 A;  1E85 A;  3DAG A;  1BR1 A;  1EA8 A;  2ASR A;  2AVK A;  3ABM C;  3HNJ A;  2YEV A;  3EQL F;  3FOP A;  4CDV A;  3S90 A;  4XLP F;  4PK4 A;  1Z23 A;  2AWY A;  1O5H A;  1PD1 A;  1C17 M;  1QQ3 A;  2D4U A;  2L7A A;  2R9R B;  3H2U A;  4J30 B;  4U5F E;  2OU6 A;  3TOL A;  1Q0K A;  2HS5 A;  4XEK A;  4E7Z A;  2G3K A;  1JMW A;  2HMZ A;  2F22 A;  3LAY A;  4NQF A;  2J0X A;  3C7J A;  3EHN A;  1MMD A;  1TWH A;  1W2W A;  3FMS A;  2YLD A;  3L8I A;  3ABK C;  3T6G B;  4UDV A;  3FAP B;  4YT4 A;  1T6I A;  3UGP A;  3J06 A;  2YWA A;  4JCZ A;  3IPM O;  1VLS A;  4XPY A;  4DRI B;  2OKU A;  5JT4 A;  4MTG A;  4QDL A;  1ZHX A;  4ULW A;  1AEP A;  1LI5 A;  1HMD A;  1LPE A;  2YRF A;  3RH3 A;  3POV A;  3KPH A;  1L3P A;  3ZQY A;  1OW6 A;  2P6V A;  3RKO F;  1H6G A;  1RKE B;  3GEI A;  3FVY A;  2LIG A;  5KYN A;  1A41 A;  1LS1 A;  1Z5Z A;  5A6A A;  2A6H F;  1ORS C;  4E17 A;  2Y39 A;  3HNL A;  3NYJ A;  3K1I A;  4YT2 A;  3RYL A;  5DS4 A;  1ZHZ A;  1TQG A;  1KU2 A;  4F4B A;  1AUE A;  3IEE A;  4MTO A;  1E86 A;  1OR3 A;  2QE9 A;  2GFH A;  3FOO A;  1CPR A;  2HJM A;  1TWG A;  3DAF A;  2W4M A;  3RIP A;  2BC5 A;  4C3D A;  3S84 A;  1A0B A;  2HKV A;  2WL8 A;  3B29 A;  4I1O B;  3WAQ A;  1T9K A;  3W4Y A;  3U2M A;  3HKK A;  3MFN A;  1FTS A;  3IQ6 A;  3M15 A;  4G78 A;  4HEA J;  4O6Y A;  4CJG A;  5EHH A;  3NYL A;  1QPU A;  4JC7 A;  5A6B A;  2W9Y A;  3QW0 A;  4U5G A;  1OCO C;  2A68 F;  4E7S A;  3AQB A;  2B0H A;  3Q6N A;  2VCC A;  4JZA A;  1O87 A;  2R7Q A;  4MVQ A;  1YDI A;  2XL4 A;  1NG1 A;  4IAR A;  3LNR A;  1OXB A;  2EIM C;  3C8G D;  4CS8 A;  3SYN A;  2I8B A;  1ORJ A;  2PBE A;  4AK9 A;  2J0W A;  2EPL X;  3ATP A;  3IQ5 A;  3K1H A;  5DS6 A;  1RJ9 A;  2CNW D;  2DB4 A;  5A69 A;  5KYY A;  3KKB A;  1SF8 A;  2PX0 A;  4U5C E;  1FFH A;  2A0U A;  3I4U A;  3DZA A;  3W8I A;  1SMY F;  3TD7 A;  1ZU5 A;  4W8P A;  1ZU4 A;  1TFK B;  1HMO A;  3LNM B;  3ZTZ A;  1LI7 A;  1RJ9 B;  2OOC A;  2UUI A;  4XQ1 A;  1QVX A;  4EKW A;  5KYY B;  1YZA A;  2LCH A;  2XL6 A;  3G50 A;  2KSF A;  1E83 A;  1LIH A;  1T5O A;  1C02 A;  3T6J A;  2R7O A;  1L7C A;  3ZWI A;  2Q00 A;  4CSA C;  4LDK A;  2A69 F;  1OKK D;  2XLO A;  2YL7 A;  3CQZ A;  5F5F A;  2BE5 F;  4FES A;  4BEJ A;  3IQC A;  3DMD A;  3G4Z A;  4I1M A;  4C3B A;  1U89 A;  1RKC A;  3NMK A;  5E3A A;  2DI3 A;  4BJ5 C;  4XLN F;  3TQO A;  4ULV A;  1NU7 D;  4J7Y A;  3NKE A;  5E3C A;  1TWA A;  1ST6 A;  2A6E F;  1OW8 A;  3S27 A;  1H7I A;  1G8X A;  1LE4 A;  2J9V A;  3L8J A;  5D92 A;  1OW7 A;  2Q3T A;  3O55 A;  2QTV A;  4Z9I A;  1LVK A;  3ZIB A;  3OWT A;  2AU5 A;  3TK0 A;  3JZ0 A;  3ZVR A;  1LE2 A;  4N6C A;  4O6N A;  1QSP A;  4YJW A;  1GS9 A;  2XSE A;  3C8G A;  4JTA B;  4AE4 A;  5F28 E;  1BZ4 A;  1WAT A;  2CDQ A;  4AX2 A;  2GAQ A;  2HJ3 A;  1M2O A;  4JE9 A;  2YL3 A;  3T4R A;  2ZPA A;  2IOQ A;  1S05 A;  3RQF A;  3C8G B;  4U5D E;  4OIO F;  4LLE A;  3CSK A;  3PMR A;  4MW8 A;  4QI0 A;  3S29 A;  3UMH A;  3EH2 A;  3JT1 A;  2XLM A;  4WAB A;  4MND A;  2HFI A;  1DOW A;  2IXO A;  3AGT A;  3C62 A;  5T3W A;  2OQM A;  4PJM A;  2JD3 A;  2WZG A;  4K0D A;  2KC3 A;  1Q0F A;  2C03 A;  2KW3 C;  2P7V A;  1N1C A;  3GWN A;  3F46 A;  4U5H A;  4E0I A;  2Q9C A;  1A7E A;  1PCX A;  4A4A A;  5IY5 C;  1S7Z A;  3PHF 2;  1XZQ A;  4BG0 A;  3HLZ A;  1EKY A;  5L0F A;  2IXN A;  3MLG A;  4XPW A;  1MMG A;  2RSE B;  3DE8 A;  4KBL A;  1FMW A;  2YQY A;  3EPV A;  4XEV A;  1A7V A;  4JEA A;  1Z3I X;  3EJN A;  4NTF A;  3U8P A;  3T9O A;  4NTB A;  3UMK A;  2NSG A;  5L0D A;  5JLI A;  2G3V A;  3MX3 A;  2FAP B;  2LFF A;  4NC3 A;  3JYH A;  2XS1 A;  5A6J A;  1JOG A;  4LDQ A;  1IW7 F;  5B1B C;  3B9Q A;  1VK5 A;  4LAC B;  2OCC C;  4JUR I;  2EIK C;  3UGO A;  3DJN B;  3FAJ A;  2XL8 A;  4FWV A;  2YKZ A;  4OIN F;  1Z63 A;  3EHM A;  3CEX A;  1M57 C;  3B0P A;  3JTL O;  4N6H A;  1JPJ A;  3KMI A;  5B1A C;  3N2Z B;  1BR4 A;  3SXK A;  4EBB A;  3L34 A;  3ZDL A;  1C03 A;  4MVU A;  2R03 A;  3ABL C;  2C04 A;  3L1M A;  3S9O A;  2X51 A;  5AGF A;  3K66 A;  1VYK A;  3B71 A;  3OA1 A;  4MS2 A;  2ZD9 A;  2J7P A;  3SP1 A;  2EPM X;  3RVZ A;  3JYY A;  4JJF A;  2VAS A;  4NCQ A;  2J9U A;  4JRZ A;  4WGY A;  3C63 A;  3HNI A;  4BJ6 C;  1RKE A;  1WOL A;  2H8A A;  3GM1 A;  3DM5 A;  1YA7 O;  4B6I A;  2HMQ A;  1E2X A;  2J9B A;  2NUP A;  3RQE A;  3A9C A;  5A6K A;  4YL0 A;  2LSE A;  3HNK A;  3U8V A;  2EIN C;  2R7U A;  4NTA A;  1Z6A A;  3AG3 C;  4XPX A;  3ZSU A;  3N24 A;  2VCA A;  2NUP B;  4ZLC A;  2EPK X;  5HSW A;  2Q4F A;  4I44 A;  4L6R A;  2YVK A;  4JJG A;  3Q7G A;  5GPG B;  4XWJ A;  5BQG A;  3I5P A;  5B3I A;  4U9E A;  3ZG1 A;  3VRC A;  5L0H A;  4RBN A;  5L3Q A;  4PFP A;  1RXQ A;  3PDM P;  3MYF A;  3VM6 A;  2HV6 A;  1MQV A;  2WZL A;  3K33 A;  3BRJ A;  3TJ5 A;  4DBQ A;  1GGQ A;  4R32 A;  2M64 A;  4QI2 A;  3SXM A;  1FR0 A;  4KC9 A;  1ZHY A;  2IXM A;  3AG1 C;  4P9T A;  4WJ0 A;  4YL1 A;  4Z9H A;  2P0N A;  3KH2 A;  2Q7R A;  3LLI A;  3SNH A;  3U5S A;  1H9T A;  2XXA B;  3AG4 C;  3HTK C;  2VC9 A;  2LQG A;  3KYJ A;  1OCC C;  2R7S A;  2KYH A;  1HE9 A;  1ORY A;  3GEE A;  3SZR A;  3O39 A;  3GM3 A;  2CYD A;  5JS5 A;  3K6B A;  1ZVZ A;  3H65 A;  2E87 A;  2HZ8 A;  2R25 A;  1WN0 A;  1HW1 A;  1MND A;  3C8Z A;  1NZE A;  3U2L A;  1FNT c;  2Z15 A;  1YAU O;  3DE9 A;  4KI2 A;  3KL4 A;  3V5Z A;  2OJQ A;  5L0G A;  2XM4 A;  2X0C A;  2XLW A;  4IAO A;  3QW1 A;  3R2P A;  2ETS A;  5HV9 A;  1CGN A;  1LM3 B;  3RQG A;  2RD9 A;  2IBF A;  2FFH A;  5KYU B;  3O6X A;  1OR2 A;  1SR2 A;  4JEB A;  4ANJ A;  2MHR A;  1NBB A;  3LUT B;  2R7R A;  4YK5 A;  4AL1 A;  3X2Q C;  4BPM A;  5JUA A;  1GM5 A;  1HY5 A;  4CJO A;  2W45 A;  3GAN A;  1BDJ B;  2JPU A;  5CIV A;  2Y3G A;  1Q0D A;  1CGO A;  2ZXR A;  5E2Q A;  1EI7 A;  2GA0 A;  2AP3 A;  3JSE O;  3ASO C;  2L81 A;  5COF A;  4XEF A;  2QLA A;  3RVY A;  2YLI A;  3Q6M A;  4IJJ A;  4OIP F;  4PJN A;  3US6 A;  3R7C A;  2CNW A;  2OEX A;  4G0H A;  2BL2 A;  1T6U A;  4GYT A;  2ZXW C;  3ZQV A;  4BEM J;  1VB5 A;  4U5E E;  2QNL A;  2B0J A;  2H7O A;  3EGX A;  4HFF B;  3S28 A;  4YWQ A;  3DM9 B;  3TUL A;  5BQH A;  2J8W A;  3GOR A;  1J8M F;  3FDQ A;  1VTM P;  4PFO A;  2CW0 F;  5JP7 A;  4JTD B;  3LES A;  3EGX B;  1G4W R;  2J9W A;  2ZXP A;  3H2V A;  3LEV A;  2GWW A;  3V5Y A;  1A7D A;  1YJG A;  1OKK A;  2ICW G;  3ZTM A;  3W2W A;  1I4Z A;  1YYJ A;  2XLV A;  2YL1 A;  3SXZ A;  2Q9A A;  1H9G A;  3V5X A;  1D1A A;  3O10 A;  2OG2 A;  1WGW A;  2OEV A;  3TJ6 A;  4HE8 D;  4PJJ A;  2NG1 A;  3NRH A;  5DLJ A;  3N0T A;  5D91 A;  1MNE A;  4CDY A;  1NSG B;  2NPU A;  3SEO A;  1OCZ C;  2D5R B;  3M4B A;  3I5Q A;  3Q7L A;  4MVR A;  4NY3 A;  1OCR C;  2CCY A;  2Y3B A;  3E70 C;  1LS4 A;  4BJ1 A;  5L0J A;  2YL0 A;  2KK1 A;  2L6H A;  2XS8 A;  4BJ6 A;  2VH3 A;  3LS0 A;  3U9J A;  1JR8 A;  4K7B A;  2I15 A;  2XLH A;  1Y4C A;  4EIY A;  1WAS A;  1KTM A;  2QUP A;  3UNG C;  3ITF A;  3A11 A;  3SXY A;  4Z9J A;  1FAP B;  1YVI A;  2GDC A;  5BUO A;  3UR3 C;  2R7V A;  1V55 C;  1YZC A;  4X0R A;  4EUK B;  1DOV A;  1U6H A;  2LP4 A;  3ECS A;  2FGY A;  2JX0 A;  4P6I C;  3B0V C;  3JRM O;  5COG A;  4EBK A;  2R7T A;  4CIP A;  3GWL A;  3MBG A;  4XTK A;  2G62 A;  1T6Q A;  2WB7 A;  2XRH A;  1IZM A;  1B68 A;  2PX3 A;  3EZI A;  4IAQ A;  5DQT A;  3TOM A;  1D0Y A;  3NKD A;  2DYR C;  3FHD A;  2P61 A;  3WG7 C;  4G7H F;  1G5Z A;  3K7D A;  4H54 A;  2LFD A;  3UMI A;  2Q9B A;  2Y3D A;  3AGU A;  4JVS A;  5AC5 A;  1VYI A;  5JVE A;  4Q7C A;  2IYL D;  5TJ5 E;  2HSB A;  1FFT C;  4OD5 A;  4I3M A;  1M2V A;  2Y3H A;  2PF4 E;  3JSZ A;  3MYI A;  2H7V C;  4N06 A;  5L3V A;  4A2N B;  1V54 C;  3IQT A;  2XM0 A;  4BJT A;  4DJ9 A;  4CS9 C;  1KNY A;  256B A;  4DRJ B;  2AWC A;  2HUJ A;  1M2V B;  4CIH A;  3S0X A;  1Z7Q c;  1VLT A;  4P9F A;  1JRA A;  3EFO A;  1JAF A;  5CI9 A;  4AL0 A;  2O9X A;  4M63 A;  2NUT A;  3WHN A;  2V26 A;  5A6B D;  4LDR A;  2DYS C;  3M4C A;  1UG7 A;  1TWC A;  1D1B A;  2MWQ A;  3RF3 A;  1APC A;  1YAR O;  1YLM A;  2ZXO A;  3U9M A;  3EFO B;  4OIQ F;  4D4X A;  2XXA A;  2L9J A;  4OD4 A;  4JKV A;  3IHU A;  2NUT B;  3NYM A;  3VAY A;  3U0C A;  4FX5 A;  4MVM A;  1G4U S;  4ONS A;  4E18 A;  1ZHT A;  1U0B B;  4EWC A;  1NFN A;  2YHS A;  4WGZ A;  4KNW A;  3X1O A;  4DOZ A;  2NSF A;  1NFO A;  1VMA A;  3FXH A;  1CPQ A;  3QMK A;  4O6M A;  4CDA A;  3VF0 A;  4CSA A;  4H4K C;  3HJC A;  2V3C C;  1FMV A;  1TKN A;  4PAC A;  1R5I D;  1XWJ A;  1BBH A; 
#chains in the Genus database with same CATH homology
 2KSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...