4YWQA

Crystal structure of the roq domain of human roquin-1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
152
Chain Sequence
b'QQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Crystal structure of the ROQ domain of human Roquin-1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 50
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ywqA00
4QI0A 5F5FA 3X1OA 5F5HA 4QI2A 4YWQA 4ZLCA 4ZLDA 4ULWA
chains in the Genus database with same CATH superfamily
3C62A 3I5PA 4IGGA 4WABA 1JPJA 1NU7D 2WL8A 3V7OA 4K1OA 1K05A 1LS4A 2RSEB 1U0BB 4DRJB 4MVZA 4F4BA 3V5XA 3IPMO 3S28A 1PV3A 3U8PA 2OG2A 4W8PA 3HLZA 2NUTB 1YDIA 4EWCA 2AWCA 3R7CA 3KH2A 3RVYA 3B9QA 5B3SC 3DI5A 5JVEA 4PJLA 4W8KA 1HMDA 3L8IA 4NY3A 3DKAA 4YL3A 1NSGB 2A1DD 3ASNC 4DVZA 2HJ3A 1A41A 4E18A 4O6YA 4YT8A 2X51A 1T6QA 3L34A 2J7PA 2LK4A 4QI0A 4JCHA 2A68F 1BZ4A 2MYSA 2XLOA 2OEXA 2YLDA 3S90A 3LUTB 2WB7A 3TD7A 5B3IA 3EZHA 2V3CC 3FAJA 3AG2C 3U9MA 3ZQYA 3DM5A 3GEHA 1MQVA 2PF4E 3LESA 3QTHA 2BC5A 4DBQA 1RKCA 2HUJA 2Q4FA 4MTGA 3U2LA 3VAYA 1ZZPA 2HS5A 3C8GA 4ER9A 4EHPA 3QW0A 3ZIBA 2W4MA 3LAYA 3R2PA 4QDLA 2NUPB 4DXWA 1YARO 4OIRF 4QI2A 3K33A 3TULA 4LLCA 4YT5A 1LI5A 1CGME 2I8BA 4CDAA 1ZW2A 3UMHA 4CDVA 3RIPA 1NZEA 1FR0A 1G4US 3K7DA 2HKVA 2LIGA 4JC7A 4YT4A 2CW0F 2JX0A 3GM3A 3NYMA 1Q0GA 3GM2A 3C63A 1HW1A 3EH1A 4FESA 4H4KC 4IB4A 1E85A 2CNWD 1AEPA 2R25A 2WZLA 4NCQA 4JTDB 4EIYA 1K04A 3ABKC 1OCOC 3GODA 2EPMX 3SYNA 1G8XA 1WASA 1VB5A 3KYIA 2YL1A 2YWAA 4AX2A 2ZXPA 4R32A 1Z23A 5DS5A 4C7OA 5COGA 3GEIA 4CJOA 3RW0A 3CSKA 3IQTA 3JSEO 1T01A 2O9XA 1Z63A 3J06A 1ZYRF 2NSGA 2ZXOA 4U5CE 5A6AA 2LFDA 2YRFA 3JRTA 1I4YA 4RBNA 5TJ5E 2VB6A 3GWNA 3NG1A 2G62A 2R7VA 1V4AA 2PX0A 1A0BA 2KK1A 1OR3A 3DWWA 3LEVA 1AVOB 3ABLC 4CIPA 2XLEA 1WTYA 3EFOB 1E2XA 3TJ5A 1M2OA 1ZU5A 4CBEA 1SMYF 4YN0B 3LEOA 1VOMA 3V5ZA 4CS8A 3AOUA 2KJGA 3QVYA 2Q3TA 1TQGA 1Y6DA 2XM0A 1Q0DA 4YJWA 3NYJA 4AK9A 4CS8C 3S29A 3JYHA 1GQAA 4MVRA 4IRUA 3ZTMA 5KYXA 3N0TA 1ZHTA 2VCBA 3JCUQ 1AUEA 2ZPAA 4LDKA 4YL1A 4E17A 2XSEA 3JT1A 1KU2A 4AE4B 1ORYA 4EUKB 4X0RA 3W8IA 4ZLCA 2VASA 2QY9A 2GA0A 5KYYB 3HTKC 3LNRA 2ZXWC 1H9GA 3HNJA 2J8WA 3B71A 4C3DA 1A7DA 5BQIA 4CSAC 5AC5A 2HV7A 3AJMA 3DJNB 2R7OA 3KPHA 1EI7A 4PACA 5T3TA 2R03A 2HFIA 2PFDA 3EFOA 5KYNA 1M2VB 1BBHA 2YKZA 2XS1A 1D0XA 2EIMC 5CI8A 3SZRA 2C03A 3X2QC 2OOCA 2CCYA 1BR4A 1OXKA 3MX3A 4Z9HA 4XLNF 5D91A 256BA 5JUAA 3NKEA 1QQ3A 4JRZA 2UUIA 3T6BA 2D4UA 2Y3BA 3B0PA 3KL4A 2XS8A 4Q7CA 1F1MA 3NYLA 1SR2A 1DOVA 2Q9CA 1J8YF 4AE4A 5DLJA 5AC4A 2BL2A 1Z3IX 4B6IA 3W4YA 4Z9JA 5L0FA 3F47A 3G4ZA 5KYYA 3NKDA 1CPRA 1L7CA 1Q0MA 1MMDA 3DM9B 3EPVA 3M79A 2R9RB 3PMRA 4ANJA 5IY5C 3DJUB 5L3VA 5A6BA 3RQGA 3AG4C 3JZ0A 1H9TA 2XLWA 1QLEC 2ZD9A 3SNHA 2J45A 3LNMB 4MTFA 1D1AA 1YYXA 5A6JA 3UNGC 2WVQA 1Z5ZA 3RFYA 4Q4ZF 1D1CA 1BDJB 1C02A 1M2VA 2Y39A 1GS9A 3DMDA 3AQBA 3KYJA 1CGOA 1YA9A 3M4BA 2IBFA 4MVOA 5T3WA 2HZ8A 3U9JA 3DXJF 3CQZA 3X1OA 4E7ZA 4JURI 1Q0KA 3GANA 5FZTA 3SXYA 1VK5A 4MVMA 5COFA 2GFHA 3DD7A 2R7RA 4XWJA 3K1IC 5L0JA 1H6GA 2W4BA 1L3PA 2P61A 4I1MA 5F28E 4BJ5A 3TOLA 2BE5F 2QUPA 1SZIA 4GYTA 1D0YA 1YAUO 4O7GA 1TR2A 4NC3A 3ZWIA 4BJ5C 2H7VC 1RXQA 1T6IA 4I3MA 3ATPA 3HNIA 2ZXRA 3EQLF 1WWPA 1B68A 1CGNA 1PCXA 4NTAA 5JSLA 3EGXB 3JTLO 3C8GD 1M6TA 2HMQA 2D5RB 1R4TA 1ZW3A 3QW1A 2AWYA 3RF3A 2W9YA 2Y3GA 3EHNA 5BQGA 2P6VA 3S9OA 3I5QA 4A2NB 3A11A 2EPLX 3Q6MA 4YK5A 4LDRA 1VLSA 3DAGA 5T1DB 1KTMA 1RCPA 2PBEA 4OINF 2ETSA 2M64A 3ABMC 4MTOA 2OEVA 3G4XA 1HE9A 2EPNA 3IEEA 2PNOA 1LVKA 2EINC 1ZU4A 2J9UA 2NUTA 4CJGA 2AU5A 2Y3HA 4MVQA 4ONSA 2MWQA 3KKBA 5CIVA 3UGPA 4PJNA 1V55C 1S7ZA 3QZCA 1G5ZA 3U8VA 3FMSA 3T4RA 5A69A 4N06A 3GEEA 1RKEB 2WVNA 3BEHA 5JP7A 4PJMA 4BEMJ 4IWBA 4E0HA 2Y69C 4PFPA 3B0VC 1U6HA 1OCRC 2IXPA 3LS1A 2W45A 3EGXA 1M56C 5E3AA 4J30B 1C17M 1E83A 2JPUA 2KNHA 4JE9A 4MVSA 3HKKA 4N4WA 3HJCA 1T6UA 2A6EF 4O79A 2EIJC 3OA1A 4KNVA 2L6HA 1ZHWA 5COMA 4EBJA 4GQHA 1E86A 1VMAA 4DRIB 1YZAA 3TQOA 4YL0A 4XPWA 2NUPA 3W8HA 3ECSA 2L9JA 4K7BA 4D4XA 1NLXA 1Y4CA 3Q7GA 1R5ID 2LFFA 1T5OA 3ZSUA 2I15A 2OCCC 2YL0A 3NMJA 3IQCA 3T6GB 3BRJA 4KC9A 1BR2A 4U5BE 2GDCA 4FAPB 2P0NA 2MHRA 2XL8A 1D0ZA 3IHUA 5L0DA 2V26A 4P9TA 3QVZA 3H2UA 3L1MA 5B1BC 4YT2A 5D92A 1N1CA 2J0WA 1JPNA 4ULWA 4XTKA 3AGTA 4G7OF 2EPKX 2J9WA 2A0UA 2Q9AA 3DE8A 2EPOA 2H8AA 3LS0A 3SEOA 1J8MF 1GGQA 2L6GA 2J46A 2VH3A 3NRHA 1ORJA 2A0BA 4KBLA 4OD4A 4YWQA 2CNWA 2NSFA 2QTVA 3O39A 1W2WA 1APCA 2GAQA 3SXKA 2HJMA 3EG9B 4KI2A 3C7JA 4LLEA 3M15A 1YA7O 5KYWB 4MVUA 2R7WA 3WG7C 1ZHXA 3N2ZB 3OWTA 2P1AA 4J7TA 3FHDA 3U5SA 1MMGA 4JKVA 2J9VA 1HMOA 4CSAA 1PD0A 4IAQA 2OKUA 2OJQA 3MYFA 4NTBA 4BPMA 2YHSA 1ZVZA 4XPXA 4CIHA 2YLIA 1A7VA 3PHF2 1ZHYA 1WN0A 2YLGA 2CGEA 4RD9A 1K40A 3M4CA 1MMNA 2H7OA 3DZAA 2A6HF 1YZCA 1VYKA 1V54C 1D1BA 3S84A 3U0CA 2XLHA 4LERA 2CDQA 4D4NA 2DYSC 3VRCA 2R7UA 1JMWA 2NPUA 4AL1A 3MLGA 1RJ9B 1OCCC 4BJTA 3C8ZA 1OKKD 1WATA 3EHMA 2R02A 5A6BD 2DI3A 2XLVA 3GM1A 3NMIA 1IZMA 4WJ0A 4DBRA 1UFBA 1JAFA 1Q0FA 3WODF 4MQ9F 5KYWA 2KW3C 4IJJA 4DVYP 3MYIA 2XXAB 1EA8A 2XM4A 1VYIA 4XEFA 3W2WA 1TFOB 2XLDA 3ASOC 4I1OB 2J0XA 2J9BA 4PR9A 1V74B 2R7SA 1M57C 2KYHA 1JRAA 1FMWA 5JRAA 3RKOF 1ORSC 3SXMA 1VLTA 3CZ6A 3AG1C 1GM5A 4OIOF 4Q5SF 1XZQA 2YL3A 4LACB 4PJJA 1A7EA 1U89A 5E33A 5HSWA 2H7BA 4MW3A 3K1IA 1JOGA 2L7AA 2F22A 2OU6A 5A6KA 2AVKA 3O6XA 2J7PD 4EBBA 1RJ9A 1TKNA 2G3VA 3JSZA 4HE8D 2Q00A 1HE1A 2UUHA 1NFNA 2XL4A 2LP4A 2XLMA 5GPGB 2B0JA 4DOZA 1OR2A 4NQFA 1LE4A 3QMKA 4WGZA 4JEAA 2R7QA 3RQFA 3GWLA 2XL6A 3ZQVA 3VM6A 2R7XA 3VF0A 3ZTZA 4N6HA 1LIHA 1O3UA 3H65A 3SXZA 3EJNA 1TWCA 4P9FA 1FFTC 1MNDA 3ITFA 2Y3DA 4CDYA 2PP4A 5JS5A 4MNDA 2IM8A 3L8JA 4KNWA 4CS7A 3POVA 3C18A 1TWGA 3C8GB 3RYLA 1NFOA 1G4WR 4MS2A 2C04A 4E0IA 4UDVA 1LPEA 3A9CA 3W2VA 2KSFA 2HMZA 4XEKA 2R7TA 2GWWA 2HSQA 1FAPB 5F5FA 1YLMA 1MNEA 2NG1A 4G78A 1I4ZA 5BUOA 4XPYA 3U2MA 2Q7RA 1SF8A 1E84A 2G3KA 3F46A 3LLKA 1JR8A 3HNKA 4C3EA 2XRHA 5L0CA 3Q7LA 3IQ6A 1LE2A 1IW7F 3I4UA 3JRMO 4J7YA 5EK0A 1LS1A 1DOWA 3TJ6A 3US6A 3E70C 3JYYA 2WZGA 4IAOA 1NU9C 5CI9A 4GEHA 4XEVA 4AL0A 4U9DA 2JD3A 3RH3A 5EHHA 4U5HA 1EKYA 4FX5A 4JEBA 2PX3A 1HY5A 1KNYA 1NBBA 4G7ZF 3ZC4A 3V5YA 2L81A 5E2QA 1LI7A 2Q9BA 1SYQA 3EGDB 2L6FA 5L0IA 3CEXA 5JLIA 1QPUA 3DAFA 3FVYA 4C7OB 1XWJA 3MFNA 3O10A 2QE9A 4JTAB 4U5EE 1QKRA 2M4EA 4BJ1A 1S05A 4JTCB 3S27A 4U5FE 2EIKC 4U5GA 4C3BA 4OD5A 3CAXA 2KC3A 4BJ6A 1UG7A 4NTFA 3G50A 4J32B 5B1AC 2IXOA 4HFKB 4BJ6C 1OCZC 2A69F 1PD1A 4G7HF 4L6RA 1LKXA 1RKEA 3OEOA 5E3CA 5DQTA 1YYJA 4HFFB 1YJGA 2EILC 4JIOA 2DGJA 1TWAA 5KYUB 3UGOA 2QNLA 3TOMA 5AGFA 5K0IA 1T9KA 1TWHA 1YVIA 3RQEA 3EGDA 4O6NA 2DB4A 2VC9A 3UMIA 5DS6A 3M1CB 3T6JA 3ZG1A 5JT4A 4OIQF 1FNTc 1BR1A 5KYXB 1OW7A 2YVKA 3K66A 3FXHA 3K6BA 1EQ1A 2FFHA 1OW6A 4DJ9A 4K0DA 2TMVP 4JZAA 1OXBA 2YZSA 3EZIA 4XLPF 2YQYA 2YEVA 1VTMP 1MMAA 3KMIA 3L0IA 4O6MA 5DS4A 3DE9A 1O5HA 1HW2A 3FOOA 3PDMP 1WOLA 4CS9A 5HV9A 1XZPA 3ZVRA 2LSEA 3MBGA 4P6IC 1Z6AA 2HV6A 5BQHA 3LLIA 4BG0A 4CS9C 2CYDA 4JVSA 1WGWA 3FDQA 2DYRC 5KYUA 2AP3A 3NDBB 4JJFA 4JCZA 3LJBA 1QZXA 4CX9A 3U3BA 3B29A 3NMKA 1QVXA 2OJED 2ASRA 2FGYA 2IXMA 2R05A 2X0CA 3RVZA 2Z15A 5L0GA 4ZLDA 2IYLD 3E9VA 3Q6NA 1TFKB 3UR3C 3EG9A 5FCLA 1LM3B 4EBKA 1ZHZA 4OIPF 4Z9IA 4DRHB 2KQ9A 4RDAA 3N24A 4H54A 5F5HA 2IXNA 3AQCA 1OW8A 3H2VA 5EGYA 3WAQA 3SP1A 1FTSA 4JJGA 5L0HA 1FFHA 4PFOA 2FAPB 1Z7Qc 2LQGA 4U9EA 2HSBA 2ICWG 2RD9A 4HEAJ 4PK4A 3K1HA 3B0UX 2IOQA 2WVOA 1NG1A 4I44A 2QLAA 1C03A 4M63A 5DVWA 5DQZA 2P7VA 4IARA 2B0HA 2YL7A 2OQMA 3ZDLA 2E87A 1QSPA 1H7IA 3IQ5A 3AGUA 1OQCA 3PCVA 1I5NA 3TK0A 4U5DE 2VCCA 3FAPB 2KGOA 4BEJA 2WZFA 4N6CA 4ULVA 4FWVA 1CPQA 1FMVA 3FOPA 2VCAA 4XQ1A 3O55A 1ST6A 4EKWA 3S0XA 3EH2A 4LDQA 2LD6A 3GORA 3AG3C 3T9OA 3UMKA 3VYWA 3U3FA 3WHNA 4G0HA 2XXAA 4JW1A 1OKKA 4MW8A 5L3QA 1RMVA 2LCHA 4WGYA 4A4AA 4E7SA 3HNLA 1O87A
chains in the Genus database with same CATH topology
3I5PA 1JPJA 1NU7D 2WL8A 3V7OA 4F4BA 3S28A 2OG2A 3HLZA 2NUTB 4EWCA 3KH2A 3B9QA 5B3SC 4PJLA 4W8KA 4NY3A 2A1DD 3ASNC 4DVZA 4O6YA 4YT8A 2X51A 3L34A 2J7PA 4QI0A 4JCHA 2A68F 2MYSA 2WB7A 3TD7A 3EZHA 3FAJA 3AG2C 3DM5A 2PF4E 3LESA 4DBQA 3VAYA 3ZIBA 2W4MA 3LAYA 4QDLA 2NUPB 4OIRF 4QI2A 3K33A 4LLCA 4YT5A 2I8BA 3UMHA 3RIPA 1NZEA 3K7DA 4YT4A 2CW0F 3NYMA 3EH1A 4FESA 4H4KC 2CNWD 2WZLA 3ABKC 1OCOC 3GODA 3SYNA 1G8XA 4AX2A 2ZXPA 1Z23A 5DS5A 4C7OA 3CSKA 2O9XA 1Z63A 1ZYRF 2ZXOA 4U5CE 3JRTA 4RBNA 2VB6A 3NG1A 2G62A 2R7VA 2PX0A 3LEVA 3ABLC 3EFOB 4CBEA 1M2OA 1ZU5A 1SMYF 4YN0B 4CS8A 1VOMA 2KJGA 2Q3TA 4AK9A 4YJWA 3NYJA 4CS8C 3S29A 3JYHA 4IRUA 5KYXA 3N0TA 1ZHTA 3JCUQ 2ZPAA 2XSEA 3JT1A 1KU2A 4AE4B 4X0RA 3W8IA 4ZLCA 2VASA 2QY9A 5KYYB 3HTKC 3LNRA 2ZXWC 4C3DA 4CSAC 3DJNB 2HV7A 2R7OA 5T3TA 2PFDA 3EFOA 5KYNA 1M2VB 1D0XA 2EIMC 5CI8A 3SZRA 2C03A 3X2QC 3MX3A 1BR4A 4XLNF 5D91A 3NKEA 3T6BA 2Y3BA 3B0PA 3KL4A 4Q7CA 3NYLA 2Q9CA 1J8YF 4AE4A 5DLJA 4B6IA 1Z3IX 3F47A 5KYYA 3NKDA 3DM9B 3PMRA 1MMDA 3EPVA 5L3VA 4ANJA 5IY5C 3DJUB 3AG4C 3SNHA 1QLEC 2J45A 1D1AA 3UNGC 2WVQA 1Z5ZA 3RFYA 4Q4ZF 1D1CA 1M2VA 2Y39A 3DMDA 3AQBA 5T3WA 2R7SA 4E7ZA 3DXJF 3CQZA 3X1OA 4JURI 3GANA 1VK5A 2GFHA 3DD7A 2R7RA 4XWJA 3K1IC 2W4BA 4I1MA 4BJ5A 2BE5F 4GYTA 1SZIA 1D0YA 4O7GA 1TR2A 4BJ5C 2H7VC 4I3MA 2ZXRA 3EQLF 1PCXA 3EGXB 2D5RB 2W9YA 2Y3GA 3EHNA 4A2NB 2P6VA 3I5QA 3Q6MA 3DAGA 5T1DB 4OINF 3ABMC 3IEEA 1LVKA 2EINC 1ZU4A 2J9UA 2NUTA 2Y3HA 2MWQA 3KKBA 3UGPA 4PJNA 1V55C 1S7ZA 3QZCA 3T4RA 4N06A 2WVNA 4PJMA 4IWBA 2Y69C 4PFPA 3B0VC 1OCRC 2IXPA 3LS1A 2W45A 3EGXA 1M56C 5E3AA 4J30B 2KNHA 3HJCA 4O79A 2A6EF 2EIJC 3OA1A 4KNVA 1ZHWA 1VMAA 2NUPA 3W8HA 3ECSA 2L9JA 4K7BA 3Q7GA 3ZSUA 2OCCC 4KC9A 1BR2A 4U5BE 1D0ZA 2V26A 5B1BC 4YT2A 5D92A 1N1CA 2J0WA 1JPNA 4ULWA 4XTKA 4G7OF 2J9WA 2Q9AA 3LS0A 3SEOA 1J8MF 4KBLA 2VH3A 2J46A 3NRHA 4OD4A 4YWQA 2CNWA 3O39A 2QTVA 1W2WA 3EG9B 4KI2A 4LLEA 5KYWB 2R7WA 3WG7C 1ZHXA 3N2ZB 3OWTA 3FHDA 1MMGA 2J9VA 4CSAA 1PD0A 2YHSA 4CIHA 3PHF2 1ZHYA 2CGEA 4RD9A 1MMNA 2H7OA 3DZAA 2A6HF 1VYKA 1V54C 1D1BA 4LERA 2CDQA 2DYSC 2R7UA 3MLGA 1RJ9B 1OCCC 4BJTA 1OKKD 3EHMA 4WJ0A 4DBRA 1IZMA 3WODF 5KYWA 4MQ9F 2KW3C 4IJJA 4DVYP 2XXAB 1VYIA 3W2WA 3ASOC 4I1OB 2J0XA 1M57C 1FMWA 3RKOF 3CZ6A 3AG1C 4OIOF 4Q5SF 4LACB 4PJJA 5E33A 5HSWA 2H7BA 3O6XA 2J7PD 4EBBA 1RJ9A 1TKNA 2G3VA 3JSZA 4HE8D 2XL4A 4DOZA 2B0JA 3QMKA 2R7QA 2R7XA 3H65A 3EJNA 1TWCA 3ITFA 1FFTC 1MNDA 2Y3DA 2PP4A 4MNDA 3POVA 4KNWA 4CS7A 1TWGA 3RYLA 2C04A 3W2VA 2R7TA 5F5FA 1MNEA 2NG1A 5BUOA 1SF8A 2G3KA 3F46A 3LLKA 4C3EA 2XRHA 3Q7LA 1IW7F 3I4UA 1LS1A 3E70C 2WZGA 4IAOA 1NU9C 5CI9A 4GEHA 5EHHA 2V3CC 3RH3A 2JD3A 4U5HA 4FX5A 2PX3A 4G7ZF 3ZC4A 2L81A 5E2QA 3EGDB 2Q9BA 3DAFA 3FVYA 4C7OB 4U5EE 2M4EA 4BJ1A 3S27A 4U5FE 2EIKC 4U5GA 4C3BA 4OD5A 4BJ6A 4J32B 5B1AC 2IXOA 4HFKB 4BJ6C 1OCZC 2A69F 1PD1A 4G7HF 1LKXA 3OEOA 5E3CA 5DQTA 4HFFB 2EILC 2DGJA 1TWAA 5KYUB 3UGOA 1TWHA 5DS6A 3EGDA 4O6NA 3UMIA 3M1CB 3T6JA 3ZG1A 4OIQF 1BR1A 5KYXB 3K66A 3K6BA 2FFHA 4K0DA 4JZAA 2YZSA 3EZIA 4XLPF 2YEVA 1MMAA 3KMIA 3L0IA 4O6MA 5DS4A 1O5HA 4CS9A 3ZVRA 2LSEA 4P6IC 1Z6AA 2HV6A 3LLIA 4BG0A 4CS9C 4JVSA 1WGWA 3FDQA 2DYRC 5KYUA 3NDBB 4JJFA 3LJBA 1QZXA 2IXMA 2FGYA 4ZLDA 2Z15A 2IYLD 3E9VA 3Q6NA 3UR3C 3EG9A 5FCLA 1ZHZA 4OIPF 2KQ9A 4RDAA 3N24A 5F5HA 2IXNA 3AQCA 5EGYA 3SP1A 1FTSA 4JJGA 1FFHA 4PFOA 4HEAJ 4PK4A 3K1HA 3B0UX 2IOQA 2WVOA 1NG1A 4I44A 4M63A 5DVWA 2P7VA 2E87A 4U5DE 2KGOA 4BEJA 2WZFA 4FWVA 1FMVA 3S0XA 1ST6A 3EH2A 3UMKA 3AG3C 3VYWA 4G0HA 2XXAA 4JW1A 1OKKA 5L3QA 4E7SA 5DQZA 1O87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QI0 A;  5F5F A;  3X1O A;  5F5H A;  4QI2 A;  4YWQ A;  4ZLC A;  4ZLD A;  4ULW A; 
#chains in the Genus database with same CATH topology
 3C62 A;  3I5P A;  4IGG A;  4WAB A;  1JPJ A;  1NU7 D;  2WL8 A;  3V7O A;  4K1O A;  1K05 A;  1LS4 A;  2RSE B;  1U0B B;  4DRJ B;  4MVZ A;  4F4B A;  3V5X A;  3IPM O;  3S28 A;  1PV3 A;  3U8P A;  2OG2 A;  4W8P A;  3HLZ A;  2NUT B;  1YDI A;  4EWC A;  2AWC A;  3R7C A;  3KH2 A;  3RVY A;  3B9Q A;  5B3S C;  3DI5 A;  5JVE A;  4PJL A;  4W8K A;  1HMD A;  3L8I A;  4NY3 A;  3DKA A;  4YL3 A;  1NSG B;  2A1D D;  3ASN C;  4DVZ A;  2HJ3 A;  1A41 A;  4E18 A;  4O6Y A;  4YT8 A;  2X51 A;  1T6Q A;  3L34 A;  2J7P A;  2LK4 A;  4QI0 A;  4JCH A;  2A68 F;  1BZ4 A;  2MYS A;  2XLO A;  2OEX A;  2YLD A;  3S90 A;  3LUT B;  2WB7 A;  3TD7 A;  5B3I A;  3EZH A;  2V3C C;  3FAJ A;  3AG2 C;  3U9M A;  3ZQY A;  3DM5 A;  3GEH A;  1MQV A;  2PF4 E;  3LES A;  3QTH A;  2BC5 A;  4DBQ A;  1RKC A;  2HUJ A;  2Q4F A;  4MTG A;  3U2L A;  3VAY A;  1ZZP A;  2HS5 A;  3C8G A;  4ER9 A;  4EHP A;  3QW0 A;  3ZIB A;  2W4M A;  3LAY A;  3R2P A;  4QDL A;  2NUP B;  4DXW A;  1YAR O;  4OIR F;  4QI2 A;  3K33 A;  3TUL A;  4LLC A;  4YT5 A;  1LI5 A;  1CGM E;  2I8B A;  4CDA A;  1ZW2 A;  3UMH A;  4CDV A;  3RIP A;  1NZE A;  1FR0 A;  1G4U S;  3K7D A;  2HKV A;  2LIG A;  4JC7 A;  4YT4 A;  2CW0 F;  2JX0 A;  3GM3 A;  3NYM A;  1Q0G A;  3GM2 A;  3C63 A;  1HW1 A;  3EH1 A;  4FES A;  4H4K C;  4IB4 A;  1E85 A;  2CNW D;  1AEP A;  2R25 A;  2WZL A;  4NCQ A;  4JTD B;  4EIY A;  1K04 A;  3ABK C;  1OCO C;  3GOD A;  2EPM X;  3SYN A;  1G8X A;  1WAS A;  1VB5 A;  3KYI A;  2YL1 A;  2YWA A;  4AX2 A;  2ZXP A;  4R32 A;  1Z23 A;  5DS5 A;  4C7O A;  5COG A;  3GEI A;  4CJO A;  3RW0 A;  3CSK A;  3IQT A;  3JSE O;  1T01 A;  2O9X A;  1Z63 A;  3J06 A;  1ZYR F;  2NSG A;  2ZXO A;  4U5C E;  5A6A A;  2LFD A;  2YRF A;  3JRT A;  1I4Y A;  4RBN A;  5TJ5 E;  2VB6 A;  3GWN A;  3NG1 A;  2G62 A;  2R7V A;  1V4A A;  2PX0 A;  1A0B A;  2KK1 A;  1OR3 A;  3DWW A;  3LEV A;  1AVO B;  3ABL C;  4CIP A;  2XLE A;  1WTY A;  3EFO B;  1E2X A;  3TJ5 A;  1M2O A;  1ZU5 A;  4CBE A;  1SMY F;  4YN0 B;  3LEO A;  1VOM A;  3V5Z A;  4CS8 A;  3AOU A;  2KJG A;  3QVY A;  2Q3T A;  1TQG A;  1Y6D A;  2XM0 A;  1Q0D A;  4YJW A;  3NYJ A;  4AK9 A;  4CS8 C;  3S29 A;  3JYH A;  1GQA A;  4MVR A;  4IRU A;  3ZTM A;  5KYX A;  3N0T A;  1ZHT A;  2VCB A;  3JCU Q;  1AUE A;  2ZPA A;  4LDK A;  4YL1 A;  4E17 A;  2XSE A;  3JT1 A;  1KU2 A;  4AE4 B;  1ORY A;  4EUK B;  4X0R A;  3W8I A;  4ZLC A;  2VAS A;  2QY9 A;  2GA0 A;  5KYY B;  3HTK C;  3LNR A;  2ZXW C;  1H9G A;  3HNJ A;  2J8W A;  3B71 A;  4C3D A;  1A7D A;  5BQI A;  4CSA C;  5AC5 A;  2HV7 A;  3AJM A;  3DJN B;  2R7O A;  3KPH A;  1EI7 A;  4PAC A;  5T3T A;  2R03 A;  2HFI A;  2PFD A;  3EFO A;  5KYN A;  1M2V B;  1BBH A;  2YKZ A;  2XS1 A;  1D0X A;  2EIM C;  5CI8 A;  3SZR A;  2C03 A;  3X2Q C;  2OOC A;  2CCY A;  1BR4 A;  1OXK A;  3MX3 A;  4Z9H A;  4XLN F;  5D91 A;  256B A;  5JUA A;  3NKE A;  1QQ3 A;  4JRZ A;  2UUI A;  3T6B A;  2D4U A;  2Y3B A;  3B0P A;  3KL4 A;  2XS8 A;  4Q7C A;  1F1M A;  3NYL A;  1SR2 A;  1DOV A;  2Q9C A;  1J8Y F;  4AE4 A;  5DLJ A;  5AC4 A;  2BL2 A;  1Z3I X;  4B6I A;  3W4Y A;  4Z9J A;  5L0F A;  3F47 A;  3G4Z A;  5KYY A;  3NKD A;  1CPR A;  1L7C A;  1Q0M A;  1MMD A;  3DM9 B;  3EPV A;  3M79 A;  2R9R B;  3PMR A;  4ANJ A;  5IY5 C;  3DJU B;  5L3V A;  5A6B A;  3RQG A;  3AG4 C;  3JZ0 A;  1H9T A;  2XLW A;  1QLE C;  2ZD9 A;  3SNH A;  2J45 A;  3LNM B;  4MTF A;  1D1A A;  1YYX A;  5A6J A;  3UNG C;  2WVQ A;  1Z5Z A;  3RFY A;  4Q4Z F;  1D1C A;  1BDJ B;  1C02 A;  1M2V A;  2Y39 A;  1GS9 A;  3DMD A;  3AQB A;  3KYJ A;  1CGO A;  1YA9 A;  3M4B A;  2IBF A;  4MVO A;  5T3W A;  2HZ8 A;  3U9J A;  3DXJ F;  3CQZ A;  3X1O A;  4E7Z A;  4JUR I;  1Q0K A;  3GAN A;  5FZT A;  3SXY A;  1VK5 A;  4MVM A;  5COF A;  2GFH A;  3DD7 A;  2R7R A;  4XWJ A;  3K1I C;  5L0J A;  1H6G A;  2W4B A;  1L3P A;  2P61 A;  4I1M A;  5F28 E;  4BJ5 A;  3TOL A;  2BE5 F;  2QUP A;  1SZI A;  4GYT A;  1D0Y A;  1YAU O;  4O7G A;  1TR2 A;  4NC3 A;  3ZWI A;  4BJ5 C;  2H7V C;  1RXQ A;  1T6I A;  4I3M A;  3ATP A;  3HNI A;  2ZXR A;  3EQL F;  1WWP A;  1B68 A;  1CGN A;  1PCX A;  4NTA A;  5JSL A;  3EGX B;  3JTL O;  3C8G D;  1M6T A;  2HMQ A;  2D5R B;  1R4T A;  1ZW3 A;  3QW1 A;  2AWY A;  3RF3 A;  2W9Y A;  2Y3G A;  3EHN A;  5BQG A;  2P6V A;  3S9O A;  3I5Q A;  4A2N B;  3A11 A;  2EPL X;  3Q6M A;  4YK5 A;  4LDR A;  1VLS A;  3DAG A;  5T1D B;  1KTM A;  1RCP A;  2PBE A;  4OIN F;  2ETS A;  2M64 A;  3ABM C;  4MTO A;  2OEV A;  3G4X A;  1HE9 A;  2EPN A;  3IEE A;  2PNO A;  1LVK A;  2EIN C;  1ZU4 A;  2J9U A;  2NUT A;  4CJG A;  2AU5 A;  2Y3H A;  4MVQ A;  4ONS A;  2MWQ A;  3KKB A;  5CIV A;  3UGP A;  4PJN A;  1V55 C;  1S7Z A;  3QZC A;  1G5Z A;  3U8V A;  3FMS A;  3T4R A;  5A69 A;  4N06 A;  3GEE A;  1RKE B;  2WVN A;  3BEH A;  5JP7 A;  4PJM A;  4BEM J;  4IWB A;  4E0H A;  2Y69 C;  4PFP A;  3B0V C;  1U6H A;  1OCR C;  2IXP A;  3LS1 A;  2W45 A;  3EGX A;  1M56 C;  5E3A A;  4J30 B;  1C17 M;  1E83 A;  2JPU A;  2KNH A;  4JE9 A;  4MVS A;  3HKK A;  4N4W A;  3HJC A;  1T6U A;  2A6E F;  4O79 A;  2EIJ C;  3OA1 A;  4KNV A;  2L6H A;  1ZHW A;  5COM A;  4EBJ A;  4GQH A;  1E86 A;  1VMA A;  4DRI B;  1YZA A;  3TQO A;  4YL0 A;  4XPW A;  2NUP A;  3W8H A;  3ECS A;  2L9J A;  4K7B A;  4D4X A;  1NLX A;  1Y4C A;  3Q7G A;  1R5I D;  2LFF A;  1T5O A;  3ZSU A;  2I15 A;  2OCC C;  2YL0 A;  3NMJ A;  3IQC A;  3T6G B;  3BRJ A;  4KC9 A;  1BR2 A;  4U5B E;  2GDC A;  4FAP B;  2P0N A;  2MHR A;  2XL8 A;  1D0Z A;  3IHU A;  5L0D A;  2V26 A;  4P9T A;  3QVZ A;  3H2U A;  3L1M A;  5B1B C;  4YT2 A;  5D92 A;  1N1C A;  2J0W A;  1JPN A;  4ULW A;  4XTK A;  3AGT A;  4G7O F;  2EPK X;  2J9W A;  2A0U A;  2Q9A A;  3DE8 A;  2EPO A;  2H8A A;  3LS0 A;  3SEO A;  1J8M F;  1GGQ A;  2L6G A;  2J46 A;  2VH3 A;  3NRH A;  1ORJ A;  2A0B A;  4KBL A;  4OD4 A;  4YWQ A;  2CNW A;  2NSF A;  2QTV A;  3O39 A;  1W2W A;  1APC A;  2GAQ A;  3SXK A;  2HJM A;  3EG9 B;  4KI2 A;  3C7J A;  4LLE A;  3M15 A;  1YA7 O;  5KYW B;  4MVU A;  2R7W A;  3WG7 C;  1ZHX A;  3N2Z B;  3OWT A;  2P1A A;  4J7T A;  3FHD A;  3U5S A;  1MMG A;  4JKV A;  2J9V A;  1HMO A;  4CSA A;  1PD0 A;  4IAQ A;  2OKU A;  2OJQ A;  3MYF A;  4NTB A;  4BPM A;  2YHS A;  1ZVZ A;  4XPX A;  4CIH A;  2YLI A;  1A7V A;  3PHF 2;  1ZHY A;  1WN0 A;  2YLG A;  2CGE A;  4RD9 A;  1K40 A;  3M4C A;  1MMN A;  2H7O A;  3DZA A;  2A6H F;  1YZC A;  1VYK A;  1V54 C;  1D1B A;  3S84 A;  3U0C A;  2XLH A;  4LER A;  2CDQ A;  4D4N A;  2DYS C;  3VRC A;  2R7U A;  1JMW A;  2NPU A;  4AL1 A;  3MLG A;  1RJ9 B;  1OCC C;  4BJT A;  3C8Z A;  1OKK D;  1WAT A;  3EHM A;  2R02 A;  5A6B D;  2DI3 A;  2XLV A;  3GM1 A;  3NMI A;  1IZM A;  4WJ0 A;  4DBR A;  1UFB A;  1JAF A;  1Q0F A;  3WOD F;  4MQ9 F;  5KYW A;  2KW3 C;  4IJJ A;  4DVY P;  3MYI A;  2XXA B;  1EA8 A;  2XM4 A;  1VYI A;  4XEF A;  3W2W A;  1TFO B;  2XLD A;  3ASO C;  4I1O B;  2J0X A;  2J9B A;  4PR9 A;  1V74 B;  2R7S A;  1M57 C;  2KYH A;  1JRA A;  1FMW A;  5JRA A;  3RKO F;  1ORS C;  3SXM A;  1VLT A;  3CZ6 A;  3AG1 C;  1GM5 A;  4OIO F;  4Q5S F;  1XZQ A;  2YL3 A;  4LAC B;  4PJJ A;  1A7E A;  1U89 A;  5E33 A;  5HSW A;  2H7B A;  4MW3 A;  3K1I A;  1JOG A;  2L7A A;  2F22 A;  2OU6 A;  5A6K A;  2AVK A;  3O6X A;  2J7P D;  4EBB A;  1RJ9 A;  1TKN A;  2G3V A;  3JSZ A;  4HE8 D;  2Q00 A;  1HE1 A;  2UUH A;  1NFN A;  2XL4 A;  2LP4 A;  2XLM A;  5GPG B;  2B0J A;  4DOZ A;  1OR2 A;  4NQF A;  1LE4 A;  3QMK A;  4WGZ A;  4JEA A;  2R7Q A;  3RQF A;  3GWL A;  2XL6 A;  3ZQV A;  3VM6 A;  2R7X A;  3VF0 A;  3ZTZ A;  4N6H A;  1LIH A;  1O3U A;  3H65 A;  3SXZ A;  3EJN A;  1TWC A;  4P9F A;  1FFT C;  1MND A;  3ITF A;  2Y3D A;  4CDY A;  2PP4 A;  5JS5 A;  4MND A;  2IM8 A;  3L8J A;  4KNW A;  4CS7 A;  3POV A;  3C18 A;  1TWG A;  3C8G B;  3RYL A;  1NFO A;  1G4W R;  4MS2 A;  2C04 A;  4E0I A;  4UDV A;  1LPE A;  3A9C A;  3W2V A;  2KSF A;  2HMZ A;  4XEK A;  2R7T A;  2GWW A;  2HSQ A;  1FAP B;  5F5F A;  1YLM A;  1MNE A;  2NG1 A;  4G78 A;  1I4Z A;  5BUO A;  4XPY A;  3U2M A;  2Q7R A;  1SF8 A;  1E84 A;  2G3K A;  3F46 A;  3LLK A;  1JR8 A;  3HNK A;  4C3E A;  2XRH A;  5L0C A;  3Q7L A;  3IQ6 A;  1LE2 A;  1IW7 F;  3I4U A;  3JRM O;  4J7Y A;  5EK0 A;  1LS1 A;  1DOW A;  3TJ6 A;  3US6 A;  3E70 C;  3JYY A;  2WZG A;  4IAO A;  1NU9 C;  5CI9 A;  4GEH A;  4XEV A;  4AL0 A;  4U9D A;  2JD3 A;  3RH3 A;  5EHH A;  4U5H A;  1EKY A;  4FX5 A;  4JEB A;  2PX3 A;  1HY5 A;  1KNY A;  1NBB A;  4G7Z F;  3ZC4 A;  3V5Y A;  2L81 A;  5E2Q A;  1LI7 A;  2Q9B A;  1SYQ A;  3EGD B;  2L6F A;  5L0I A;  3CEX A;  5JLI A;  1QPU A;  3DAF A;  3FVY A;  4C7O B;  1XWJ A;  3MFN A;  3O10 A;  2QE9 A;  4JTA B;  4U5E E;  1QKR A;  2M4E A;  4BJ1 A;  1S05 A;  4JTC B;  3S27 A;  4U5F E;  2EIK C;  4U5G A;  4C3B A;  4OD5 A;  3CAX A;  2KC3 A;  4BJ6 A;  1UG7 A;  4NTF A;  3G50 A;  4J32 B;  5B1A C;  2IXO A;  4HFK B;  4BJ6 C;  1OCZ C;  2A69 F;  1PD1 A;  4G7H F;  4L6R A;  1LKX A;  1RKE A;  3OEO A;  5E3C A;  5DQT A;  1YYJ A;  4HFF B;  1YJG A;  2EIL C;  4JIO A;  2DGJ A;  1TWA A;  5KYU B;  3UGO A;  2QNL A;  3TOM A;  5AGF A;  5K0I A;  1T9K A;  1TWH A;  1YVI A;  3RQE A;  3EGD A;  4O6N A;  2DB4 A;  2VC9 A;  3UMI A;  5DS6 A;  3M1C B;  3T6J A;  3ZG1 A;  5JT4 A;  4OIQ F;  1FNT c;  1BR1 A;  5KYX B;  1OW7 A;  2YVK A;  3K66 A;  3FXH A;  3K6B A;  1EQ1 A;  2FFH A;  1OW6 A;  4DJ9 A;  4K0D A;  2TMV P;  4JZA A;  1OXB A;  2YZS A;  3EZI A;  4XLP F;  2YQY A;  2YEV A;  1VTM P;  1MMA A;  3KMI A;  3L0I A;  4O6M A;  5DS4 A;  3DE9 A;  1O5H A;  1HW2 A;  3FOO A;  3PDM P;  1WOL A;  4CS9 A;  5HV9 A;  1XZP A;  3ZVR A;  2LSE A;  3MBG A;  4P6I C;  1Z6A A;  2HV6 A;  5BQH A;  3LLI A;  4BG0 A;  4CS9 C;  2CYD A;  4JVS A;  1WGW A;  3FDQ A;  2DYR C;  5KYU A;  2AP3 A;  3NDB B;  4JJF A;  4JCZ A;  3LJB A;  1QZX A;  4CX9 A;  3U3B A;  3B29 A;  3NMK A;  1QVX A;  2OJE D;  2ASR A;  2FGY A;  2IXM A;  2R05 A;  2X0C A;  3RVZ A;  2Z15 A;  5L0G A;  4ZLD A;  2IYL D;  3E9V A;  3Q6N A;  1TFK B;  3UR3 C;  3EG9 A;  5FCL A;  1LM3 B;  4EBK A;  1ZHZ A;  4OIP F;  4Z9I A;  4DRH B;  2KQ9 A;  4RDA A;  3N24 A;  4H54 A;  5F5H A;  2IXN A;  3AQC A;  1OW8 A;  3H2V A;  5EGY A;  3WAQ A;  3SP1 A;  1FTS A;  4JJG A;  5L0H A;  1FFH A;  4PFO A;  2FAP B;  1Z7Q c;  2LQG A;  4U9E A;  2HSB A;  2ICW G;  2RD9 A;  4HEA J;  4PK4 A;  3K1H A;  3B0U X;  2IOQ A;  2WVO A;  1NG1 A;  4I44 A;  2QLA A;  1C03 A;  4M63 A;  5DVW A;  5DQZ A;  2P7V A;  4IAR A;  2B0H A;  2YL7 A;  2OQM A;  3ZDL A;  2E87 A;  1QSP A;  1H7I A;  3IQ5 A;  3AGU A;  1OQC A;  3PCV A;  1I5N A;  3TK0 A;  4U5D E;  2VCC A;  3FAP B;  2KGO A;  4BEJ A;  2WZF A;  4N6C A;  4ULV A;  4FWV A;  1CPQ A;  1FMV A;  3FOP A;  2VCA A;  4XQ1 A;  3O55 A;  1ST6 A;  4EKW A;  3S0X A;  3EH2 A;  4LDQ A;  2LD6 A;  3GOR A;  3AG3 C;  3T9O A;  3UMK A;  3VYW A;  3U3F A;  3WHN A;  4G0H A;  2XXA A;  4JW1 A;  1OKK A;  4MW8 A;  5L3Q A;  1RMV A;  2LCH A;  4WGY A;  4A4A A;  4E7S A;  3HNL A;  1O87 A; 
#chains in the Genus database with same CATH homology
 3I5P A;  1JPJ A;  1NU7 D;  2WL8 A;  3V7O A;  4F4B A;  3S28 A;  2OG2 A;  3HLZ A;  2NUT B;  4EWC A;  3KH2 A;  3B9Q A;  5B3S C;  4PJL A;  4W8K A;  4NY3 A;  2A1D D;  3ASN C;  4DVZ A;  4O6Y A;  4YT8 A;  2X51 A;  3L34 A;  2J7P A;  4QI0 A;  4JCH A;  2A68 F;  2MYS A;  2WB7 A;  3TD7 A;  3EZH A;  3FAJ A;  3AG2 C;  3DM5 A;  2PF4 E;  3LES A;  4DBQ A;  3VAY A;  3ZIB A;  2W4M A;  3LAY A;  4QDL A;  2NUP B;  4OIR F;  4QI2 A;  3K33 A;  4LLC A;  4YT5 A;  2I8B A;  3UMH A;  3RIP A;  1NZE A;  3K7D A;  4YT4 A;  2CW0 F;  3NYM A;  3EH1 A;  4FES A;  4H4K C;  2CNW D;  2WZL A;  3ABK C;  1OCO C;  3GOD A;  3SYN A;  1G8X A;  4AX2 A;  2ZXP A;  1Z23 A;  5DS5 A;  4C7O A;  3CSK A;  2O9X A;  1Z63 A;  1ZYR F;  2ZXO A;  4U5C E;  3JRT A;  4RBN A;  2VB6 A;  3NG1 A;  2G62 A;  2R7V A;  2PX0 A;  3LEV A;  3ABL C;  3EFO B;  4CBE A;  1M2O A;  1ZU5 A;  1SMY F;  4YN0 B;  4CS8 A;  1VOM A;  2KJG A;  2Q3T A;  4AK9 A;  4YJW A;  3NYJ A;  4CS8 C;  3S29 A;  3JYH A;  4IRU A;  5KYX A;  3N0T A;  1ZHT A;  3JCU Q;  2ZPA A;  2XSE A;  3JT1 A;  1KU2 A;  4AE4 B;  4X0R A;  3W8I A;  4ZLC A;  2VAS A;  2QY9 A;  5KYY B;  3HTK C;  3LNR A;  2ZXW C;  4C3D A;  4CSA C;  3DJN B;  2HV7 A;  2R7O A;  5T3T A;  2PFD A;  3EFO A;  5KYN A;  1M2V B;  1D0X A;  2EIM C;  5CI8 A;  3SZR A;  2C03 A;  3X2Q C;  3MX3 A;  1BR4 A;  4XLN F;  5D91 A;  3NKE A;  3T6B A;  2Y3B A;  3B0P A;  3KL4 A;  4Q7C A;  3NYL A;  2Q9C A;  1J8Y F;  4AE4 A;  5DLJ A;  4B6I A;  1Z3I X;  3F47 A;  5KYY A;  3NKD A;  3DM9 B;  3PMR A;  1MMD A;  3EPV A;  5L3V A;  4ANJ A;  5IY5 C;  3DJU B;  3AG4 C;  3SNH A;  1QLE C;  2J45 A;  1D1A A;  3UNG C;  2WVQ A;  1Z5Z A;  3RFY A;  4Q4Z F;  1D1C A;  1M2V A;  2Y39 A;  3DMD A;  3AQB A;  5T3W A;  2R7S A;  4E7Z A;  3DXJ F;  3CQZ A;  3X1O A;  4JUR I;  3GAN A;  1VK5 A;  2GFH A;  3DD7 A;  2R7R A;  4XWJ A;  3K1I C;  2W4B A;  4I1M A;  4BJ5 A;  2BE5 F;  4GYT A;  1SZI A;  1D0Y A;  4O7G A;  1TR2 A;  4BJ5 C;  2H7V C;  4I3M A;  2ZXR A;  3EQL F;  1PCX A;  3EGX B;  2D5R B;  2W9Y A;  2Y3G A;  3EHN A;  4A2N B;  2P6V A;  3I5Q A;  3Q6M A;  3DAG A;  5T1D B;  4OIN F;  3ABM C;  3IEE A;  1LVK A;  2EIN C;  1ZU4 A;  2J9U A;  2NUT A;  2Y3H A;  2MWQ A;  3KKB A;  3UGP A;  4PJN A;  1V55 C;  1S7Z A;  3QZC A;  3T4R A;  4N06 A;  2WVN A;  4PJM A;  4IWB A;  2Y69 C;  4PFP A;  3B0V C;  1OCR C;  2IXP A;  3LS1 A;  2W45 A;  3EGX A;  1M56 C;  5E3A A;  4J30 B;  2KNH A;  3HJC A;  4O79 A;  2A6E F;  2EIJ C;  3OA1 A;  4KNV A;  1ZHW A;  1VMA A;  2NUP A;  3W8H A;  3ECS A;  2L9J A;  4K7B A;  3Q7G A;  3ZSU A;  2OCC C;  4KC9 A;  1BR2 A;  4U5B E;  1D0Z A;  2V26 A;  5B1B C;  4YT2 A;  5D92 A;  1N1C A;  2J0W A;  1JPN A;  4ULW A;  4XTK A;  4G7O F;  2J9W A;  2Q9A A;  3LS0 A;  3SEO A;  1J8M F;  4KBL A;  2VH3 A;  2J46 A;  3NRH A;  4OD4 A;  4YWQ A;  2CNW A;  3O39 A;  2QTV A;  1W2W A;  3EG9 B;  4KI2 A;  4LLE A;  5KYW B;  2R7W A;  3WG7 C;  1ZHX A;  3N2Z B;  3OWT A;  3FHD A;  1MMG A;  2J9V A;  4CSA A;  1PD0 A;  2YHS A;  4CIH A;  3PHF 2;  1ZHY A;  2CGE A;  4RD9 A;  1MMN A;  2H7O A;  3DZA A;  2A6H F;  1VYK A;  1V54 C;  1D1B A;  4LER A;  2CDQ A;  2DYS C;  2R7U A;  3MLG A;  1RJ9 B;  1OCC C;  4BJT A;  1OKK D;  3EHM A;  4WJ0 A;  4DBR A;  1IZM A;  3WOD F;  5KYW A;  4MQ9 F;  2KW3 C;  4IJJ A;  4DVY P;  2XXA B;  1VYI A;  3W2W A;  3ASO C;  4I1O B;  2J0X A;  1M57 C;  1FMW A;  3RKO F;  3CZ6 A;  3AG1 C;  4OIO F;  4Q5S F;  4LAC B;  4PJJ A;  5E33 A;  5HSW A;  2H7B A;  3O6X A;  2J7P D;  4EBB A;  1RJ9 A;  1TKN A;  2G3V A;  3JSZ A;  4HE8 D;  2XL4 A;  4DOZ A;  2B0J A;  3QMK A;  2R7Q A;  2R7X A;  3H65 A;  3EJN A;  1TWC A;  3ITF A;  1FFT C;  1MND A;  2Y3D A;  2PP4 A;  4MND A;  3POV A;  4KNW A;  4CS7 A;  1TWG A;  3RYL A;  2C04 A;  3W2V A;  2R7T A;  5F5F A;  1MNE A;  2NG1 A;  5BUO A;  1SF8 A;  2G3K A;  3F46 A;  3LLK A;  4C3E A;  2XRH A;  3Q7L A;  1IW7 F;  3I4U A;  1LS1 A;  3E70 C;  2WZG A;  4IAO A;  1NU9 C;  5CI9 A;  4GEH A;  5EHH A;  2V3C C;  3RH3 A;  2JD3 A;  4U5H A;  4FX5 A;  2PX3 A;  4G7Z F;  3ZC4 A;  2L81 A;  5E2Q A;  3EGD B;  2Q9B A;  3DAF A;  3FVY A;  4C7O B;  4U5E E;  2M4E A;  4BJ1 A;  3S27 A;  4U5F E;  2EIK C;  4U5G A;  4C3B A;  4OD5 A;  4BJ6 A;  4J32 B;  5B1A C;  2IXO A;  4HFK B;  4BJ6 C;  1OCZ C;  2A69 F;  1PD1 A;  4G7H F;  1LKX A;  3OEO A;  5E3C A;  5DQT A;  4HFF B;  2EIL C;  2DGJ A;  1TWA A;  5KYU B;  3UGO A;  1TWH A;  5DS6 A;  3EGD A;  4O6N A;  3UMI A;  3M1C B;  3T6J A;  3ZG1 A;  4OIQ F;  1BR1 A;  5KYX B;  3K66 A;  3K6B A;  2FFH A;  4K0D A;  4JZA A;  2YZS A;  3EZI A;  4XLP F;  2YEV A;  1MMA A;  3KMI A;  3L0I A;  4O6M A;  5DS4 A;  1O5H A;  4CS9 A;  3ZVR A;  2LSE A;  4P6I C;  1Z6A A;  2HV6 A;  3LLI A;  4BG0 A;  4CS9 C;  4JVS A;  1WGW A;  3FDQ A;  2DYR C;  5KYU A;  3NDB B;  4JJF A;  3LJB A;  1QZX A;  2IXM A;  2FGY A;  4ZLD A;  2Z15 A;  2IYL D;  3E9V A;  3Q6N A;  3UR3 C;  3EG9 A;  5FCL A;  1ZHZ A;  4OIP F;  2KQ9 A;  4RDA A;  3N24 A;  5F5H A;  2IXN A;  3AQC A;  5EGY A;  3SP1 A;  1FTS A;  4JJG A;  1FFH A;  4PFO A;  4HEA J;  4PK4 A;  3K1H A;  3B0U X;  2IOQ A;  2WVO A;  1NG1 A;  4I44 A;  4M63 A;  5DVW A;  2P7V A;  2E87 A;  4U5D E;  2KGO A;  4BEJ A;  2WZF A;  4FWV A;  1FMV A;  3S0X A;  1ST6 A;  3EH2 A;  3UMK A;  3AG3 C;  3VYW A;  4G0H A;  2XXA A;  4JW1 A;  1OKK A;  5L3Q A;  4E7S A;  5DQZ A;  1O87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...