4YWQA

Crystal structure of the roq domain of human roquin-1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
152
Chain Sequence
QQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Crystal structure of the ROQ domain of human Roquin-1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 50
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ywqA00
4ZLCA 5F5FA 4ULWA 4YWQA 4ZLDA 3X1OA 4QI0A 4QI2A 5F5HA
chains in the Genus database with same CATH superfamily
4E18A 3ZQVA 1TQGA 2MWQA 2A68F 2LD6A 3S0XA 3KYIA 2QY9A 3ZDLA 2VH3A 5KYWA 2EIMC 3C8ZA 5L0DA 2G3KA 1MMGA 3O39A 5F5HA 1W2WA 3IQ5A 2KSFA 4RDAA 3K1IA 3NDBB 3B71A 2IXMA 2YLGA 1U89A 2IXOA 2J45A 2KNHA 4XTKA 3RQEA 4OIOF 1T6UA 2Y3DA 1T6IA 3SNHA 1YZCA 3M1CB 4JJFA 4FAPB 3VAYA 4JJGA 2KGOA 1G4US 3T6GB 3VF0A 3LS0A 1TWCA 2JD3A 4BEJA 1CGOA 3AG3C 4MNDA 4XPWA 4DVYP 3EG9B 3MFNA 1EI7A 3PHF2 2XM0A 2G62A 3L1MA 3QW0A 5L0CA 3EHNA 2YL3A 2NUPB 4JW1A 4YT8A 1HW2A 3UNGC 3FOPA 1OR3A 2CW0F 2OJQA 2P7VA 2IM8A 3CQZA 2XM4A 3M4CA 3N2ZB 3NYMA 3RFYA 5AC5A 5HV9A 2R03A 1Z7Qc 4CJGA 2CYDA 1YA9A 4JTAB 3V5XA 1JOGA 3ECSA 4WJ0A 1CPRA 1QLEC 2L6GA 1YARO 2Q00A 3N0TA 4FWVA 4L6RA 1TKNA 3DKAA 1ZW2A 4R32A 2EPOA 2J0WA 3TJ6A 4N06A 1SZIA 2EINC 3DM5A 1RKEB 1PCXA 3NKEA 2OG2A 3V5YA 4C3BA 2OJED 1EKYA 1H6GA 4WABA 3EQLF 3U8VA 2C03A 1LI7A 1BDJB 2J9WA 1G8XA 2P1AA 2XL4A 3EGXB 4HE8D 4J30B 2KQ9A 2KK1A 5BQHA 4UDVA 3Q7LA 3K33A 3V7OA 2EILC 4A4AA 4G0HA 3AG2C 3AQCA 2P6VA 3FXHA 2OKUA 3AJMA 1CGME 3FHDA 2VB6A 3ABLC 2PBEA 3T9OA 1A41A 3S28A 4Q7CA 2PX0A 1LVKA 1GM5A 4XWJA 1WN0A 1I4ZA 1ORJA 2QTVA 3ZC4A 3ZTMA 4MTFA 3ZSUA 4J7YA 1Y6DA 4IB4A 3QTHA 5E3CA 4I44A 1NU7D 1FAPB 4ER9A 1PD1A 3JRTA 4O6YA 2MHRA 4DRIB 5HSWA 3B0UX 3GM1A 2R7VA 1D1BA 1M6TA 1Y4CA 2LIGA 5EGYA 3W4YA 1JPNA 3LJBA 3DZAA 3NYLA 1ZHXA 4OINF 3H65A 3ZVRA 3AG1C 2ICWG 3KPHA 1OR2A 1E2XA 4OIQF 2EPKX 4PACA 1Q0MA 3ABMC 4Z9IA 2R7OA 2FFHA 2LSEA 3JCUQ 3U9JA 4PFPA 1Q0GA 4CS9A 3LNRA 5A6BA 2X51A 4EBBA 4CIHA 1NZEA 4LDQA 4NTAA 3LAYA 4YL3A 1M2VA 4DOZA 1M2OA 2AU5A 2ZXRA 2DB4A 4NY3A 1Z63A 5B3SC 4JEBA 4IRUA 3G50A 3I4UA 4MW3A 4CIPA 5CI8A 4EIYA 1WTYA 2ZXWC 3C62A 3WG7C 3SXYA 2WZFA 4IAQA 3S84A 4DXWA 2CCYA 2PNOA 5D91A 3IHUA 5T3TA 3ZTZA 3PDMP 3NMIA 1M56C 3M79A 3Q7GA 1FTSA 1TWAA 2YLIA 1V55C 2Y69C 1Q0DA 3FVYA 2UUHA 3ZG1A 2YL0A 2EPLX 1AVOB 3B0PA 4LDRA 4U5HA 4E0HA 2QE9A 4C3DA 2YHSA 1J8MF 1OKKA 4K1OA 5L3QA 2J9VA 3KKBA 3KMIA 3RF3A 3BEHA 3CAXA 4YWQA 2CDQA 1XZPA 4PJJA 2HKVA 3WODF 3DWWA 2GAQA 2VC9A 5A69A 2YL1A 3KL4A 3BRJA 2UUIA 4JURI 1XWJA 4P6IC 3VM6A 2M64A 3C8GD 1D0ZA 1MMNA 1HY5A 5DS4A 3NMJA 4LLCA 1JAFA 2X0CA 3RW0A 4Q4ZF 2D5RB 3TJ5A 4G7OF 3H2UA 3LEVA 2XS1A 2AP3A 2XS8A 1SF8A 1OCZC 3S9OA 1HE1A 3G4ZA 1A0BA 3WHNA 2HSBA 3GODA 3CEXA 1S7ZA 256BA 3C63A 4Z9JA 2XRHA 4AX2A 1OQCA 1RMVA 3OWTA 1KNYA 1TWGA 3FOOA 1NSGB 4JIOA 1LPEA 4OD5A 4X0RA 4XPYA 5BUOA 1PD0A 1S05A 2J8WA 3RYLA 3TQOA 5K0IA 3IQ6A 4IWBA 1RJ9B 5JS5A 2BC5A 1KTMA 4I1OB 1LI5A 2XXAB 1ZHTA 3I5PA 2V26A 2VCCA 5DS6A 2Y39A 2XL8A 3QMKA 2WB7A 3EZHA 4MW8A 3MYFA 2GFHA 3H2VA 2ZXOA 1IZMA 5KYUB 3UGPA 3GANA 3DI5A 2W9YA 3SZRA 4EBKA 5BQIA 5F5FA 3E9VA 2NUTB 4J7TA 1LIHA 4CS8C 4K0DA 4A2NB 2YZSA 2XLOA 5DVWA 3V5ZA 2OCCC 3L34A 1ZHYA 2XL6A 3LEOA 2KW3C 3NMKA 5B3IA 2OU6A 3DM9B 2LFFA 2R9RB 4MVSA 2J46A 2M4EA 2Y3BA 4CJOA 3QVYA 4BJ5A 2J7PA 2QNLA 5B1AC 4EBJA 3T6JA 3ASNC 4XEVA 3LS1A 1HMOA 4J32B 4JVSA 3LLKA 3FMSA 3LNMB 1BR4A 3HNJA 4MTGA 4ULWA 2Y3GA 5A6KA 4XLPF 4E7SA 3S90A 2FGYA 1A7VA 1TWHA 5DLJA 1YAUO 1IW7F 2HSQA 2L6FA 5JLIA 1T01A 5T3WA 1E83A 3LUTB 2WL8A 1ORSC 1JR8A 4QI0A 2I8BA 4QI2A 5F28E 4JCZA 2A1DD 4PJNA 5AC4A 3TOLA 3DMDA 1BR2A 2W4MA 1QKRA 2AVKA 2R02A 3CZ6A 1C02A 5JUAA 1VTMP 2R7XA 1BBHA 1A7DA 3K1HA 4O7GA 1VLSA 3SXKA 2E87A 2CNWD 4MVQA 1FFTC 4EUKB 4H54A 1D0YA 4WGYA 3C7JA 2H8AA 1VYIA 2RSEB 4B6IA 1I4YA 2J9BA 2W4BA 3HLZA 3K7DA 3OA1A 4CSAA 4YK5A 1DOVA 2DYRC 4BJTA 2EPMX 3QW1A 1ZHWA 2H7VC 3O10A 3TK0A 3F47A 3U8PA 2R7TA 4ZLCA 5L3VA 1C03A 3PCVA 1Q0KA 1F1MA 1UFBA 4AK9A 2AWCA 5COMA 3O6XA 1ZU4A 1HW1A 2WVOA 3NKDA 3JZ0A 4CS7A 1LS4A 1YA7O 4U5EE 1U0BB 2EIJC 3IEEA 1OW6A 1RKCA 1APCA 1WGWA 4BJ6A 1Z3IX 2DI3A 4U5DE 5FZTA 4XLNF 2Q9AA 1YLMA 3S29A 3UGOA 3JSEO 3RVZA 2XLVA 3U5SA 3EZIA 3NG1A 3X2QC 5DS5A 2H7BA 1TR2A 2R7SA 3SYNA 5L0IA 1HE9A 2KYHA 4F4BA 4JEAA 1TFKB 3R7CA 2HZ8A 2RD9A 2ZPAA 4C3EA 1ZZPA 3GM3A 1C17M 3K1IC 1JRAA 3L8IA 2YL7A 3AGTA 3C8GB 4KNWA 5TJ5E 1Q0FA 3POVA 2PF4E 1CGNA 3W2VA 1NLXA 4M63A 1OCCC 2XXAA 3ABKC 4JZAA 4N4WA 2KJGA 1FMVA 2A69F 4BEMJ 5AGFA 1H7IA 3DJUB 3RVYA 2AWYA 3K66A 2V3CC 5KYUA 4NTFA 4BG0A 1RXQA 1WOLA 2MYSA 4U5FE 2HUJA 4WGZA 2JPUA 2NUTA 1H9GA 3EG9A 4G7HF 1I5NA 1MQVA 4MVRA 4EKWA 1QQ3A 4DVZA 5T1DB 4C7OB 1XZQA 4PJLA 2NUPA 3FDQA 1KU2A 1NFOA 2OOCA 3RH3A 1D1CA 3GEIA 3UMIA 3WAQA 2C04A 2GDCA 5DQTA 2WZLA 1SYQA 3GWNA 4Z9HA 3G4XA 2LQGA 5EHHA 1M57C 1ZU5A 2QUPA 3MLGA 4GEHA 4PK4A 3OEOA 4ANJA 2L7AA 1GQAA 1BR1A 1RKEA 2NSFA 3B29A 3HNIA 2IYLD 3US6A 2PX3A 3X1OA 3RIPA 1D1AA 2A0UA 2CGEA 5EK0A 4W8PA 1EQ1A 1GS9A 3I5QA 2NG1A 3EGXA 3W8IA 4DRHB 5KYYB 3JT1A 3A9CA 2W45A 1FFHA 2HV7A 1MNDA 5KYXB 4IAOA 1TFOB 1BZ4A 2B0HA 2IXNA 3M4BA 4YL0A 5E3AA 5CIVA 3F46A 1OCRC 3EFOB 1K04A 2YEVA 5IY5C 1NU9C 4EWCA 3QZCA 4AL1A 2GA0A 3U3FA 4AE4B 1O5HA 4RBNA 5CI9A 1VOMA 2ASRA 4O6NA 4NC3A 2IBFA 2TMVP 4HFKB 2HS5A 1J8YF 2D4UA 3EHMA 3JYHA 1O3UA 4K7BA 4I3MA 4MVOA 4YL1A 4NCQA 4DBQA 1VMAA 1UG7A 4IJJA 1VLTA 2A6EF 4BJ6C 1CPQA 4LLEA 3GORA 4CS9C 2DYSC 4XEFA 2G3VA 3UMHA 2A6HF 1K40A 2VCBA 3L0IA 3GWLA 5KYNA 3N24A 3UR3C 5JRAA 4KI2A 5A6BD 1HMDA 5BQGA 3DAGA 1YYJA 4RD9A 3SP1A 2BL2A 2YWAA 1O87A 1MMAA 2WZGA 1FR0A 2QLAA 5GPGB 2J9UA 3JRMO 4KNVA 1E84A 3RQFA 2LK4A 3DXJF 3IQCA 4BJ1A 2XLWA 3EH2A 3S27A 5A6JA 1H9TA 3ZQYA 1LE2A 1L7CA 2H7OA 3EJNA 5COGA 3LESA 2EIKC 3EGDB 4BPMA 2Q9CA 3DE9A 3RKOF 2YKZA 3AOUA 3E70C 1OXKA 5COFA 1Z23A 3Q6MA 3C8GA 3EPVA 2L6HA 2OQMA 4FESA 4PFOA 4G7ZF 2L81A 4MS2A 2YRFA 4XPXA 3IQTA 2R7WA 2B0JA 3EH1A 4JTDB 4IARA 4OD4A 1V74B 2NPUA 4JRZA 1YJGA 4JCHA 5FCLA 5E2QA 1RCPA 3U9MA 1OKKD 1SMYF 4KBLA 1QZXA 2KC3A 4OIRF 3RQGA 4N6CA 4YJWA 3SXZA 3U0CA 2L9JA 2PFDA 1ZW3A 2HMZA 3IPMO 5KYWB 3M15A 1WWPA 1YVIA 4U9DA 2YVKA 4YN0B 5E33A 3UMKA 2DGJA 4C7OA 3KH2A 5L0GA 1K05A 3ATPA 4E0IA 4ULVA 4W8KA 1D0XA 2P61A 2WVQA 4GQHA 4CDYA 4O79A 4ZLDA 2Q9BA 2PP4A 1R4TA 3HNLA 4MVMA 4DBRA 1LM3B 1MNEA 1QSPA 1V4AA 2WVNA 4QDLA 1Z5ZA 1AEPA 1YDIA 4MVZA 2LCHA 2XSEA 1WATA 2YQYA 3HJCA 4I1MA 5JSLA 3SXMA 2HFIA 4CX9A 4JTCB 3AGUA 4GYTA 1YZAA 3AQBA 4IGGA 4U9EA 3T6BA 3PMRA 4P9TA 4NQFA 4E7ZA 2JX0A 3T4RA 1ZHZA 1JPJA 3W8HA 4MVUA 1LKXA 3DE8A 4G78A 3K6BA 5KYYA 1OXBA 3JYYA 1T6QA 5DQZA 5JT4A 3B9QA 4D4XA 1E86A 2Q3TA 4CS8A 3ASOC 1ZYRF 5KYXA 5L0FA 1ZVZA 1RJ9A 2LFDA 2R7QA 2O9XA 3GEHA 3EFOA 2ETSA 3JTLO 3LLIA 4LACB 1VK5A 4DRJB 2XLDA 3R2PA 3TD7A 4DJ9A 4AL0A 2VASA 2BE5F 3DJNB 1FMWA 4NTBA 1U6HA 3Q6NA 3QVZA 4AE4A 1GGQA 5L0JA 3KYJA 3AG4C 3JSZA 1B68A 1PV3A 3SEOA 1SR2A 4XEKA 1ORYA 2XLMA 4N6HA 1LS1A 3U2LA 4CBEA 2R7UA 3CSKA 2Z15A 2A0BA 4BJ5C 4H4KC 2XLEA 1L3PA 4MTOA 1AUEA 4CDAA 1FNTc 1ST6A 4JKVA 1OW8A 1R5ID 1T9KA 4U5BE 5A6AA 2J7PD 2HV6A 4PR9A 1WASA 1JMWA 2LP4A 3FAPB 1OW7A 1N1CA 2CNWA 2EPNA 1G4WR 2Y3HA 3FAJA 3GEEA 4LDKA 1YYXA 3U3BA 4CDVA 1MMDA 3W2WA 1G5ZA 3HTKC 3DD7A 1T5OA 4HFFB 4FX5A 4LERA 2P0NA 4U5GA 3C18A 1VYKA 2OEVA 2YLDA 1A7EA 3MBGA 5L0HA 3ZWIA 3A11A 1LE4A 1EA8A 1V54C 1QPUA 2HMQA 2XLHA 2J0XA 3HKKA 3NRHA 2VCAA 4HEAJ 3VYWA 3TULA 4EHPA 3B0VC 1Z6AA 4JE9A 1DOWA 1NG1A 1OCOC 3L8JA 3EGDA 4U5CE 3VRCA 1VB5A 5B1BC 3O55A 3TOMA 2F22A 2NSGA 4CSAC 2R05A 4D4NA 2I15A 2HJ3A 1NBBA 2R25A 2ZXPA 1QVXA 2IOQA 4P9FA 3J06A 4Q5SF 4OIPF 4JC7A 3ZIBA 4KC9A 4YT2A 2IXPA 3DAFA 4ONSA 2Q7RA 2R7RA 5JP7A 3NYJA 3GM2A 4YT4A 4O6MA 3U2MA 2OEXA 1M2VB 2Q4FA 4YT5A 4PJMA 5JVEA 1E85A 3MYIA 3HNKA 3ITFA 3MX3A 2HJMA 4E17A 5D92A 4MQ9F 2FAPB 4XQ1A 1NFNA 2GWWA 2ZD9A
chains in the Genus database with same CATH topology
2MWQA 2A68F 3S0XA 2QY9A 5KYWA 2VH3A 2EIMC 2G3KA 1MMGA 3O39A 5F5HA 1W2WA 4RDAA 3NDBB 2IXMA 2IXOA 2J45A 2KNHA 4XTKA 4OIOF 2Y3DA 3SNHA 4JJFA 3M1CB 3VAYA 4JJGA 2KGOA 3LS0A 1TWCA 2JD3A 4BEJA 3AG3C 4MNDA 3EG9B 3PHF2 2G62A 3EHNA 2NUPB 4JW1A 4YT8A 3UNGC 3CQZA 2CW0F 2P7VA 3N2ZB 3NYMA 3RFYA 3ECSA 4WJ0A 1QLEC 3N0TA 4FWVA 4OINF 1TKNA 4F4BA 2J0WA 4N06A 1SZIA 2EINC 3DM5A 3NKEA 1PCXA 4C3BA 2OG2A 3EQLF 2C03A 4J30B 2J9WA 4HE8D 1G8XA 2XL4A 3EGXB 2KQ9A 3Q7LA 3K33A 3V7OA 2EILC 4G0HA 3AG2C 3AQCA 2P6VA 3FHDA 2VB6A 3ABLC 3S28A 4Q7CA 2PX0A 1LVKA 4XWJA 2QTVA 3ZC4A 3ZSUA 5E3CA 4I44A 1NU7D 1PD1A 3JRTA 4O6YA 5HSWA 3B0UX 2R7VA 1D1BA 5EGYA 1JPNA 3LJBA 3DZAA 3NYLA 1ZHXA 3H65A 3AG1C 4OIQF 3ABMC 2FFHA 2LSEA 3JCUQ 4PFPA 4CS9A 3LNRA 2X51A 4EBBA 4CIHA 1NZEA 3LAYA 1M2VA 4DOZA 1M2OA 2ZXRA 4NY3A 1Z63A 5B3SC 4IRUA 3I4UA 5CI8A 2ZXWC 3WG7C 2WZFA 5D91A 5T3TA 1M56C 3Q7GA 1FTSA 1TWAA 1V55C 2Y69C 3FVYA 3ZG1A 3B0PA 4U5HA 4C3DA 2YHSA 1J8MF 1OKKA 5L3QA 2J9VA 3KKBA 3KMIA 4YWQA 2CDQA 4PJJA 3WODF 3KL4A 4JURI 4P6IC 1D0ZA 1MMNA 5DS4A 4G7OF 4LLCA 4Q4ZF 2D5RB 3LEVA 1SF8A 1OCZC 3GODA 1S7ZA 4AX2A 2XRHA 3OWTA 1TWGA 4OD5A 4X0RA 5BUOA 1PD0A 3RYLA 4IWBA 1RJ9B 4I1OB 2XXAB 1ZHTA 3I5PA 2V26A 5DS6A 2Y39A 3QMKA 2WB7A 3EZHA 2GFHA 2ZXOA 1IZMA 5KYUB 3UGPA 3GANA 3SZRA 2W9YA 3E9VA 2NUTB 4CS8C 4K0DA 4A2NB 2YZSA 5DVWA 2OCCC 3L34A 1ZHYA 2KW3C 3DM9B 2J46A 2M4EA 2Y3BA 4BJ5A 2J7PA 5B1AC 3T6JA 3ASNC 3LS1A 4JVSA 4J32B 3LLKA 4ULWA 1BR4A 4XLPF 2Y3GA 4E7SA 2FGYA 1TWHA 5DLJA 1IW7F 5T3WA 2WL8A 4QI0A 2I8BA 4QI2A 4PJNA 2A1DD 3DMDA 1BR2A 2W4MA 3CZ6A 2R7XA 3K1HA 4O7GA 2E87A 2CNWD 1FFTC 1D0YA 4B6IA 1VYIA 2W4BA 3HLZA 3K7DA 3OA1A 4CSAA 4BJTA 2DYRC 1ZHWA 2H7VC 3F47A 2R7TA 4ZLCA 5L3VA 4AK9A 3O6XA 1ZU4A 2WVOA 3NKDA 4CS7A 4U5EE 2EIJC 3IEEA 1WGWA 4BJ6A 1Z3IX 4U5DE 4XLNF 2Q9AA 3S29A 3UGOA 5DS5A 3EZIA 3NG1A 3X2QC 2H7BA 1TR2A 2R7SA 3SYNA 2ZPAA 4C3EA 3K1IC 4KNWA 3POVA 2PF4E 3W2VA 4M63A 1OCCC 2XXAA 3ABKC 4JZAA 2KJGA 1FMVA 2A69F 3DJUB 3K66A 2V3CC 5KYUA 4BG0A 2MYSA 4U5FE 2NUTA 4G7HF 3EG9A 4DVZA 5T1DB 4C7OB 4PJLA 2NUPA 3FDQA 1KU2A 3RH3A 1D1CA 3UMIA 2C04A 5DQTA 2WZLA 5EHHA 1M57C 1ZU5A 3MLGA 4GEHA 4PK4A 3OEOA 4ANJA 1BR1A 2IYLD 2PX3A 3X1OA 3RIPA 1D1AA 2CGEA 3I5QA 2NG1A 3EGXA 3W8IA 5KYYB 3JT1A 2W45A 1FFHA 2HV7A 1MNDA 5KYXB 4IAOA 5F5FA 2IXNA 5E3AA 3F46A 1OCRC 3EFOB 2YEVA 5IY5C 1NU9C 4EWCA 3QZCA 4AE4B 1O5HA 4RBNA 5CI9A 1VOMA 4O6NA 4HFKB 1J8YF 3JYHA 3EHMA 4K7BA 4I3MA 4DBQA 1VMAA 4IJJA 2A6EF 4BJ6C 4LLEA 4CS9C 2DYSC 2G3VA 3UMHA 2A6HF 3L0IA 5KYNA 3N24A 3UR3C 4KI2A 3DAGA 4RD9A 3SP1A 1O87A 1MMAA 2WZGA 2J9UA 4KNVA 3DXJF 4BJ1A 3S27A 3EH2A 3EJNA 2H7OA 3LESA 2EIKC 3EGDB 2Q9CA 3RKOF 3E70C 1Z23A 3Q6MA 3EPVA 4FESA 4PFOA 4G7ZF 2L81A 2B0JA 3EH1A 4OD4A 4JCHA 5FCLA 5E2QA 1OKKD 1SMYF 4KBLA 1QZXA 4OIRF 4YJWA 2L9JA 2PFDA 5KYWB 3UMKA 4YN0B 5E33A 2DGJA 4C7OA 3KH2A 4W8KA 1D0XA 2WVQA 4ZLDA 4O79A 2Q9BA 2PP4A 4DBRA 1MNEA 2WVNA 4QDLA 1Z5ZA 2XSEA 4I1MA 3HJCA 4GYTA 3AQBA 3T6BA 3PMRA 4E7ZA 3T4RA 1ZHZA 1JPJA 3W8HA 1LKXA 3K6BA 5KYYA 5DQZA 3B9QA 2Q3TA 4CS8A 3ASOC 1ZYRF 5KYXA 3LLIA 1RJ9A 2R7QA 2O9XA 4LACB 3EFOA 1VK5A 3TD7A 2VASA 2BE5F 3DJNB 1FMWA 3Q6NA 4AE4A 3AG4C 3JSZA 3SEOA 1LS1A 4CBEA 2R7UA 3CSKA 2Z15A 4BJ5C 4H4KC 1ST6A 4U5BE 2J7PD 2HV6A 3FAJA 3ZVRA 2Y3HA 1N1CA 2CNWA 2R7WA 1MMDA 3W2WA 3HTKC 3DD7A 4HFFB 4FX5A 4LERA 4U5GA 1VYKA 1V54C 4HEAJ 3NRHA 4DVYP 2J0XA 3VYWA 3B0VC 1Z6AA 1NG1A 1OCOC 4U5CE 3EGDA 5B1BC 4CSAC 2ZXPA 4Q5SF 2IOQA 4OIPF 3ZIBA 4KC9A 4YT2A 2IXPA 3DAFA 2R7RA 3NYJA 4YT4A 4O6MA 1M2VB 4YT5A 4PJMA 3ITFA 3MX3A 5D92A 4MQ9F 2R7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZLC A;  5F5F A;  4ULW A;  4YWQ A;  4ZLD A;  3X1O A;  4QI0 A;  4QI2 A;  5F5H A; 
#chains in the Genus database with same CATH topology
 4E18 A;  3ZQV A;  1TQG A;  2MWQ A;  2A68 F;  2LD6 A;  3S0X A;  3KYI A;  2QY9 A;  3ZDL A;  2VH3 A;  5KYW A;  2EIM C;  3C8Z A;  5L0D A;  2G3K A;  1MMG A;  3O39 A;  5F5H A;  1W2W A;  3IQ5 A;  2KSF A;  4RDA A;  3K1I A;  3NDB B;  3B71 A;  2IXM A;  2YLG A;  1U89 A;  2IXO A;  2J45 A;  2KNH A;  4XTK A;  3RQE A;  4OIO F;  1T6U A;  2Y3D A;  1T6I A;  3SNH A;  1YZC A;  3M1C B;  4JJF A;  4FAP B;  3VAY A;  4JJG A;  2KGO A;  1G4U S;  3T6G B;  3VF0 A;  3LS0 A;  1TWC A;  2JD3 A;  4BEJ A;  1CGO A;  3AG3 C;  4MND A;  4XPW A;  4DVY P;  3EG9 B;  3MFN A;  1EI7 A;  3PHF 2;  2XM0 A;  2G62 A;  3L1M A;  3QW0 A;  5L0C A;  3EHN A;  2YL3 A;  2NUP B;  4JW1 A;  4YT8 A;  1HW2 A;  3UNG C;  3FOP A;  1OR3 A;  2CW0 F;  2OJQ A;  2P7V A;  2IM8 A;  3CQZ A;  2XM4 A;  3M4C A;  3N2Z B;  3NYM A;  3RFY A;  5AC5 A;  5HV9 A;  2R03 A;  1Z7Q c;  4CJG A;  2CYD A;  1YA9 A;  4JTA B;  3V5X A;  1JOG A;  3ECS A;  4WJ0 A;  1CPR A;  1QLE C;  2L6G A;  1YAR O;  2Q00 A;  3N0T A;  4FWV A;  4L6R A;  1TKN A;  3DKA A;  1ZW2 A;  4R32 A;  2EPO A;  2J0W A;  3TJ6 A;  4N06 A;  1SZI A;  2EIN C;  3DM5 A;  1RKE B;  1PCX A;  3NKE A;  2OG2 A;  3V5Y A;  4C3B A;  2OJE D;  1EKY A;  1H6G A;  4WAB A;  3EQL F;  3U8V A;  2C03 A;  1LI7 A;  1BDJ B;  2J9W A;  1G8X A;  2P1A A;  2XL4 A;  3EGX B;  4HE8 D;  4J30 B;  2KQ9 A;  2KK1 A;  5BQH A;  4UDV A;  3Q7L A;  3K33 A;  3V7O A;  2EIL C;  4A4A A;  4G0H A;  3AG2 C;  3AQC A;  2P6V A;  3FXH A;  2OKU A;  3AJM A;  1CGM E;  3FHD A;  2VB6 A;  3ABL C;  2PBE A;  3T9O A;  1A41 A;  3S28 A;  4Q7C A;  2PX0 A;  1LVK A;  1GM5 A;  4XWJ A;  1WN0 A;  1I4Z A;  1ORJ A;  2QTV A;  3ZC4 A;  3ZTM A;  4MTF A;  3ZSU A;  4J7Y A;  1Y6D A;  4IB4 A;  3QTH A;  5E3C A;  4I44 A;  1NU7 D;  1FAP B;  4ER9 A;  1PD1 A;  3JRT A;  4O6Y A;  2MHR A;  4DRI B;  5HSW A;  3B0U X;  3GM1 A;  2R7V A;  1D1B A;  1M6T A;  1Y4C A;  2LIG A;  5EGY A;  3W4Y A;  1JPN A;  3LJB A;  3DZA A;  3NYL A;  1ZHX A;  4OIN F;  3H65 A;  3ZVR A;  3AG1 C;  2ICW G;  3KPH A;  1OR2 A;  1E2X A;  4OIQ F;  2EPK X;  4PAC A;  1Q0M A;  3ABM C;  4Z9I A;  2R7O A;  2FFH A;  2LSE A;  3JCU Q;  3U9J A;  4PFP A;  1Q0G A;  4CS9 A;  3LNR A;  5A6B A;  2X51 A;  4EBB A;  4CIH A;  1NZE A;  4LDQ A;  4NTA A;  3LAY A;  4YL3 A;  1M2V A;  4DOZ A;  1M2O A;  2AU5 A;  2ZXR A;  2DB4 A;  4NY3 A;  1Z63 A;  5B3S C;  4JEB A;  4IRU A;  3G50 A;  3I4U A;  4MW3 A;  4CIP A;  5CI8 A;  4EIY A;  1WTY A;  2ZXW C;  3C62 A;  3WG7 C;  3SXY A;  2WZF A;  4IAQ A;  3S84 A;  4DXW A;  2CCY A;  2PNO A;  5D91 A;  3IHU A;  5T3T A;  3ZTZ A;  3PDM P;  3NMI A;  1M56 C;  3M79 A;  3Q7G A;  1FTS A;  1TWA A;  2YLI A;  1V55 C;  2Y69 C;  1Q0D A;  3FVY A;  2UUH A;  3ZG1 A;  2YL0 A;  2EPL X;  1AVO B;  3B0P A;  4LDR A;  4U5H A;  4E0H A;  2QE9 A;  4C3D A;  2YHS A;  1J8M F;  1OKK A;  4K1O A;  5L3Q A;  2J9V A;  3KKB A;  3KMI A;  3RF3 A;  3BEH A;  3CAX A;  4YWQ A;  2CDQ A;  1XZP A;  4PJJ A;  2HKV A;  3WOD F;  3DWW A;  2GAQ A;  2VC9 A;  5A69 A;  2YL1 A;  3KL4 A;  3BRJ A;  2UUI A;  4JUR I;  1XWJ A;  4P6I C;  3VM6 A;  2M64 A;  3C8G D;  1D0Z A;  1MMN A;  1HY5 A;  5DS4 A;  3NMJ A;  4LLC A;  1JAF A;  2X0C A;  3RW0 A;  4Q4Z F;  2D5R B;  3TJ5 A;  4G7O F;  3H2U A;  3LEV A;  2XS1 A;  2AP3 A;  2XS8 A;  1SF8 A;  1OCZ C;  3S9O A;  1HE1 A;  3G4Z A;  1A0B A;  3WHN A;  2HSB A;  3GOD A;  3CEX A;  1S7Z A;  256B A;  3C63 A;  4Z9J A;  2XRH A;  4AX2 A;  1OQC A;  1RMV A;  3OWT A;  1KNY A;  1TWG A;  3FOO A;  1NSG B;  4JIO A;  1LPE A;  4OD5 A;  4X0R A;  4XPY A;  5BUO A;  1PD0 A;  1S05 A;  2J8W A;  3RYL A;  3TQO A;  5K0I A;  3IQ6 A;  4IWB A;  1RJ9 B;  5JS5 A;  2BC5 A;  1KTM A;  4I1O B;  1LI5 A;  2XXA B;  1ZHT A;  3I5P A;  2V26 A;  2VCC A;  5DS6 A;  2Y39 A;  2XL8 A;  3QMK A;  2WB7 A;  3EZH A;  4MW8 A;  3MYF A;  2GFH A;  3H2V A;  2ZXO A;  1IZM A;  5KYU B;  3UGP A;  3GAN A;  3DI5 A;  2W9Y A;  3SZR A;  4EBK A;  5BQI A;  5F5F A;  3E9V A;  2NUT B;  4J7T A;  1LIH A;  4CS8 C;  4K0D A;  4A2N B;  2YZS A;  2XLO A;  5DVW A;  3V5Z A;  2OCC C;  3L34 A;  1ZHY A;  2XL6 A;  3LEO A;  2KW3 C;  3NMK A;  5B3I A;  2OU6 A;  3DM9 B;  2LFF A;  2R9R B;  4MVS A;  2J46 A;  2M4E A;  2Y3B A;  4CJO A;  3QVY A;  4BJ5 A;  2J7P A;  2QNL A;  5B1A C;  4EBJ A;  3T6J A;  3ASN C;  4XEV A;  3LS1 A;  1HMO A;  4J32 B;  4JVS A;  3LLK A;  3FMS A;  3LNM B;  1BR4 A;  3HNJ A;  4MTG A;  4ULW A;  2Y3G A;  5A6K A;  4XLP F;  4E7S A;  3S90 A;  2FGY A;  1A7V A;  1TWH A;  5DLJ A;  1YAU O;  1IW7 F;  2HSQ A;  2L6F A;  5JLI A;  1T01 A;  5T3W A;  1E83 A;  3LUT B;  2WL8 A;  1ORS C;  1JR8 A;  4QI0 A;  2I8B A;  4QI2 A;  5F28 E;  4JCZ A;  2A1D D;  4PJN A;  5AC4 A;  3TOL A;  3DMD A;  1BR2 A;  2W4M A;  1QKR A;  2AVK A;  2R02 A;  3CZ6 A;  1C02 A;  5JUA A;  1VTM P;  2R7X A;  1BBH A;  1A7D A;  3K1H A;  4O7G A;  1VLS A;  3SXK A;  2E87 A;  2CNW D;  4MVQ A;  1FFT C;  4EUK B;  4H54 A;  1D0Y A;  4WGY A;  3C7J A;  2H8A A;  1VYI A;  2RSE B;  4B6I A;  1I4Y A;  2J9B A;  2W4B A;  3HLZ A;  3K7D A;  3OA1 A;  4CSA A;  4YK5 A;  1DOV A;  2DYR C;  4BJT A;  2EPM X;  3QW1 A;  1ZHW A;  2H7V C;  3O10 A;  3TK0 A;  3F47 A;  3U8P A;  2R7T A;  4ZLC A;  5L3V A;  1C03 A;  3PCV A;  1Q0K A;  1F1M A;  1UFB A;  4AK9 A;  2AWC A;  5COM A;  3O6X A;  1ZU4 A;  1HW1 A;  2WVO A;  3NKD A;  3JZ0 A;  4CS7 A;  1LS4 A;  1YA7 O;  4U5E E;  1U0B B;  2EIJ C;  3IEE A;  1OW6 A;  1RKC A;  1APC A;  1WGW A;  4BJ6 A;  1Z3I X;  2DI3 A;  4U5D E;  5FZT A;  4XLN F;  2Q9A A;  1YLM A;  3S29 A;  3UGO A;  3JSE O;  3RVZ A;  2XLV A;  3U5S A;  3EZI A;  3NG1 A;  3X2Q C;  5DS5 A;  2H7B A;  1TR2 A;  2R7S A;  3SYN A;  5L0I A;  1HE9 A;  2KYH A;  4F4B A;  4JEA A;  1TFK B;  3R7C A;  2HZ8 A;  2RD9 A;  2ZPA A;  4C3E A;  1ZZP A;  3GM3 A;  1C17 M;  3K1I C;  1JRA A;  3L8I A;  2YL7 A;  3AGT A;  3C8G B;  4KNW A;  5TJ5 E;  1Q0F A;  3POV A;  2PF4 E;  1CGN A;  3W2V A;  1NLX A;  4M63 A;  1OCC C;  2XXA A;  3ABK C;  4JZA A;  4N4W A;  2KJG A;  1FMV A;  2A69 F;  4BEM J;  5AGF A;  1H7I A;  3DJU B;  3RVY A;  2AWY A;  3K66 A;  2V3C C;  5KYU A;  4NTF A;  4BG0 A;  1RXQ A;  1WOL A;  2MYS A;  4U5F E;  2HUJ A;  4WGZ A;  2JPU A;  2NUT A;  1H9G A;  3EG9 A;  4G7H F;  1I5N A;  1MQV A;  4MVR A;  4EKW A;  1QQ3 A;  4DVZ A;  5T1D B;  4C7O B;  1XZQ A;  4PJL A;  2NUP A;  3FDQ A;  1KU2 A;  1NFO A;  2OOC A;  3RH3 A;  1D1C A;  3GEI A;  3UMI A;  3WAQ A;  2C04 A;  2GDC A;  5DQT A;  2WZL A;  1SYQ A;  3GWN A;  4Z9H A;  3G4X A;  2LQG A;  5EHH A;  1M57 C;  1ZU5 A;  2QUP A;  3MLG A;  4GEH A;  4PK4 A;  3OEO A;  4ANJ A;  2L7A A;  1GQA A;  1BR1 A;  1RKE A;  2NSF A;  3B29 A;  3HNI A;  2IYL D;  3US6 A;  2PX3 A;  3X1O A;  3RIP A;  1D1A A;  2A0U A;  2CGE A;  5EK0 A;  4W8P A;  1EQ1 A;  1GS9 A;  3I5Q A;  2NG1 A;  3EGX A;  3W8I A;  4DRH B;  5KYY B;  3JT1 A;  3A9C A;  2W45 A;  1FFH A;  2HV7 A;  1MND A;  5KYX B;  4IAO A;  1TFO B;  1BZ4 A;  2B0H A;  2IXN A;  3M4B A;  4YL0 A;  5E3A A;  5CIV A;  3F46 A;  1OCR C;  3EFO B;  1K04 A;  2YEV A;  5IY5 C;  1NU9 C;  4EWC A;  3QZC A;  4AL1 A;  2GA0 A;  3U3F A;  4AE4 B;  1O5H A;  4RBN A;  5CI9 A;  1VOM A;  2ASR A;  4O6N A;  4NC3 A;  2IBF A;  2TMV P;  4HFK B;  2HS5 A;  1J8Y F;  2D4U A;  3EHM A;  3JYH A;  1O3U A;  4K7B A;  4I3M A;  4MVO A;  4YL1 A;  4NCQ A;  4DBQ A;  1VMA A;  1UG7 A;  4IJJ A;  1VLT A;  2A6E F;  4BJ6 C;  1CPQ A;  4LLE A;  3GOR A;  4CS9 C;  2DYS C;  4XEF A;  2G3V A;  3UMH A;  2A6H F;  1K40 A;  2VCB A;  3L0I A;  3GWL A;  5KYN A;  3N24 A;  3UR3 C;  5JRA A;  4KI2 A;  5A6B D;  1HMD A;  5BQG A;  3DAG A;  1YYJ A;  4RD9 A;  3SP1 A;  2BL2 A;  2YWA A;  1O87 A;  1MMA A;  2WZG A;  1FR0 A;  2QLA A;  5GPG B;  2J9U A;  3JRM O;  4KNV A;  1E84 A;  3RQF A;  2LK4 A;  3DXJ F;  3IQC A;  4BJ1 A;  2XLW A;  3EH2 A;  3S27 A;  5A6J A;  1H9T A;  3ZQY A;  1LE2 A;  1L7C A;  2H7O A;  3EJN A;  5COG A;  3LES A;  2EIK C;  3EGD B;  4BPM A;  2Q9C A;  3DE9 A;  3RKO F;  2YKZ A;  3AOU A;  3E70 C;  1OXK A;  5COF A;  1Z23 A;  3Q6M A;  3C8G A;  3EPV A;  2L6H A;  2OQM A;  4FES A;  4PFO A;  4G7Z F;  2L81 A;  4MS2 A;  2YRF A;  4XPX A;  3IQT A;  2R7W A;  2B0J A;  3EH1 A;  4JTD B;  4IAR A;  4OD4 A;  1V74 B;  2NPU A;  4JRZ A;  1YJG A;  4JCH A;  5FCL A;  5E2Q A;  1RCP A;  3U9M A;  1OKK D;  1SMY F;  4KBL A;  1QZX A;  2KC3 A;  4OIR F;  3RQG A;  4N6C A;  4YJW A;  3SXZ A;  3U0C A;  2L9J A;  2PFD A;  1ZW3 A;  2HMZ A;  3IPM O;  5KYW B;  3M15 A;  1WWP A;  1YVI A;  4U9D A;  2YVK A;  4YN0 B;  5E33 A;  3UMK A;  2DGJ A;  4C7O A;  3KH2 A;  5L0G A;  1K05 A;  3ATP A;  4E0I A;  4ULV A;  4W8K A;  1D0X A;  2P61 A;  2WVQ A;  4GQH A;  4CDY A;  4O79 A;  4ZLD A;  2Q9B A;  2PP4 A;  1R4T A;  3HNL A;  4MVM A;  4DBR A;  1LM3 B;  1MNE A;  1QSP A;  1V4A A;  2WVN A;  4QDL A;  1Z5Z A;  1AEP A;  1YDI A;  4MVZ A;  2LCH A;  2XSE A;  1WAT A;  2YQY A;  3HJC A;  4I1M A;  5JSL A;  3SXM A;  2HFI A;  4CX9 A;  4JTC B;  3AGU A;  4GYT A;  1YZA A;  3AQB A;  4IGG A;  4U9E A;  3T6B A;  3PMR A;  4P9T A;  4NQF A;  4E7Z A;  2JX0 A;  3T4R A;  1ZHZ A;  1JPJ A;  3W8H A;  4MVU A;  1LKX A;  3DE8 A;  4G78 A;  3K6B A;  5KYY A;  1OXB A;  3JYY A;  1T6Q A;  5DQZ A;  5JT4 A;  3B9Q A;  4D4X A;  1E86 A;  2Q3T A;  4CS8 A;  3ASO C;  1ZYR F;  5KYX A;  5L0F A;  1ZVZ A;  1RJ9 A;  2LFD A;  2R7Q A;  2O9X A;  3GEH A;  3EFO A;  2ETS A;  3JTL O;  3LLI A;  4LAC B;  1VK5 A;  4DRJ B;  2XLD A;  3R2P A;  3TD7 A;  4DJ9 A;  4AL0 A;  2VAS A;  2BE5 F;  3DJN B;  1FMW A;  4NTB A;  1U6H A;  3Q6N A;  3QVZ A;  4AE4 A;  1GGQ A;  5L0J A;  3KYJ A;  3AG4 C;  3JSZ A;  1B68 A;  1PV3 A;  3SEO A;  1SR2 A;  4XEK A;  1ORY A;  2XLM A;  4N6H A;  1LS1 A;  3U2L A;  4CBE A;  2R7U A;  3CSK A;  2Z15 A;  2A0B A;  4BJ5 C;  4H4K C;  2XLE A;  1L3P A;  4MTO A;  1AUE A;  4CDA A;  1FNT c;  1ST6 A;  4JKV A;  1OW8 A;  1R5I D;  1T9K A;  4U5B E;  5A6A A;  2J7P D;  2HV6 A;  4PR9 A;  1WAS A;  1JMW A;  2LP4 A;  3FAP B;  1OW7 A;  1N1C A;  2CNW A;  2EPN A;  1G4W R;  2Y3H A;  3FAJ A;  3GEE A;  4LDK A;  1YYX A;  3U3B A;  4CDV A;  1MMD A;  3W2W A;  1G5Z A;  3HTK C;  3DD7 A;  1T5O A;  4HFF B;  4FX5 A;  4LER A;  2P0N A;  4U5G A;  3C18 A;  1VYK A;  2OEV A;  2YLD A;  1A7E A;  3MBG A;  5L0H A;  3ZWI A;  3A11 A;  1LE4 A;  1EA8 A;  1V54 C;  1QPU A;  2HMQ A;  2XLH A;  2J0X A;  3HKK A;  3NRH A;  2VCA A;  4HEA J;  3VYW A;  3TUL A;  4EHP A;  3B0V C;  1Z6A A;  4JE9 A;  1DOW A;  1NG1 A;  1OCO C;  3L8J A;  3EGD A;  4U5C E;  3VRC A;  1VB5 A;  5B1B C;  3O55 A;  3TOM A;  2F22 A;  2NSG A;  4CSA C;  2R05 A;  4D4N A;  2I15 A;  2HJ3 A;  1NBB A;  2R25 A;  2ZXP A;  1QVX A;  2IOQ A;  4P9F A;  3J06 A;  4Q5S F;  4OIP F;  4JC7 A;  3ZIB A;  4KC9 A;  4YT2 A;  2IXP A;  3DAF A;  4ONS A;  2Q7R A;  2R7R A;  5JP7 A;  3NYJ A;  3GM2 A;  4YT4 A;  4O6M A;  3U2M A;  2OEX A;  1M2V B;  2Q4F A;  4YT5 A;  4PJM A;  5JVE A;  1E85 A;  3MYI A;  3HNK A;  3ITF A;  3MX3 A;  2HJM A;  4E17 A;  5D92 A;  4MQ9 F;  2FAP B;  4XQ1 A;  1NFN A;  2GWW A;  2ZD9 A; 
#chains in the Genus database with same CATH homology
 2MWQ A;  2A68 F;  3S0X A;  2QY9 A;  5KYW A;  2VH3 A;  2EIM C;  2G3K A;  1MMG A;  3O39 A;  5F5H A;  1W2W A;  4RDA A;  3NDB B;  2IXM A;  2IXO A;  2J45 A;  2KNH A;  4XTK A;  4OIO F;  2Y3D A;  3SNH A;  4JJF A;  3M1C B;  3VAY A;  4JJG A;  2KGO A;  3LS0 A;  1TWC A;  2JD3 A;  4BEJ A;  3AG3 C;  4MND A;  3EG9 B;  3PHF 2;  2G62 A;  3EHN A;  2NUP B;  4JW1 A;  4YT8 A;  3UNG C;  3CQZ A;  2CW0 F;  2P7V A;  3N2Z B;  3NYM A;  3RFY A;  3ECS A;  4WJ0 A;  1QLE C;  3N0T A;  4FWV A;  4OIN F;  1TKN A;  4F4B A;  2J0W A;  4N06 A;  1SZI A;  2EIN C;  3DM5 A;  3NKE A;  1PCX A;  4C3B A;  2OG2 A;  3EQL F;  2C03 A;  4J30 B;  2J9W A;  4HE8 D;  1G8X A;  2XL4 A;  3EGX B;  2KQ9 A;  3Q7L A;  3K33 A;  3V7O A;  2EIL C;  4G0H A;  3AG2 C;  3AQC A;  2P6V A;  3FHD A;  2VB6 A;  3ABL C;  3S28 A;  4Q7C A;  2PX0 A;  1LVK A;  4XWJ A;  2QTV A;  3ZC4 A;  3ZSU A;  5E3C A;  4I44 A;  1NU7 D;  1PD1 A;  3JRT A;  4O6Y A;  5HSW A;  3B0U X;  2R7V A;  1D1B A;  5EGY A;  1JPN A;  3LJB A;  3DZA A;  3NYL A;  1ZHX A;  3H65 A;  3AG1 C;  4OIQ F;  3ABM C;  2FFH A;  2LSE A;  3JCU Q;  4PFP A;  4CS9 A;  3LNR A;  2X51 A;  4EBB A;  4CIH A;  1NZE A;  3LAY A;  1M2V A;  4DOZ A;  1M2O A;  2ZXR A;  4NY3 A;  1Z63 A;  5B3S C;  4IRU A;  3I4U A;  5CI8 A;  2ZXW C;  3WG7 C;  2WZF A;  5D91 A;  5T3T A;  1M56 C;  3Q7G A;  1FTS A;  1TWA A;  1V55 C;  2Y69 C;  3FVY A;  3ZG1 A;  3B0P A;  4U5H A;  4C3D A;  2YHS A;  1J8M F;  1OKK A;  5L3Q A;  2J9V A;  3KKB A;  3KMI A;  4YWQ A;  2CDQ A;  4PJJ A;  3WOD F;  3KL4 A;  4JUR I;  4P6I C;  1D0Z A;  1MMN A;  5DS4 A;  4G7O F;  4LLC A;  4Q4Z F;  2D5R B;  3LEV A;  1SF8 A;  1OCZ C;  3GOD A;  1S7Z A;  4AX2 A;  2XRH A;  3OWT A;  1TWG A;  4OD5 A;  4X0R A;  5BUO A;  1PD0 A;  3RYL A;  4IWB A;  1RJ9 B;  4I1O B;  2XXA B;  1ZHT A;  3I5P A;  2V26 A;  5DS6 A;  2Y39 A;  3QMK A;  2WB7 A;  3EZH A;  2GFH A;  2ZXO A;  1IZM A;  5KYU B;  3UGP A;  3GAN A;  3SZR A;  2W9Y A;  3E9V A;  2NUT B;  4CS8 C;  4K0D A;  4A2N B;  2YZS A;  5DVW A;  2OCC C;  3L34 A;  1ZHY A;  2KW3 C;  3DM9 B;  2J46 A;  2M4E A;  2Y3B A;  4BJ5 A;  2J7P A;  5B1A C;  3T6J A;  3ASN C;  3LS1 A;  4JVS A;  4J32 B;  3LLK A;  4ULW A;  1BR4 A;  4XLP F;  2Y3G A;  4E7S A;  2FGY A;  1TWH A;  5DLJ A;  1IW7 F;  5T3W A;  2WL8 A;  4QI0 A;  2I8B A;  4QI2 A;  4PJN A;  2A1D D;  3DMD A;  1BR2 A;  2W4M A;  3CZ6 A;  2R7X A;  3K1H A;  4O7G A;  2E87 A;  2CNW D;  1FFT C;  1D0Y A;  4B6I A;  1VYI A;  2W4B A;  3HLZ A;  3K7D A;  3OA1 A;  4CSA A;  4BJT A;  2DYR C;  1ZHW A;  2H7V C;  3F47 A;  2R7T A;  4ZLC A;  5L3V A;  4AK9 A;  3O6X A;  1ZU4 A;  2WVO A;  3NKD A;  4CS7 A;  4U5E E;  2EIJ C;  3IEE A;  1WGW A;  4BJ6 A;  1Z3I X;  4U5D E;  4XLN F;  2Q9A A;  3S29 A;  3UGO A;  5DS5 A;  3EZI A;  3NG1 A;  3X2Q C;  2H7B A;  1TR2 A;  2R7S A;  3SYN A;  2ZPA A;  4C3E A;  3K1I C;  4KNW A;  3POV A;  2PF4 E;  3W2V A;  4M63 A;  1OCC C;  2XXA A;  3ABK C;  4JZA A;  2KJG A;  1FMV A;  2A69 F;  3DJU B;  3K66 A;  2V3C C;  5KYU A;  4BG0 A;  2MYS A;  4U5F E;  2NUT A;  4G7H F;  3EG9 A;  4DVZ A;  5T1D B;  4C7O B;  4PJL A;  2NUP A;  3FDQ A;  1KU2 A;  3RH3 A;  1D1C A;  3UMI A;  2C04 A;  5DQT A;  2WZL A;  5EHH A;  1M57 C;  1ZU5 A;  3MLG A;  4GEH A;  4PK4 A;  3OEO A;  4ANJ A;  1BR1 A;  2IYL D;  2PX3 A;  3X1O A;  3RIP A;  1D1A A;  2CGE A;  3I5Q A;  2NG1 A;  3EGX A;  3W8I A;  5KYY B;  3JT1 A;  2W45 A;  1FFH A;  2HV7 A;  1MND A;  5KYX B;  4IAO A;  5F5F A;  2IXN A;  5E3A A;  3F46 A;  1OCR C;  3EFO B;  2YEV A;  5IY5 C;  1NU9 C;  4EWC A;  3QZC A;  4AE4 B;  1O5H A;  4RBN A;  5CI9 A;  1VOM A;  4O6N A;  4HFK B;  1J8Y F;  3JYH A;  3EHM A;  4K7B A;  4I3M A;  4DBQ A;  1VMA A;  4IJJ A;  2A6E F;  4BJ6 C;  4LLE A;  4CS9 C;  2DYS C;  2G3V A;  3UMH A;  2A6H F;  3L0I A;  5KYN A;  3N24 A;  3UR3 C;  4KI2 A;  3DAG A;  4RD9 A;  3SP1 A;  1O87 A;  1MMA A;  2WZG A;  2J9U A;  4KNV A;  3DXJ F;  4BJ1 A;  3S27 A;  3EH2 A;  3EJN A;  2H7O A;  3LES A;  2EIK C;  3EGD B;  2Q9C A;  3RKO F;  3E70 C;  1Z23 A;  3Q6M A;  3EPV A;  4FES A;  4PFO A;  4G7Z F;  2L81 A;  2B0J A;  3EH1 A;  4OD4 A;  4JCH A;  5FCL A;  5E2Q A;  1OKK D;  1SMY F;  4KBL A;  1QZX A;  4OIR F;  4YJW A;  2L9J A;  2PFD A;  5KYW B;  3UMK A;  4YN0 B;  5E33 A;  2DGJ A;  4C7O A;  3KH2 A;  4W8K A;  1D0X A;  2WVQ A;  4ZLD A;  4O79 A;  2Q9B A;  2PP4 A;  4DBR A;  1MNE A;  2WVN A;  4QDL A;  1Z5Z A;  2XSE A;  4I1M A;  3HJC A;  4GYT A;  3AQB A;  3T6B A;  3PMR A;  4E7Z A;  3T4R A;  1ZHZ A;  1JPJ A;  3W8H A;  1LKX A;  3K6B A;  5KYY A;  5DQZ A;  3B9Q A;  2Q3T A;  4CS8 A;  3ASO C;  1ZYR F;  5KYX A;  3LLI A;  1RJ9 A;  2R7Q A;  2O9X A;  4LAC B;  3EFO A;  1VK5 A;  3TD7 A;  2VAS A;  2BE5 F;  3DJN B;  1FMW A;  3Q6N A;  4AE4 A;  3AG4 C;  3JSZ A;  3SEO A;  1LS1 A;  4CBE A;  2R7U A;  3CSK A;  2Z15 A;  4BJ5 C;  4H4K C;  1ST6 A;  4U5B E;  2J7P D;  2HV6 A;  3FAJ A;  3ZVR A;  2Y3H A;  1N1C A;  2CNW A;  2R7W A;  1MMD A;  3W2W A;  3HTK C;  3DD7 A;  4HFF B;  4FX5 A;  4LER A;  4U5G A;  1VYK A;  1V54 C;  4HEA J;  3NRH A;  4DVY P;  2J0X A;  3VYW A;  3B0V C;  1Z6A A;  1NG1 A;  1OCO C;  4U5C E;  3EGD A;  5B1B C;  4CSA C;  2ZXP A;  4Q5S F;  2IOQ A;  4OIP F;  3ZIB A;  4KC9 A;  4YT2 A;  2IXP A;  3DAF A;  2R7R A;  3NYJ A;  4YT4 A;  4O6M A;  1M2V B;  4YT5 A;  4PJM A;  3ITF A;  3MX3 A;  5D92 A;  4MQ9 F;  2R7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...