4YWQA

Crystal structure of the roq domain of human roquin-1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
152
Chain Sequence
QQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Roquin-1
publication title Crystal structure of the ROQ domain of human Roquin-1
rcsb
source organism Homo sapiens
total genus 50
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ywqA00
4QI2A 5F5HA 5F5FA 3X1OA 4ZLDA 4QI0A 4YWQA 4ULWA 4ZLCA
chains in the Genus database with same CATH superfamily
3IHUA 1OQCA 4YL1A 4CS8A 1TWHA 2R7SA 2NSGA 4YT5A 5EHHA 2BC5A 3JTLO 1EI7A 3FXHA 1T01A 3EZHA 3C8ZA 2J7PD 3ZDLA 1S05A 2H7BA 3ITFA 4MQ9F 1JR8A 1PV3A 1R4TA 2XRHA 2R7RA 3OWTA 2KW3C 3HTKC 1QLEC 2EILC 3QW0A 1CPRA 4B6IA 1FR0A 3K1IC 4MVZA 3IQ6A 3PMRA 3RQEA 3K33A 1K04A 4EBKA 1APCA 4LDRA 1OW7A 3MBGA 5BQHA 4NTBA 1VTMP 3GEHA 1Y6DA 3K6BA 1B68A 3DAGA 4WGYA 1ZHYA 3C63A 3VYWA 3IQ5A 4MTGA 1OXKA 2R7TA 2XLHA 1JMWA 1GGQA 1U0BB 2IXNA 2EIJC 4IB4A 3AOUA 4K0DA 3CAXA 5COGA 3M79A 2KC3A 4N06A 2L6FA 4HE8D 4I44A 3U2MA 3MYFA 4GEHA 3DD7A 4JZAA 4ULVA 4N6HA 1YARO 2H7VC 4PJNA 4QDLA 5E33A 4Z9JA 3RVZA 4CIPA 4DXWA 4A2NB 2CCYA 2I8BA 1U89A 1TR2A 2UUHA 2YHSA 2YWAA 3DI5A 2RSEB 2R7XA 3BEHA 5CIVA 4OIPF 1FFHA 5L0CA 4IGGA 3H65A 3GODA 1SR2A 3WHNA 2B0HA 1L7CA 3FDQA 1G5ZA 4D4XA 2YLDA 1VYIA 3V5ZA 3C8GA 3ATPA 3GM2A 4P9FA 1K40A 3RQFA 3SXKA 1MQVA 2KYHA 4XQ1A 1H9GA 1ZHXA 1IZMA 3Q7LA 4FESA 4ZLCA 5KYXB 4JW1A 3EQLF 4P9TA 1DOVA 5EK0A 4NTAA 1YYJA 3U2LA 4BJ6A 3TD7A 1ZYRF 3AGUA 2J8WA 5L0HA 2XL4A 5T1DB 4MNDA 2YL0A 3S0XA 2J46A 4W8PA 3F47A 2CDQA 4N6CA 3JSEO 3JRMO 4CJOA 3VF0A 1LS1A 3EPVA 5DS4A 3SXYA 4ULWA 2VCCA 1A0BA 1AEPA 1D1BA 1HE9A 1QQ3A 2X51A 3NMIA 4K7BA 1VOMA 5T3TA 4CS9C 2J9VA 5KYXA 1T9KA 4GQHA 2HS5A 4JRZA 3SP1A 2IXMA 2G62A 3U8PA 1QSPA 1ST6A 3HLZA 3UMHA 1EKYA 1M56C 3AG4C 3HNIA 2J45A 2L7AA 3C8GB 4DVYP 2C03A 3LNRA 4MTFA 1OCCC 4CIHA 2OEXA 5L0IA 1BDJB 3UNGC 3C7JA 3JT1A 3K1HA 3JZ0A 1XWJA 2FFHA 2EPMX 3LEOA 3G50A 3AG3C 4WJ0A 4OINF 2UUIA 2XXAA 3B71A 1Z3IX 2P61A 4A4AA 4YN0B 3CEXA 1LKXA 1I4YA 3NYJA 1TQGA 4U5HA 3EFOA 2Q9BA 3K1IA 4AK9A 4Q5SF 1ORJA 1M6TA 1SYQA 3FAJA 3GEIA 2QUPA 5KYUA 3U9MA 3RFYA 4W8KA 5DS6A 5JLIA 1OCOC 3DJNB 4J30B 4X0RA 4BG0A 3HNJA 2A6HF 3LJBA 3W4YA 1YYXA 4YJWA 3H2VA 4C3BA 2A0BA 1FTSA 2CNWD 2VH3A 3LAYA 4XLNF 2A1DD 2WZLA 3JRTA 2ZXWC 2KSFA 3H2UA 3ZQVA 4JCZA 5L0FA 1LM3B 2ZXRA 3NYLA 3W2VA 1LE4A 5DQZA 3S90A 3RIPA 3NMJA 1LPEA 1MMAA 4C3DA 2W9YA 1WATA 1ZU5A 2OJED 4U9DA 3M4BA 1QVXA 4CX9A 2WZFA 2XXAB 2J0XA 3JSZA 4WABA 4GYTA 2W4MA 1E83A 3UR3C 5JVEA 5JSLA 2XS8A 4I1MA 5K0IA 2WVOA 3B29A 1HY5A 1HMOA 3EFOB 3M15A 3MYIA 1HE1A 1QZXA 3RYLA 5KYUB 4XPXA 2L6GA 4XEFA 2HV6A 2FGYA 1A41A 1MNEA 4PJJA 1BR1A 2D5RB 2L81A 2XLOA 4WGZA 4XPYA 3ZIBA 1T6UA 2RD9A 1JPNA 4PK4A 3TJ6A 4AE4A 4FAPB 5L3VA 2W45A 2DI3A 4DRHB 1C17M 3EH2A 2Z15A 3GORA 2ZXOA 4RD9A 3CZ6A 3HKKA 3O10A 5T3WA 3NYMA 4MVOA 2O9XA 4ONSA 1LE2A 1TWCA 2J9BA 2YRFA 3LS0A 3NRHA 3O6XA 1C02A 5D91A 5AGFA 5KYYB 1V74B 2Y3HA 1QPUA 256BA 1QKRA 2EPKX 1GQAA 3HNLA 1T6IA 4L6RA 3RVYA 3T4RA 4O7GA 3KL4A 1TFKB 2QLAA 4MVRA 3KPHA 5FCLA 4CS9A 3DJUB 2EPNA 5KYNA 1GM5A 1W2WA 1A7VA 1ZW3A 2G3KA 2ZPAA 3V7OA 4AE4B 5JUAA 3U0CA 1F1MA 3ABKC 3WODF 1FMWA 1D0ZA 3F46A 4U5FE 1T5OA 1ZHTA 3HJCA 3J06A 2FAPB 2WZGA 4DRJB 3QZCA 1WN0A 4XWJA 1NFNA 4BPMA 2CGEA 2JPUA 1MNDA 2DYSC 4CS7A 2TMVP 1Q0DA 1H7IA 1NSGB 1WGWA 3EGDA 3L8JA 1ZHZA 4XLPF 1SF8A 2XSEA 4JKVA 3RKOF 1MMNA 3KYIA 1A7EA 2PNOA 3TOMA 3EGXA 3GEEA 3FVYA 2NSFA 4D4NA 2LQGA 1YDIA 2V26A 5HSWA 1FMVA 1RKEA 2ASRA 3E9VA 2GWWA 3ZC4A 3ASOC 4MW8A 5JRAA 4U5DE 5DS5A 4YT8A 1EQ1A 1M2VA 1OKKA 2H8AA 2IXOA 3GM1A 4DBRA 4EWCA 3EZIA 3WAQA 4J7YA 1NU7D 1LI5A 1V54C 1YLMA 2Y69C 2ZXPA 4XEKA 3VAYA 3C18A 5E3CA 1R5ID 2X0CA 2VCBA 4JJGA 2LCHA 2PFDA 1G8XA 2DYRC 4E7ZA 3B0VC 4IARA 3PCVA 1V55C 3ASNC 3EGDB 4CDYA 2KNHA 2GFHA 4AL0A 1VMAA 1M2OA 3AQCA 2L6HA 3LLKA 1OR2A 2WVQA 3B0UX 3I5QA 4LERA 4NQFA 5TJ5E 1CPQA 3EH1A 1TWAA 3EGXB 2NUTA 4KI2A 1O87A 4OIQF 2P0NA 1H6GA 3RH3A 3T6GB 4AX2A 1RKEB 2R7QA 2AWCA 4IRUA 1YAUO 4PJMA 5B1BC 4OIOF 4G7OF 4EKWA 4EIYA 2BL2A 1OXBA 3C8GD 2Q3TA 1KU2A 1M2VB 4QI2A 4O6YA 1YA9A 1HW1A 2R02A 2R05A 2WL8A 4JVSA 4M63A 1VLTA 1LI7A 2QTVA 3QTHA 5B3IA 3AGTA 3EHNA 3FAPB 4JC7A 4LACB 2XLVA 4HFKB 5COFA 3JYYA 2OEVA 3ECSA 2HKVA 2LIGA 3SEOA 3QVYA 5B1AC 3U3BA 4PJLA 2QY9A 1SZIA 3AG2C 4MVMA 4PFPA 1OW6A 4KC9A 1OCRC 2YLIA 4LDQA 1NFOA 3Q6NA 4JEAA 4E0HA 4EBJA 2F22A 5F28E 1XZPA 4JTDB 3QVZA 4U5CE 3T6BA 2NUTB 3EG9A 3X1OA 4EBBA 2KK1A 3SNHA 1U6HA 3RF3A 4E17A 5A6KA 2EPLX 3NDBB 3Q6MA 1ORYA 1RJ9A 1WWPA 3ZG1A 1MMGA 3MX3A 2AVKA 2I15A 5KYWA 1D0YA 3DZAA 1UG7A 2IXPA 3C62A 3UGOA 3U5SA 3IQCA 2YL3A 1O3UA 1WTYA 3M1CB 4O6NA 4PACA 3E70C 2Q9AA 1D1CA 2J9WA 3DM9B 4DJ9A 2G3VA 2NUPA 1K05A 3S84A 3L0IA 3O39A 4H54A 1EA8A 2B0JA 3DM5A 3A11A 4O79A 1E86A 4G78A 2L9JA 3ZSUA 1KTMA 2NPUA 3GANA 4BEJA 1KNYA 1V4AA 2ZD9A 2J9UA 3EG9B 3OEOA 2OOCA 4LLCA 4U5BE 3N2ZB 3TQOA 1N1CA 1MMDA 4YK5A 3UMIA 5JS5A 4LDKA 4DBQA 3R7CA 1RJ9B 1Z6AA 2MYSA 5L3QA 3LS1A 1FNTc 3SYNA 4JTCB 4KNVA 1Z7Qc 5GPGB 2P6VA 3K7DA 3GM3A 4E18A 3S28A 4UDVA 2PBEA 4RBNA 3W8IA 2VB6A 1G4WR 5AC4A 3NMKA 2NUPB 1PD0A 1Q0FA 1YZCA 3KMIA 2XLDA 1YZAA 5E3AA 3VM6A 5DLJA 1Z63A 4DOZA 3LESA 3FMSA 1BZ4A 5E2QA 3T9OA 4YL0A 4Q4ZF 4N4WA 4LLEA 3W2WA 2J7PA 2Y3BA 1FFTC 4JTAB 2QNLA 4EUKB 3VRCA 2R7UA 3LUTB 3MLGA 4ZLDA 2IM8A 2EINC 3DXJF 3NKEA 2R7WA 2LFFA 3L8IA 1PCXA 1C03A 2KQ9A 4U5GA 1I5NA 4PR9A 4BJ5A 1T6QA 4IJJA 3DE9A 3OA1A 1BR4A 2PX0A 2HSBA 4NY3A 2NG1A 5L0JA 3ZTZA 3GWNA 4MTOA 1RCPA 2LD6A 1ZU4A 1PD1A 2HJMA 4BJTA 3DMDA 2P7VA 2VC9A 3U8VA 2XS1A 1Y4CA 2IOQA 1D0XA 5A69A 3GWLA 3KKBA 4CSAA 3AG1C 2YL7A 2Q7RA 3V5XA 3KH2A 4K1OA 3KYJA 2CYDA 3SXZA 4RDAA 2YVKA 2AWYA 1Z5ZA 2AP3A 2V3CC 3N24A 1ORSC 4AL1A 3N0TA 4YWQA 1VB5A 2R7OA 3W8HA 4XEVA 3I5PA 2Y39A 4DVZA 1S7ZA 2CW0F 1AUEA 2OG2A 3RQGA 3QW1A 2J0WA 1OCZC 1GS9A 4OD5A 2P1AA 1NZEA 1XZQA 1FAPB 1CGNA 2AU5A 2H7OA 4Z9HA 1ZVZA 2LFDA 3CSKA 3S29A 4ANJA 2JD3A 5B3SC 2A6EF 4HEAJ 3U3FA 4CDVA 1O5HA 1RKCA 4FX5A 2Y3DA 4MW3A 4O6MA 3B0PA 1NG1A 3EHMA 5F5FA 5D92A 5IY5C 1VK5A 3ABMC 3ABLC 1ZHWA 2HV7A 5COMA 1JOGA 1L3PA 1J8YF 3LLIA 3AJMA 4XPWA 2IBFA 2LK4A 1NU9C 4Z9IA 1H9TA 3FOPA 1Q0GA 3IPMO 4G0HA 4C3EA 1J8MF 1CGME 4NC3A 1OKKD 4BJ5C 2YKZA 5A6JA 3L34A 5L0GA 3PHF2 5F5HA 1OW8A 1SMYF 1DOWA 2EIKC 3S9OA 2WB7A 3G4ZA 4P6IC 4J7TA 4G7ZF 2EIMC 3K66A 3FOOA 4IWBA 3MFNA 4KBLA 2LP4A 4CJGA 3ZVRA 4YL3A 4CDAA 2MWQA 2GAQA 4CS8C 1E2XA 1E84A 2HJ3A 1TKNA 2HMQA 2MHRA 1OR3A 2OQMA 2HSQA 2XLMA 3WG7C 2OKUA 4BEMJ 4G7HF 4CSAC 2BE5F 1WOLA 2HFIA 2VCAA 4Q7CA 1Z23A 3V5YA 4HFFB 3PDMP 3CQZA 3DE8A 2OCCC 1E85A 3JYHA 5FZTA 3EJNA 1YVIA 2GDCA 1TFOB 2KJGA 3AQBA 2R9RB 5DVWA 4CBEA 3FHDA 4JJFA 2XLEA 2D4UA 2R7VA 3S27A 1JPJA 2DGJA 2HUJA 1A7DA 4XTKA 4KNWA 2A0UA 3T6JA 3IEEA 4MVQA 1TWGA 3LNMB 1IW7F 2YZSA 3R2PA 4OIRF 5HV9A 3LEVA 1VLSA 5BQGA 3US6A 2KGOA 4ER9A 2CNWA 2PX3A 4QI0A 1VYKA 5CI8A 3A9CA 1AVOB 3POVA 2HZ8A 4PFOA 1LIHA 2W4BA 1HW2A 4C7OA 3RW0A 3L1MA 2YL1A 3SXMA 2DB4A 1D1AA 1LS4A 1YA7O 1YJGA 2OU6A 5A6AA 2VASA 3I4UA 2ETSA 3DKAA 4BJ1A 3TJ5A 4F4BA 3JCUQ 4YT2A 5AC5A 1WASA 2EPOA 2LSEA 1M57C 2YEVA 4JCHA 1JAFA 2GA0A 4NCQA 2A68F 2XL6A 2OJQA 3DWWA 4MS2A 3SZRA 3ZQYA 4EHPA 4J32B 2Q9CA 3M4CA 5BQIA 5A6BA 4IAQA 5JT4A 4MVSA 2XM4A 5KYWB 3ZTMA 1UFBA 1Q0MA 4FWVA 2YLGA 2YQYA 2IYLD 3BRJA 2ICWG 5BUOA 4NTFA 2A69F 4BJ6C 1BR2A 1CGOA 3B9QA 3G4XA 1RXQA 3NG1A 4E7SA 4I3MA 1NBBA 5L0DA 3U9JA 3TULA 2WVNA 4C7OB 4E0IA 2JX0A 2PP4A 4I1OB 3ZWIA 4R32A 2Q4FA 4IAOA 1I4ZA 5KYYA 2R03A 2HMZA 1ZZPA 2XLWA 3HNKA 4YT4A 4U9EA 2C04A 1BBHA 1HMDA 2E87A 3QMKA 4MVUA 2M4EA 4H4KC 3O55A 5A6BD 4JE9A 1NLXA 3NKDA 4JURI 2R25A 2M64A 4JIOA 1G4US 5JP7A 3TK0A 4OD4A 3Q7GA 3UMKA 3DAFA 1Q0KA 3TOLA 4JEBA 2QE9A 3IQTA 4DRIB 3UGPA 1ZW2A 2PF4E 2XM0A 4U5EE 1LVKA 2Q00A 5DQTA 1JRAA 2XL8A 5CI9A 5EGYA 3X2QC 1RMVA 2Y3GA
chains in the Genus database with same CATH topology
4CS8A 1TWHA 2R7SA 4YT5A 5EHHA 3EZHA 2J7PD 3ITFA 2H7BA 4MQ9F 2R7RA 2XRHA 3OWTA 2KW3C 3HTKC 1QLEC 2EILC 4B6IA 3K1IC 3PMRA 3K33A 3K6BA 3DAGA 3VYWA 1ZHYA 2R7TA 2IXNA 2EIJC 4K0DA 4N06A 4HE8D 4I44A 4GEHA 4JZAA 3DD7A 5E33A 2H7VC 4PJNA 4QDLA 4A2NB 2I8BA 1TR2A 2YHSA 2R7XA 4OIPF 1FFHA 3H65A 3GODA 3FDQA 1VYIA 1ZHXA 1IZMA 3Q7LA 4FESA 4ZLCA 4JW1A 3EQLF 4BJ6A 3TD7A 1ZYRF 2XL4A 5T1DB 4MNDA 3S0XA 2J46A 3F47A 2CDQA 1LS1A 3EPVA 5DS4A 4ULWA 2X51A 4K7BA 1D1BA 5T3TA 1VOMA 4CS9C 2J9VA 5KYXA 3SP1A 2IXMA 2G62A 1ST6A 3HLZA 3UMHA 1M56C 3AG4C 2J45A 4DVYP 2C03A 3LNRA 1OCCC 4CIHA 3UNGC 3JT1A 3K1HA 2FFHA 4OINF 3AG3C 4WJ0A 2XXAA 1Z3IX 4YN0B 1LKXA 3NYJA 4U5HA 3EFOA 2Q9BA 4AK9A 4Q5SF 3FAJA 5KYUA 3RFYA 4W8KA 5DS6A 5KYXB 1OCOC 3DJNB 4J30B 4X0RA 4BG0A 2A6HF 3LJBA 4C3BA 1FTSA 2CNWD 2VH3A 3LAYA 4XLNF 2A1DD 2WZLA 3JRTA 2ZXWC 3NYLA 2ZXRA 3W2VA 5DQZA 3RIPA 1MMAA 4C3DA 2W9YA 1ZU5A 2WZFA 2XXAB 2J0XA 3JSZA 4GYTA 2W4MA 3UR3C 4I1MA 2WVOA 3EFOB 3RYLA 1QZXA 5KYUB 2HV6A 2FGYA 1MNEA 4PJJA 1BR1A 2D5RB 2L81A 3ZIBA 1JPNA 4PK4A 4AE4A 5L3VA 2W45A 3EH2A 2Z15A 2ZXOA 4RD9A 3CZ6A 5T3WA 3NYMA 2O9XA 1TWCA 3LS0A 3NRHA 3O6XA 5D91A 5KYYB 2Y3HA 3T4RA 4O7GA 3KL4A 5FCLA 4CS9A 3DJUB 5KYNA 1W2WA 2G3KA 2ZPAA 3V7OA 4AE4B 3ABKC 3WODF 1FMWA 1D0ZA 3F46A 4U5FE 3HJCA 1ZHTA 2WZGA 3QZCA 4XWJA 2CGEA 1MNDA 2DYSC 4CS7A 1WGWA 3EGDA 1ZHZA 4XLPF 1SF8A 2XSEA 3RKOF 1MMNA 3EGXA 3FVYA 2V26A 5HSWA 1FMVA 3E9VA 3ZC4A 3ASOC 4U5DE 5DS5A 4YT8A 1M2VA 1OKKA 2IXOA 4DBRA 4EWCA 3EZIA 1NU7D 1V54C 2Y69C 2ZXPA 3VAYA 5E3CA 4JJGA 4E7ZA 2PFDA 1G8XA 2DYRC 3B0VC 1V55C 3ASNC 3EGDB 2KNHA 2GFHA 1VMAA 1M2OA 3AQCA 3LLKA 2WVQA 3B0UX 3I5QA 4LERA 3EH1A 1TWAA 3EGXB 2NUTA 4KI2A 1O87A 4OIQF 3RH3A 4AX2A 2R7QA 4IRUA 4PJMA 5B1BC 4OIOF 4G7OF 2Q3TA 1KU2A 1M2VB 4QI2A 4O6YA 2WL8A 4YJWA 4M63A 4JVSA 2QTVA 3EHNA 4LACB 4HFKB 3ECSA 3SEOA 5B1AC 4PJLA 2QY9A 1SZIA 3AG2C 4PFPA 4KC9A 1OCRC 3Q6NA 3T6BA 4U5CE 4EBBA 3X1OA 2NUTB 3EG9A 3SNHA 3NDBB 3Q6MA 1RJ9A 3ZG1A 1MMGA 3MX3A 5KYWA 1D0YA 3DZAA 2IXPA 3UGOA 4O6NA 3M1CB 3E70C 2Q9AA 1D1CA 2J9WA 3DM9B 2G3VA 2NUPA 3L0IA 3O39A 2B0JA 3DM5A 4O79A 2L9JA 3ZSUA 3GANA 4BEJA 3EG9B 2J9UA 3OEOA 4LLCA 4U5BE 3N2ZB 1N1CA 1MMDA 3UMIA 4DBQA 1RJ9B 1Z6AA 2MYSA 5L3QA 3LS1A 3SYNA 4KNVA 2P6VA 3K7DA 3S28A 4RBNA 3W8IA 2VB6A 2NUPB 1PD0A 3KMIA 5DLJA 5E3AA 1Z63A 4DOZA 3LESA 5E2QA 4Q4ZF 4LLEA 3W2WA 2J7PA 2Y3BA 1FFTC 2R7UA 3MLGA 4ZLDA 3DXJF 2EINC 3NKEA 2R7WA 1PCXA 2KQ9A 4U5GA 4BJ5A 4IJJA 3OA1A 1BR4A 2PX0A 4NY3A 2NG1A 1ZU4A 1PD1A 4BJTA 3DMDA 2P7VA 2IOQA 1D0XA 3KKBA 4CSAA 3AG1C 3KH2A 4RDAA 2V3CC 1Z5ZA 3N24A 3N0TA 4YWQA 2R7OA 3W8HA 3I5PA 2Y39A 4DVZA 1S7ZA 2CW0F 2OG2A 2J0WA 1OCZC 4OD5A 1NZEA 2H7OA 3CSKA 3S29A 4ANJA 2JD3A 5B3SC 2A6EF 4HEAJ 1O5HA 4FX5A 2Y3DA 4O6MA 3B0PA 1NG1A 3EHMA 5F5FA 5D92A 5IY5C 1VK5A 3ABMC 3ABLC 1ZHWA 2HV7A 1J8YF 3LLIA 1NU9C 4G0HA 4C3EA 1J8MF 1OKKD 4BJ5C 3L34A 3PHF2 5F5HA 1SMYF 2EIKC 4G7ZF 2WB7A 4P6IC 2EIMC 3K66A 4IWBA 4KBLA 3ZVRA 2MWQA 4CS8C 1TKNA 4G7HF 3WG7C 4CSAC 2BE5F 4Q7CA 1Z23A 4HFFB 3CQZA 2OCCC 3JYHA 3EJNA 2KJGA 3AQBA 5DVWA 4CBEA 3FHDA 4JJFA 2R7VA 3S27A 1JPJA 2DGJA 4XTKA 4KNWA 3T6JA 3IEEA 4OIRF 1TWGA 1IW7F 2YZSA 3LEVA 2KGOA 2CNWA 2PX3A 4QI0A 1VYKA 5CI8A 3POVA 4PFOA 2W4BA 4C7OA 1D1AA 2VASA 3I4UA 4BJ1A 4F4BA 3JCUQ 4YT2A 2LSEA 1M57C 2YEVA 4JCHA 2A68F 3SZRA 4J32B 2Q9CA 5KYWB 4FWVA 2IYLD 5BUOA 2A69F 4BJ6C 1BR2A 3B9QA 3NG1A 4E7SA 4I3MA 2WVNA 4C7OB 2PP4A 4I1OB 4IAOA 5KYYA 4YT4A 2C04A 2E87A 3QMKA 2M4EA 4H4KC 3NKDA 4JURI 4OD4A 3Q7GA 3UMKA 3DAFA 3UGPA 2PF4E 4U5EE 1LVKA 5DQTA 5EGYA 5CI9A 3X2QC 2Y3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QI2 A;  5F5H A;  5F5F A;  3X1O A;  4ZLD A;  4QI0 A;  4YWQ A;  4ULW A;  4ZLC A; 
#chains in the Genus database with same CATH topology
 3IHU A;  1OQC A;  4YL1 A;  4CS8 A;  1TWH A;  2R7S A;  2NSG A;  4YT5 A;  5EHH A;  2BC5 A;  3JTL O;  1EI7 A;  3FXH A;  1T01 A;  3EZH A;  3C8Z A;  2J7P D;  3ZDL A;  1S05 A;  2H7B A;  3ITF A;  4MQ9 F;  1JR8 A;  1PV3 A;  1R4T A;  2XRH A;  2R7R A;  3OWT A;  2KW3 C;  3HTK C;  1QLE C;  2EIL C;  3QW0 A;  1CPR A;  4B6I A;  1FR0 A;  3K1I C;  4MVZ A;  3IQ6 A;  3PMR A;  3RQE A;  3K33 A;  1K04 A;  4EBK A;  1APC A;  4LDR A;  1OW7 A;  3MBG A;  5BQH A;  4NTB A;  1VTM P;  3GEH A;  1Y6D A;  3K6B A;  1B68 A;  3DAG A;  4WGY A;  1ZHY A;  3C63 A;  3VYW A;  3IQ5 A;  4MTG A;  1OXK A;  2R7T A;  2XLH A;  1JMW A;  1GGQ A;  1U0B B;  2IXN A;  2EIJ C;  4IB4 A;  3AOU A;  4K0D A;  3CAX A;  5COG A;  3M79 A;  2KC3 A;  4N06 A;  2L6F A;  4HE8 D;  4I44 A;  3U2M A;  3MYF A;  4GEH A;  3DD7 A;  4JZA A;  4ULV A;  4N6H A;  1YAR O;  2H7V C;  4PJN A;  4QDL A;  5E33 A;  4Z9J A;  3RVZ A;  4CIP A;  4DXW A;  4A2N B;  2CCY A;  2I8B A;  1U89 A;  1TR2 A;  2UUH A;  2YHS A;  2YWA A;  3DI5 A;  2RSE B;  2R7X A;  3BEH A;  5CIV A;  4OIP F;  1FFH A;  5L0C A;  4IGG A;  3H65 A;  3GOD A;  1SR2 A;  3WHN A;  2B0H A;  1L7C A;  3FDQ A;  1G5Z A;  4D4X A;  2YLD A;  1VYI A;  3V5Z A;  3C8G A;  3ATP A;  3GM2 A;  4P9F A;  1K40 A;  3RQF A;  3SXK A;  1MQV A;  2KYH A;  4XQ1 A;  1H9G A;  1ZHX A;  1IZM A;  3Q7L A;  4FES A;  4ZLC A;  5KYX B;  4JW1 A;  3EQL F;  4P9T A;  1DOV A;  5EK0 A;  4NTA A;  1YYJ A;  3U2L A;  4BJ6 A;  3TD7 A;  1ZYR F;  3AGU A;  2J8W A;  5L0H A;  2XL4 A;  5T1D B;  4MND A;  2YL0 A;  3S0X A;  2J46 A;  4W8P A;  3F47 A;  2CDQ A;  4N6C A;  3JSE O;  3JRM O;  4CJO A;  3VF0 A;  1LS1 A;  3EPV A;  5DS4 A;  3SXY A;  4ULW A;  2VCC A;  1A0B A;  1AEP A;  1D1B A;  1HE9 A;  1QQ3 A;  2X51 A;  3NMI A;  4K7B A;  1VOM A;  5T3T A;  4CS9 C;  2J9V A;  5KYX A;  1T9K A;  4GQH A;  2HS5 A;  4JRZ A;  3SP1 A;  2IXM A;  2G62 A;  3U8P A;  1QSP A;  1ST6 A;  3HLZ A;  3UMH A;  1EKY A;  1M56 C;  3AG4 C;  3HNI A;  2J45 A;  2L7A A;  3C8G B;  4DVY P;  2C03 A;  3LNR A;  4MTF A;  1OCC C;  4CIH A;  2OEX A;  5L0I A;  1BDJ B;  3UNG C;  3C7J A;  3JT1 A;  3K1H A;  3JZ0 A;  1XWJ A;  2FFH A;  2EPM X;  3LEO A;  3G50 A;  3AG3 C;  4WJ0 A;  4OIN F;  2UUI A;  2XXA A;  3B71 A;  1Z3I X;  2P61 A;  4A4A A;  4YN0 B;  3CEX A;  1LKX A;  1I4Y A;  3NYJ A;  1TQG A;  4U5H A;  3EFO A;  2Q9B A;  3K1I A;  4AK9 A;  4Q5S F;  1ORJ A;  1M6T A;  1SYQ A;  3FAJ A;  3GEI A;  2QUP A;  5KYU A;  3U9M A;  3RFY A;  4W8K A;  5DS6 A;  5JLI A;  1OCO C;  3DJN B;  4J30 B;  4X0R A;  4BG0 A;  3HNJ A;  2A6H F;  3LJB A;  3W4Y A;  1YYX A;  4YJW A;  3H2V A;  4C3B A;  2A0B A;  1FTS A;  2CNW D;  2VH3 A;  3LAY A;  4XLN F;  2A1D D;  2WZL A;  3JRT A;  2ZXW C;  2KSF A;  3H2U A;  3ZQV A;  4JCZ A;  5L0F A;  1LM3 B;  2ZXR A;  3NYL A;  3W2V A;  1LE4 A;  5DQZ A;  3S90 A;  3RIP A;  3NMJ A;  1LPE A;  1MMA A;  4C3D A;  2W9Y A;  1WAT A;  1ZU5 A;  2OJE D;  4U9D A;  3M4B A;  1QVX A;  4CX9 A;  2WZF A;  2XXA B;  2J0X A;  3JSZ A;  4WAB A;  4GYT A;  2W4M A;  1E83 A;  3UR3 C;  5JVE A;  5JSL A;  2XS8 A;  4I1M A;  5K0I A;  2WVO A;  3B29 A;  1HY5 A;  1HMO A;  3EFO B;  3M15 A;  3MYI A;  1HE1 A;  1QZX A;  3RYL A;  5KYU B;  4XPX A;  2L6G A;  4XEF A;  2HV6 A;  2FGY A;  1A41 A;  1MNE A;  4PJJ A;  1BR1 A;  2D5R B;  2L81 A;  2XLO A;  4WGZ A;  4XPY A;  3ZIB A;  1T6U A;  2RD9 A;  1JPN A;  4PK4 A;  3TJ6 A;  4AE4 A;  4FAP B;  5L3V A;  2W45 A;  2DI3 A;  4DRH B;  1C17 M;  3EH2 A;  2Z15 A;  3GOR A;  2ZXO A;  4RD9 A;  3CZ6 A;  3HKK A;  3O10 A;  5T3W A;  3NYM A;  4MVO A;  2O9X A;  4ONS A;  1LE2 A;  1TWC A;  2J9B A;  2YRF A;  3LS0 A;  3NRH A;  3O6X A;  1C02 A;  5D91 A;  5AGF A;  5KYY B;  1V74 B;  2Y3H A;  1QPU A;  256B A;  1QKR A;  2EPK X;  1GQA A;  3HNL A;  1T6I A;  4L6R A;  3RVY A;  3T4R A;  4O7G A;  3KL4 A;  1TFK B;  2QLA A;  4MVR A;  3KPH A;  5FCL A;  4CS9 A;  3DJU B;  2EPN A;  5KYN A;  1GM5 A;  1W2W A;  1A7V A;  1ZW3 A;  2G3K A;  2ZPA A;  3V7O A;  4AE4 B;  5JUA A;  3U0C A;  1F1M A;  3ABK C;  3WOD F;  1FMW A;  1D0Z A;  3F46 A;  4U5F E;  1T5O A;  1ZHT A;  3HJC A;  3J06 A;  2FAP B;  2WZG A;  4DRJ B;  3QZC A;  1WN0 A;  4XWJ A;  1NFN A;  4BPM A;  2CGE A;  2JPU A;  1MND A;  2DYS C;  4CS7 A;  2TMV P;  1Q0D A;  1H7I A;  1NSG B;  1WGW A;  3EGD A;  3L8J A;  1ZHZ A;  4XLP F;  1SF8 A;  2XSE A;  4JKV A;  3RKO F;  1MMN A;  3KYI A;  1A7E A;  2PNO A;  3TOM A;  3EGX A;  3GEE A;  3FVY A;  2NSF A;  4D4N A;  2LQG A;  1YDI A;  2V26 A;  5HSW A;  1FMV A;  1RKE A;  2ASR A;  3E9V A;  2GWW A;  3ZC4 A;  3ASO C;  4MW8 A;  5JRA A;  4U5D E;  5DS5 A;  4YT8 A;  1EQ1 A;  1M2V A;  1OKK A;  2H8A A;  2IXO A;  3GM1 A;  4DBR A;  4EWC A;  3EZI A;  3WAQ A;  4J7Y A;  1NU7 D;  1LI5 A;  1V54 C;  1YLM A;  2Y69 C;  2ZXP A;  4XEK A;  3VAY A;  3C18 A;  5E3C A;  1R5I D;  2X0C A;  2VCB A;  4JJG A;  2LCH A;  2PFD A;  1G8X A;  2DYR C;  4E7Z A;  3B0V C;  4IAR A;  3PCV A;  1V55 C;  3ASN C;  3EGD B;  4CDY A;  2KNH A;  2GFH A;  4AL0 A;  1VMA A;  1M2O A;  3AQC A;  2L6H A;  3LLK A;  1OR2 A;  2WVQ A;  3B0U X;  3I5Q A;  4LER A;  4NQF A;  5TJ5 E;  1CPQ A;  3EH1 A;  1TWA A;  3EGX B;  2NUT A;  4KI2 A;  1O87 A;  4OIQ F;  2P0N A;  1H6G A;  3RH3 A;  3T6G B;  4AX2 A;  1RKE B;  2R7Q A;  2AWC A;  4IRU A;  1YAU O;  4PJM A;  5B1B C;  4OIO F;  4G7O F;  4EKW A;  4EIY A;  2BL2 A;  1OXB A;  3C8G D;  2Q3T A;  1KU2 A;  1M2V B;  4QI2 A;  4O6Y A;  1YA9 A;  1HW1 A;  2R02 A;  2R05 A;  2WL8 A;  4JVS A;  4M63 A;  1VLT A;  1LI7 A;  2QTV A;  3QTH A;  5B3I A;  3AGT A;  3EHN A;  3FAP B;  4JC7 A;  4LAC B;  2XLV A;  4HFK B;  5COF A;  3JYY A;  2OEV A;  3ECS A;  2HKV A;  2LIG A;  3SEO A;  3QVY A;  5B1A C;  3U3B A;  4PJL A;  2QY9 A;  1SZI A;  3AG2 C;  4MVM A;  4PFP A;  1OW6 A;  4KC9 A;  1OCR C;  2YLI A;  4LDQ A;  1NFO A;  3Q6N A;  4JEA A;  4E0H A;  4EBJ A;  2F22 A;  5F28 E;  1XZP A;  4JTD B;  3QVZ A;  4U5C E;  3T6B A;  2NUT B;  3EG9 A;  3X1O A;  4EBB A;  2KK1 A;  3SNH A;  1U6H A;  3RF3 A;  4E17 A;  5A6K A;  2EPL X;  3NDB B;  3Q6M A;  1ORY A;  1RJ9 A;  1WWP A;  3ZG1 A;  1MMG A;  3MX3 A;  2AVK A;  2I15 A;  5KYW A;  1D0Y A;  3DZA A;  1UG7 A;  2IXP A;  3C62 A;  3UGO A;  3U5S A;  3IQC A;  2YL3 A;  1O3U A;  1WTY A;  3M1C B;  4O6N A;  4PAC A;  3E70 C;  2Q9A A;  1D1C A;  2J9W A;  3DM9 B;  4DJ9 A;  2G3V A;  2NUP A;  1K05 A;  3S84 A;  3L0I A;  3O39 A;  4H54 A;  1EA8 A;  2B0J A;  3DM5 A;  3A11 A;  4O79 A;  1E86 A;  4G78 A;  2L9J A;  3ZSU A;  1KTM A;  2NPU A;  3GAN A;  4BEJ A;  1KNY A;  1V4A A;  2ZD9 A;  2J9U A;  3EG9 B;  3OEO A;  2OOC A;  4LLC A;  4U5B E;  3N2Z B;  3TQO A;  1N1C A;  1MMD A;  4YK5 A;  3UMI A;  5JS5 A;  4LDK A;  4DBQ A;  3R7C A;  1RJ9 B;  1Z6A A;  2MYS A;  5L3Q A;  3LS1 A;  1FNT c;  3SYN A;  4JTC B;  4KNV A;  1Z7Q c;  5GPG B;  2P6V A;  3K7D A;  3GM3 A;  4E18 A;  3S28 A;  4UDV A;  2PBE A;  4RBN A;  3W8I A;  2VB6 A;  1G4W R;  5AC4 A;  3NMK A;  2NUP B;  1PD0 A;  1Q0F A;  1YZC A;  3KMI A;  2XLD A;  1YZA A;  5E3A A;  3VM6 A;  5DLJ A;  1Z63 A;  4DOZ A;  3LES A;  3FMS A;  1BZ4 A;  5E2Q A;  3T9O A;  4YL0 A;  4Q4Z F;  4N4W A;  4LLE A;  3W2W A;  2J7P A;  2Y3B A;  1FFT C;  4JTA B;  2QNL A;  4EUK B;  3VRC A;  2R7U A;  3LUT B;  3MLG A;  4ZLD A;  2IM8 A;  2EIN C;  3DXJ F;  3NKE A;  2R7W A;  2LFF A;  3L8I A;  1PCX A;  1C03 A;  2KQ9 A;  4U5G A;  1I5N A;  4PR9 A;  4BJ5 A;  1T6Q A;  4IJJ A;  3DE9 A;  3OA1 A;  1BR4 A;  2PX0 A;  2HSB A;  4NY3 A;  2NG1 A;  5L0J A;  3ZTZ A;  3GWN A;  4MTO A;  1RCP A;  2LD6 A;  1ZU4 A;  1PD1 A;  2HJM A;  4BJT A;  3DMD A;  2P7V A;  2VC9 A;  3U8V A;  2XS1 A;  1Y4C A;  2IOQ A;  1D0X A;  5A69 A;  3GWL A;  3KKB A;  4CSA A;  3AG1 C;  2YL7 A;  2Q7R A;  3V5X A;  3KH2 A;  4K1O A;  3KYJ A;  2CYD A;  3SXZ A;  4RDA A;  2YVK A;  2AWY A;  1Z5Z A;  2AP3 A;  2V3C C;  3N24 A;  1ORS C;  4AL1 A;  3N0T A;  4YWQ A;  1VB5 A;  2R7O A;  3W8H A;  4XEV A;  3I5P A;  2Y39 A;  4DVZ A;  1S7Z A;  2CW0 F;  1AUE A;  2OG2 A;  3RQG A;  3QW1 A;  2J0W A;  1OCZ C;  1GS9 A;  4OD5 A;  2P1A A;  1NZE A;  1XZQ A;  1FAP B;  1CGN A;  2AU5 A;  2H7O A;  4Z9H A;  1ZVZ A;  2LFD A;  3CSK A;  3S29 A;  4ANJ A;  2JD3 A;  5B3S C;  2A6E F;  4HEA J;  3U3F A;  4CDV A;  1O5H A;  1RKC A;  4FX5 A;  2Y3D A;  4MW3 A;  4O6M A;  3B0P A;  1NG1 A;  3EHM A;  5F5F A;  5D92 A;  5IY5 C;  1VK5 A;  3ABM C;  3ABL C;  1ZHW A;  2HV7 A;  5COM A;  1JOG A;  1L3P A;  1J8Y F;  3LLI A;  3AJM A;  4XPW A;  2IBF A;  2LK4 A;  1NU9 C;  4Z9I A;  1H9T A;  3FOP A;  1Q0G A;  3IPM O;  4G0H A;  4C3E A;  1J8M F;  1CGM E;  4NC3 A;  1OKK D;  4BJ5 C;  2YKZ A;  5A6J A;  3L34 A;  5L0G A;  3PHF 2;  5F5H A;  1OW8 A;  1SMY F;  1DOW A;  2EIK C;  3S9O A;  2WB7 A;  3G4Z A;  4P6I C;  4J7T A;  4G7Z F;  2EIM C;  3K66 A;  3FOO A;  4IWB A;  3MFN A;  4KBL A;  2LP4 A;  4CJG A;  3ZVR A;  4YL3 A;  4CDA A;  2MWQ A;  2GAQ A;  4CS8 C;  1E2X A;  1E84 A;  2HJ3 A;  1TKN A;  2HMQ A;  2MHR A;  1OR3 A;  2OQM A;  2HSQ A;  2XLM A;  3WG7 C;  2OKU A;  4BEM J;  4G7H F;  4CSA C;  2BE5 F;  1WOL A;  2HFI A;  2VCA A;  4Q7C A;  1Z23 A;  3V5Y A;  4HFF B;  3PDM P;  3CQZ A;  3DE8 A;  2OCC C;  1E85 A;  3JYH A;  5FZT A;  3EJN A;  1YVI A;  2GDC A;  1TFO B;  2KJG A;  3AQB A;  2R9R B;  5DVW A;  4CBE A;  3FHD A;  4JJF A;  2XLE A;  2D4U A;  2R7V A;  3S27 A;  1JPJ A;  2DGJ A;  2HUJ A;  1A7D A;  4XTK A;  4KNW A;  2A0U A;  3T6J A;  3IEE A;  4MVQ A;  1TWG A;  3LNM B;  1IW7 F;  2YZS A;  3R2P A;  4OIR F;  5HV9 A;  3LEV A;  1VLS A;  5BQG A;  3US6 A;  2KGO A;  4ER9 A;  2CNW A;  2PX3 A;  4QI0 A;  1VYK A;  5CI8 A;  3A9C A;  1AVO B;  3POV A;  2HZ8 A;  4PFO A;  1LIH A;  2W4B A;  1HW2 A;  4C7O A;  3RW0 A;  3L1M A;  2YL1 A;  3SXM A;  2DB4 A;  1D1A A;  1LS4 A;  1YA7 O;  1YJG A;  2OU6 A;  5A6A A;  2VAS A;  3I4U A;  2ETS A;  3DKA A;  4BJ1 A;  3TJ5 A;  4F4B A;  3JCU Q;  4YT2 A;  5AC5 A;  1WAS A;  2EPO A;  2LSE A;  1M57 C;  2YEV A;  4JCH A;  1JAF A;  2GA0 A;  4NCQ A;  2A68 F;  2XL6 A;  2OJQ A;  3DWW A;  4MS2 A;  3SZR A;  3ZQY A;  4EHP A;  4J32 B;  2Q9C A;  3M4C A;  5BQI A;  5A6B A;  4IAQ A;  5JT4 A;  4MVS A;  2XM4 A;  5KYW B;  3ZTM A;  1UFB A;  1Q0M A;  4FWV A;  2YLG A;  2YQY A;  2IYL D;  3BRJ A;  2ICW G;  5BUO A;  4NTF A;  2A69 F;  4BJ6 C;  1BR2 A;  1CGO A;  3B9Q A;  3G4X A;  1RXQ A;  3NG1 A;  4E7S A;  4I3M A;  1NBB A;  5L0D A;  3U9J A;  3TUL A;  2WVN A;  4C7O B;  4E0I A;  2JX0 A;  2PP4 A;  4I1O B;  3ZWI A;  4R32 A;  2Q4F A;  4IAO A;  1I4Z A;  5KYY A;  2R03 A;  2HMZ A;  1ZZP A;  2XLW A;  3HNK A;  4YT4 A;  4U9E A;  2C04 A;  1BBH A;  1HMD A;  2E87 A;  3QMK A;  4MVU A;  2M4E A;  4H4K C;  3O55 A;  5A6B D;  4JE9 A;  1NLX A;  3NKD A;  4JUR I;  2R25 A;  2M64 A;  4JIO A;  1G4U S;  5JP7 A;  3TK0 A;  4OD4 A;  3Q7G A;  3UMK A;  3DAF A;  1Q0K A;  3TOL A;  4JEB A;  2QE9 A;  3IQT A;  4DRI B;  3UGP A;  1ZW2 A;  2PF4 E;  2XM0 A;  4U5E E;  1LVK A;  2Q00 A;  5DQT A;  1JRA A;  2XL8 A;  5CI9 A;  5EGY A;  3X2Q C;  1RMV A;  2Y3G A; 
#chains in the Genus database with same CATH homology
 4CS8 A;  1TWH A;  2R7S A;  4YT5 A;  5EHH A;  3EZH A;  2J7P D;  3ITF A;  2H7B A;  4MQ9 F;  2R7R A;  2XRH A;  3OWT A;  2KW3 C;  3HTK C;  1QLE C;  2EIL C;  4B6I A;  3K1I C;  3PMR A;  3K33 A;  3K6B A;  3DAG A;  3VYW A;  1ZHY A;  2R7T A;  2IXN A;  2EIJ C;  4K0D A;  4N06 A;  4HE8 D;  4I44 A;  4GEH A;  4JZA A;  3DD7 A;  5E33 A;  2H7V C;  4PJN A;  4QDL A;  4A2N B;  2I8B A;  1TR2 A;  2YHS A;  2R7X A;  4OIP F;  1FFH A;  3H65 A;  3GOD A;  3FDQ A;  1VYI A;  1ZHX A;  1IZM A;  3Q7L A;  4FES A;  4ZLC A;  4JW1 A;  3EQL F;  4BJ6 A;  3TD7 A;  1ZYR F;  2XL4 A;  5T1D B;  4MND A;  3S0X A;  2J46 A;  3F47 A;  2CDQ A;  1LS1 A;  3EPV A;  5DS4 A;  4ULW A;  2X51 A;  4K7B A;  1D1B A;  5T3T A;  1VOM A;  4CS9 C;  2J9V A;  5KYX A;  3SP1 A;  2IXM A;  2G62 A;  1ST6 A;  3HLZ A;  3UMH A;  1M56 C;  3AG4 C;  2J45 A;  4DVY P;  2C03 A;  3LNR A;  1OCC C;  4CIH A;  3UNG C;  3JT1 A;  3K1H A;  2FFH A;  4OIN F;  3AG3 C;  4WJ0 A;  2XXA A;  1Z3I X;  4YN0 B;  1LKX A;  3NYJ A;  4U5H A;  3EFO A;  2Q9B A;  4AK9 A;  4Q5S F;  3FAJ A;  5KYU A;  3RFY A;  4W8K A;  5DS6 A;  5KYX B;  1OCO C;  3DJN B;  4J30 B;  4X0R A;  4BG0 A;  2A6H F;  3LJB A;  4C3B A;  1FTS A;  2CNW D;  2VH3 A;  3LAY A;  4XLN F;  2A1D D;  2WZL A;  3JRT A;  2ZXW C;  3NYL A;  2ZXR A;  3W2V A;  5DQZ A;  3RIP A;  1MMA A;  4C3D A;  2W9Y A;  1ZU5 A;  2WZF A;  2XXA B;  2J0X A;  3JSZ A;  4GYT A;  2W4M A;  3UR3 C;  4I1M A;  2WVO A;  3EFO B;  3RYL A;  1QZX A;  5KYU B;  2HV6 A;  2FGY A;  1MNE A;  4PJJ A;  1BR1 A;  2D5R B;  2L81 A;  3ZIB A;  1JPN A;  4PK4 A;  4AE4 A;  5L3V A;  2W45 A;  3EH2 A;  2Z15 A;  2ZXO A;  4RD9 A;  3CZ6 A;  5T3W A;  3NYM A;  2O9X A;  1TWC A;  3LS0 A;  3NRH A;  3O6X A;  5D91 A;  5KYY B;  2Y3H A;  3T4R A;  4O7G A;  3KL4 A;  5FCL A;  4CS9 A;  3DJU B;  5KYN A;  1W2W A;  2G3K A;  2ZPA A;  3V7O A;  4AE4 B;  3ABK C;  3WOD F;  1FMW A;  1D0Z A;  3F46 A;  4U5F E;  3HJC A;  1ZHT A;  2WZG A;  3QZC A;  4XWJ A;  2CGE A;  1MND A;  2DYS C;  4CS7 A;  1WGW A;  3EGD A;  1ZHZ A;  4XLP F;  1SF8 A;  2XSE A;  3RKO F;  1MMN A;  3EGX A;  3FVY A;  2V26 A;  5HSW A;  1FMV A;  3E9V A;  3ZC4 A;  3ASO C;  4U5D E;  5DS5 A;  4YT8 A;  1M2V A;  1OKK A;  2IXO A;  4DBR A;  4EWC A;  3EZI A;  1NU7 D;  1V54 C;  2Y69 C;  2ZXP A;  3VAY A;  5E3C A;  4JJG A;  4E7Z A;  2PFD A;  1G8X A;  2DYR C;  3B0V C;  1V55 C;  3ASN C;  3EGD B;  2KNH A;  2GFH A;  1VMA A;  1M2O A;  3AQC A;  3LLK A;  2WVQ A;  3B0U X;  3I5Q A;  4LER A;  3EH1 A;  1TWA A;  3EGX B;  2NUT A;  4KI2 A;  1O87 A;  4OIQ F;  3RH3 A;  4AX2 A;  2R7Q A;  4IRU A;  4PJM A;  5B1B C;  4OIO F;  4G7O F;  2Q3T A;  1KU2 A;  1M2V B;  4QI2 A;  4O6Y A;  2WL8 A;  4YJW A;  4M63 A;  4JVS A;  2QTV A;  3EHN A;  4LAC B;  4HFK B;  3ECS A;  3SEO A;  5B1A C;  4PJL A;  2QY9 A;  1SZI A;  3AG2 C;  4PFP A;  4KC9 A;  1OCR C;  3Q6N A;  3T6B A;  4U5C E;  4EBB A;  3X1O A;  2NUT B;  3EG9 A;  3SNH A;  3NDB B;  3Q6M A;  1RJ9 A;  3ZG1 A;  1MMG A;  3MX3 A;  5KYW A;  1D0Y A;  3DZA A;  2IXP A;  3UGO A;  4O6N A;  3M1C B;  3E70 C;  2Q9A A;  1D1C A;  2J9W A;  3DM9 B;  2G3V A;  2NUP A;  3L0I A;  3O39 A;  2B0J A;  3DM5 A;  4O79 A;  2L9J A;  3ZSU A;  3GAN A;  4BEJ A;  3EG9 B;  2J9U A;  3OEO A;  4LLC A;  4U5B E;  3N2Z B;  1N1C A;  1MMD A;  3UMI A;  4DBQ A;  1RJ9 B;  1Z6A A;  2MYS A;  5L3Q A;  3LS1 A;  3SYN A;  4KNV A;  2P6V A;  3K7D A;  3S28 A;  4RBN A;  3W8I A;  2VB6 A;  2NUP B;  1PD0 A;  3KMI A;  5DLJ A;  5E3A A;  1Z63 A;  4DOZ A;  3LES A;  5E2Q A;  4Q4Z F;  4LLE A;  3W2W A;  2J7P A;  2Y3B A;  1FFT C;  2R7U A;  3MLG A;  4ZLD A;  3DXJ F;  2EIN C;  3NKE A;  2R7W A;  1PCX A;  2KQ9 A;  4U5G A;  4BJ5 A;  4IJJ A;  3OA1 A;  1BR4 A;  2PX0 A;  4NY3 A;  2NG1 A;  1ZU4 A;  1PD1 A;  4BJT A;  3DMD A;  2P7V A;  2IOQ A;  1D0X A;  3KKB A;  4CSA A;  3AG1 C;  3KH2 A;  4RDA A;  2V3C C;  1Z5Z A;  3N24 A;  3N0T A;  4YWQ A;  2R7O A;  3W8H A;  3I5P A;  2Y39 A;  4DVZ A;  1S7Z A;  2CW0 F;  2OG2 A;  2J0W A;  1OCZ C;  4OD5 A;  1NZE A;  2H7O A;  3CSK A;  3S29 A;  4ANJ A;  2JD3 A;  5B3S C;  2A6E F;  4HEA J;  1O5H A;  4FX5 A;  2Y3D A;  4O6M A;  3B0P A;  1NG1 A;  3EHM A;  5F5F A;  5D92 A;  5IY5 C;  1VK5 A;  3ABM C;  3ABL C;  1ZHW A;  2HV7 A;  1J8Y F;  3LLI A;  1NU9 C;  4G0H A;  4C3E A;  1J8M F;  1OKK D;  4BJ5 C;  3L34 A;  3PHF 2;  5F5H A;  1SMY F;  2EIK C;  4G7Z F;  2WB7 A;  4P6I C;  2EIM C;  3K66 A;  4IWB A;  4KBL A;  3ZVR A;  2MWQ A;  4CS8 C;  1TKN A;  4G7H F;  3WG7 C;  4CSA C;  2BE5 F;  4Q7C A;  1Z23 A;  4HFF B;  3CQZ A;  2OCC C;  3JYH A;  3EJN A;  2KJG A;  3AQB A;  5DVW A;  4CBE A;  3FHD A;  4JJF A;  2R7V A;  3S27 A;  1JPJ A;  2DGJ A;  4XTK A;  4KNW A;  3T6J A;  3IEE A;  4OIR F;  1TWG A;  1IW7 F;  2YZS A;  3LEV A;  2KGO A;  2CNW A;  2PX3 A;  4QI0 A;  1VYK A;  5CI8 A;  3POV A;  4PFO A;  2W4B A;  4C7O A;  1D1A A;  2VAS A;  3I4U A;  4BJ1 A;  4F4B A;  3JCU Q;  4YT2 A;  2LSE A;  1M57 C;  2YEV A;  4JCH A;  2A68 F;  3SZR A;  4J32 B;  2Q9C A;  5KYW B;  4FWV A;  2IYL D;  5BUO A;  2A69 F;  4BJ6 C;  1BR2 A;  3B9Q A;  3NG1 A;  4E7S A;  4I3M A;  2WVN A;  4C7O B;  2PP4 A;  4I1O B;  4IAO A;  5KYY A;  4YT4 A;  2C04 A;  2E87 A;  3QMK A;  2M4E A;  4H4K C;  3NKD A;  4JUR I;  4OD4 A;  3Q7G A;  3UMK A;  3DAF A;  3UGP A;  2PF4 E;  4U5E E;  1LVK A;  5DQT A;  5EGY A;  5CI9 A;  3X2Q C;  2Y3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...