4YWQA

Crystal structure of the roq domain of human roquin-1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
152
Chain Sequence
QQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Crystal structure of the ROQ domain of human Roquin-1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 50
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ywqA00
5F5HA 4YWQA 3X1OA 4QI2A 5F5FA 4QI0A 4ZLCA 4ULWA 4ZLDA
chains in the Genus database with same CATH superfamily
4U5EE 1O3UA 1U89A 1ZZPA 4K0DA 4DJ9A 1Z5ZA 1C17M 3JYYA 3DM9B 2LIGA 2Q9BA 2L6HA 3GORA 2Y69C 4PJMA 4XQ1A 3AG2C 3EZIA 5A69A 1LIHA 2ZXOA 5IY5C 5DS5A 1ZVZA 2HS5A 2R25A 2FAPB 4MVRA 4K1OA 3T4RA 4EUKB 3E9VA 1D0ZA 1GQAA 3AQCA 4AL1A 3PHF2 3X1OA 2NUTB 2QLAA 1WN0A 4LLEA 1XZPA 4RD9A 4P9TA 3TK0A 5COFA 5CIVA 2XLVA 3GEIA 4YK5A 2E87A 4JTAB 1FMVA 1A41A 3M4CA 4WGYA 5COMA 5T3WA 2XLWA 2WVNA 2KJGA 4W8PA 2XXAB 1FR0A 3KKBA 4JRZA 2PX0A 4YT8A 4CJGA 3LUTB 1VYIA 3LAYA 5JP7A 2ZXWC 4KC9A 4ANJA 1EQ1A 2R05A 1NG1A 3SNHA 1RKEA 4DRIB 5E33A 3K1IA 4MVZA 3ZTMA 2EPLX 1KTMA 2W4MA 3G4XA 2NSGA 4D4XA 2YLGA 5L3QA 2C04A 2MYSA 2UUHA 3DJUB 3U3BA 3DD7A 2YLIA 3HLZA 3ZTZA 2H8AA 2CDQA 4DVYP 4MTFA 1TFKB 2TMVP 3C7JA 1M56C 3K33A 1QLEC 3DWWA 3ATPA 2J9UA 5A6JA 4NY3A 2YLDA 1W2WA 3ABMC 2WVQA 3T6BA 1Z63A 1UG7A 1ZHXA 1HW2A 1NU7D 3JYHA 4O6NA 1PD0A 3NDBB 2XL8A 3S28A 2J9BA 3U0CA 2IXOA 1JMWA 3LEVA 3MYFA 1Z7Qc 2XL6A 3RVYA 2C03A 4EHPA 2FGYA 1IZMA 3ECSA 1EKYA 4G7ZF 3QTHA 1V55C 3MBGA 5L0DA 4BJ6A 2QTVA 1T6QA 4G78A 4J30B 2LFDA 1H9TA 1BR1A 4CS7A 3HNIA 1DOVA 1GS9A 3GWLA 4NCQA 2VB6A 1BR4A 1TR2A 2R7WA 3RQGA 1YYJA 1G5ZA 1ZHZA 3L0IA 1A7DA 4HEAJ 1GM5A 3JSEO 4C7OB 1ZW3A 1ZYRF 1G4WR 2EIKC 2NG1A 2W9YA 4E17A 2GDCA 3H2UA 2L6GA 4PACA 4XPWA 1AVOB 3IPMO 4M63A 1D1CA 1OR3A 4YN0B 4U9DA 2W4BA 1OW6A 2YKZA 1LM3B 4UDVA 3G4ZA 1RCPA 3ITFA 3SP1A 3FHDA 3O39A 2R7VA 3W2VA 2Y3DA 3VAYA 4U5FE 3EGDB 5KYNA 4EBBA 3RFYA 5COGA 5KYXA 1Z23A 3ZC4A 4XEVA 3AG3C 4JCZA 1Q0MA 2KSFA 1APCA 1H9GA 3TOMA 4E7SA 4XPXA 2AWCA 2B0JA 4H4KC 3WAQA 3SYNA 4NQFA 2I15A 2XS8A 1IW7F 1ORYA 2IBFA 2L7AA 3NYLA 3NKDA 3QW0A 4JURI 4ZLCA 2JD3A 1LKXA 1NFOA 4O79A 1ST6A 2KYHA 4JC7A 3F46A 4CDYA 4YL0A 5AC4A 4NTFA 5DS6A 2QNLA 4DRJB 2OCCC 3T6JA 2YL1A 2R7OA 2YL3A 4JEBA 4YL1A 1PV3A 3WG7C 4BEMJ 4DVZA 3MFNA 2PFDA 1U0BB 4I3MA 4P6IC 3A11A 1NBBA 4WABA 2XM4A 2XLOA 3M79A 5DLJA 1BBHA 3S84A 5T1DB 4XEKA 3O55A 3L1MA 2OKUA 1WGWA 2HUJA 4AX2A 3IHUA 2ZXRA 4N6HA 4MQ9F 3N0TA 4IWBA 2NUPB 4MW3A 2CNWA 2CW0F 4QDLA 2EIJC 4LDRA 4F4BA 1E86A 2W45A 3OWTA 2NUTA 4C3EA 2OU6A 1OCRC 2HV6A 2OQMA 1MMGA 1VLSA 2JPUA 1WTYA 3CZ6A 3DM5A 4Q7CA 1F1MA 4K7BA 4U9EA 2IXMA 1FMWA 3M4BA 4E7ZA 3E70C 1O5HA 1LPEA 3HNKA 3KL4A 1LI5A 4LLCA 3HKKA 1YA7O 3U2LA 1A0BA 5HSWA 2ASRA 1KNYA 5JLIA 2XXAA 1K04A 3JCUQ 2A0UA 3KYIA 2AVKA 4PK4A 4ULWA 2A68F 2DI3A 1N1CA 3ASNC 4JEAA 2P1AA 2YL0A 2CNWD 2XM0A 2VH3A 2R03A 4PR9A 4RDAA 4YL3A 1VYKA 4E0HA 1XZQA 2QUPA 4HFKB 4JJFA 5CI8A 3VRCA 2LQGA 4AE4B 3UGPA 3C63A 4JE9A 3ZQYA 3DI5A 2WVOA 3SEOA 3K1IC 4OD4A 4I1MA 1R4TA 3ZG1A 5F28E 1VK5A 3DZAA 1OKKA 3LS1A 4PJNA 1VTMP 4DRHB 3EJNA 2V26A 1R5ID 2ZPAA 1HE9A 2EINC 1Y6DA 4ZLDA 2HSBA 4QI2A 5DQTA 1LS1A 1M2VB 256BA 3K7DA 1OCOC 1Q0DA 2RSEB 4A2NB 4CS9C 2EIMC 3W8IA 4BEJA 4E0IA 4BJ5A 1TQGA 2XLDA 3JT1A 4MNDA 2LD6A 3K6BA 3CEXA 3FMSA 1WATA 3MLGA 5DVWA 1QPUA 3Q6MA 3VM6A 4BJ6C 4L6RA 5BUOA 2XL4A 4JVSA 2F22A 2R7RA 1OKKD 3UGOA 4C7OA 3OEOA 3AJMA 3S29A 3ZQVA 1OCZC 3EHMA 1B68A 1VMAA 5TJ5E 2OOCA 4Q5SF 1T5OA 3NMJA 1JR8A 3W2WA 1T01A 4J7TA 4CDAA 4CS8A 3ABLC 4IJJA 3C18A 3IQTA 2G62A 2HJ3A 3KH2A 5AC5A 4CS9A 4MVOA 3FOOA 4XTKA 1DOWA 1YAUO 2H7BA 3C8GB 3L34A 3GWNA 4JTCB 3EGDA 2PNOA 4FAPB 2EPMX 4EBJA 4DOZA 4JTDB 1E85A 1Z6AA 2OG2A 1CPRA 2GA0A 4JCHA 5L0GA 2WZFA 3HNJA 5JS5A 2IXNA 4IAQA 3S90A 1AUEA 3WHNA 2Q9AA 1EA8A 4HFFB 4CJOA 4FX5A 3JRTA 1H7IA 3QW1A 3V5XA 2OJED 4IB4A 4GQHA 2P0NA 1HY5A 3FAJA 1I4ZA 2LCHA 1M2OA 2LK4A 3SZRA 3A9CA 2ZXPA 2RD9A 4AL0A 4NC3A 3JZ0A 4J32B 4ONSA 3UNGC 2YQYA 3FAPB 4MVSA 4WJ0A 1JRAA 1OQCA 2KW3C 3TJ6A 4A4AA 5BQHA 2VCAA 2JX0A 4HE8D 2J9VA 2EILC 2VCCA 2EPNA 1OW7A 4DBRA 1NSGB 5JRAA 1BR2A 2J7PA 2R7QA 1RMVA 3EGXB 4KBLA 4OIQF 3NG1A 4LDQA 5JSLA 2LFFA 2NUPA 4MTGA 2P7VA 2G3VA 4EKWA 1TWAA 1MQVA 2P61A 1D0YA 1MMAA 3W8HA 2XLEA 2IXPA 2YRFA 1OCCC 4BG0A 3CAXA 3MX3A 2XS1A 3V7OA 1T9KA 2YVKA 4AK9A 5F5HA 1J8MF 3GEEA 3I4UA 1Q0GA 1V74B 2L6FA 3T9OA 2KK1A 2D4UA 4XEFA 5FZTA 2HZ8A 3UMHA 1AEPA 3X2QC 3POVA 3DE9A 2DB4A 3RH3A 4JJGA 5B3IA 1GGQA 2A1DD 2XLHA 5KYYB 1FFTC 3HJCA 2J7PD 5L0HA 1D1AA 2KNHA 3LS0A 4YT4A 5KYWB 3AGTA 4LDKA 3S0XA 1LI7A 5L0FA 4MS2A 4YJWA 4Z9JA 5F5FA 2J8WA 2OEXA 1LE2A 3GM2A 5BQIA 1ZHWA 3IQ5A 4R32A 1MNDA 3RW0A 2ICWG 2PP4A 2YZSA 1HE1A 3GANA 1RKCA 2L9JA 3NYJA 2Y3GA 3QVZA 4C3DA 3FVYA 4XLNF 4EBKA 3DJNB 3V5ZA 4YT5A 1OXKA 4X0RA 3UMKA 1LE4A 2AWYA 1ORSC 1YJGA 3EG9B 2BC5A 3I5QA 2WB7A 2VASA 4J7YA 3TOLA 1WWPA 1XWJA 1S05A 4MW8A 3SXKA 1OR2A 3GM3A 3V5YA 2L81A 1M2VA 2LSEA 4JW1A 1TKNA 1YARO 2X51A 1FFHA 3BEHA 4CBEA 2XRHA 4O6YA 3RQFA 2KGOA 3ZVRA 4YT2A 1YVIA 3LNMB 4IAOA 2KC3A 4XLPF 4EIYA 1HMOA 2XSEA 2R7UA 4IRUA 1KU2A 1QKRA 4OIPF 4DXWA 4CIHA 2V3CC 3NMIA 3M1CB 3DAFA 4OIOF 1L7CA 2EPOA 2FFHA 2YWAA 2QY9A 3NMKA 2DYRC 3NYMA 3QMKA 5E3CA 4BJ5C 5L0IA 2A0BA 1G8XA 3TD7A 2QE9A 3EFOB 5BQGA 4U5HA 2M4EA 1LVKA 2GFHA 3KYJA 2J46A 2OJQA 1D1BA 5D92A 5L0JA 1L3PA 2Z15A 3C8ZA 1I4YA 4FESA 1M6TA 5E2QA 3K1HA 3AG1C 1HMDA 5DQZA 3PCVA 3CQZA 2NPUA 4JKVA 1K05A 4OIRF 3C8GA 3DKAA 2BL2A 3KMIA 3ZSUA 2IYLD 1HW1A 2Y3BA 2ZD9A 3IEEA 3PMRA 4O7GA 3ZDLA 4MVUA 3ZIBA 4CS8C 3SXZA 1SYQA 1Q0FA 3LLKA 1J8YF 2Q3TA 2HMZA 4Z9IA 2VCBA 3HNLA 3SXMA 4D4NA 4CSAC 1Z3IX 2ETSA 2GWWA 2VC9A 1TWHA 2UUIA 1VOMA 3LESA 3AGUA 4N6CA 2H7OA 2Y3HA 3U5SA 1FNTc 3U9JA 1JAFA 3TJ5A 3UR3C 3W4YA 3KPHA 1E2XA 3U3FA 1Q0KA 5JT4A 1E84A 3BRJA 4U5DE 2DGJA 4EWCA 5A6BA 5CI9A 4GEHA 4KI2A 3DE8A 2O9XA 2R02A 3I5PA 1RJ9B 4MVMA 2HFIA 1C03A 3C8GD 1TFOB 5KYUB 3JSZA 5AGFA 3NKEA 1ZU5A 4H54A 1ZU4A 3DXJF 2A69F 2NSFA 2OEVA 2CCYA 2MWQA 2PX3A 3CSKA 3RIPA 4CSAA 1WOLA 4U5BE 3G50A 2Q4FA 3HTKC 3EGXA 3DMDA 4JIOA 3LJBA 1C02A 3EPVA 3AQBA 1CGNA 3L8IA 3LLIA 5D91A 3O10A 3WODF 2R7TA 3MYIA 2HSQA 3R2PA 4O6MA 5A6BD 1QZXA 3FDQA 5JVEA 1E83A 3AOUA 1PCXA 1UFBA 2YL7A 4BJTA 1MMDA 3B0PA 1NZEA 4NTAA 3T6GB 3B9QA 1OW8A 2HV7A 3UMIA 1SZIA 4CX9A 4MVQA 5FCLA 4JZAA 2HKVA 3S9OA 3R7CA 2WL8A 5A6KA 2AP3A 2H7VC 1SR2A 5T3TA 2BE5F 2IM8A 5KYYA 1BZ4A 4PJLA 2Q00A 1NLXA 2P6VA 5E3AA 1U6HA 3US6A 3N24A 2LP4A 3O6XA 3ABKC 5KYWA 1H6GA 4FWVA 4U5CE 1FAPB 1JPJA 3DAGA 4IARA 4BJ1A 1YA9A 3PDMP 4XWJA 2XLMA 3F47A 4LERA 1YDIA 3IQ6A 5JUAA 4ER9A 3TQOA 1NU9C 2R9RB 3EH2A 3ASOC 5EK0A 1A7EA 1M57C 1ZW2A 1QVXA 1RKEB 2DYSC 3Q6NA 4ULVA 5K0IA 1O87A 2CGEA 3EG9A 2Q7RA 3RKOF 3EH1A 3SXYA 1K40A 5B1BC 4E18A 3IQCA 3B0UX 4KNVA 2I8BA 1YZCA 4XPYA 3RQEA 3B29A 3U8VA 1VLTA 2J0XA 2A6HF 2IOQA 4W8KA 1D0XA 3AG4C 1MNEA 3EZHA 3L8JA 4QI0A 3C62A 3Q7GA 3JRMO 3H2VA 3GEHA 1CGOA 2YHSA 3QVYA 3N2ZB 3RYLA 4CDVA 1QSPA 3M15A 3ZWIA 3J06A 5L0CA 1SF8A 1ZHYA 1MMNA 4Z9HA 3S27A 1JPNA 3EQLF 4AE4A 5L3VA 4PJJA 4WGZA 1JOGA 3EFOA 1RXQA 1A7VA 2GAQA 1TWCA 3RVZA 4C3BA 3RF3A 3Q7LA 1OXBA 2YEVA 4GYTA 5HV9A 1V4AA 4OD5A 4NTBA 4PFOA 3K66A 3TULA 3U2MA 5EHHA 4PFPA 2WZGA 1CPQA 5DS4A 1T6IA 1TWGA 2D5RB 3EHNA 3H65A 3B71A 2A6EF 1YYXA 2MHRA 4N4WA 5B1AC 4B6IA 2EPKX 4IGGA 3LNRA 4I44A 5EGYA 4Q4ZF 2R7XA 3U8PA 2PF4E 2WZLA 4RBNA 3VF0A 5B3SC 4MTOA 5GPGB 1QQ3A 4G7OF 4P9FA 3QZCA 1V54C 1Y4CA 1T6UA 2HMQA 3VYWA 2B0HA 5KYXB 2M64A 2AU5A 2KQ9A 1NFNA 3JTLO 1SMYF 2J0WA 4BPMA 1I5NA 4YWQA 1WASA 2HJMA 3LEOA 1VB5A 3FXHA 1RJ9A 2CYDA 4KNWA 4G7HF 4LACB 1G4US 4N06A 2X0CA 1BDJB 1ZHTA 4CIPA 3NRHA 3GODA 5KYUA 2R7SA 4G0HA 2Y39A 1PD1A 4OINF 1ORJA 2Q9CA 2G3KA 1YLMA 4DBQA 3OA1A 3GM1A 1CGME 1FTSA 1YZAA 3FOPA 2J9WA 3B0VC 2PBEA 4U5GA 1LS4A 1S7ZA 3U9MA 2J45A 4I1OB 1EI7A 5A6AA
chains in the Genus database with same CATH topology
4U5EE 4K0DA 1Z5ZA 3DM9B 2Q9BA 4PJMA 2Y69C 3AG2C 3EZIA 2ZXOA 5IY5C 5DS5A 3T4RA 3E9VA 1D0ZA 3AQCA 3PHF2 3X1OA 2NUTB 4LLEA 4RD9A 2E87A 1FMVA 5T3WA 2WVNA 2KJGA 2XXAB 3KKBA 4YT8A 2PX0A 1VYIA 3LAYA 2ZXWC 4KC9A 4ANJA 1NG1A 3SNHA 5E33A 2W4MA 5L3QA 2C04A 2MYSA 4DVYP 3DJUB 3DD7A 3HLZA 2CDQA 1M56C 3K33A 1QLEC 2J9UA 4NY3A 3ABMC 1W2WA 3T6BA 2WVQA 1Z63A 1ZHXA 3JYHA 1NU7D 4O6NA 1PD0A 3NDBB 3S28A 2IXOA 3LEVA 2C03A 2FGYA 1IZMA 3ECSA 4G7ZF 1V55C 4BJ6A 2QTVA 4J30B 1BR1A 4CS7A 2VB6A 1BR4A 1TR2A 2R7WA 1ZHZA 3L0IA 4HEAJ 4C7OB 1ZYRF 2EIKC 2NG1A 2W9YA 4M63A 1D1CA 4YN0B 2W4BA 3ITFA 3SP1A 3FHDA 3O39A 2R7VA 3W2VA 2Y3DA 3VAYA 4U5FE 3EGDB 5KYNA 4EBBA 3RFYA 5KYXA 1Z23A 3AG3C 4E7SA 2B0JA 4H4KC 3SYNA 1IW7F 3NYLA 4JURI 4ZLCA 3NKDA 2JD3A 1LKXA 4O79A 1ST6A 3F46A 5DS6A 2OCCC 3T6JA 3WG7C 2R7OA 4DVZA 2PFDA 4I3MA 4P6IC 5DLJA 1WGWA 4AX2A 2ZXRA 4MQ9F 3N0TA 4IWBA 2NUPB 2CNWA 2CW0F 4QDLA 2EIJC 4F4BA 2W45A 3OWTA 2NUTA 4C3EA 1OCRC 2HV6A 1MMGA 3CZ6A 3DM5A 4Q7CA 4K7BA 2IXMA 1FMWA 4E7ZA 3E70C 1O5HA 3KL4A 4LLCA 5HSWA 2XXAA 3JCUQ 4PK4A 4ULWA 2A68F 1N1CA 3ASNC 2CNWD 2VH3A 4RDAA 1VYKA 4HFKB 4JJFA 5CI8A 4AE4B 3UGPA 2WVOA 3SEOA 3K1IC 4OD4A 4I1MA 3ZG1A 1VK5A 3DZAA 1OKKA 3LS1A 4PJNA 3EJNA 2V26A 2ZPAA 2EINC 4ZLDA 4QI2A 5DQTA 1LS1A 1M2VB 3K7DA 1OCOC 4CS9C 4A2NB 2EIMC 3W8IA 4BEJA 4BJ5A 3JT1A 4MNDA 3K6BA 3MLGA 5DVWA 3Q6MA 4BJ6C 5BUOA 2XL4A 4JVSA 2R7RA 3UGOA 1OKKD 4C7OA 3OEOA 3S29A 1OCZC 3EHMA 1VMAA 4Q5SF 3W2WA 4CS8A 3ABLC 4IJJA 2G62A 3KH2A 4CS9A 4XTKA 2H7BA 3L34A 3EGDA 1Z6AA 2OG2A 4JCHA 2WZFA 2IXNA 2Q9AA 4HFFB 4FX5A 3JRTA 3FAJA 3SZRA 1M2OA 2ZXPA 4J32B 3UNGC 4WJ0A 2KW3C 4HE8D 2J9VA 2EILC 4DBRA 1BR2A 2J7PA 2R7QA 3EGXB 4KBLA 4OIQF 3NG1A 2NUPA 2P7VA 2G3VA 1TWAA 1D0YA 1MMAA 3W8HA 2IXPA 1OCCC 4BG0A 3MX3A 3V7OA 4AK9A 5F5HA 1J8MF 3I4UA 3ZC4A 3X2QC 3UMHA 3POVA 3RH3A 4JJGA 5KYYB 2A1DD 1FFTC 3HJCA 2J7PD 1D1AA 2KNHA 3LS0A 4YT4A 5KYWB 3S0XA 5F5FA 4YJWA 1ZHWA 1MNDA 2PP4A 2YZSA 3GANA 2L9JA 3NYJA 4C3DA 2Y3GA 3FVYA 4XLNF 3DJNB 4YT5A 4X0RA 3UMKA 3EG9B 3I5QA 2WB7A 2VASA 2L81A 1M2VA 2LSEA 4JW1A 1TKNA 2X51A 4OIOF 1FFHA 4CBEA 2XRHA 4O6YA 2KGOA 3ZVRA 4YT2A 4IAOA 4XLPF 2XSEA 2R7UA 4IRUA 1KU2A 4OIPF 4CIHA 2V3CC 3M1CB 3DAFA 3QMKA 5T1DB 2FFHA 2QY9A 3NYMA 2DYRC 4BJ5C 5E3CA 3TD7A 1G8XA 3EFOB 4U5HA 2M4EA 1LVKA 2GFHA 2J46A 1D1BA 5D92A 2Z15A 4FESA 5E2QA 3K1HA 3AG1C 5DQZA 3CQZA 4OIRF 3ZSUA 3KMIA 2IYLD 2Y3BA 3IEEA 3PMRA 4O7GA 4CS8C 3ZIBA 3LLKA 4DOZA 1J8YF 2Q3TA 4CSAC 1Z3IX 1TWHA 1VOMA 3LESA 2H7OA 2Y3HA 3UR3C 4EWCA 4U5DE 2DGJA 5CI9A 4GEHA 4KI2A 2O9XA 3I5PA 1RJ9B 5KYUB 3JSZA 3NKEA 1ZU5A 1ZU4A 3DXJF 2A69F 3RIPA 2MWQA 2PX3A 4CSAA 3CSKA 4U5BE 3HTKC 3EGXA 3DMDA 3LJBA 3EPVA 3AQBA 3LLIA 5D91A 3WODF 2R7TA 4O6MA 1QZXA 3FDQA 1PCXA 4BJTA 1MMDA 3B0PA 1NZEA 3B9QA 3UMIA 2HV7A 1SZIA 5FCLA 4JZAA 2WL8A 5T3TA 2H7VC 2BE5F 5KYYA 4PJLA 2P6VA 5E3AA 3N24A 3O6XA 3ABKC 5KYWA 4FWVA 4U5CE 1JPJA 3DAGA 4BJ1A 4XWJA 3F47A 4LERA 1NU9C 3EH2A 3ASOC 2DYSC 1M57C 3Q6NA 1O87A 2CGEA 3EG9A 3RKOF 3EH1A 5B1BC 3B0UX 4KNVA 2I8BA 2J0XA 2A6HF 2IOQA 4W8KA 1D0XA 3AG4C 1MNEA 3EZHA 4QI0A 3Q7GA 2YHSA 3RYLA 3N2ZB 1SF8A 1ZHYA 1MMNA 3S27A 1JPNA 3EQLF 4AE4A 5L3VA 4PJJA 3EFOA 1TWCA 4C3BA 3Q7LA 2YEVA 4GYTA 4OD5A 4PFOA 3K66A 5EHHA 4PFPA 2WZGA 5DS4A 1TWGA 2D5RB 3EHNA 3H65A 2A6EF 5B1AC 4B6IA 5EGYA 3LNRA 4I44A 4Q4ZF 2R7XA 2PF4E 2WZLA 4RBNA 5B3SC 4G7OF 3QZCA 1V54C 3VYWA 5KYXB 4YWQA 2KQ9A 1SMYF 2J0WA 1RJ9A 4G7HF 4KNWA 4LACB 4N06A 1ZHTA 3NRHA 3GODA 5KYUA 2R7SA 4G0HA 2Y39A 1PD1A 4OINF 2Q9CA 2G3KA 4DBQA 3OA1A 1FTSA 2J9WA 3B0VC 4U5GA 1S7ZA 2J45A 4I1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5H A;  4YWQ A;  3X1O A;  4QI2 A;  5F5F A;  4QI0 A;  4ZLC A;  4ULW A;  4ZLD A; 
#chains in the Genus database with same CATH topology
 4U5E E;  1O3U A;  1U89 A;  1ZZP A;  4K0D A;  4DJ9 A;  1Z5Z A;  1C17 M;  3JYY A;  3DM9 B;  2LIG A;  2Q9B A;  2L6H A;  3GOR A;  2Y69 C;  4PJM A;  4XQ1 A;  3AG2 C;  3EZI A;  5A69 A;  1LIH A;  2ZXO A;  5IY5 C;  5DS5 A;  1ZVZ A;  2HS5 A;  2R25 A;  2FAP B;  4MVR A;  4K1O A;  3T4R A;  4EUK B;  3E9V A;  1D0Z A;  1GQA A;  3AQC A;  4AL1 A;  3PHF 2;  3X1O A;  2NUT B;  2QLA A;  1WN0 A;  4LLE A;  1XZP A;  4RD9 A;  4P9T A;  3TK0 A;  5COF A;  5CIV A;  2XLV A;  3GEI A;  4YK5 A;  2E87 A;  4JTA B;  1FMV A;  1A41 A;  3M4C A;  4WGY A;  5COM A;  5T3W A;  2XLW A;  2WVN A;  2KJG A;  4W8P A;  2XXA B;  1FR0 A;  3KKB A;  4JRZ A;  2PX0 A;  4YT8 A;  4CJG A;  3LUT B;  1VYI A;  3LAY A;  5JP7 A;  2ZXW C;  4KC9 A;  4ANJ A;  1EQ1 A;  2R05 A;  1NG1 A;  3SNH A;  1RKE A;  4DRI B;  5E33 A;  3K1I A;  4MVZ A;  3ZTM A;  2EPL X;  1KTM A;  2W4M A;  3G4X A;  2NSG A;  4D4X A;  2YLG A;  5L3Q A;  2C04 A;  2MYS A;  2UUH A;  3DJU B;  3U3B A;  3DD7 A;  2YLI A;  3HLZ A;  3ZTZ A;  2H8A A;  2CDQ A;  4DVY P;  4MTF A;  1TFK B;  2TMV P;  3C7J A;  1M56 C;  3K33 A;  1QLE C;  3DWW A;  3ATP A;  2J9U A;  5A6J A;  4NY3 A;  2YLD A;  1W2W A;  3ABM C;  2WVQ A;  3T6B A;  1Z63 A;  1UG7 A;  1ZHX A;  1HW2 A;  1NU7 D;  3JYH A;  4O6N A;  1PD0 A;  3NDB B;  2XL8 A;  3S28 A;  2J9B A;  3U0C A;  2IXO A;  1JMW A;  3LEV A;  3MYF A;  1Z7Q c;  2XL6 A;  3RVY A;  2C03 A;  4EHP A;  2FGY A;  1IZM A;  3ECS A;  1EKY A;  4G7Z F;  3QTH A;  1V55 C;  3MBG A;  5L0D A;  4BJ6 A;  2QTV A;  1T6Q A;  4G78 A;  4J30 B;  2LFD A;  1H9T A;  1BR1 A;  4CS7 A;  3HNI A;  1DOV A;  1GS9 A;  3GWL A;  4NCQ A;  2VB6 A;  1BR4 A;  1TR2 A;  2R7W A;  3RQG A;  1YYJ A;  1G5Z A;  1ZHZ A;  3L0I A;  1A7D A;  4HEA J;  1GM5 A;  3JSE O;  4C7O B;  1ZW3 A;  1ZYR F;  1G4W R;  2EIK C;  2NG1 A;  2W9Y A;  4E17 A;  2GDC A;  3H2U A;  2L6G A;  4PAC A;  4XPW A;  1AVO B;  3IPM O;  4M63 A;  1D1C A;  1OR3 A;  4YN0 B;  4U9D A;  2W4B A;  1OW6 A;  2YKZ A;  1LM3 B;  4UDV A;  3G4Z A;  1RCP A;  3ITF A;  3SP1 A;  3FHD A;  3O39 A;  2R7V A;  3W2V A;  2Y3D A;  3VAY A;  4U5F E;  3EGD B;  5KYN A;  4EBB A;  3RFY A;  5COG A;  5KYX A;  1Z23 A;  3ZC4 A;  4XEV A;  3AG3 C;  4JCZ A;  1Q0M A;  2KSF A;  1APC A;  1H9G A;  3TOM A;  4E7S A;  4XPX A;  2AWC A;  2B0J A;  4H4K C;  3WAQ A;  3SYN A;  4NQF A;  2I15 A;  2XS8 A;  1IW7 F;  1ORY A;  2IBF A;  2L7A A;  3NYL A;  3NKD A;  3QW0 A;  4JUR I;  4ZLC A;  2JD3 A;  1LKX A;  1NFO A;  4O79 A;  1ST6 A;  2KYH A;  4JC7 A;  3F46 A;  4CDY A;  4YL0 A;  5AC4 A;  4NTF A;  5DS6 A;  2QNL A;  4DRJ B;  2OCC C;  3T6J A;  2YL1 A;  2R7O A;  2YL3 A;  4JEB A;  4YL1 A;  1PV3 A;  3WG7 C;  4BEM J;  4DVZ A;  3MFN A;  2PFD A;  1U0B B;  4I3M A;  4P6I C;  3A11 A;  1NBB A;  4WAB A;  2XM4 A;  2XLO A;  3M79 A;  5DLJ A;  1BBH A;  3S84 A;  5T1D B;  4XEK A;  3O55 A;  3L1M A;  2OKU A;  1WGW A;  2HUJ A;  4AX2 A;  3IHU A;  2ZXR A;  4N6H A;  4MQ9 F;  3N0T A;  4IWB A;  2NUP B;  4MW3 A;  2CNW A;  2CW0 F;  4QDL A;  2EIJ C;  4LDR A;  4F4B A;  1E86 A;  2W45 A;  3OWT A;  2NUT A;  4C3E A;  2OU6 A;  1OCR C;  2HV6 A;  2OQM A;  1MMG A;  1VLS A;  2JPU A;  1WTY A;  3CZ6 A;  3DM5 A;  4Q7C A;  1F1M A;  4K7B A;  4U9E A;  2IXM A;  1FMW A;  3M4B A;  4E7Z A;  3E70 C;  1O5H A;  1LPE A;  3HNK A;  3KL4 A;  1LI5 A;  4LLC A;  3HKK A;  1YA7 O;  3U2L A;  1A0B A;  5HSW A;  2ASR A;  1KNY A;  5JLI A;  2XXA A;  1K04 A;  3JCU Q;  2A0U A;  3KYI A;  2AVK A;  4PK4 A;  4ULW A;  2A68 F;  2DI3 A;  1N1C A;  3ASN C;  4JEA A;  2P1A A;  2YL0 A;  2CNW D;  2XM0 A;  2VH3 A;  2R03 A;  4PR9 A;  4RDA A;  4YL3 A;  1VYK A;  4E0H A;  1XZQ A;  2QUP A;  4HFK B;  4JJF A;  5CI8 A;  3VRC A;  2LQG A;  4AE4 B;  3UGP A;  3C63 A;  4JE9 A;  3ZQY A;  3DI5 A;  2WVO A;  3SEO A;  3K1I C;  4OD4 A;  4I1M A;  1R4T A;  3ZG1 A;  5F28 E;  1VK5 A;  3DZA A;  1OKK A;  3LS1 A;  4PJN A;  1VTM P;  4DRH B;  3EJN A;  2V26 A;  1R5I D;  2ZPA A;  1HE9 A;  2EIN C;  1Y6D A;  4ZLD A;  2HSB A;  4QI2 A;  5DQT A;  1LS1 A;  1M2V B;  256B A;  3K7D A;  1OCO C;  1Q0D A;  2RSE B;  4A2N B;  4CS9 C;  2EIM C;  3W8I A;  4BEJ A;  4E0I A;  4BJ5 A;  1TQG A;  2XLD A;  3JT1 A;  4MND A;  2LD6 A;  3K6B A;  3CEX A;  3FMS A;  1WAT A;  3MLG A;  5DVW A;  1QPU A;  3Q6M A;  3VM6 A;  4BJ6 C;  4L6R A;  5BUO A;  2XL4 A;  4JVS A;  2F22 A;  2R7R A;  1OKK D;  3UGO A;  4C7O A;  3OEO A;  3AJM A;  3S29 A;  3ZQV A;  1OCZ C;  3EHM A;  1B68 A;  1VMA A;  5TJ5 E;  2OOC A;  4Q5S F;  1T5O A;  3NMJ A;  1JR8 A;  3W2W A;  1T01 A;  4J7T A;  4CDA A;  4CS8 A;  3ABL C;  4IJJ A;  3C18 A;  3IQT A;  2G62 A;  2HJ3 A;  3KH2 A;  5AC5 A;  4CS9 A;  4MVO A;  3FOO A;  4XTK A;  1DOW A;  1YAU O;  2H7B A;  3C8G B;  3L34 A;  3GWN A;  4JTC B;  3EGD A;  2PNO A;  4FAP B;  2EPM X;  4EBJ A;  4DOZ A;  4JTD B;  1E85 A;  1Z6A A;  2OG2 A;  1CPR A;  2GA0 A;  4JCH A;  5L0G A;  2WZF A;  3HNJ A;  5JS5 A;  2IXN A;  4IAQ A;  3S90 A;  1AUE A;  3WHN A;  2Q9A A;  1EA8 A;  4HFF B;  4CJO A;  4FX5 A;  3JRT A;  1H7I A;  3QW1 A;  3V5X A;  2OJE D;  4IB4 A;  4GQH A;  2P0N A;  1HY5 A;  3FAJ A;  1I4Z A;  2LCH A;  1M2O A;  2LK4 A;  3SZR A;  3A9C A;  2ZXP A;  2RD9 A;  4AL0 A;  4NC3 A;  3JZ0 A;  4J32 B;  4ONS A;  3UNG C;  2YQY A;  3FAP B;  4MVS A;  4WJ0 A;  1JRA A;  1OQC A;  2KW3 C;  3TJ6 A;  4A4A A;  5BQH A;  2VCA A;  2JX0 A;  4HE8 D;  2J9V A;  2EIL C;  2VCC A;  2EPN A;  1OW7 A;  4DBR A;  1NSG B;  5JRA A;  1BR2 A;  2J7P A;  2R7Q A;  1RMV A;  3EGX B;  4KBL A;  4OIQ F;  3NG1 A;  4LDQ A;  5JSL A;  2LFF A;  2NUP A;  4MTG A;  2P7V A;  2G3V A;  4EKW A;  1TWA A;  1MQV A;  2P61 A;  1D0Y A;  1MMA A;  3W8H A;  2XLE A;  2IXP A;  2YRF A;  1OCC C;  4BG0 A;  3CAX A;  3MX3 A;  2XS1 A;  3V7O A;  1T9K A;  2YVK A;  4AK9 A;  5F5H A;  1J8M F;  3GEE A;  3I4U A;  1Q0G A;  1V74 B;  2L6F A;  3T9O A;  2KK1 A;  2D4U A;  4XEF A;  5FZT A;  2HZ8 A;  3UMH A;  1AEP A;  3X2Q C;  3POV A;  3DE9 A;  2DB4 A;  3RH3 A;  4JJG A;  5B3I A;  1GGQ A;  2A1D D;  2XLH A;  5KYY B;  1FFT C;  3HJC A;  2J7P D;  5L0H A;  1D1A A;  2KNH A;  3LS0 A;  4YT4 A;  5KYW B;  3AGT A;  4LDK A;  3S0X A;  1LI7 A;  5L0F A;  4MS2 A;  4YJW A;  4Z9J A;  5F5F A;  2J8W A;  2OEX A;  1LE2 A;  3GM2 A;  5BQI A;  1ZHW A;  3IQ5 A;  4R32 A;  1MND A;  3RW0 A;  2ICW G;  2PP4 A;  2YZS A;  1HE1 A;  3GAN A;  1RKC A;  2L9J A;  3NYJ A;  2Y3G A;  3QVZ A;  4C3D A;  3FVY A;  4XLN F;  4EBK A;  3DJN B;  3V5Z A;  4YT5 A;  1OXK A;  4X0R A;  3UMK A;  1LE4 A;  2AWY A;  1ORS C;  1YJG A;  3EG9 B;  2BC5 A;  3I5Q A;  2WB7 A;  2VAS A;  4J7Y A;  3TOL A;  1WWP A;  1XWJ A;  1S05 A;  4MW8 A;  3SXK A;  1OR2 A;  3GM3 A;  3V5Y A;  2L81 A;  1M2V A;  2LSE A;  4JW1 A;  1TKN A;  1YAR O;  2X51 A;  1FFH A;  3BEH A;  4CBE A;  2XRH A;  4O6Y A;  3RQF A;  2KGO A;  3ZVR A;  4YT2 A;  1YVI A;  3LNM B;  4IAO A;  2KC3 A;  4XLP F;  4EIY A;  1HMO A;  2XSE A;  2R7U A;  4IRU A;  1KU2 A;  1QKR A;  4OIP F;  4DXW A;  4CIH A;  2V3C C;  3NMI A;  3M1C B;  3DAF A;  4OIO F;  1L7C A;  2EPO A;  2FFH A;  2YWA A;  2QY9 A;  3NMK A;  2DYR C;  3NYM A;  3QMK A;  5E3C A;  4BJ5 C;  5L0I A;  2A0B A;  1G8X A;  3TD7 A;  2QE9 A;  3EFO B;  5BQG A;  4U5H A;  2M4E A;  1LVK A;  2GFH A;  3KYJ A;  2J46 A;  2OJQ A;  1D1B A;  5D92 A;  5L0J A;  1L3P A;  2Z15 A;  3C8Z A;  1I4Y A;  4FES A;  1M6T A;  5E2Q A;  3K1H A;  3AG1 C;  1HMD A;  5DQZ A;  3PCV A;  3CQZ A;  2NPU A;  4JKV A;  1K05 A;  4OIR F;  3C8G A;  3DKA A;  2BL2 A;  3KMI A;  3ZSU A;  2IYL D;  1HW1 A;  2Y3B A;  2ZD9 A;  3IEE A;  3PMR A;  4O7G A;  3ZDL A;  4MVU A;  3ZIB A;  4CS8 C;  3SXZ A;  1SYQ A;  1Q0F A;  3LLK A;  1J8Y F;  2Q3T A;  2HMZ A;  4Z9I A;  2VCB A;  3HNL A;  3SXM A;  4D4N A;  4CSA C;  1Z3I X;  2ETS A;  2GWW A;  2VC9 A;  1TWH A;  2UUI A;  1VOM A;  3LES A;  3AGU A;  4N6C A;  2H7O A;  2Y3H A;  3U5S A;  1FNT c;  3U9J A;  1JAF A;  3TJ5 A;  3UR3 C;  3W4Y A;  3KPH A;  1E2X A;  3U3F A;  1Q0K A;  5JT4 A;  1E84 A;  3BRJ A;  4U5D E;  2DGJ A;  4EWC A;  5A6B A;  5CI9 A;  4GEH A;  4KI2 A;  3DE8 A;  2O9X A;  2R02 A;  3I5P A;  1RJ9 B;  4MVM A;  2HFI A;  1C03 A;  3C8G D;  1TFO B;  5KYU B;  3JSZ A;  5AGF A;  3NKE A;  1ZU5 A;  4H54 A;  1ZU4 A;  3DXJ F;  2A69 F;  2NSF A;  2OEV A;  2CCY A;  2MWQ A;  2PX3 A;  3CSK A;  3RIP A;  4CSA A;  1WOL A;  4U5B E;  3G50 A;  2Q4F A;  3HTK C;  3EGX A;  3DMD A;  4JIO A;  3LJB A;  1C02 A;  3EPV A;  3AQB A;  1CGN A;  3L8I A;  3LLI A;  5D91 A;  3O10 A;  3WOD F;  2R7T A;  3MYI A;  2HSQ A;  3R2P A;  4O6M A;  5A6B D;  1QZX A;  3FDQ A;  5JVE A;  1E83 A;  3AOU A;  1PCX A;  1UFB A;  2YL7 A;  4BJT A;  1MMD A;  3B0P A;  1NZE A;  4NTA A;  3T6G B;  3B9Q A;  1OW8 A;  2HV7 A;  3UMI A;  1SZI A;  4CX9 A;  4MVQ A;  5FCL A;  4JZA A;  2HKV A;  3S9O A;  3R7C A;  2WL8 A;  5A6K A;  2AP3 A;  2H7V C;  1SR2 A;  5T3T A;  2BE5 F;  2IM8 A;  5KYY A;  1BZ4 A;  4PJL A;  2Q00 A;  1NLX A;  2P6V A;  5E3A A;  1U6H A;  3US6 A;  3N24 A;  2LP4 A;  3O6X A;  3ABK C;  5KYW A;  1H6G A;  4FWV A;  4U5C E;  1FAP B;  1JPJ A;  3DAG A;  4IAR A;  4BJ1 A;  1YA9 A;  3PDM P;  4XWJ A;  2XLM A;  3F47 A;  4LER A;  1YDI A;  3IQ6 A;  5JUA A;  4ER9 A;  3TQO A;  1NU9 C;  2R9R B;  3EH2 A;  3ASO C;  5EK0 A;  1A7E A;  1M57 C;  1ZW2 A;  1QVX A;  1RKE B;  2DYS C;  3Q6N A;  4ULV A;  5K0I A;  1O87 A;  2CGE A;  3EG9 A;  2Q7R A;  3RKO F;  3EH1 A;  3SXY A;  1K40 A;  5B1B C;  4E18 A;  3IQC A;  3B0U X;  4KNV A;  2I8B A;  1YZC A;  4XPY A;  3RQE A;  3B29 A;  3U8V A;  1VLT A;  2J0X A;  2A6H F;  2IOQ A;  4W8K A;  1D0X A;  3AG4 C;  1MNE A;  3EZH A;  3L8J A;  4QI0 A;  3C62 A;  3Q7G A;  3JRM O;  3H2V A;  3GEH A;  1CGO A;  2YHS A;  3QVY A;  3N2Z B;  3RYL A;  4CDV A;  1QSP A;  3M15 A;  3ZWI A;  3J06 A;  5L0C A;  1SF8 A;  1ZHY A;  1MMN A;  4Z9H A;  3S27 A;  1JPN A;  3EQL F;  4AE4 A;  5L3V A;  4PJJ A;  4WGZ A;  1JOG A;  3EFO A;  1RXQ A;  1A7V A;  2GAQ A;  1TWC A;  3RVZ A;  4C3B A;  3RF3 A;  3Q7L A;  1OXB A;  2YEV A;  4GYT A;  5HV9 A;  1V4A A;  4OD5 A;  4NTB A;  4PFO A;  3K66 A;  3TUL A;  3U2M A;  5EHH A;  4PFP A;  2WZG A;  1CPQ A;  5DS4 A;  1T6I A;  1TWG A;  2D5R B;  3EHN A;  3H65 A;  3B71 A;  2A6E F;  1YYX A;  2MHR A;  4N4W A;  5B1A C;  4B6I A;  2EPK X;  4IGG A;  3LNR A;  4I44 A;  5EGY A;  4Q4Z F;  2R7X A;  3U8P A;  2PF4 E;  2WZL A;  4RBN A;  3VF0 A;  5B3S C;  4MTO A;  5GPG B;  1QQ3 A;  4G7O F;  4P9F A;  3QZC A;  1V54 C;  1Y4C A;  1T6U A;  2HMQ A;  3VYW A;  2B0H A;  5KYX B;  2M64 A;  2AU5 A;  2KQ9 A;  1NFN A;  3JTL O;  1SMY F;  2J0W A;  4BPM A;  1I5N A;  4YWQ A;  1WAS A;  2HJM A;  3LEO A;  1VB5 A;  3FXH A;  1RJ9 A;  2CYD A;  4KNW A;  4G7H F;  4LAC B;  1G4U S;  4N06 A;  2X0C A;  1BDJ B;  1ZHT A;  4CIP A;  3NRH A;  3GOD A;  5KYU A;  2R7S A;  4G0H A;  2Y39 A;  1PD1 A;  4OIN F;  1ORJ A;  2Q9C A;  2G3K A;  1YLM A;  4DBQ A;  3OA1 A;  3GM1 A;  1CGM E;  1FTS A;  1YZA A;  3FOP A;  2J9W A;  3B0V C;  2PBE A;  4U5G A;  1LS4 A;  1S7Z A;  3U9M A;  2J45 A;  4I1O B;  1EI7 A;  5A6A A; 
#chains in the Genus database with same CATH homology
 4U5E E;  4K0D A;  1Z5Z A;  3DM9 B;  2Q9B A;  4PJM A;  2Y69 C;  3AG2 C;  3EZI A;  2ZXO A;  5IY5 C;  5DS5 A;  3T4R A;  3E9V A;  1D0Z A;  3AQC A;  3PHF 2;  3X1O A;  2NUT B;  4LLE A;  4RD9 A;  2E87 A;  1FMV A;  5T3W A;  2WVN A;  2KJG A;  2XXA B;  3KKB A;  4YT8 A;  2PX0 A;  1VYI A;  3LAY A;  2ZXW C;  4KC9 A;  4ANJ A;  1NG1 A;  3SNH A;  5E33 A;  2W4M A;  5L3Q A;  2C04 A;  2MYS A;  4DVY P;  3DJU B;  3DD7 A;  3HLZ A;  2CDQ A;  1M56 C;  3K33 A;  1QLE C;  2J9U A;  4NY3 A;  3ABM C;  1W2W A;  3T6B A;  2WVQ A;  1Z63 A;  1ZHX A;  3JYH A;  1NU7 D;  4O6N A;  1PD0 A;  3NDB B;  3S28 A;  2IXO A;  3LEV A;  2C03 A;  2FGY A;  1IZM A;  3ECS A;  4G7Z F;  1V55 C;  4BJ6 A;  2QTV A;  4J30 B;  1BR1 A;  4CS7 A;  2VB6 A;  1BR4 A;  1TR2 A;  2R7W A;  1ZHZ A;  3L0I A;  4HEA J;  4C7O B;  1ZYR F;  2EIK C;  2NG1 A;  2W9Y A;  4M63 A;  1D1C A;  4YN0 B;  2W4B A;  3ITF A;  3SP1 A;  3FHD A;  3O39 A;  2R7V A;  3W2V A;  2Y3D A;  3VAY A;  4U5F E;  3EGD B;  5KYN A;  4EBB A;  3RFY A;  5KYX A;  1Z23 A;  3AG3 C;  4E7S A;  2B0J A;  4H4K C;  3SYN A;  1IW7 F;  3NYL A;  4JUR I;  4ZLC A;  3NKD A;  2JD3 A;  1LKX A;  4O79 A;  1ST6 A;  3F46 A;  5DS6 A;  2OCC C;  3T6J A;  3WG7 C;  2R7O A;  4DVZ A;  2PFD A;  4I3M A;  4P6I C;  5DLJ A;  1WGW A;  4AX2 A;  2ZXR A;  4MQ9 F;  3N0T A;  4IWB A;  2NUP B;  2CNW A;  2CW0 F;  4QDL A;  2EIJ C;  4F4B A;  2W45 A;  3OWT A;  2NUT A;  4C3E A;  1OCR C;  2HV6 A;  1MMG A;  3CZ6 A;  3DM5 A;  4Q7C A;  4K7B A;  2IXM A;  1FMW A;  4E7Z A;  3E70 C;  1O5H A;  3KL4 A;  4LLC A;  5HSW A;  2XXA A;  3JCU Q;  4PK4 A;  4ULW A;  2A68 F;  1N1C A;  3ASN C;  2CNW D;  2VH3 A;  4RDA A;  1VYK A;  4HFK B;  4JJF A;  5CI8 A;  4AE4 B;  3UGP A;  2WVO A;  3SEO A;  3K1I C;  4OD4 A;  4I1M A;  3ZG1 A;  1VK5 A;  3DZA A;  1OKK A;  3LS1 A;  4PJN A;  3EJN A;  2V26 A;  2ZPA A;  2EIN C;  4ZLD A;  4QI2 A;  5DQT A;  1LS1 A;  1M2V B;  3K7D A;  1OCO C;  4CS9 C;  4A2N B;  2EIM C;  3W8I A;  4BEJ A;  4BJ5 A;  3JT1 A;  4MND A;  3K6B A;  3MLG A;  5DVW A;  3Q6M A;  4BJ6 C;  5BUO A;  2XL4 A;  4JVS A;  2R7R A;  3UGO A;  1OKK D;  4C7O A;  3OEO A;  3S29 A;  1OCZ C;  3EHM A;  1VMA A;  4Q5S F;  3W2W A;  4CS8 A;  3ABL C;  4IJJ A;  2G62 A;  3KH2 A;  4CS9 A;  4XTK A;  2H7B A;  3L34 A;  3EGD A;  1Z6A A;  2OG2 A;  4JCH A;  2WZF A;  2IXN A;  2Q9A A;  4HFF B;  4FX5 A;  3JRT A;  3FAJ A;  3SZR A;  1M2O A;  2ZXP A;  4J32 B;  3UNG C;  4WJ0 A;  2KW3 C;  4HE8 D;  2J9V A;  2EIL C;  4DBR A;  1BR2 A;  2J7P A;  2R7Q A;  3EGX B;  4KBL A;  4OIQ F;  3NG1 A;  2NUP A;  2P7V A;  2G3V A;  1TWA A;  1D0Y A;  1MMA A;  3W8H A;  2IXP A;  1OCC C;  4BG0 A;  3MX3 A;  3V7O A;  4AK9 A;  5F5H A;  1J8M F;  3I4U A;  3ZC4 A;  3X2Q C;  3UMH A;  3POV A;  3RH3 A;  4JJG A;  5KYY B;  2A1D D;  1FFT C;  3HJC A;  2J7P D;  1D1A A;  2KNH A;  3LS0 A;  4YT4 A;  5KYW B;  3S0X A;  5F5F A;  4YJW A;  1ZHW A;  1MND A;  2PP4 A;  2YZS A;  3GAN A;  2L9J A;  3NYJ A;  4C3D A;  2Y3G A;  3FVY A;  4XLN F;  3DJN B;  4YT5 A;  4X0R A;  3UMK A;  3EG9 B;  3I5Q A;  2WB7 A;  2VAS A;  2L81 A;  1M2V A;  2LSE A;  4JW1 A;  1TKN A;  2X51 A;  4OIO F;  1FFH A;  4CBE A;  2XRH A;  4O6Y A;  2KGO A;  3ZVR A;  4YT2 A;  4IAO A;  4XLP F;  2XSE A;  2R7U A;  4IRU A;  1KU2 A;  4OIP F;  4CIH A;  2V3C C;  3M1C B;  3DAF A;  3QMK A;  5T1D B;  2FFH A;  2QY9 A;  3NYM A;  2DYR C;  4BJ5 C;  5E3C A;  3TD7 A;  1G8X A;  3EFO B;  4U5H A;  2M4E A;  1LVK A;  2GFH A;  2J46 A;  1D1B A;  5D92 A;  2Z15 A;  4FES A;  5E2Q A;  3K1H A;  3AG1 C;  5DQZ A;  3CQZ A;  4OIR F;  3ZSU A;  3KMI A;  2IYL D;  2Y3B A;  3IEE A;  3PMR A;  4O7G A;  4CS8 C;  3ZIB A;  3LLK A;  4DOZ A;  1J8Y F;  2Q3T A;  4CSA C;  1Z3I X;  1TWH A;  1VOM A;  3LES A;  2H7O A;  2Y3H A;  3UR3 C;  4EWC A;  4U5D E;  2DGJ A;  5CI9 A;  4GEH A;  4KI2 A;  2O9X A;  3I5P A;  1RJ9 B;  5KYU B;  3JSZ A;  3NKE A;  1ZU5 A;  1ZU4 A;  3DXJ F;  2A69 F;  3RIP A;  2MWQ A;  2PX3 A;  4CSA A;  3CSK A;  4U5B E;  3HTK C;  3EGX A;  3DMD A;  3LJB A;  3EPV A;  3AQB A;  3LLI A;  5D91 A;  3WOD F;  2R7T A;  4O6M A;  1QZX A;  3FDQ A;  1PCX A;  4BJT A;  1MMD A;  3B0P A;  1NZE A;  3B9Q A;  3UMI A;  2HV7 A;  1SZI A;  5FCL A;  4JZA A;  2WL8 A;  5T3T A;  2H7V C;  2BE5 F;  5KYY A;  4PJL A;  2P6V A;  5E3A A;  3N24 A;  3O6X A;  3ABK C;  5KYW A;  4FWV A;  4U5C E;  1JPJ A;  3DAG A;  4BJ1 A;  4XWJ A;  3F47 A;  4LER A;  1NU9 C;  3EH2 A;  3ASO C;  2DYS C;  1M57 C;  3Q6N A;  1O87 A;  2CGE A;  3EG9 A;  3RKO F;  3EH1 A;  5B1B C;  3B0U X;  4KNV A;  2I8B A;  2J0X A;  2A6H F;  2IOQ A;  4W8K A;  1D0X A;  3AG4 C;  1MNE A;  3EZH A;  4QI0 A;  3Q7G A;  2YHS A;  3RYL A;  3N2Z B;  1SF8 A;  1ZHY A;  1MMN A;  3S27 A;  1JPN A;  3EQL F;  4AE4 A;  5L3V A;  4PJJ A;  3EFO A;  1TWC A;  4C3B A;  3Q7L A;  2YEV A;  4GYT A;  4OD5 A;  4PFO A;  3K66 A;  5EHH A;  4PFP A;  2WZG A;  5DS4 A;  1TWG A;  2D5R B;  3EHN A;  3H65 A;  2A6E F;  5B1A C;  4B6I A;  5EGY A;  3LNR A;  4I44 A;  4Q4Z F;  2R7X A;  2PF4 E;  2WZL A;  4RBN A;  5B3S C;  4G7O F;  3QZC A;  1V54 C;  3VYW A;  5KYX B;  4YWQ A;  2KQ9 A;  1SMY F;  2J0W A;  1RJ9 A;  4G7H F;  4KNW A;  4LAC B;  4N06 A;  1ZHT A;  3NRH A;  3GOD A;  5KYU A;  2R7S A;  4G0H A;  2Y39 A;  1PD1 A;  4OIN F;  2Q9C A;  2G3K A;  4DBQ A;  3OA1 A;  1FTS A;  2J9W A;  3B0V C;  4U5G A;  1S7Z A;  2J45 A;  4I1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...