3R2PA

2.2 angstrom crystal structure of c terminal truncated human apolipoprotein a-i reveals the assembly of hdl by dimerization.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
180
structure length
180
Chain Sequence
PPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of C-terminal Truncated Apolipoprotein A-I Reveals the Assembly of High Density Lipoprotein (HDL) by Dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords Apolipoprotein A-I
total genus 68
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.20 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3r2pA02
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 3r2pA01
1LE2A 1NFNA 1NFOA 3R2PA 2KC3A 1AEPA 1B68A 1EA8A 1OR3A 1GW4A 1LE4A 1OR2A 3S84A 1GW3A 1BZ4A 1YA9A 1H7IA 1GS9A 1LPEA 1LS4A 1EQ1A
chains in the Genus database with same CATH superfamily
2Q3IA 2HODB 4OH8B 1URQB 4YWQA 1SQPD 2BCCG 2YWAA 1NFOA 5TISH 2VC9A 3MHVA 2FYUE 3HRNA 4PD4H 3RIPA 4ASVA 4LGDE 4XEFA 2B0HA 3IQCA 1FZCC 1EZVG 5CCHD 2C04A 4JTDB 1NAFA 3NRHA 3IQ6A 4OD4A 2P10A 1BDDA 3LW5J 2PAJA 3Q7LA 2N1TD 3NMIA 3M0DC 5L0JA 4RKUJ 2D2CD 3HNKA 2YO2A 1JOCA 2ZJSE 3PJSK 1AA0A 4LLHA 1SZIA 3L72J 4E17A 2L5GB 1PP9G 1A7EA 1GK4A 4C46A 1Q0FA 4HE8D 2HKVA 1BSNA 3RBXA 3VYWA 1U0BB 5DS6A 1JAFA 3LJBA 2C0WA 2YZSA 3DWWA 3EWKA 3IAOA 4QMAA 3M1CB 1NTZK 5APYA 3D71A 1LTBC 3B4SA 2FFDA 4K0DA 2Y3BA 1HE1A 3M15A 5CCHC 1ZHZA 4JE9A 1KB9I 2QJYB 3EQLF 3JRTA 3F89A 2FYUG 1SQVJ 2X0CA 2LXCB 3GHGB 4ZMDA 1SQBJ 2C0XA 3SWKA 3TF5A 1YJGA 2GUSA 2I1JA 2XLEA 1URQC 1JY2N 2IDBA 2JJLA 4DVYP 3MYIA 1EZVI 3C8VA 1G8XA 3O39A 4YL0A 3AE8C 1BSHA 2Q9BA 2EPNA 2LXBA 3G4ZA 4L74A 2QUPA 1USDA 4U9EA 4EKWA 1ZW2A 2AXCA 2QE7H 4AUWA 4G78A 3JSEO 4HEAJ 5AC5A 1M2VA 2UUHA 4U5HA 3POVA 1NTMJ 3IHUA 1Q90D 3H1HG 3L70J 3KPHA 2WQYC 1A7VA 2GWWA 1W2WA 2HYNA 3B5NB 4E7ZA 2OTKE 4A2NB 3TJ5A 1LE2A 4I6MC 2ZFCA 1KILE 1SQVK 3JRMO 1I5NA 1L0NE 5KYYA 3EGXB 4JKVA 4JYBA 4P9FA 5COGA 4ASWA 3BCCE 1T01A 2GA0A 3CX5H 1L4AD 1JY3N 4OGQC 3ASNC 2KS1A 5E3CA 2ITAA 3C9IA 1GW3A 3AG3C 3PHF2 4EIYA 1SLQA 1H9GA 2MKVA 3CWBJ 3A2AA 2EPKX 5COMA 3UMKA 4HJGH 1SQQJ 1SFCA 3H1IG 1ZW0A 3K1IC 2M8RA 1PL5A 2E74B 3P8CE 1G2CA 4XLNF 2FYNC 1A02J 2IX7C 5HSWA 2MYSA 4WGZA 4PJMA 1M2VB 2NPSB 2J9VA 4PFOA 4N3YB 2Q9CA 2YL7A 2YL1A 3N7NA 2GUVA 4H13C 2B89A 3GORA 3FXDA 4MVZA 3P8MC 2JX0A 2E75B 2Q00A 2WZFA 2PFXA 3U1CA 2E43A 2A06D 4BRYA 2P7VA 3LW5H 2WVQA 2IYPA 1NLXA 1CI6B 1RH5B 5A6KA 4Q5SF 3R2PA 4QDLA 2HFIA 3IF4A 1QX8A 1L0LD 1RE3C 2D5RB 5BU5A 1AEPA 3CCJP 1QL1A 3IQ5A 5AVXB 2W6AA 2XDJA 1RF1C 1N1CA 1ZR2A 2QIWA 4PR9A 1A7DA 3T9OA 3B5ND 3V2PA 2YL3A 1AVOA 3G71P 3G4XA 4PJ0H 1S2EA 2Z15A 1RKEA 3CEXA 4MTGA 2OKUA 3PRJA 3KYIA 3V5XA 5DS4A 1RXQA 1IFIA 3V5ZA 1Z23A 3U2MA 1QEXA 2D4UA 5L3QA 2CDQA 1XZQA 2OCCC 3UMHA 1LT9A 2XLMA 1VQ5P 2OYHC 3RF3A 1VQPP 2QRXA 2ZPAA 4J7TA 3H1ID 1G5ZA 5DQZA 3ZQYA 5KJ7A 2OEVA 2I8BA 3GEIA 4JURI 2M0BA 2CYDA 4DXWA 4OIQF 1MFZA 4W8PA 2LKMA 5JVEA 3ABVC 4JEBA 5BVZA 4H0LB 4Z9HA 1J1EB 2QSIA 4KNVA 4N06A 5T3WA 2JP3A 4MW3A 2NPSD 2V26A 4IFFA 2KK7A 3L74G 3S0XA 3MFNA 2N1TC 3B9QA 5DVWA 2RSEB 2R7RA 1SF8A 4PACA 1M1JB 2MHRA 2B88A 2LP4A 2HLOA 3LEOA 3M79A 3CC2P 2QVAA 3L35A 2QJKB 1O3UA 1N86A 1L0LG 4AE4A 3WODF 1ZN5A 2FXOA 1OXZA 1FU1A 2IBZG 2LIGA 4I1LA 3K33A 4AE4B 2HG5D 2HS5A 1Q86Q 3L74J 3CXHI 5AW2B 4WJ0A 1LTTC 3CD6P 3WUTA 2DW3A 4O79A 4WY4A 1TWAA 2WSSH 1KC8Q 3T6JA 1M1JA 1GL2C 2LD6A 1WMKA 4NPEA 1Y47A 4NPDA 3L75D 1JB0J 4Z9JA 5APVA 4JPZB 4N4WA 4NY3A 3L37A 5BU8B 3CCRP 4QI0A 3FXEA 1HJ0A 2KSFA 3L70D 2ZYGA 4GKGA 4IGGA 5KLVE 3L73D 2Q3EA 2ETSA 3GHGC 2YEVA 2YKZA 5KYNA 1SR2A 1NH4A 4LDRA 1V55C 3TOMA 2ZD9A 1BGYD 1N73C 1URQA 1NKNA 1P84I 2EPMX 4XEKA 1L7CA 1KQSO 2DGJA 4L6RA 1VQNP 2N1TA 1DEBA 2WMMA 3A0BH 3E9VA 3H1JJ 1LTIC 5EFWB 5B5EH 1L0NG 1SQXG 4LLCA 1JM0A 3GLMA 1M56C 4FESA 1K05A 2C9NY 3L72E 4DRIB 1N7SD 1ORSC 1NTZD 4PD4I 5AVYB 4Q7CA 1D1BA 2EIMC 3H1HE 3D6ZA 3DD7A 3MD0A 3EG9B 2J46A 3NDBB 3ZTZA 5KLVG 4JBZA 3WUUA 2EIJC 5A6AA 4J32B 1SQXD 3AEDC 3U2LA 4H44B 3GW6A 2OYHA 1FAPB 1VQLP 2IPPA 5APUA 3MZWB 4XA4A 2Q7CA 4YT5A 1YZAA 5KYWB 3ZG1A 1H9TA 4NTBA 3G3ZA 1UFBA 2IXMA 2Q5UA 1GU5A 2A0UA 2J59M 1J1DC 1LTJA 4CS8C 2HZ8A 1EKYA 3EGXA 1RE4C 1KILD 1FDIA 1T6QA 2E76C 4IFMA 2R02A 3KZIH 3JTLO 4U9DA 3O8ZA 4JTCB 3U3FA 2Y0EA 3RK2C 3FGAD 1E85A 2JPUA 4JCZA 1L0LK 3H1LG 1YJ9P 1BR4A 1WATA 2J7PA 1FE6A 2A45I 4BWNA 1N2DC 3FMSA 3RH3A 3TNUA 2Y39A 2YKPA 4FX5A 5L0IA 1HY5A 4XPXA 3JCUE 3MTUE 4PV1B 3SWYA 1PIXA 3H1JD 1EXJA 3U59A 4MW8A 3TGUD 4KT0J 5AVQB 2WL8A 5BQGA 1YQ4C 3SFDC 2DYSC 1CSBA 3M4BA 4DBQA 5CJ4A 1WT6A 2J7PD 1CPRA 1IFJA 1RKEB 3CX5D 1T6IA 1BE3J 4WB4A 4YXWH 1WTYA 4G7HF 4JTAB 1SQQE 1G4WR 3T4RA 2P1JA 3I55P 3DE9A 4OIOF 3GM2A 2IYLD 1KYOI 4Z1MH 2ZT9D 1PGPA 4KNWA 4ZLDA 1JTHA 4EOTA 1LS4A 3NKDA 4OGQB 1KV4A 3HD7A 2BC5A 3M9BA 1FFHA 3H1LE 1JTHB 1NGMB 4GODA 1MMAA 3LLIA 3RVYA 2V4HA 5K5GB 2PRRA 4RBNA 1YA7O 2AP3A 2IBZI 4ER9A 4MVOA 1K40A 3DKAA 5APWA 4YXDC 3MUDC 1RY3A 1LVKA 4ULWA 2IFNA 5F28E 4K35A 2JO1A 3RK3D 4EIJA 1VDFA 4DBRA 2WSCJ 2Y3HA 1LGHB 5EGYA 3H6PA 3Q5RA 2KQ9A 4C3EA 4Q4ZF 1D0YA 1J1EC 4C7OB 2AVKA 1U7MA 3IFMA 1N7SC 1SYQA 1HUCA 1A02F 1EQ7A 4DVZA 2XV5A 3GHGA 2O1KA 4P9TA 1SQPE 2NUPB 4U5EE 5T3TA 1Y9BA 3VMAA 1WASA 2YQYA 2KJGA 1RQUA 1E86A 2LK4A 1BCCE 3V4WA 1NU1J 1QSPA 2V7QJ 1FOSE 3S27A 1S72P 2OG2A 1J8MF 1SQXE 3CPWO 1BDCA 2L9JA 2KP8A 1EI7A 3ZTMA 3OWTA 1JNMA 4EI2A 3PDMP 1PD0A 1H0TB 2YMKA 2PBEA 2A06E 4N6HA 4U3FJ 2IOQA 1NTZE 3Q5SA 1BE3D 3AOUA 4CIPA 2YKQA 1TKNA 3L36A 2W27A 5AGFA 3ZC4A 4K7BA 3CLQA 1LIHA 1ZU4A 1JCCA 1CGME 3E70C 4F4BA 1QPUA 3QH9A 4G7ZF 1NAYA 2WSEJ 3HE5B 2W4BA 2G8YA 4JIOA 3UMIA 3P8CD 1VQ7P 3ITFA 4O7GA 1LJ2A 1Z63A 2E42A 5GTIH 1H0TA 3I5QA 5AC4A 3SNHA 1PP9E 1QZXA 3WMM0 1GS9A 2YHSA 3U0CA 5JSLA 5F5FA 3VTPC 1TFOB 3PP5A 1M8OB 4EYYQ 1Q0GA 3S4RA 4IWBA 1FTSA 5AVRB 3DJNB 4PK4A 2FYZA 2K9JA 4BPMA 1Z6AA 2QTVA 4LACB 4MQ9F 2OYIC 1HMOA 2IFMA 3CCVP 3UGOA 3L71J 1YARO 3L71D 2NUPA 1ZMEC 1HW2A 2BCCJ 3FX0A 4XWJA 3AEEC 1ORYA 5CHXA 1URQD 2YMYA 4UB6E 1N7SB 1RJ9B 3SXMA 3OJAB 2M3EA 4Y99C 4O9BA 2WB7A 2FFHA 3LNRA 3TK0A 4PV1D 2QJPB 3V2QA 4O6YA 5A6JA 1USEA 1TWGA 2AXTH 1EC5A 2QM7A 2MJZA 5JRAA 3AEGC 1XTCC 1SQBG 2H89C 3F5HA 1KU2A 1WGWA 2WPSA 3L74D 2J5UA 3SYNA 5CBOA 2OU6A 4EHPA 3O55A 4U5GA 4N6JA 5BQIA 2WSFH 3H1JE 1MFTA 4ZKPA 1OW6A 3WU2H 4H0LC 1VTMP 1IK7A 3W2WA 1T8ZA 2ZXPA 3S84A 1BZ4A 3RK2D 2JD3A 3BCCG 1BGYJ 3H25A 4U5CE 2KXPB 5CCGA 3VOPA 3H1HJ 3L70G 1YDIA 2GA1A 5KTBA 1YJWP 3PHLA 1KILC 5AW5B 1LNQA 5DQTA 3I5CA 5KYUA 5L3VA 3V4QA 1Q0DA 2IZ0A 2PP6A 2WPVB 2W45A 1JR8A 1KILA 2AEJA 2XU6A 2WT7A 4E7SA 3JYYA 2XL8A 1K04A 3TSIA 1NG1A 4K3AA 1SFCC 3OA1A 1X9VA 5EK0A 4NTAA 2BE5F 3GMAA 3L4FA 4IAOA 3PLNA 3LEVA 1KORA 4CX9A 1YHQP 4WVZA 2YVKA 3IR9A 4QI2A 2XXAB 1IZMA 3CCLP 2K1AA 2XLOA 4G0HA 3O6QA 1RF1B 2ZVOB 4C7RA 5KYWA 4IRUA 1FZCA 2WZGA 3C8ZA 1OVVA 2FXMA 2PF4E 4MVUA 1SFCD 1OQCA 4CS9C 3MLGA 2KNCA 3JSVC 2E75D 5APXA 2XM0A 4H54A 2VCBA 1A41A 1GW4A 3SSUA 3I4UA 3GODA 3M4CA 1S7ZA 3Q7GA 4NQFA 1JMMA 3W8HA 1IO4A 4D6TJ 3FAPB 2Q9AA 1Y8AA 3AQBA 3HTKB 1YITP 1SQXK 2XNDH 1L0ND 1FAVA 1L4AB 3T97B 1FOSF 5APSA 1GDTA 1HF9A 4U5DE 5B1BC 1JY3P 2QJPC 2BEQD 3FWNA 2FY8A 2ZT9C 3KQGA 3U9JA 1KYOE 2D2CC 3R4YA 3RK3B 4ZNCA 4D6TD 2E87A 1E2XA 5H2FE 1VQOP 3FHDA 2ZXEB 4LERA 3CQZA 3ECSA 4BJ1A 1E83A 2FFDB 1ZHTA 4HFFB 3MX3A 2HSQA 4XPYA 4R4LA 2LFFA 2VH3A 4GYTA 3L73G 4B86A 2K9JB 2J58A 5AVTB 3BVHA 3QW1A 1FZFA 1SMYF 4CSAC 1SQQD 4Y28J 2W8ZA 1I4YA 3ABMC 3KL4A 1Y4CA 2R7VA 1C03A 3NYLA 4JW1A 3CCUP 2KGOA 3DZAA 3EZHA 2XZRA 3U5SA 3B29A 3GF7A 1S5LX 1YI2P 1KYOD 1NTKJ 4PD4D 2CNWA 3JYHA 2EIKC 5E33A 5KAIH 3WUVA 1RE4A 3S9OA 5B5EE 3B0VC 4YTPC 1VYIA 3CX5E 4PV1C 1RMVA 1BR2A 3M0DA 1RJ9A 4BEJA 3CI9A 3ITKA 5E79E 2J0XA 2G3AA 3VAYA 1K9MQ 2H7BA 3W8IA 1KFNA 1TQGA 1H6GA 3GANA 1OMIA 1EXIA 2YLIA 3ABLC 3TOLA 2J8WA 4G7OF 2CNWD 2H8PD 2OJED 2B87A 2L6GA 1PGOA 1OW8A 4K1OA 4W8KA 3H65A 1FC2C 1ZHXA 1YBKA 2Y0DA 2EILC 3LUTB 4JEAA 1MNEA 2QJKC 1ZOYC 1CPQA 1M1KQ 4W80A 3OEOA 3ZSUA 2E76B 1QVFO 1IC2A 3L75G 3CWBD 1EDIA 1LWUC 4U3FE 2NRGA 2R7WA 1FR0A 3DXJF 2HJ3A 3L0IA 4J7YA 2K3RA 2HV6A 2R3CA 2NUTA 4I44A 3II6A 1VPCA 1T2KD 2OYIA 1OCOC 4PJNA 4DJ9A 2OTJP 3CSKA 1ZZPA 2HUJA 2Q3TA 1IZNB 2EPLX 1PZQA 4KHXA 4WABA 5DS5A 1BCCG 2YIUC 1VMAA 3K7DA 3AQCA 2KC3A 2WPQA 3VM6A 2BCCD 4WY4C 3MP7B 3VYIA 3AEAC 3EFGA 5CBNA 3TGUG 2P0NA 2KOGA 1OZHA 5AVZB 1OIPA 5KLVK 1YYCA 2FFDC 2HV7A 4YJWA 5A6BA 1HJBA 3H1JG 1KQLA 2EPOA 2RKLA 1FDMA 4HH2A 1LT9B 1NU1G 1KD1Q 4BRYB 4GT1A 1PPJG 2DYRC 5L0HA 1GTWA 1R5LA 3M0AA 1B68A 3SEOA 5KAIE 5AW4B 1NU9C 1TU3F 2XLVA 1OWAA 5L8RJ 2XXAA 1FMWA 3S90A 1KNYA 1OXBA 1D1CA 3USSA 3MBGA 1YVIA 3ZVRA 2CK3H 4E18A 3TJ6A 2HPCA 4EBKA 1VK5A 3M06A 1KYOH 3HD7B 3DMDA 3I5PA 2K9YA 2KSEA 2R7QA 3MGNA 4EDFA 2R5BA 4AK9A 3EFFK 1OFCX 2Q7RA 4GOEA 1AVOB 3A0HH 2OYOA 2JR8A 2R25A 3F47A 4U3FD 3CMEP 2DI3A 5TJ5E 1Q0KA 2AU5A 3AJMA 3CL3D 1LI7A 1R5SA 3HLZA 3HUSB 4OWFA 2L81A 4NC3A 1NSGB 1SP4A 4OIRF 5TISE 4YT2A 3VN0A 2R5DA 3TGUE 1IW7F 4Y99B 2HPCB 1HW1A 1NU1D 4R32A 1IJDB 2M5AB 2E74C 3AG4C 3C7JA 1EA8A 3L8JA 2H43A 1SFCB 4AL1A 5E79H 4OINF 3T6BA 3QVZA 1SQVG 3SWFA 2UWJE 3V6IA 2YKOA 4H44D 2QA4P 1KZUB 1LPEA 3SP1A 2OOCA 3L71G 2YRFA 2IBFA 4U5BE 4JZAA 1CGNA 1EDLA 2XRHA 2WSEH 3H1KE 3AECC 1P84D 2YIUB 3NFQA 1JMWA 1OXKA 2D2CB 3RK3C 3KYJA 4E0HA 5FCLA 2E75C 2IXNA 1PFIA 2QLAA 1Z56A 2KNCB 3CX5I 3HUSC 2OQMA 1LTAC 3EFOA 1TWCA 3KZIE 1KILB 2V7QH 2B9BA 3HKKA 1VLSA 3L74E 4IARA 4ONSA 4RJTA 3H1KD 4WBAA 2WSFJ 3EZIA 2JKVA 1DOVA 1KB9D 3SFEC 3V5YA 5CMZA 3ASOC 3BASA 1RF0C 1DH3A 3N24A 3VP8A 4JF7A 1N73A 1NJIQ 3LIEA 3HE5A 4O6NA 1C17M 3UR3C 3BRVB 3SXYA 1KQFB 1HBWA 4CDAA 3T6GB 2FYUJ 2FKWB 4H4KC 1D0ZA 4YT4A 4EWCA 4I7ZB 2WVOA 3Q1MA 2WVRA 5AW8B 3CC4P 2N9YB 2VCCA 3LLKA 3QZCA 2R7TA 4LDKA 1H7IA 2Q9IA 2E74D 1SQPG 3H1HD 1VLTA 4B6IA 1YJNP 1NTKD 1HWTC 5AW7B 3RQGA 1BE3G 4XPWA 4DJGA 4CSAA 4LLEA 2Y3DA 2FGYA 3A7OA 2P6VA 4C7OA 1DEEG 5JT4A 3B0UX 2W6BA 3A0HE 3B71A 3C8GD 3KHUA 1E84A 2FXPA 1Q2NA 2A06G 3TYYA 1JOGA 1UIIA 1VOMA 3CAXA 5B3SC 2XLHA 4C3DA 5L0FA 2NSFA 4IOIH 5DLJA 2H7HA 3HD7D 3NYMA 4D4NA 3L73E 2RH0A 1SQVE 4J30B 3SXZA 3VMYA 5KJ7D 1OR2A 2ZXXA 1LWUB 3AEBC 2TMVP 5F5HA 2XS8A 3L75E 1T6UA 2P61A 4CS9A 1FJPA 3RBZA 1U89A 4M3LA 3BCCD 4JYCA 2QY9A 4WY4D 1EQ1A 3H32A 1VF5B 2XKMA 3EG9A 5GTHH 5JS5A 3KPEA 4IFDK 2E76D 1IFPA 1X0TA 2NSGA 2O01H 1FMVA 2VB6A 1NO4A 1EZVE 3BRTB 1U57A 1HVVA 3KXDA 1S5LH 4CS7A 1SQXJ 1SQBD 1ZU5A 1Q7YQ 2R7SA 1SQQK 3GM1A 4CIHA 3EH1A 3DAFA 3AE4C 4JCHA 1G4US 3GM3A 1NTZJ 4YPCA 4CBEA 4IB4A 1JEKA 3US6A 1PV3A 1OVUA 4HKZH 2HSBA 3U9MA 1TWHA 1IFDA 3S28A 3P7KA 1GK6A 1QVXA 1VF5C 1KQGB 4H13B 3LS0A 4BXLA 4I1MA 2OGUA 4U7JA 4AX2A 4BJ5C 1MMGA 1ST6A 3KYQA 3HE4B 3AG2C 1FJKA 2M64A 4XQ1A 5E3AA 2R32A 5AVWB 5AVVB 1M6TA 2ZVNB 3O6XA 2WWWA 1D1AA 2M3BA 3GWLA 2Q1KA 2LFDA 3RVZA 1PP9J 3JSZA 4GQHA 1NTZG 1R5ID 3MUDA 1YLMA 1P84H 1FFTC 3AE3C 2R05A 2VCAA 5AW3B 3H1LD 1AUEA 1KN7A 2C03A 2XLWA 3FOOA 4XTKA 1A0BA 2F22A 2K37A 4KI2A 2Z5IA 3GEHA 4DRHB 1HTLC 2KZJA 5JP7A 3L71E 3RGUA 2R9RB 3IQTA 2KS1B 3UIAA 2A6HF 2O3JA 4E0IA 3DAGA 1ZRTE 1E5WA 1OCCC 2A45G 3WU2E 2R7UA 1HMDA 1VL2A 2M4EA 3CCSP 2Y69C 1LS1A 3V2NA 1CGOA 1L0LE 1O87A 1WN0A 3AE7C 1DD4A 3NXSA 1N7SA 3A5TA 3UGPA 5AVUB 3KMIA 1W5CE 2JEEA 1NVOA 3DI5A 2AEFA 3DM9B 2JWDA 2R03A 3LIDA 3K1IA 4M63A 4MTFA 4DRJB 4O6MA 4R4MA 3L72D 2J9UA 3Q5PA 2RN0A 1BBHA 2OJQA 3AE9C 3VP9A 2JDIH 1LI5A 1MV8A 1VYKA 1ZHWA 5KYXA 4H44C 3Q6NA 1ZW3A 2POHA 1YZCA 3X1OA 3WAQA 1MZ9A 1DIPA 2E5YA 4YK5A 1APCA 1T3UA 1L0NJ 2Y3GA 1AFOA 1WWPA 5GTIE 1M57C 4EUKB 1AVYA 3HJCA 1L4AA 4N78E 5E2QA 1NYHA 3B5NC 4IJJA 3EGDA 3TD7A 3V7OA 2IYOA 3CWBG 1G1JA 1SQQG 3EQ2A 3CWBE 3H1IJ 1J1DB 5C39A 3RK2B 1FNTc 4BG0A 2HMQA 3TULA 1X22A 3TGUJ 1IK9A 5KYYB 4BEMJ 3NYJA 2N1TB 4JQ0D 3CXHE 4W7YA 4XE5B 2O01N 1OKKD 1QQ3A 3GWNA 2QM8A 2GDCA 1JY2P 3EFOB 1E79H 1NOHA 3B8EB 3ZQVA 2E5TA 2YLGA 1FS0E 2A1DD 3UNGC 3CXHD 2ZAEB 4ZKUA 1LE4A 2A68F 2MWQA 3N2ZB 3QTHA 1LTGC 2HR3A 3ZWIA 2QG4A 3CCEP 1RKCA 1N7LA 1T6AA 5CI9A 4C3BA 2NPSC 5AW0B 5L0CA 3U8VA 1QLEC 1T5OA 3IEEA 5DJTB 4JJGA 3H1LJ 4I2LC 3A9CA 2XS1A 5HV9A 4YL3A 1QLED 3IPMO 3O10A 1YQ3C 3VMXA 1AJYA 1ZYRF 1HGVA 4BJ6A 3HNIA 4CJGA 1KB9E 1D7MA 3C1LA 1R8EA 2KK1A 4ULVA 1M57D 3QVYA 2WVNA 1BDJB 1ZV8A 1YYXA 3H32B 3C18A 2IBZE 1Z5ZA 1U7JA 4JVSA 2BCCE 1R4TA 2KUBA 4W7ZA 4ZLCA 1VQ4P 3L72G 2H7OA 1LP1B 1NKZB 3QMKA 2G3VA 1XTGB 2XM4A 3N0TA 3RYLA 4C7NB 5B1AC 1GMJA 3E7KA 4AL0A 1K8AQ 2G3KA 1L2PA 2AWCA 1I4ZA 1NTKG 2WTYA 3U1AA 5FZTA 1NTMG 4N6CA 2P7JA 5H2FH 1JO5A 2GFHA 3QWOC 5GTHE 1NU1E 2Y9YA 1JPNA 2NG1A 1SQPK 1GD2E 1JRAA 3PTZA 1F1MA 4UB8H 5CCGD 1NTME 3AGUA 5EHHA 1TR2A 1NWQA 3LS1A 2CW0F 1RHZB 3SZRA 3SXKA 4PJ0E 1WRGA 2FAPB 4WGYA 3RQEA 5B3IA 1NTMD 3DE8A 2XNXA 5CJ0A 3GF3A 1S05A 3BCCJ 1GZLA 4PJLA 3LESA 2P67A 2XL6A 3KKBA 3I56P 1MNDA 4CPGA 3R7CA 5KLIB 3NKEA 2IM8A 2R7XA 1M1JC 3T97A 3L75J 3MYFA 1DOWA 3IN6A 2CCYA 1OCRC 4TT3H 1AQTA 1V74B 2CGEA 1FZBA 3RL0D 3HUSA 1ZVZA 2FBWC 3K6BA 3N4XA 1Y6DA 2XL4A 2YL0A 1OW7A 3RL0C 1Z7Qc 3JC22 2SPZA 3VF0A 5GPGB 4GEHA 4Z9IA 1X79B 3HE4A 2PX0A 1OKKA 2HODA 2VRSA 1DX7A 4LDQA 3AE5C 1N8RQ 1FZGA 2K88A 1AQ5A 1LTJC 2H88C 3CXHH 1FZCB 4MVRA 2KSJA 5KLVJ 1KFMA 4CJOA 2HFED 5BUOA 3J06A 3PCVA 3FDQA 2WPRA 1S4XA 4DT0A 1VQKP 2Z5HA 4OIPF 1IFNA 4MN4C 1EDKA 2QEXP 1MQVA 2NPSA 1L0NK 2RD9A 1PP9D 3EGDB 3JT1A 1YTZT 4FAPB 2KB7P 2WZLA 3ZDMA 1PGQA 1J2JB 1OR3A 3RL0g 3TK1A 4D6TE 1T9KA 2W9YA 1JMBA 4YT8A 2ZXWC 2YXRB 2O01J 3AE6C 3DJUB 4KJMA 2A0BA 1CW5A 1SQVD 1LKXA 4NTFA 1SS1A 4CDVA 1VB5A 5L0DA 2KI7B 3EJNA 2DB4A 1SQBK 3B5NA 3RW0A 4DCKA 4CS8A 2WSCH 2I8DA 1KB9H 1Q0MA 2H8AA 2PFDA 3AE1C 5CCHA 5AW1B 5APTA 2BEZF 2IXPA 3KDPB 1ZRTD 4GDOA 3HD7C 2J9WA 4RD9A 4IAQA 2LCHA 4JRZA 1GL2A 5B66E 2XLDA 1L0LJ 2XSEA 1FZAA 3WG7C 2O9XA 1CZQA 2Y0CA 4N78D 4UB8E 2LR2A 1S1CX 2FYUD 1ZR4A 2A69F 3M9QA 1VF5D 1OVRA 2OQQA 4H0LD 3TNUB 4L75A 5KAFE 1VQ9P 2G62A 1X8YA 3RK3E 3L34A 1ZHYA 5KKZB 1SVFA 2HJMA 2AEMA 3HTKC 1FDOA 3S1KA 3OA7A 1M2OA 3AEFC 2L91A 2KW3C 2LQGA 1XWJA 3EPVA 3B0PA 5D91A 1LT1A 1FBMA 4KC9A 3E1IA 2RMZA 1PPJE 1JCDA 1EZVD 4UB6H 2ZXRA 1VQ8P 2OYIB 2R44A 2WT7B 5JUAA 1BE3E 4L73A 5KLIC 4HYTB 3H1IE 4P6IC 1BR1A 1NZEA 3GEEA 5T1DB 4MVQA 5M1BA 3F46A 3FVYA 1NBBA 3EHNA 2AXTE 5A6BD 3QW0A 4UDVA 3DM5A 4C7NA 1JY3O 1YTZI 3FAJA 2WITA 2J45A 1LTSC 4HFKB 1LWUA 1QKRA 1EDJA 3S29A 3D70A 3AGTA 3H2UA 1M56D 2I15A 1S5LE 2P58A 3FOPA 3LAYA 3H2VA 1RCPA 1QVGO 2FYUK 2NUTB 3C8GB 2X51A 3RFYA 1MUUA 1NTKK 4KBLA 3TDKA 4A4AA 5CIVA 2R3SA 3WHNA 3C8GA 2I1KA 3NMKA 1S3JA 2Q4FA 3CCMP 3W4YA 4FWVA 4IL6E 1L3PA 4MS2A 1CI6A 3C62A 4JC7A 2JWAA 2Y9ZA 3H1KG 1SQBE 4EBJA 5B66H 5KKZC 2W6JH 1T3JA 2ICWG 1S9KD 3O6QB 1RF1A 4A7PA 4JJFA 3M91A 3KH2A 2UUIA 1Q82Q 1ORJA 2OTLP 1NTKE 1FZEA 4D6TG 3U8PA 2YLDA 4I7ZC 2AWYA 3PH0A 4CDYA 2KLVA 1G1IA 2OARA 3CZ6A 4TLFA 4AYCA 3A11A 1ZLLA 3NMJA 1GL2D 3L70E 1M7LA 2KYVA 1U6HA 2A6EF 1YAUO 1OCZC 3LNMB 2N9BA 3K1HA 5JLIA 3A0BE 2J0WA 256BA 5KYXB 3CCQP 3OW2O 3P32A 3FXHA 2QE9A 4RO0A 5DJUB 2ZXOA 1BGYE 3D6YA 3CMAP 3JCUQ 3L8IA 2W90A 3RL0B 3BEHA 4GIFA 1YIJP 3L1MA 3L73J 2VASA 2YNYA 4RDAA 2ASRA 1Q81Q 2QJYC 2Q6QA 1H88A 1GQAA 2PP4A 1UIXA 2NZ2A 5BQHA 4XFJA 5KLVD 2BASA 1MMDA 2H7VC 3ZDLA 3EH2A 3GG2A 1WOLA 2KZIA 4OVNF 4IL6X 5KJ7C 2QNLA 1HGZA 5APQA 3Q2YA 1NU7D 1AV1A 2NPUA 3HNLA 2ZT9B 2Z4EA 4MTOA 1C02A 3RKOF 1H89A 4WY4B 4I3MA 1M90Q 4NCQA 2ZYAA 1V4AA 2M5AA 1NFNA 1G2CB 4DOJA 3MIWA 1ZP0C 5IY5C 4XLPF 3NMDA 1MKMA 1LTJB 5TJHA 2FYNB 3NG1A 2PGDA 4BJ6C 3AE2C 1XZPA 4GOFA 4YL1A 3K66A 3X2QC 1GU4A 4PD4E 1D0XA 5L0GA 2LSEA 1OX3A 3PMRA 3M9HA 4I1OB 5COFA 3G4SP 4YN0B 3OAKA 3W2VA 4HB1A 4XEVA 1YYJA 1GM5A 3Q3DA 1W2EA 5K0IA 3VMZA 2L6FA 3U3BA 1O5HA 1JUNA 1PPJD 2OEXA 1T2KC 4L76A 1TFKB 1NTMK 2WZ7A 3G6EP 1JY2O 1Z3IX 2BL2A 1P84E 3HTKA 4H13D 2CPBA 4MVSA 2J9BA 1NU1K 3Q6MA 2P1AA 1N73B 2KIKA 1LM3B 1NHLA 5AVSB 1S9KE 1IFMA 1LT9C 1SQPJ 1KTMA 1L4AC 4OGQD 4PFPA 2YXQB 3VRCA 5AW6B 4PJJA 2CPSA 2IBZD 2W83C 3EHMA 1MMNA 4MNDA 1BCCJ 5KAFH 3CC7P 1BCCD 2EINC 4IL6H 2PNOA 5AW9B 4OD5A 5CI8A 1GGQA 1BGYG 1VQ6P 3AG1C 3V2RA 4WWIA 3E1RA 1H8AA 2O1JA 2B87B 1KMIZ 4U3FG 3RQFA 1RF0A 3ZIBA 2R7OA 3W67A 1RE3A 1VQMP 2HMZA 5CCGC 1GL2B 3ATPA 2GAQA 1UG7A 2GM4A 1QL2A 3HNJA 4BJ5A 2L7AA 1V54C 1LP1A 3FWLA 4DOZA 2OYHB 1QGKB 1DD3A 3C63A 1JPJA 3NTNA 1PGJA 2P2UA 1J8YF 2C9LY 3ABKC 3G9RA 3JCUH 2L6HA 3G50A 1K73Q 3JZ0A 5KYUB 2KLUA 1PCXA 3A3YB 2B0JA 1ZXGA 4BJTA 2IZ1A 3W68A 1PD1A 4NPFX 2W4MA 4LC1A 2IXOA 3TQOA 3H1KJ 2KNHA 1HE9A 4ANJA 2KYHA 4X0RA 2V3CC 2PX3A 2YO3A 3BRJA 5D92A 1HH0A 3BATA 4RESB 4DZOA 5A69A 3V5BA 4D4XA 3K5BA 2ZYDA 1RQVA 4MVMA 4U5FE 1YA9A 2A45H 4AQRD 1W2BO 4EBBA
chains in the Genus database with same CATH topology
1GZLA 2HODB 2Q3IA 3HD7A 4OH8B 1URQB 2HPCA 3M9BA 2P67A 1JTHB 3M06A 1NFOA 3HD7B 1M1JC 3MGNA 3T97A 2R5BA 3HRNA 5APWA 1RY3A 2IFNA 1FZBA 3RL0D 3HUSA 4LGDE 3N4XA 3RK3D 4EIJA 1FZCC 1VDFA 3CL3D 5CCHD 1LGHB 3RL0C 3H6PA 1NAFA 3HUSB 1J1EC 2PAJA 2N1TD 1SP4A 3IFMA 3M0DC 1N7SC 1X79B 3HE4A 3VN0A 2YO2A 2HODA 1JOCA 1HUCA 2R5DA 2VRSA 1EQ7A 4LLHA 2XV5A 4Y99B 2HPCB 1A02F 3GHGA 1DX7A 1IJDB 2O1KA 2L5GB 1FZGA 1EA8A 1AQ5A 2H43A 1GK4A 1LTJC 1SFCB 4C46A 1FZCB 2KSJA 1KFMA 2HFED 3SWFA 2YKOA 2WPRA 3V4WA 1KZUB 2C0WA 1LPEA 2Z5HA 1NTZK 1IFNA 5APYA 1FOSE 1LTBC 2FFDA 2NPSA 1L0NK 2WSEH 5CCHC 3NFQA 2KP8A 3RK3C 1JNMA 1PFIA 1YTZT 1Z56A 2KB7P 3HUSC 1LTAC 1J2JB 1OR3A 3TK1A 1KILB 3GHGB 2C0XA 4WBAA 2GUSA 2I1JA 2YKQA 1URQC 1JY2N 2JJLA 3L36A 5CMZA 3BASA 2W27A 1CW5A 1RF0C 1DH3A 3VP8A 4JF7A 1N73A 3LIEA 3HE5A 3CLQA 1JCCA 3BRVB 1HBWA 2FKWB 3HE5B 4AUWA 3P8CD 1SQBK 3B5NA 5AW8B 2E42A 1H7IA 2Q9IA 2WSCH 3WMM0 2HYNA 3B5NB 1GS9A 1HWTC 5CCHA 5AW7B 3VTPC 3PP5A 5AW1B 4I6MC 5APTA 1LE2A 2ZFCA 1SQVK 3KDPB 3HD7C 3A7OA 4JYBA 5AVRB 1GL2A 2FYZA 2W6BA 1L4AD 1JY3N 1FZAA 2OYIC 2IFMA 3C9IA 3TYYA 1GW3A 1CZQA 4N78D 1SLQA 3A2AA 1SFCA 1ZR4A 3M9QA 2M8RA 3P8CE 1G2CA 5CHXA 1URQD 2YMYA 1N7SB 2H7HA 3TNUB 1A02J 2IX7C 3HD7D 1X8YA 3OJAB 4Y99C 2NPSB 4O9BA 1SVFA 4N3YB 3OA7A 3N7NA 2GUVA 5KJ7D 3VMYA 1OR2A 3V2QA 1LWUB 3P8MC 1FBMA 2QM7A 2MJZA 1FJPA 3E1IA 1XTCC 3U1CA 4M3LA 4JYCA 1EQ1A 4WY4D 2E43A 2WPSA 3LW5H 3H32A 1JCDA 2XKMA 2OYIB 1CI6B 2WT7B 3KPEA 3R2PA 4IFDK 4HYTB 4N6JA 2O01H 2WSFH 1RE3C 4ZKPA 5BU5A 1NO4A 1AEPA 1QL1A 3BRTB 1HVVA 5AVXB 2W6AA 2XDJA 1RF1C 1T8ZA 3S84A 1ZR2A 1BZ4A 3RK2D 4C7NA 1JY3O 1YTZI 3B5ND 3V2PA 2WITA 1SQQK 3VOPA 1LTSC 5CCGA 1LWUA 5KTBA 1KILC 1IFIA 5AW5B 3I5CA 3V4QA 2PP6A 1KILA 2FYUK 1LT9A 2XU6A 2WT7A 2OYHC 1IFDA 1MUUA 1NTKK 3P7KA 3TSIA 1GK6A 1SFCC 1X9VA 2I1KA 5KJ7A 3L4FA 3KYQA 1CI6A 3HE4B 1FJKA 3IR9A 1MFZA 2R32A 2LKMA 5AVWB 5BVZA 5AVVB 1RF1B 2WWWA 1J1EB 4C7RA 2M3BA 1T3JA 2NPSD 1S9KD 1RF1A 4IFFA 1FZCA 3MUDA 2FXMA 3M91A 2N1TC 1SFCD 1FZEA 5AW3B 2KLVA 5APXA 1G1IA 1M1JB 2OARA 1GW4A 2HLOA 2Z5IA 4AYCA 1ZLLA 3L35A 1GL2D 1HTLC 1M7LA 2KYVA 1N86A 1JMMA 1IO4A 2N9BA 1ZN5A 3UIAA 1OXZA 1FU1A 3HTKB 4I1LA 3P32A 1SQXK 2HG5D 1E5WA 1FAVA 1L4AB 2A45G 5AW2B 1FOSF 1LTTC 5APSA 1GDTA 1JY3P 3RL0B 3V2NA 4GIFA 3KQGA 4WY4A 2YNYA 3RK3B 3NXSA 1N7SA 1H88A 3A5TA 1M1JA 1GL2C 5AVUB 2JEEA 2ZXEB 2BASA 3LIDA 2FFDB 5APVA 5KJ7C 1HGZA 5APQA 3L37A 5BU8B 3VP9A 4B86A 1MV8A 2Z4EA 2J58A 5AVTB 3BVHA 4GKGA 2POHA 1FZFA 1MZ9A 1H89A 1T3UA 3GHGC 4WY4B 1AFOA 1NH4A 2XZRA 1NFNA 1N73C 1URQA 1G2CB 1L4AA 4N78E 4DOJA 3MIWA 1NKNA 3B5NC 3NMDA 1G1JA 1LTJB 3EQ2A 1RE4A 2N1TA 1DEBA 1J1DB 1LTIC 3RK2B 1GU4A 1IK9A 2N1TB 3M0DA 3M9HA 2C9NY 4W7YA 3CI9A 4XE5B 1N7SD 5AVYB 2QM8A 3OAKA 1KFNA 1JY2P 1NOHA 3B8EB 3MD0A 1W2EA 3VMZA 1JUNA 2H8PD 1T2KC 1NTMK 2WZ7A 4ZKUA 1LE4A 1JY2O 1LTGC 3HTKA 2CPBA 1NU1K 2OYHA 1N73B 1N7LA 1NHLA 2IPPA 4XA4A 5APUA 5AVSB 2Q7CA 1S9KE 2NPSC 5AW0B 1IFMA 1LT9C 1L4AC 4W80A 3G3ZA 1IC2A 4I2LC 5AW6B 2CPSA 2Q5UA 1LWUC 1GU5A 2J59M 3VMXA 1J1DC 1LTJA 1HGVA 1RE4C 1KILD 5AW9B 2R3CA 4IFMA 3II6A 1VPCA 3V2RA 1H8AA 1ZV8A 2O1JA 3O8ZA 3H32B 1T2KD 3RK2C 2OYIA 1RF0A 1L0LK 1RE3A 4W7ZA 5CCGC 1GL2B 4KHXA 1NKZB 2A45I 2GM4A 1QL2A 2WPQA 2KC3A 1XTGB 1N2DC 3TNUA 4C7NB 2OYHB 4WY4C 3NTNA 3VYIA 2YKPA 3EFGA 2P2UA 2C9LY 2KOGA 3MTUE 3SWYA 5AVZB 2WTYA 5KLVK 3U1AA 3U59A 1YYCA 2FFDC 1HJBA 2P7JA 1JO5A 5AVQB 1KQLA 3A3YB 1CSBA 4HH2A 1FDMA 5CJ4A 1WT6A 1LT9B 1SQPK 1GD2E 4LC1A 1IFJA 5CCGD 4GT1A 4WB4A 1GTWA 1NWQA 2YO3A 3M0AA 1B68A 1HH0A 2P1JA 5AW4B 3BATA 1WRGA 4RESB 4DZOA 3V5BA 1OWAA 2XNXA 1YA9A 5CJ0A 1JTHA 2A45H 4AQRD 4EOTA 1LS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE2 A;  1NFN A;  1NFO A;  3R2P A;  2KC3 A;  1AEP A;  1B68 A;  1EA8 A;  1OR3 A;  1GW4 A;  1LE4 A;  1OR2 A;  3S84 A;  1GW3 A;  1BZ4 A;  1YA9 A;  1H7I A;  1GS9 A;  1LPE A;  1LS4 A;  1EQ1 A; 
#chains in the Genus database with same CATH topology
 2Q3I A;  2HOD B;  4OH8 B;  1URQ B;  4YWQ A;  1SQP D;  2BCC G;  2YWA A;  1NFO A;  5TIS H;  2VC9 A;  3MHV A;  2FYU E;  3HRN A;  4PD4 H;  3RIP A;  4ASV A;  4LGD E;  4XEF A;  2B0H A;  3IQC A;  1FZC C;  1EZV G;  5CCH D;  2C04 A;  4JTD B;  1NAF A;  3NRH A;  3IQ6 A;  4OD4 A;  2P10 A;  1BDD A;  3LW5 J;  2PAJ A;  3Q7L A;  2N1T D;  3NMI A;  3M0D C;  5L0J A;  4RKU J;  2D2C D;  3HNK A;  2YO2 A;  1JOC A;  2ZJS E;  3PJS K;  1AA0 A;  4LLH A;  1SZI A;  3L72 J;  4E17 A;  2L5G B;  1PP9 G;  1A7E A;  1GK4 A;  4C46 A;  1Q0F A;  4HE8 D;  2HKV A;  1BSN A;  3RBX A;  3VYW A;  1U0B B;  5DS6 A;  1JAF A;  3LJB A;  2C0W A;  2YZS A;  3DWW A;  3EWK A;  3IAO A;  4QMA A;  3M1C B;  1NTZ K;  5APY A;  3D71 A;  1LTB C;  3B4S A;  2FFD A;  4K0D A;  2Y3B A;  1HE1 A;  3M15 A;  5CCH C;  1ZHZ A;  4JE9 A;  1KB9 I;  2QJY B;  3EQL F;  3JRT A;  3F89 A;  2FYU G;  1SQV J;  2X0C A;  2LXC B;  3GHG B;  4ZMD A;  1SQB J;  2C0X A;  3SWK A;  3TF5 A;  1YJG A;  2GUS A;  2I1J A;  2XLE A;  1URQ C;  1JY2 N;  2IDB A;  2JJL A;  4DVY P;  3MYI A;  1EZV I;  3C8V A;  1G8X A;  3O39 A;  4YL0 A;  3AE8 C;  1BSH A;  2Q9B A;  2EPN A;  2LXB A;  3G4Z A;  4L74 A;  2QUP A;  1USD A;  4U9E A;  4EKW A;  1ZW2 A;  2AXC A;  2QE7 H;  4AUW A;  4G78 A;  3JSE O;  4HEA J;  5AC5 A;  1M2V A;  2UUH A;  4U5H A;  3POV A;  1NTM J;  3IHU A;  1Q90 D;  3H1H G;  3L70 J;  3KPH A;  2WQY C;  1A7V A;  2GWW A;  1W2W A;  2HYN A;  3B5N B;  4E7Z A;  2OTK E;  4A2N B;  3TJ5 A;  1LE2 A;  4I6M C;  2ZFC A;  1KIL E;  1SQV K;  3JRM O;  1I5N A;  1L0N E;  5KYY A;  3EGX B;  4JKV A;  4JYB A;  4P9F A;  5COG A;  4ASW A;  3BCC E;  1T01 A;  2GA0 A;  3CX5 H;  1L4A D;  1JY3 N;  4OGQ C;  3ASN C;  2KS1 A;  5E3C A;  2ITA A;  3C9I A;  1GW3 A;  3AG3 C;  3PHF 2;  4EIY A;  1SLQ A;  1H9G A;  2MKV A;  3CWB J;  3A2A A;  2EPK X;  5COM A;  3UMK A;  4HJG H;  1SQQ J;  1SFC A;  3H1I G;  1ZW0 A;  3K1I C;  2M8R A;  1PL5 A;  2E74 B;  3P8C E;  1G2C A;  4XLN F;  2FYN C;  1A02 J;  2IX7 C;  5HSW A;  2MYS A;  4WGZ A;  4PJM A;  1M2V B;  2NPS B;  2J9V A;  4PFO A;  4N3Y B;  2Q9C A;  2YL7 A;  2YL1 A;  3N7N A;  2GUV A;  4H13 C;  2B89 A;  3GOR A;  3FXD A;  4MVZ A;  3P8M C;  2JX0 A;  2E75 B;  2Q00 A;  2WZF A;  2PFX A;  3U1C A;  2E43 A;  2A06 D;  4BRY A;  2P7V A;  3LW5 H;  2WVQ A;  2IYP A;  1NLX A;  1CI6 B;  1RH5 B;  5A6K A;  4Q5S F;  3R2P A;  4QDL A;  2HFI A;  3IF4 A;  1QX8 A;  1L0L D;  1RE3 C;  2D5R B;  5BU5 A;  1AEP A;  3CCJ P;  1QL1 A;  3IQ5 A;  5AVX B;  2W6A A;  2XDJ A;  1RF1 C;  1N1C A;  1ZR2 A;  2QIW A;  4PR9 A;  1A7D A;  3T9O A;  3B5N D;  3V2P A;  2YL3 A;  1AVO A;  3G71 P;  3G4X A;  4PJ0 H;  1S2E A;  2Z15 A;  1RKE A;  3CEX A;  4MTG A;  2OKU A;  3PRJ A;  3KYI A;  3V5X A;  5DS4 A;  1RXQ A;  1IFI A;  3V5Z A;  1Z23 A;  3U2M A;  1QEX A;  2D4U A;  5L3Q A;  2CDQ A;  1XZQ A;  2OCC C;  3UMH A;  1LT9 A;  2XLM A;  1VQ5 P;  2OYH C;  3RF3 A;  1VQP P;  2QRX A;  2ZPA A;  4J7T A;  3H1I D;  1G5Z A;  5DQZ A;  3ZQY A;  5KJ7 A;  2OEV A;  2I8B A;  3GEI A;  4JUR I;  2M0B A;  2CYD A;  4DXW A;  4OIQ F;  1MFZ A;  4W8P A;  2LKM A;  5JVE A;  3ABV C;  4JEB A;  5BVZ A;  4H0L B;  4Z9H A;  1J1E B;  2QSI A;  4KNV A;  4N06 A;  5T3W A;  2JP3 A;  4MW3 A;  2NPS D;  2V26 A;  4IFF A;  2KK7 A;  3L74 G;  3S0X A;  3MFN A;  2N1T C;  3B9Q A;  5DVW A;  2RSE B;  2R7R A;  1SF8 A;  4PAC A;  1M1J B;  2MHR A;  2B88 A;  2LP4 A;  2HLO A;  3LEO A;  3M79 A;  3CC2 P;  2QVA A;  3L35 A;  2QJK B;  1O3U A;  1N86 A;  1L0L G;  4AE4 A;  3WOD F;  1ZN5 A;  2FXO A;  1OXZ A;  1FU1 A;  2IBZ G;  2LIG A;  4I1L A;  3K33 A;  4AE4 B;  2HG5 D;  2HS5 A;  1Q86 Q;  3L74 J;  3CXH I;  5AW2 B;  4WJ0 A;  1LTT C;  3CD6 P;  3WUT A;  2DW3 A;  4O79 A;  4WY4 A;  1TWA A;  2WSS H;  1KC8 Q;  3T6J A;  1M1J A;  1GL2 C;  2LD6 A;  1WMK A;  4NPE A;  1Y47 A;  4NPD A;  3L75 D;  1JB0 J;  4Z9J A;  5APV A;  4JPZ B;  4N4W A;  4NY3 A;  3L37 A;  5BU8 B;  3CCR P;  4QI0 A;  3FXE A;  1HJ0 A;  2KSF A;  3L70 D;  2ZYG A;  4GKG A;  4IGG A;  5KLV E;  3L73 D;  2Q3E A;  2ETS A;  3GHG C;  2YEV A;  2YKZ A;  5KYN A;  1SR2 A;  1NH4 A;  4LDR A;  1V55 C;  3TOM A;  2ZD9 A;  1BGY D;  1N73 C;  1URQ A;  1NKN A;  1P84 I;  2EPM X;  4XEK A;  1L7C A;  1KQS O;  2DGJ A;  4L6R A;  1VQN P;  2N1T A;  1DEB A;  2WMM A;  3A0B H;  3E9V A;  3H1J J;  1LTI C;  5EFW B;  5B5E H;  1L0N G;  1SQX G;  4LLC A;  1JM0 A;  3GLM A;  1M56 C;  4FES A;  1K05 A;  2C9N Y;  3L72 E;  4DRI B;  1N7S D;  1ORS C;  1NTZ D;  4PD4 I;  5AVY B;  4Q7C A;  1D1B A;  2EIM C;  3H1H E;  3D6Z A;  3DD7 A;  3MD0 A;  3EG9 B;  2J46 A;  3NDB B;  3ZTZ A;  5KLV G;  4JBZ A;  3WUU A;  2EIJ C;  5A6A A;  4J32 B;  1SQX D;  3AED C;  3U2L A;  4H44 B;  3GW6 A;  2OYH A;  1FAP B;  1VQL P;  2IPP A;  5APU A;  3MZW B;  4XA4 A;  2Q7C A;  4YT5 A;  1YZA A;  5KYW B;  3ZG1 A;  1H9T A;  4NTB A;  3G3Z A;  1UFB A;  2IXM A;  2Q5U A;  1GU5 A;  2A0U A;  2J59 M;  1J1D C;  1LTJ A;  4CS8 C;  2HZ8 A;  1EKY A;  3EGX A;  1RE4 C;  1KIL D;  1FDI A;  1T6Q A;  2E76 C;  4IFM A;  2R02 A;  3KZI H;  3JTL O;  4U9D A;  3O8Z A;  4JTC B;  3U3F A;  2Y0E A;  3RK2 C;  3FGA D;  1E85 A;  2JPU A;  4JCZ A;  1L0L K;  3H1L G;  1YJ9 P;  1BR4 A;  1WAT A;  2J7P A;  1FE6 A;  2A45 I;  4BWN A;  1N2D C;  3FMS A;  3RH3 A;  3TNU A;  2Y39 A;  2YKP A;  4FX5 A;  5L0I A;  1HY5 A;  4XPX A;  3JCU E;  3MTU E;  4PV1 B;  3SWY A;  1PIX A;  3H1J D;  1EXJ A;  3U59 A;  4MW8 A;  3TGU D;  4KT0 J;  5AVQ B;  2WL8 A;  5BQG A;  1YQ4 C;  3SFD C;  2DYS C;  1CSB A;  3M4B A;  4DBQ A;  5CJ4 A;  1WT6 A;  2J7P D;  1CPR A;  1IFJ A;  1RKE B;  3CX5 D;  1T6I A;  1BE3 J;  4WB4 A;  4YXW H;  1WTY A;  4G7H F;  4JTA B;  1SQQ E;  1G4W R;  3T4R A;  2P1J A;  3I55 P;  3DE9 A;  4OIO F;  3GM2 A;  2IYL D;  1KYO I;  4Z1M H;  2ZT9 D;  1PGP A;  4KNW A;  4ZLD A;  1JTH A;  4EOT A;  1LS4 A;  3NKD A;  4OGQ B;  1KV4 A;  3HD7 A;  2BC5 A;  3M9B A;  1FFH A;  3H1L E;  1JTH B;  1NGM B;  4GOD A;  1MMA A;  3LLI A;  3RVY A;  2V4H A;  5K5G B;  2PRR A;  4RBN A;  1YA7 O;  2AP3 A;  2IBZ I;  4ER9 A;  4MVO A;  1K40 A;  3DKA A;  5APW A;  4YXD C;  3MUD C;  1RY3 A;  1LVK A;  4ULW A;  2IFN A;  5F28 E;  4K35 A;  2JO1 A;  3RK3 D;  4EIJ A;  1VDF A;  4DBR A;  2WSC J;  2Y3H A;  1LGH B;  5EGY A;  3H6P A;  3Q5R A;  2KQ9 A;  4C3E A;  4Q4Z F;  1D0Y A;  1J1E C;  4C7O B;  2AVK A;  1U7M A;  3IFM A;  1N7S C;  1SYQ A;  1HUC A;  1A02 F;  1EQ7 A;  4DVZ A;  2XV5 A;  3GHG A;  2O1K A;  4P9T A;  1SQP E;  2NUP B;  4U5E E;  5T3T A;  1Y9B A;  3VMA A;  1WAS A;  2YQY A;  2KJG A;  1RQU A;  1E86 A;  2LK4 A;  1BCC E;  3V4W A;  1NU1 J;  1QSP A;  2V7Q J;  1FOS E;  3S27 A;  1S72 P;  2OG2 A;  1J8M F;  1SQX E;  3CPW O;  1BDC A;  2L9J A;  2KP8 A;  1EI7 A;  3ZTM A;  3OWT A;  1JNM A;  4EI2 A;  3PDM P;  1PD0 A;  1H0T B;  2YMK A;  2PBE A;  2A06 E;  4N6H A;  4U3F J;  2IOQ A;  1NTZ E;  3Q5S A;  1BE3 D;  3AOU A;  4CIP A;  2YKQ A;  1TKN A;  3L36 A;  2W27 A;  5AGF A;  3ZC4 A;  4K7B A;  3CLQ A;  1LIH A;  1ZU4 A;  1JCC A;  1CGM E;  3E70 C;  4F4B A;  1QPU A;  3QH9 A;  4G7Z F;  1NAY A;  2WSE J;  3HE5 B;  2W4B A;  2G8Y A;  4JIO A;  3UMI A;  3P8C D;  1VQ7 P;  3ITF A;  4O7G A;  1LJ2 A;  1Z63 A;  2E42 A;  5GTI H;  1H0T A;  3I5Q A;  5AC4 A;  3SNH A;  1PP9 E;  1QZX A;  3WMM 0;  1GS9 A;  2YHS A;  3U0C A;  5JSL A;  5F5F A;  3VTP C;  1TFO B;  3PP5 A;  1M8O B;  4EYY Q;  1Q0G A;  3S4R A;  4IWB A;  1FTS A;  5AVR B;  3DJN B;  4PK4 A;  2FYZ A;  2K9J A;  4BPM A;  1Z6A A;  2QTV A;  4LAC B;  4MQ9 F;  2OYI C;  1HMO A;  2IFM A;  3CCV P;  3UGO A;  3L71 J;  1YAR O;  3L71 D;  2NUP A;  1ZME C;  1HW2 A;  2BCC J;  3FX0 A;  4XWJ A;  3AEE C;  1ORY A;  5CHX A;  1URQ D;  2YMY A;  4UB6 E;  1N7S B;  1RJ9 B;  3SXM A;  3OJA B;  2M3E A;  4Y99 C;  4O9B A;  2WB7 A;  2FFH A;  3LNR A;  3TK0 A;  4PV1 D;  2QJP B;  3V2Q A;  4O6Y A;  5A6J A;  1USE A;  1TWG A;  2AXT H;  1EC5 A;  2QM7 A;  2MJZ A;  5JRA A;  3AEG C;  1XTC C;  1SQB G;  2H89 C;  3F5H A;  1KU2 A;  1WGW A;  2WPS A;  3L74 D;  2J5U A;  3SYN A;  5CBO A;  2OU6 A;  4EHP A;  3O55 A;  4U5G A;  4N6J A;  5BQI A;  2WSF H;  3H1J E;  1MFT A;  4ZKP A;  1OW6 A;  3WU2 H;  4H0L C;  1VTM P;  1IK7 A;  3W2W A;  1T8Z A;  2ZXP A;  3S84 A;  1BZ4 A;  3RK2 D;  2JD3 A;  3BCC G;  1BGY J;  3H25 A;  4U5C E;  2KXP B;  5CCG A;  3VOP A;  3H1H J;  3L70 G;  1YDI A;  2GA1 A;  5KTB A;  1YJW P;  3PHL A;  1KIL C;  5AW5 B;  1LNQ A;  5DQT A;  3I5C A;  5KYU A;  5L3V A;  3V4Q A;  1Q0D A;  2IZ0 A;  2PP6 A;  2WPV B;  2W45 A;  1JR8 A;  1KIL A;  2AEJ A;  2XU6 A;  2WT7 A;  4E7S A;  3JYY A;  2XL8 A;  1K04 A;  3TSI A;  1NG1 A;  4K3A A;  1SFC C;  3OA1 A;  1X9V A;  5EK0 A;  4NTA A;  2BE5 F;  3GMA A;  3L4F A;  4IAO A;  3PLN A;  3LEV A;  1KOR A;  4CX9 A;  1YHQ P;  4WVZ A;  2YVK A;  3IR9 A;  4QI2 A;  2XXA B;  1IZM A;  3CCL P;  2K1A A;  2XLO A;  4G0H A;  3O6Q A;  1RF1 B;  2ZVO B;  4C7R A;  5KYW A;  4IRU A;  1FZC A;  2WZG A;  3C8Z A;  1OVV A;  2FXM A;  2PF4 E;  4MVU A;  1SFC D;  1OQC A;  4CS9 C;  3MLG A;  2KNC A;  3JSV C;  2E75 D;  5APX A;  2XM0 A;  4H54 A;  2VCB A;  1A41 A;  1GW4 A;  3SSU A;  3I4U A;  3GOD A;  3M4C A;  1S7Z A;  3Q7G A;  4NQF A;  1JMM A;  3W8H A;  1IO4 A;  4D6T J;  3FAP B;  2Q9A A;  1Y8A A;  3AQB A;  3HTK B;  1YIT P;  1SQX K;  2XND H;  1L0N D;  1FAV A;  1L4A B;  3T97 B;  1FOS F;  5APS A;  1GDT A;  1HF9 A;  4U5D E;  5B1B C;  1JY3 P;  2QJP C;  2BEQ D;  3FWN A;  2FY8 A;  2ZT9 C;  3KQG A;  3U9J A;  1KYO E;  2D2C C;  3R4Y A;  3RK3 B;  4ZNC A;  4D6T D;  2E87 A;  1E2X A;  5H2F E;  1VQO P;  3FHD A;  2ZXE B;  4LER A;  3CQZ A;  3ECS A;  4BJ1 A;  1E83 A;  2FFD B;  1ZHT A;  4HFF B;  3MX3 A;  2HSQ A;  4XPY A;  4R4L A;  2LFF A;  2VH3 A;  4GYT A;  3L73 G;  4B86 A;  2K9J B;  2J58 A;  5AVT B;  3BVH A;  3QW1 A;  1FZF A;  1SMY F;  4CSA C;  1SQQ D;  4Y28 J;  2W8Z A;  1I4Y A;  3ABM C;  3KL4 A;  1Y4C A;  2R7V A;  1C03 A;  3NYL A;  4JW1 A;  3CCU P;  2KGO A;  3DZA A;  3EZH A;  2XZR A;  3U5S A;  3B29 A;  3GF7 A;  1S5L X;  1YI2 P;  1KYO D;  1NTK J;  4PD4 D;  2CNW A;  3JYH A;  2EIK C;  5E33 A;  5KAI H;  3WUV A;  1RE4 A;  3S9O A;  5B5E E;  3B0V C;  4YTP C;  1VYI A;  3CX5 E;  4PV1 C;  1RMV A;  1BR2 A;  3M0D A;  1RJ9 A;  4BEJ A;  3CI9 A;  3ITK A;  5E79 E;  2J0X A;  2G3A A;  3VAY A;  1K9M Q;  2H7B A;  3W8I A;  1KFN A;  1TQG A;  1H6G A;  3GAN A;  1OMI A;  1EXI A;  2YLI A;  3ABL C;  3TOL A;  2J8W A;  4G7O F;  2CNW D;  2H8P D;  2OJE D;  2B87 A;  2L6G A;  1PGO A;  1OW8 A;  4K1O A;  4W8K A;  3H65 A;  1FC2 C;  1ZHX A;  1YBK A;  2Y0D A;  2EIL C;  3LUT B;  4JEA A;  1MNE A;  2QJK C;  1ZOY C;  1CPQ A;  1M1K Q;  4W80 A;  3OEO A;  3ZSU A;  2E76 B;  1QVF O;  1IC2 A;  3L75 G;  3CWB D;  1EDI A;  1LWU C;  4U3F E;  2NRG A;  2R7W A;  1FR0 A;  3DXJ F;  2HJ3 A;  3L0I A;  4J7Y A;  2K3R A;  2HV6 A;  2R3C A;  2NUT A;  4I44 A;  3II6 A;  1VPC A;  1T2K D;  2OYI A;  1OCO C;  4PJN A;  4DJ9 A;  2OTJ P;  3CSK A;  1ZZP A;  2HUJ A;  2Q3T A;  1IZN B;  2EPL X;  1PZQ A;  4KHX A;  4WAB A;  5DS5 A;  1BCC G;  2YIU C;  1VMA A;  3K7D A;  3AQC A;  2KC3 A;  2WPQ A;  3VM6 A;  2BCC D;  4WY4 C;  3MP7 B;  3VYI A;  3AEA C;  3EFG A;  5CBN A;  3TGU G;  2P0N A;  2KOG A;  1OZH A;  5AVZ B;  1OIP A;  5KLV K;  1YYC A;  2FFD C;  2HV7 A;  4YJW A;  5A6B A;  1HJB A;  3H1J G;  1KQL A;  2EPO A;  2RKL A;  1FDM A;  4HH2 A;  1LT9 B;  1NU1 G;  1KD1 Q;  4BRY B;  4GT1 A;  1PPJ G;  2DYR C;  5L0H A;  1GTW A;  1R5L A;  3M0A A;  1B68 A;  3SEO A;  5KAI E;  5AW4 B;  1NU9 C;  1TU3 F;  2XLV A;  1OWA A;  5L8R J;  2XXA A;  1FMW A;  3S90 A;  1KNY A;  1OXB A;  1D1C A;  3USS A;  3MBG A;  1YVI A;  3ZVR A;  2CK3 H;  4E18 A;  3TJ6 A;  2HPC A;  4EBK A;  1VK5 A;  3M06 A;  1KYO H;  3HD7 B;  3DMD A;  3I5P A;  2K9Y A;  2KSE A;  2R7Q A;  3MGN A;  4EDF A;  2R5B A;  4AK9 A;  3EFF K;  1OFC X;  2Q7R A;  4GOE A;  1AVO B;  3A0H H;  2OYO A;  2JR8 A;  2R25 A;  3F47 A;  4U3F D;  3CME P;  2DI3 A;  5TJ5 E;  1Q0K A;  2AU5 A;  3AJM A;  3CL3 D;  1LI7 A;  1R5S A;  3HLZ A;  3HUS B;  4OWF A;  2L81 A;  4NC3 A;  1NSG B;  1SP4 A;  4OIR F;  5TIS E;  4YT2 A;  3VN0 A;  2R5D A;  3TGU E;  1IW7 F;  4Y99 B;  2HPC B;  1HW1 A;  1NU1 D;  4R32 A;  1IJD B;  2M5A B;  2E74 C;  3AG4 C;  3C7J A;  1EA8 A;  3L8J A;  2H43 A;  1SFC B;  4AL1 A;  5E79 H;  4OIN F;  3T6B A;  3QVZ A;  1SQV G;  3SWF A;  2UWJ E;  3V6I A;  2YKO A;  4H44 D;  2QA4 P;  1KZU B;  1LPE A;  3SP1 A;  2OOC A;  3L71 G;  2YRF A;  2IBF A;  4U5B E;  4JZA A;  1CGN A;  1EDL A;  2XRH A;  2WSE H;  3H1K E;  3AEC C;  1P84 D;  2YIU B;  3NFQ A;  1JMW A;  1OXK A;  2D2C B;  3RK3 C;  3KYJ A;  4E0H A;  5FCL A;  2E75 C;  2IXN A;  1PFI A;  2QLA A;  1Z56 A;  2KNC B;  3CX5 I;  3HUS C;  2OQM A;  1LTA C;  3EFO A;  1TWC A;  3KZI E;  1KIL B;  2V7Q H;  2B9B A;  3HKK A;  1VLS A;  3L74 E;  4IAR A;  4ONS A;  4RJT A;  3H1K D;  4WBA A;  2WSF J;  3EZI A;  2JKV A;  1DOV A;  1KB9 D;  3SFE C;  3V5Y A;  5CMZ A;  3ASO C;  3BAS A;  1RF0 C;  1DH3 A;  3N24 A;  3VP8 A;  4JF7 A;  1N73 A;  1NJI Q;  3LIE A;  3HE5 A;  4O6N A;  1C17 M;  3UR3 C;  3BRV B;  3SXY A;  1KQF B;  1HBW A;  4CDA A;  3T6G B;  2FYU J;  2FKW B;  4H4K C;  1D0Z A;  4YT4 A;  4EWC A;  4I7Z B;  2WVO A;  3Q1M A;  2WVR A;  5AW8 B;  3CC4 P;  2N9Y B;  2VCC A;  3LLK A;  3QZC A;  2R7T A;  4LDK A;  1H7I A;  2Q9I A;  2E74 D;  1SQP G;  3H1H D;  1VLT A;  4B6I A;  1YJN P;  1NTK D;  1HWT C;  5AW7 B;  3RQG A;  1BE3 G;  4XPW A;  4DJG A;  4CSA A;  4LLE A;  2Y3D A;  2FGY A;  3A7O A;  2P6V A;  4C7O A;  1DEE G;  5JT4 A;  3B0U X;  2W6B A;  3A0H E;  3B71 A;  3C8G D;  3KHU A;  1E84 A;  2FXP A;  1Q2N A;  2A06 G;  3TYY A;  1JOG A;  1UII A;  1VOM A;  3CAX A;  5B3S C;  2XLH A;  4C3D A;  5L0F A;  2NSF A;  4IOI H;  5DLJ A;  2H7H A;  3HD7 D;  3NYM A;  4D4N A;  3L73 E;  2RH0 A;  1SQV E;  4J30 B;  3SXZ A;  3VMY A;  5KJ7 D;  1OR2 A;  2ZXX A;  1LWU B;  3AEB C;  2TMV P;  5F5H A;  2XS8 A;  3L75 E;  1T6U A;  2P61 A;  4CS9 A;  1FJP A;  3RBZ A;  1U89 A;  4M3L A;  3BCC D;  4JYC A;  2QY9 A;  4WY4 D;  1EQ1 A;  3H32 A;  1VF5 B;  2XKM A;  3EG9 A;  5GTH H;  5JS5 A;  3KPE A;  4IFD K;  2E76 D;  1IFP A;  1X0T A;  2NSG A;  2O01 H;  1FMV A;  2VB6 A;  1NO4 A;  1EZV E;  3BRT B;  1U57 A;  1HVV A;  3KXD A;  1S5L H;  4CS7 A;  1SQX J;  1SQB D;  1ZU5 A;  1Q7Y Q;  2R7S A;  1SQQ K;  3GM1 A;  4CIH A;  3EH1 A;  3DAF A;  3AE4 C;  4JCH A;  1G4U S;  3GM3 A;  1NTZ J;  4YPC A;  4CBE A;  4IB4 A;  1JEK A;  3US6 A;  1PV3 A;  1OVU A;  4HKZ H;  2HSB A;  3U9M A;  1TWH A;  1IFD A;  3S28 A;  3P7K A;  1GK6 A;  1QVX A;  1VF5 C;  1KQG B;  4H13 B;  3LS0 A;  4BXL A;  4I1M A;  2OGU A;  4U7J A;  4AX2 A;  4BJ5 C;  1MMG A;  1ST6 A;  3KYQ A;  3HE4 B;  3AG2 C;  1FJK A;  2M64 A;  4XQ1 A;  5E3A A;  2R32 A;  5AVW B;  5AVV B;  1M6T A;  2ZVN B;  3O6X A;  2WWW A;  1D1A A;  2M3B A;  3GWL A;  2Q1K A;  2LFD A;  3RVZ A;  1PP9 J;  3JSZ A;  4GQH A;  1NTZ G;  1R5I D;  3MUD A;  1YLM A;  1P84 H;  1FFT C;  3AE3 C;  2R05 A;  2VCA A;  5AW3 B;  3H1L D;  1AUE A;  1KN7 A;  2C03 A;  2XLW A;  3FOO A;  4XTK A;  1A0B A;  2F22 A;  2K37 A;  4KI2 A;  2Z5I A;  3GEH A;  4DRH B;  1HTL C;  2KZJ A;  5JP7 A;  3L71 E;  3RGU A;  2R9R B;  3IQT A;  2KS1 B;  3UIA A;  2A6H F;  2O3J A;  4E0I A;  3DAG A;  1ZRT E;  1E5W A;  1OCC C;  2A45 G;  3WU2 E;  2R7U A;  1HMD A;  1VL2 A;  2M4E A;  3CCS P;  2Y69 C;  1LS1 A;  3V2N A;  1CGO A;  1L0L E;  1O87 A;  1WN0 A;  3AE7 C;  1DD4 A;  3NXS A;  1N7S A;  3A5T A;  3UGP A;  5AVU B;  3KMI A;  1W5C E;  2JEE A;  1NVO A;  3DI5 A;  2AEF A;  3DM9 B;  2JWD A;  2R03 A;  3LID A;  3K1I A;  4M63 A;  4MTF A;  4DRJ B;  4O6M A;  4R4M A;  3L72 D;  2J9U A;  3Q5P A;  2RN0 A;  1BBH A;  2OJQ A;  3AE9 C;  3VP9 A;  2JDI H;  1LI5 A;  1MV8 A;  1VYK A;  1ZHW A;  5KYX A;  4H44 C;  3Q6N A;  1ZW3 A;  2POH A;  1YZC A;  3X1O A;  3WAQ A;  1MZ9 A;  1DIP A;  2E5Y A;  4YK5 A;  1APC A;  1T3U A;  1L0N J;  2Y3G A;  1AFO A;  1WWP A;  5GTI E;  1M57 C;  4EUK B;  1AVY A;  3HJC A;  1L4A A;  4N78 E;  5E2Q A;  1NYH A;  3B5N C;  4IJJ A;  3EGD A;  3TD7 A;  3V7O A;  2IYO A;  3CWB G;  1G1J A;  1SQQ G;  3EQ2 A;  3CWB E;  3H1I J;  1J1D B;  5C39 A;  3RK2 B;  1FNT c;  4BG0 A;  2HMQ A;  3TUL A;  1X22 A;  3TGU J;  1IK9 A;  5KYY B;  4BEM J;  3NYJ A;  2N1T B;  4JQ0 D;  3CXH E;  4W7Y A;  4XE5 B;  2O01 N;  1OKK D;  1QQ3 A;  3GWN A;  2QM8 A;  2GDC A;  1JY2 P;  3EFO B;  1E79 H;  1NOH A;  3B8E B;  3ZQV A;  2E5T A;  2YLG A;  1FS0 E;  2A1D D;  3UNG C;  3CXH D;  2ZAE B;  4ZKU A;  1LE4 A;  2A68 F;  2MWQ A;  3N2Z B;  3QTH A;  1LTG C;  2HR3 A;  3ZWI A;  2QG4 A;  3CCE P;  1RKC A;  1N7L A;  1T6A A;  5CI9 A;  4C3B A;  2NPS C;  5AW0 B;  5L0C A;  3U8V A;  1QLE C;  1T5O A;  3IEE A;  5DJT B;  4JJG A;  3H1L J;  4I2L C;  3A9C A;  2XS1 A;  5HV9 A;  4YL3 A;  1QLE D;  3IPM O;  3O10 A;  1YQ3 C;  3VMX A;  1AJY A;  1ZYR F;  1HGV A;  4BJ6 A;  3HNI A;  4CJG A;  1KB9 E;  1D7M A;  3C1L A;  1R8E A;  2KK1 A;  4ULV A;  1M57 D;  3QVY A;  2WVN A;  1BDJ B;  1ZV8 A;  1YYX A;  3H32 B;  3C18 A;  2IBZ E;  1Z5Z A;  1U7J A;  4JVS A;  2BCC E;  1R4T A;  2KUB A;  4W7Z A;  4ZLC A;  1VQ4 P;  3L72 G;  2H7O A;  1LP1 B;  1NKZ B;  3QMK A;  2G3V A;  1XTG B;  2XM4 A;  3N0T A;  3RYL A;  4C7N B;  5B1A C;  1GMJ A;  3E7K A;  4AL0 A;  1K8A Q;  2G3K A;  1L2P A;  2AWC A;  1I4Z A;  1NTK G;  2WTY A;  3U1A A;  5FZT A;  1NTM G;  4N6C A;  2P7J A;  5H2F H;  1JO5 A;  2GFH A;  3QWO C;  5GTH E;  1NU1 E;  2Y9Y A;  1JPN A;  2NG1 A;  1SQP K;  1GD2 E;  1JRA A;  3PTZ A;  1F1M A;  4UB8 H;  5CCG D;  1NTM E;  3AGU A;  5EHH A;  1TR2 A;  1NWQ A;  3LS1 A;  2CW0 F;  1RHZ B;  3SZR A;  3SXK A;  4PJ0 E;  1WRG A;  2FAP B;  4WGY A;  3RQE A;  5B3I A;  1NTM D;  3DE8 A;  2XNX A;  5CJ0 A;  3GF3 A;  1S05 A;  3BCC J;  1GZL A;  4PJL A;  3LES A;  2P67 A;  2XL6 A;  3KKB A;  3I56 P;  1MND A;  4CPG A;  3R7C A;  5KLI B;  3NKE A;  2IM8 A;  2R7X A;  1M1J C;  3T97 A;  3L75 J;  3MYF A;  1DOW A;  3IN6 A;  2CCY A;  1OCR C;  4TT3 H;  1AQT A;  1V74 B;  2CGE A;  1FZB A;  3RL0 D;  3HUS A;  1ZVZ A;  2FBW C;  3K6B A;  3N4X A;  1Y6D A;  2XL4 A;  2YL0 A;  1OW7 A;  3RL0 C;  1Z7Q c;  3JC2 2;  2SPZ A;  3VF0 A;  5GPG B;  4GEH A;  4Z9I A;  1X79 B;  3HE4 A;  2PX0 A;  1OKK A;  2HOD A;  2VRS A;  1DX7 A;  4LDQ A;  3AE5 C;  1N8R Q;  1FZG A;  2K88 A;  1AQ5 A;  1LTJ C;  2H88 C;  3CXH H;  1FZC B;  4MVR A;  2KSJ A;  5KLV J;  1KFM A;  4CJO A;  2HFE D;  5BUO A;  3J06 A;  3PCV A;  3FDQ A;  2WPR A;  1S4X A;  4DT0 A;  1VQK P;  2Z5H A;  4OIP F;  1IFN A;  4MN4 C;  1EDK A;  2QEX P;  1MQV A;  2NPS A;  1L0N K;  2RD9 A;  1PP9 D;  3EGD B;  3JT1 A;  1YTZ T;  4FAP B;  2KB7 P;  2WZL A;  3ZDM A;  1PGQ A;  1J2J B;  1OR3 A;  3RL0 g;  3TK1 A;  4D6T E;  1T9K A;  2W9Y A;  1JMB A;  4YT8 A;  2ZXW C;  2YXR B;  2O01 J;  3AE6 C;  3DJU B;  4KJM A;  2A0B A;  1CW5 A;  1SQV D;  1LKX A;  4NTF A;  1SS1 A;  4CDV A;  1VB5 A;  5L0D A;  2KI7 B;  3EJN A;  2DB4 A;  1SQB K;  3B5N A;  3RW0 A;  4DCK A;  4CS8 A;  2WSC H;  2I8D A;  1KB9 H;  1Q0M A;  2H8A A;  2PFD A;  3AE1 C;  5CCH A;  5AW1 B;  5APT A;  2BEZ F;  2IXP A;  3KDP B;  1ZRT D;  4GDO A;  3HD7 C;  2J9W A;  4RD9 A;  4IAQ A;  2LCH A;  4JRZ A;  1GL2 A;  5B66 E;  2XLD A;  1L0L J;  2XSE A;  1FZA A;  3WG7 C;  2O9X A;  1CZQ A;  2Y0C A;  4N78 D;  4UB8 E;  2LR2 A;  1S1C X;  2FYU D;  1ZR4 A;  2A69 F;  3M9Q A;  1VF5 D;  1OVR A;  2OQQ A;  4H0L D;  3TNU B;  4L75 A;  5KAF E;  1VQ9 P;  2G62 A;  1X8Y A;  3RK3 E;  3L34 A;  1ZHY A;  5KKZ B;  1SVF A;  2HJM A;  2AEM A;  3HTK C;  1FDO A;  3S1K A;  3OA7 A;  1M2O A;  3AEF C;  2L91 A;  2KW3 C;  2LQG A;  1XWJ A;  3EPV A;  3B0P A;  5D91 A;  1LT1 A;  1FBM A;  4KC9 A;  3E1I A;  2RMZ A;  1PPJ E;  1JCD A;  1EZV D;  4UB6 H;  2ZXR A;  1VQ8 P;  2OYI B;  2R44 A;  2WT7 B;  5JUA A;  1BE3 E;  4L73 A;  5KLI C;  4HYT B;  3H1I E;  4P6I C;  1BR1 A;  1NZE A;  3GEE A;  5T1D B;  4MVQ A;  5M1B A;  3F46 A;  3FVY A;  1NBB A;  3EHN A;  2AXT E;  5A6B D;  3QW0 A;  4UDV A;  3DM5 A;  4C7N A;  1JY3 O;  1YTZ I;  3FAJ A;  2WIT A;  2J45 A;  1LTS C;  4HFK B;  1LWU A;  1QKR A;  1EDJ A;  3S29 A;  3D70 A;  3AGT A;  3H2U A;  1M56 D;  2I15 A;  1S5L E;  2P58 A;  3FOP A;  3LAY A;  3H2V A;  1RCP A;  1QVG O;  2FYU K;  2NUT B;  3C8G B;  2X51 A;  3RFY A;  1MUU A;  1NTK K;  4KBL A;  3TDK A;  4A4A A;  5CIV A;  2R3S A;  3WHN A;  3C8G A;  2I1K A;  3NMK A;  1S3J A;  2Q4F A;  3CCM P;  3W4Y A;  4FWV A;  4IL6 E;  1L3P A;  4MS2 A;  1CI6 A;  3C62 A;  4JC7 A;  2JWA A;  2Y9Z A;  3H1K G;  1SQB E;  4EBJ A;  5B66 H;  5KKZ C;  2W6J H;  1T3J A;  2ICW G;  1S9K D;  3O6Q B;  1RF1 A;  4A7P A;  4JJF A;  3M91 A;  3KH2 A;  2UUI A;  1Q82 Q;  1ORJ A;  2OTL P;  1NTK E;  1FZE A;  4D6T G;  3U8P A;  2YLD A;  4I7Z C;  2AWY A;  3PH0 A;  4CDY A;  2KLV A;  1G1I A;  2OAR A;  3CZ6 A;  4TLF A;  4AYC A;  3A11 A;  1ZLL A;  3NMJ A;  1GL2 D;  3L70 E;  1M7L A;  2KYV A;  1U6H A;  2A6E F;  1YAU O;  1OCZ C;  3LNM B;  2N9B A;  3K1H A;  5JLI A;  3A0B E;  2J0W A;  256B A;  5KYX B;  3CCQ P;  3OW2 O;  3P32 A;  3FXH A;  2QE9 A;  4RO0 A;  5DJU B;  2ZXO A;  1BGY E;  3D6Y A;  3CMA P;  3JCU Q;  3L8I A;  2W90 A;  3RL0 B;  3BEH A;  4GIF A;  1YIJ P;  3L1M A;  3L73 J;  2VAS A;  2YNY A;  4RDA A;  2ASR A;  1Q81 Q;  2QJY C;  2Q6Q A;  1H88 A;  1GQA A;  2PP4 A;  1UIX A;  2NZ2 A;  5BQH A;  4XFJ A;  5KLV D;  2BAS A;  1MMD A;  2H7V C;  3ZDL A;  3EH2 A;  3GG2 A;  1WOL A;  2KZI A;  4OVN F;  4IL6 X;  5KJ7 C;  2QNL A;  1HGZ A;  5APQ A;  3Q2Y A;  1NU7 D;  1AV1 A;  2NPU A;  3HNL A;  2ZT9 B;  2Z4E A;  4MTO A;  1C02 A;  3RKO F;  1H89 A;  4WY4 B;  4I3M A;  1M90 Q;  4NCQ A;  2ZYA A;  1V4A A;  2M5A A;  1NFN A;  1G2C B;  4DOJ A;  3MIW A;  1ZP0 C;  5IY5 C;  4XLP F;  3NMD A;  1MKM A;  1LTJ B;  5TJH A;  2FYN B;  3NG1 A;  2PGD A;  4BJ6 C;  3AE2 C;  1XZP A;  4GOF A;  4YL1 A;  3K66 A;  3X2Q C;  1GU4 A;  4PD4 E;  1D0X A;  5L0G A;  2LSE A;  1OX3 A;  3PMR A;  3M9H A;  4I1O B;  5COF A;  3G4S P;  4YN0 B;  3OAK A;  3W2V A;  4HB1 A;  4XEV A;  1YYJ A;  1GM5 A;  3Q3D A;  1W2E A;  5K0I A;  3VMZ A;  2L6F A;  3U3B A;  1O5H A;  1JUN A;  1PPJ D;  2OEX A;  1T2K C;  4L76 A;  1TFK B;  1NTM K;  2WZ7 A;  3G6E P;  1JY2 O;  1Z3I X;  2BL2 A;  1P84 E;  3HTK A;  4H13 D;  2CPB A;  4MVS A;  2J9B A;  1NU1 K;  3Q6M A;  2P1A A;  1N73 B;  2KIK A;  1LM3 B;  1NHL A;  5AVS B;  1S9K E;  1IFM A;  1LT9 C;  1SQP J;  1KTM A;  1L4A C;  4OGQ D;  4PFP A;  2YXQ B;  3VRC A;  5AW6 B;  4PJJ A;  2CPS A;  2IBZ D;  2W83 C;  3EHM A;  1MMN A;  4MND A;  1BCC J;  5KAF H;  3CC7 P;  1BCC D;  2EIN C;  4IL6 H;  2PNO A;  5AW9 B;  4OD5 A;  5CI8 A;  1GGQ A;  1BGY G;  1VQ6 P;  3AG1 C;  3V2R A;  4WWI A;  3E1R A;  1H8A A;  2O1J A;  2B87 B;  1KMI Z;  4U3F G;  3RQF A;  1RF0 A;  3ZIB A;  2R7O A;  3W67 A;  1RE3 A;  1VQM P;  2HMZ A;  5CCG C;  1GL2 B;  3ATP A;  2GAQ A;  1UG7 A;  2GM4 A;  1QL2 A;  3HNJ A;  4BJ5 A;  2L7A A;  1V54 C;  1LP1 A;  3FWL A;  4DOZ A;  2OYH B;  1QGK B;  1DD3 A;  3C63 A;  1JPJ A;  3NTN A;  1PGJ A;  2P2U A;  1J8Y F;  2C9L Y;  3ABK C;  3G9R A;  3JCU H;  2L6H A;  3G50 A;  1K73 Q;  3JZ0 A;  5KYU B;  2KLU A;  1PCX A;  3A3Y B;  2B0J A;  1ZXG A;  4BJT A;  2IZ1 A;  3W68 A;  1PD1 A;  4NPF X;  2W4M A;  4LC1 A;  2IXO A;  3TQO A;  3H1K J;  2KNH A;  1HE9 A;  4ANJ A;  2KYH A;  4X0R A;  2V3C C;  2PX3 A;  2YO3 A;  3BRJ A;  5D92 A;  1HH0 A;  3BAT A;  4RES B;  4DZO A;  5A69 A;  3V5B A;  4D4X A;  3K5B A;  2ZYD A;  1RQV A;  4MVM A;  4U5F E;  1YA9 A;  2A45 H;  4AQR D;  1W2B O;  4EBB A; 
#chains in the Genus database with same CATH homology
 1GZL A;  2HOD B;  2Q3I A;  3HD7 A;  4OH8 B;  1URQ B;  2HPC A;  3M9B A;  2P67 A;  1JTH B;  3M06 A;  1NFO A;  3HD7 B;  1M1J C;  3MGN A;  3T97 A;  2R5B A;  3HRN A;  5APW A;  1RY3 A;  2IFN A;  1FZB A;  3RL0 D;  3HUS A;  4LGD E;  3N4X A;  3RK3 D;  4EIJ A;  1FZC C;  1VDF A;  3CL3 D;  5CCH D;  1LGH B;  3RL0 C;  3H6P A;  1NAF A;  3HUS B;  1J1E C;  2PAJ A;  2N1T D;  1SP4 A;  3IFM A;  3M0D C;  1N7S C;  1X79 B;  3HE4 A;  3VN0 A;  2YO2 A;  2HOD A;  1JOC A;  1HUC A;  2R5D A;  2VRS A;  1EQ7 A;  4LLH A;  2XV5 A;  4Y99 B;  2HPC B;  1A02 F;  3GHG A;  1DX7 A;  1IJD B;  2O1K A;  2L5G B;  1FZG A;  1EA8 A;  1AQ5 A;  2H43 A;  1GK4 A;  1LTJ C;  1SFC B;  4C46 A;  1FZC B;  2KSJ A;  1KFM A;  2HFE D;  3SWF A;  2YKO A;  2WPR A;  3V4W A;  1KZU B;  2C0W A;  1LPE A;  2Z5H A;  1NTZ K;  1IFN A;  5APY A;  1FOS E;  1LTB C;  2FFD A;  2NPS A;  1L0N K;  2WSE H;  5CCH C;  3NFQ A;  2KP8 A;  3RK3 C;  1JNM A;  1PFI A;  1YTZ T;  1Z56 A;  2KB7 P;  3HUS C;  1LTA C;  1J2J B;  1OR3 A;  3TK1 A;  1KIL B;  3GHG B;  2C0X A;  4WBA A;  2GUS A;  2I1J A;  2YKQ A;  1URQ C;  1JY2 N;  2JJL A;  3L36 A;  5CMZ A;  3BAS A;  2W27 A;  1CW5 A;  1RF0 C;  1DH3 A;  3VP8 A;  4JF7 A;  1N73 A;  3LIE A;  3HE5 A;  3CLQ A;  1JCC A;  3BRV B;  1HBW A;  2FKW B;  3HE5 B;  4AUW A;  3P8C D;  1SQB K;  3B5N A;  5AW8 B;  2E42 A;  1H7I A;  2Q9I A;  2WSC H;  3WMM 0;  2HYN A;  3B5N B;  1GS9 A;  1HWT C;  5CCH A;  5AW7 B;  3VTP C;  3PP5 A;  5AW1 B;  4I6M C;  5APT A;  1LE2 A;  2ZFC A;  1SQV K;  3KDP B;  3HD7 C;  3A7O A;  4JYB A;  5AVR B;  1GL2 A;  2FYZ A;  2W6B A;  1L4A D;  1JY3 N;  1FZA A;  2OYI C;  2IFM A;  3C9I A;  3TYY A;  1GW3 A;  1CZQ A;  4N78 D;  1SLQ A;  3A2A A;  1SFC A;  1ZR4 A;  3M9Q A;  2M8R A;  3P8C E;  1G2C A;  5CHX A;  1URQ D;  2YMY A;  1N7S B;  2H7H A;  3TNU B;  1A02 J;  2IX7 C;  3HD7 D;  1X8Y A;  3OJA B;  4Y99 C;  2NPS B;  4O9B A;  1SVF A;  4N3Y B;  3OA7 A;  3N7N A;  2GUV A;  5KJ7 D;  3VMY A;  1OR2 A;  3V2Q A;  1LWU B;  3P8M C;  1FBM A;  2QM7 A;  2MJZ A;  1FJP A;  3E1I A;  1XTC C;  3U1C A;  4M3L A;  4JYC A;  1EQ1 A;  4WY4 D;  2E43 A;  2WPS A;  3LW5 H;  3H32 A;  1JCD A;  2XKM A;  2OYI B;  1CI6 B;  2WT7 B;  3KPE A;  3R2P A;  4IFD K;  4HYT B;  4N6J A;  2O01 H;  2WSF H;  1RE3 C;  4ZKP A;  5BU5 A;  1NO4 A;  1AEP A;  1QL1 A;  3BRT B;  1HVV A;  5AVX B;  2W6A A;  2XDJ A;  1RF1 C;  1T8Z A;  3S84 A;  1ZR2 A;  1BZ4 A;  3RK2 D;  4C7N A;  1JY3 O;  1YTZ I;  3B5N D;  3V2P A;  2WIT A;  1SQQ K;  3VOP A;  1LTS C;  5CCG A;  1LWU A;  5KTB A;  1KIL C;  1IFI A;  5AW5 B;  3I5C A;  3V4Q A;  2PP6 A;  1KIL A;  2FYU K;  1LT9 A;  2XU6 A;  2WT7 A;  2OYH C;  1IFD A;  1MUU A;  1NTK K;  3P7K A;  3TSI A;  1GK6 A;  1SFC C;  1X9V A;  2I1K A;  5KJ7 A;  3L4F A;  3KYQ A;  1CI6 A;  3HE4 B;  1FJK A;  3IR9 A;  1MFZ A;  2R32 A;  2LKM A;  5AVW B;  5BVZ A;  5AVV B;  1RF1 B;  2WWW A;  1J1E B;  4C7R A;  2M3B A;  1T3J A;  2NPS D;  1S9K D;  1RF1 A;  4IFF A;  1FZC A;  3MUD A;  2FXM A;  3M91 A;  2N1T C;  1SFC D;  1FZE A;  5AW3 B;  2KLV A;  5APX A;  1G1I A;  1M1J B;  2OAR A;  1GW4 A;  2HLO A;  2Z5I A;  4AYC A;  1ZLL A;  3L35 A;  1GL2 D;  1HTL C;  1M7L A;  2KYV A;  1N86 A;  1JMM A;  1IO4 A;  2N9B A;  1ZN5 A;  3UIA A;  1OXZ A;  1FU1 A;  3HTK B;  4I1L A;  3P32 A;  1SQX K;  2HG5 D;  1E5W A;  1FAV A;  1L4A B;  2A45 G;  5AW2 B;  1FOS F;  1LTT C;  5APS A;  1GDT A;  1JY3 P;  3RL0 B;  3V2N A;  4GIF A;  3KQG A;  4WY4 A;  2YNY A;  3RK3 B;  3NXS A;  1N7S A;  1H88 A;  3A5T A;  1M1J A;  1GL2 C;  5AVU B;  2JEE A;  2ZXE B;  2BAS A;  3LID A;  2FFD B;  5APV A;  5KJ7 C;  1HGZ A;  5APQ A;  3L37 A;  5BU8 B;  3VP9 A;  4B86 A;  1MV8 A;  2Z4E A;  2J58 A;  5AVT B;  3BVH A;  4GKG A;  2POH A;  1FZF A;  1MZ9 A;  1H89 A;  1T3U A;  3GHG C;  4WY4 B;  1AFO A;  1NH4 A;  2XZR A;  1NFN A;  1N73 C;  1URQ A;  1G2C B;  1L4A A;  4N78 E;  4DOJ A;  3MIW A;  1NKN A;  3B5N C;  3NMD A;  1G1J A;  1LTJ B;  3EQ2 A;  1RE4 A;  2N1T A;  1DEB A;  1J1D B;  1LTI C;  3RK2 B;  1GU4 A;  1IK9 A;  2N1T B;  3M0D A;  3M9H A;  2C9N Y;  4W7Y A;  3CI9 A;  4XE5 B;  1N7S D;  5AVY B;  2QM8 A;  3OAK A;  1KFN A;  1JY2 P;  1NOH A;  3B8E B;  3MD0 A;  1W2E A;  3VMZ A;  1JUN A;  2H8P D;  1T2K C;  1NTM K;  2WZ7 A;  4ZKU A;  1LE4 A;  1JY2 O;  1LTG C;  3HTK A;  2CPB A;  1NU1 K;  2OYH A;  1N73 B;  1N7L A;  1NHL A;  2IPP A;  4XA4 A;  5APU A;  5AVS B;  2Q7C A;  1S9K E;  2NPS C;  5AW0 B;  1IFM A;  1LT9 C;  1L4A C;  4W80 A;  3G3Z A;  1IC2 A;  4I2L C;  5AW6 B;  2CPS A;  2Q5U A;  1LWU C;  1GU5 A;  2J59 M;  3VMX A;  1J1D C;  1LTJ A;  1HGV A;  1RE4 C;  1KIL D;  5AW9 B;  2R3C A;  4IFM A;  3II6 A;  1VPC A;  3V2R A;  1H8A A;  1ZV8 A;  2O1J A;  3O8Z A;  3H32 B;  1T2K D;  3RK2 C;  2OYI A;  1RF0 A;  1L0L K;  1RE3 A;  4W7Z A;  5CCG C;  1GL2 B;  4KHX A;  1NKZ B;  2A45 I;  2GM4 A;  1QL2 A;  2WPQ A;  2KC3 A;  1XTG B;  1N2D C;  3TNU A;  4C7N B;  2OYH B;  4WY4 C;  3NTN A;  3VYI A;  2YKP A;  3EFG A;  2P2U A;  2C9L Y;  2KOG A;  3MTU E;  3SWY A;  5AVZ B;  2WTY A;  5KLV K;  3U1A A;  3U59 A;  1YYC A;  2FFD C;  1HJB A;  2P7J A;  1JO5 A;  5AVQ B;  1KQL A;  3A3Y B;  1CSB A;  4HH2 A;  1FDM A;  5CJ4 A;  1WT6 A;  1LT9 B;  1SQP K;  1GD2 E;  4LC1 A;  1IFJ A;  5CCG D;  4GT1 A;  4WB4 A;  1GTW A;  1NWQ A;  2YO3 A;  3M0A A;  1B68 A;  1HH0 A;  2P1J A;  5AW4 B;  3BAT A;  1WRG A;  4RES B;  4DZO A;  3V5B A;  1OWA A;  2XNX A;  1YA9 A;  5CJ0 A;  1JTH A;  2A45 H;  4AQR D;  4EOT A;  1LS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...