3R2PA

2.2 angstrom crystal structure of c terminal truncated human apolipoprotein a-i reveals the assembly of hdl by dimerization.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
180
structure length
180
Chain Sequence
b'PPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-I
publication title Crystal Structure of C-terminal Truncated Apolipoprotein A-I Reveals the Assembly of High Density Lipoprotein (HDL) by Dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 68
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.20 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3r2pA02
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 3r2pA01
1EQ1A 1LS4A 1BZ4A 1GW4A 1LE2A 1H7IA 3R2PA 1NFNA 1YA9A 2KC3A 1B68A 1LPEA 1OR3A 1LE4A 3S84A 1GS9A 1NFOA 1OR2A 1GW3A 1EA8A 1AEPA
chains in the Genus database with same CATH superfamily
1TR2A 3CMAP 5CI9A 4LACB 3V6IA 2BCCJ 2NPUA 3FHDA 3GANA 1ZW2A 2A69F 2XLDA 2I1JA 3LW5J 2W4BA 5KJ7C 4D4NA 4OWFA 1KMIZ 3ABVC 1J1DB 2YNYA 3EFOA 2RH0A 3DI5A 2WMMA 5KLVE 2Y69C 2DB4A 1OW8A 1AVYA 1J1DC 3NMJA 3H1HD 5B5EE 3A0HH 1GU5A 4CIHA 1T6IA 2KLVA 2KSEA 2ZXEB 4JJGA 2B88A 3LEOA 3WU2H 4H54A 3AE4C 3GHGA 3UGOA 1SQBJ 3CX5I 1OKKA 1VTMP 1Z6AA 1X9VA 3D70A 2CW0F 3PHF2 1NTMK 2E75D 1AJYA 1GL2B 1RF0A 4P9TA 3IQ5A 4FWVA 3CXHE 5KLIB 4I1MA 4WB4A 5TJ5E 2GM4A 5KYUB 3ZWIA 2M3BA 3DMDA 4IFDK 5KLIC 1AEPA 3FWNA 2PAJA 1S2EA 2LXBA 2WVQA 3LESA 3JC22 4JTAB 1U7MA 2BE5F 2PNOA 1JMBA 2YIUB 3CXHD 4XPXA 1NVOA 2VH3A 1YI2P 1EDJA 4W80A 2QRXA 3MP7B 4JF7A 1QL2A 3CEXA 3BRVB 1MFTA 4KNWA 3TOMA 2KIKA 4O9BA 4JE9A 1L4AD 4PV1B 1MNEA 3AE1C 4IOIH 1L4AB 3U8VA 2LR2A 1KQSO 1XWJA 2YO2A 4PV1C 1G5ZA 2BL2A 2JWDA 1L4AC 1QX8A 1JR8A 3ZTZA 3T6BA 1P84E 2BEZF 3SWKA 4OGQB 1RQVA 3QMKA 2OGUA 4QMAA 2EIMC 1N2DC 2OARA 3CC2P 2IXMA 3L73G 3GF3A 1MZ9A 2GDCA 2WZLA 4C46A 5APWA 4IARA 1L0NK 1PZQA 2HFED 5GTIH 2KI7B 3AE3C 4U3FE 1YTZI 2JPUA 2FXOA 3OA7A 3Q6NA 4MVRA 1NU1G 3AQCA 1N7SB 3UIAA 2YQYA 5KYNA 5CCHD 1N8RQ 1YIJP 3AE9C 1ZV8A 1N7SC 4U3FD 1NWQA 1M57D 2I15A 5L0FA 4HFFB 3R4YA 1RJ9A 2MJZA 4EBJA 2CPBA 4P6IC 2OYIC 3L8JA 1JRAA 3BCCJ 5CCHC 3ZDLA 3D71A 1JPNA 3TD7A 1PGPA 2P7VA 1M57C 4ONSA 4ZKPA 3GM3A 3QH9A 1MFZA 4C7NB 2B0HA 2AEFA 3AJMA 2R32A 2MKVA 2QM7A 3PCVA 2BASA 1NHLA 1M8OB 2ZVOB 2I8DA 4JQ0D 5AW5B 1ORYA 3I55P 2Q9AA 4EYYQ 3SXZA 1XZPA 2JR8A 3WUVA 1HGZA 1K73Q 2M8RA 1WMKA 2QNLA 5GTHE 4EOTA 2IPPA 2J58A 2OTKE 4KBLA 3HUSB 4OIRF 1MUUA 1FC2C 2WVNA 3USSA 3QZCA 2NSFA 5APVA 3EJNA 1BBHA 3UMHA 3HUSC 2XXAA 3L75E 1OCRC 1LT9A 1RY3A 3RL0g 1VMAA 1HJ0A 1S5LX 2N1TD 1AVOB 4QI0A 4NTFA 3Q7GA 3C8VA 2R05A 4BRYA 2N1TB 3V5ZA 2FGYA 3B0PA 2ZYGA 3BRTB 3C1LA 1S9KD 1ZHYA 1OW7A 2W6JH 2L91A 3TGUG 4BJ6C 1FZAA 5B3IA 2N1TC 4LDQA 3GEEA 1D1BA 1XZQA 3UMKA 5CCGD 3U1AA 1HBWA 2YO3A 1OX3A 2WSCJ 1H89A 2UWJE 2K9JB 4UDVA 1CSBA 3FOPA 2QJPC 2FFDB 5CCGC 1OCCC 2FYUG 1GQAA 1YTZT 3KPHA 3IF4A 2YEVA 3T4RA 3AEEC 3C18A 2K88A 2PF4E 1T2KD 2PP4A 1RF1B 4XA4A 1J8YF 3MLGA 1HMDA 4WWIA 1RF1C 2AU5A 2CNWA 4ER9A 2IDBA 5KLVG 1E5WA 3SWYA 4J7TA 5COFA 4H0LB 1T2KC 5CJ0A 2J9BA 3VMYA 1DOVA 4TLFA 1LE2A 3ZTMA 1RCPA 2FBWC 1JAFA 4H0LC 4XQ1A 1IW7F 2AXTH 2WSSH 3CCLP 5KJ7A 5L0HA 1OVRA 2HG5D 3AEFC 1O3UA 3KZIH 4NQFA 5A6JA 3MYFA 3H1JE 5EFWB 1YZCA 2Y9ZA 4DOZA 2IBZD 1TQGA 2A6HF 4WBAA 3D6YA 4GEHA 3WMM0 4UB8E 2FXPA 1LI7A 4UB6H 5BU5A 2WSEH 3H1JD 3B4SA 2L6FA 1LTBC 3RGUA 1UIIA 4U5FE 1BE3E 1H9TA 2E5TA 2QG4A 3JCUE 5L3QA 3JRTA 3CCVP 1ZP0C 1RMVA 2M5AB 2Y0DA 2KSJA 4HB1A 3AE2C 1LWUB 3G6EP 4XE5B 1FJKA 1KQLA 1QZXA 3U3FA 3WG7C 1OXBA 1BE3D 4X0RA 5L0GA 2R44A 2L5GB 3H25A 1LWUC 1CPQA 2L6HA 4ZLDA 3RK3E 1FZBA 5KYUA 5L8RJ 3DD7A 5DS4A 3ZIBA 2FAPB 1SS1A 5EHHA 4D4XA 1KZUB 3FOOA 2HFIA 2P10A 2B87B 1UIXA 1HJBA 3LIDA 3CLQA 3GM2A 1JTHB 4C3DA 3L70E 1YVIA 3QW0A 4JYCA 1G4WR 3ZVRA 1YJ9P 4AE4A 3RK3B 3JSZA 5JVEA 3U1CA 5K5GB 1KD1Q 1L4AA 3RK3C 4U3FG 1Q82Q 4YL3A 2KZIA 4AYCA 3L70D 1SQVJ 3QWOC 1YAUO 2D5RB 1CI6B 4JIOA 3EFGA 1EZVE 3FMSA 3KYIA 2JKVA 4IWBA 1GTWA 1FZGA 3L71D 1FAPB 5A6AA 1T9KA 1WATA 3JT1A 4DVZA 2Q3EA 2XL6A 5KAIE 5B5EH 5KLVK 1V55C 3W67A 2Z5IA 3II6A 5KAFE 1M2OA 3JTLO 3SP1A 2Y9YA 3M0AA 3TULA 2R3CA 1K40A 1L0NJ 1QVFO 1YLMA 1PP9J 3GEHA 1A7VA 4J30B 3M06A 2K1AA 1HF9A 3CCEP 3CD6P 3L74J 2OQMA 1N7SA 2J5UA 1S05A 4W8PA 1N1CA 3V2NA 1BGYE 2J9VA 3AQBA 4PJNA 2OYIA 4L75A 2AWYA 1OVUA 3H1ID 3CXHH 5DLJA 5CCHA 2DGJA 3SXMA 1SQPJ 4YXWH 4AX2A 1OXKA 4ASWA 2B89A 2H43A 1VB5A 2XKMA 3F89A 3IQTA 2P58A 1BGYD 5GPGB 3RBZA 2J8WA 2YKQA 3L75G 1LIHA 4R4LA 1ZHXA 3MX3A 3GHGB 2HODB 1OZHA 4DCKA 3U9JA 4R4MA 3CCJP 5B3SC 1VPCA 4R32A 1JY3P 4OIQF 2IZ1A 2ZT9D 1JO5A 1H9GA 3B8EB 4JW1A 2ZT9B 1LP1B 3HUSA 3P8CE 2WSFH 1NTKJ 2XL8A 3TQOA 2ZT9C 1HY5A 1P84H 3NDBB 2J7PD 2A1DD 2OOCA 2E43A 2G3VA 4O6NA 4C3BA 3AEBC 3CX5E 4IL6E 1KFNA 4BJ6A 2GA0A 1XTCC 2N1TA 3H32B 2POHA 1JY3N 5B1AC 4RESB 2ZXWC 3LJBA 5L0IA 1FZFA 2QSIA 3IR9A 2WPQA 3JCUQ 4CDAA 3HD7D 3JSVC 2CK3H 3V4WA 2IBZI 1U57A 2HYNA 5CCGA 1VQPP 2H89C 1HGVA 2IXPA 3HD7B 2NZ2A 4JYBA 5APQA 2OYHB 1MQVA 4JPZB 2IM8A 1DEBA 1HW1A 3HD7C 2OYHC 1QLED 1JEKA 2PP6A 1RF1A 4QDLA 3CZ6A 4A7PA 1KNYA 2YKPA 4L74A 1ZHTA 3L73J 3V5BA 2OEVA 2ZXRA 2BC5A 3LNMB 1YA9A 3NKEA 1V74B 1QLEC 1VQMP 2R25A 2DYRC 4HH2A 1RE3C 3DAFA 1NU1J 1HW2A 1BE3G 1TWGA 4GDOA 5GTHH 2HJ3A 2LFFA 3A5TA 1CZQA 2Q6QA 3SWFA 1NTZJ 5CHXA 1C03A 2O01J 2QJYB 3SSUA 3LEVA 3NYMA 1YBKA 4O79A 3RYLA 3O6XA 2XL4A 2IFNA 1SQQJ 1ZMEC 4FESA 2QJYC 4G7OF 1IFIA 1WRGA 3H1LE 2W45A 2PBEA 2HMZA 4GT1A 1NU9C 1SQXD 4Q7CA 3FXDA 2D4UA 1QL1A 3S1KA 1VF5D 3AGUA 3H2UA 5DJUB 4I7ZB 2WPSA 5APTA 3CC4P 4YN0B 4OH8B 3A0BE 5A6KA 3H1LD 2M5AA 2WITA 3MUDC 4AUWA 2LXCB 3L70G 1ZU5A 1VQLP 4I7ZC 1O5HA 1NTMG 3ASOC 1LWUA 1JY2P 1VF5C 1O87A 1IFPA 5L0CA 2FYNB 3DKAA 4E7SA 3L0IA 4PJJA 2AEMA 1Y4CA 1LT9B 4YT2A 2FYNC 3DZAA 3PH0A 2I1KA 1F1MA 2R7WA 1TWCA 3C8ZA 1EZVG 5A6BD 2R7TA 2B87A 2P61A 3DE9A 5KTBA 4IB4A 1KILD 2C9NY 5D91A 3CL3D 1M90Q 4BJ5C 3KH2A 1JTHA 1GZLA 4U5HA 3TGUJ 3E9VA 1NTZD 3HNJA 2HUJA 1JY2N 3VP9A 2XM0A 3H6PA 4KNVA 1PGJA 3W8HA 2K9YA 4ZKUA 2B9BA 2X0CA 3OWTA 2NPSD 2RKLA 2A45G 1KQFB 1CI6A 2NPSB 1GD2E 3L72J 1Z7Qc 2FYUJ 3RFYA 2Y0CA 1YZAA 1BGYG 3ABMC 2NPSC 3ZC4A 1EKYA 5AW3B 2PX3A 2VRSA 4U5EE 4UB8H 4ULVA 1AUEA 2H8PD 3AE6C 4FAPB 5DS6A 4HKZH 4JURI 3JCUH 2L81A 3SXYA 256BA 3H1HE 1I5NA 3MTUE 1NOHA 4DRHB 3M9BA 1A7DA 2NSGA 1M7LA 4CJGA 2O1JA 2OQQA 5DQZA 2LKMA 2P1JA 2WPRA 3Q5SA 2EIJC 3OEOA 4YT8A 4NCQA 2YXRB 1QEXA 1VQ9P 1L0LJ 3EZHA 3Q2YA 3HNLA 5T1DB 4J32B 1X22A 2HODA 3M4BA 1X79B 2OEXA 4DRIB 3DJUB 5A69A 2VASA 4PJ0E 3U3BA 1QQ3A 1M6TA 2E75B 2N9YB 1LP1A 1Q2NA 2DW3A 1LTJB 2RMZA 3PP5A 4AQRD 1VLTA 2E75C 2ZXPA 3PTZA 5T3TA 5K0IA 1FOSF 3LUTB 1LTJC 2IBFA 3EGDB 1LKXA 2WSFJ 2OTJP 3C63A 5APYA 2BCCD 5HV9A 2M4EA 1BCCJ 1C17M 1CGOA 2OJQA 5KAIH 2J7PA 4A4AA 4ULWA 3H32A 1MV8A 3T6JA 4AE4B 3HE4B 3L37A 1T8ZA 5KAFH 3GWLA 2I8BA 4OIOF 4XFJA 4GODA 2WZFA 1DD4A 1SQBE 3Q7LA 4EHPA 1K05A 2A45H 2GA1A 3U0CA 4CJOA 3HJCA 3T6GB 2M64A 3PHLA 1WWPA 3I5PA 2RSEB 4KHXA 2O9XA 3MD0A 2H8AA 1L0LD 2Z4EA 3HD7A 1URQD 2OYHA 1LTIC 5BQIA 1OCOC 3MBGA 1JUNA 4JZAA 1SQBD 4EKWA 2AVKA 5JUAA 1URQB 1NYHA 3A9CA 5AVWB 1HMOA 3NYJA 4D6TJ 1YQ4C 1URQC 1ST6A 2Q3TA 5BU8B 4YL1A 4N78E 1V54C 2W4MA 1SVFA 1N73C 1RE3A 2A0BA 2WB7A 3W2VA 4Y99B 2XSEA 3H1KJ 3EFFK 2V7QJ 3G4SP 1U6HA 4Y99C 1VLSA 3ZQVA 3KQGA 1Z63A 4N78D 3HTKB 1NFNA 2OYIB 2PGDA 3EPVA 4L73A 3HTKC 1KYOI 1D7MA 3K7DA 1OWAA 3I5CA 2WVOA 2R9RB 4Q4ZF 4YT4A 3EG9B 1M1KQ 3ZG1A 3LLKA 3A11A 1L7CA 1ZW3A 1RQUA 3AG4C 3TK0A 2R7XA 3S4RA 4OVNF 3CX5H 4IL6H 1H0TB 2R5BA 4LLCA 1LTTC 4YXDC 1YDIA 3L75J 1WASA 4RDAA 3MUDA 4DZOA 1LPEA 1OXZA 3AG2C 2LP4A 2IFMA 3LIEA 3ECSA 4B86A 2Y0EA 1VDFA 2FKWB 2CDQA 5EK0A 3WODF 2XRHA 2JP3A 3G50A 3AG3C 1TFOB 3G71P 5JP7A 3U2MA 1S9KE 4LGDE 4KI2A 3E1IA 4PFPA 1T5OA 1IFJA 4LERA 3LLIA 2WZ7A 4U5DE 5BQGA 5L0JA 2K37A 4BJ5A 3BCCE 4EBKA 2C9LY 4NPFX 2VCAA 1Z56A 4C3EA 5A6BA 1GW3A 4B6IA 2FFHA 1R5ID 4MVZA 2QEXP 1NO4A 3AE8C 3BCCD 2QJPB 1PV3A 1Z5ZA 2NG1A 1NSGB 1ZN5A 5KYXB 3F46A 4U5GA 4GIFA 5E33A 1Q0GA 1KQGB 2WZGA 1R4TA 2XZRA 3AG1C 2NPSA 3H1HG 2P0NA 1NH4A 2KW3C 4YK5A 2Q3IA 3Q5RA 3MIWA 3K1IC 3N4XA 4EIYA 3UMIA 2QUPA 3G3ZA 1YYCA 4Z9HA 1EDKA 2R02A 2A06E 3ABLC 4GYTA 5FCLA 2IBZE 3C8GD 3SFDC 3EWKA 2XM4A 3A0BH 1YJNP 4C7OB 1EXIA 3UGPA 4DT0A 2KUBA 1Y9BA 3C8GB 1OQCA 3TSIA 3NXSA 2C04A 1KB9I 3K5BA 3ZDMA 2A06D 1C02A 2XLMA 3B9QA 5BQHA 1DEEG 1LGHB 2Q7RA 3RKOF 2JEEA 5DQTA 1CGME 1IFMA 4IAOA 4PD4I 3PMRA 1NU7D 4BEMJ 2ZPAA 4Z9JA 2LD6A 1A02J 1ZLLA 2HR3A 4H13D 3U2LA 1FS0E 1ZHZA 1YYXA 4CS8C 3QVYA 5BVZA 2KZJA 1U7JA 2KYVA 4W7YA 2Q4FA 2FY8A 1LNQA 1JY3O 1U0BB 3SZRA 2W83C 1G1IA 1AFOA 1T3UA 3LS1A 1NTMJ 4U9DA 4G78A 1FTSA 3LNRA 2W9YA 3Q3DA 1V4AA 4JTDB 3KHUA 2OCCC 2A6EF 2ASRA 3OW2O 4BJ1A 1SQBG 1LTJA 3CWBJ 4MTGA 2Q5UA 2WTYA 3B71A 1RKCA 3V5XA 3EGDA 2XDJA 1S4XA 2QA4P 1A0BA 4I3MA 1A7EA 2EPKX 2MWQA 2ZD9A 1BR1A 2Q1KA 3NFQA 4EIJA 4ZMDA 2LSEA 1EXJA 2Y3HA 2R5DA 3IFMA 5KYYB 1T6QA 3HE4A 1HE9A 3M1CB 3RF3A 1AA0A 3L71E 1A41A 4RD9A 4W8KA 3US6A 2CPSA 2YRFA 3VRCA 1IZNB 1LM3B 4AL1A 2G3AA 4EDFA 3MFNA 3CAXA 3GW6A 5AVYB 3VN0A 1LTSC 2M0BA 1RKEB 4M3LA 2Q00A 3ZQYA 3JYYA 1URQA 1NZEA 1G4US 3VYWA 4E7ZA 1YYJA 4PFOA 2RN0A 3BEHA 1N73A 1WT6A 1FR0A 2VC9A 3CQZA 5AGFA 2XLEA 4MW8A 4IGGA 1K04A 1IZMA 3H1IE 5AVUB 1H8AA 1CGNA 2JDIH 1N86A 3IEEA 3AEAC 1DX7A 1ZU4A 2H7HA 3CWBD 2XS8A 3NYLA 3V4QA 4IJJA 3HTKA 4PJ0H 2HV7A 2L7AA 4G7ZF 4ANJA 3L35A 1M2VA 3EHMA 2KB7P 1HE1A 3M91A 3WUUA 2KOGA 5AW0B 3LW5H 1A02F 1RH5B 4MTOA 3EG9A 2NUTB 2C03A 3KMIA 1JPJA 1G8XA 4J7YA 3WAQA 1SQVD 2HLOA 4Z9IA 1H0TA 4AK9A 2PX0A 1ZZPA 4TT3H 5CBNA 2ICWG 4DXWA 3DWWA 4HE8D 4YT5A 1LI5A 1YA7O 2AP3A 5AW2B 1FAVA 4YL0A 5F5HA 3Q6MA 1PP9E 2WT7B 1MMGA 2PFDA 1JY2O 1OKKD 3L74E 2KK7A 1SQBK 1OMIA 2E5YA 3L1MA 4OINF 1FE6A 3P7KA 4HFKB 3EGXB 4JVSA 1L3PA 2XS1A 1L0ND 3IQ6A 2WQYC 1YJWP 1PP9D 5C39A 1VQOP 2WWWA 4WY4D 1SQPE 3L74D 4I2LC 5JRAA 1EQ1A 3M15A 5APSA 4QI2A 1RE4C 4WY4B 3D6ZA 3AE7C 4NPDA 4XWJA 1GW4A 4BPMA 2W90A 3RL0D 3GF7A 3H65A 4WY4C 3MZWB 4Y28J 1S1CX 3BASA 3V7OA 5AW9B 2IOQA 1BSNA 1DH3A 2EINC 1ZYRF 1SQPD 3N7NA 2R7VA 3RL0B 3RQFA 3EHNA 3GM1A 2QJKB 1PCXA 4N6HA 3RL0C 5KYXA 2IBZG 2HZ8A 2PFXA 3JZ0A 2QJKC 3K1IA 1NTKE 3EH1A 2P1AA 3H1JG 1SLQA 3KPEA 3I4UA 4XTKA 3CSKA 2EPMX 1PD1A 3CCSP 4JBZA 4ASVA 4JKVA 5APUA 1QVGO 4M63A 1NTKD 1HWTC 5F5FA 4F4BA 1PIXA 2ZYDA 2QE7H 3ITFA 4C7OA 3P32A 1ZRTE 2C0WA 2LK4A 1S5LE 3U8PA 3C8GA 3K66A 1Q0FA 3O55A 1SQXE 4YPCA 4C7RA 4CX9A 1PGOA 3L8IA 3DM9B 3J06A 1TWAA 1ZRTD 3T9OA 1W2EA 3VOPA 4CS8A 1LVKA 3L36A 1QGKB 1NKZB 2YKOA 1E85A 3DM5A 2WSEJ 4YTPC 4ZLCA 1E2XA 4PACA 2F22A 2E76D 1BR2A 3MGNA 1VF5B 2ZVNB 5AVZB 1KYOE 4A2NB 1ORSC 1FU1A 4EUKB 3L73D 1KILE 3L71G 1E79H 1U89A 3KYJA 4EWCA 3JSEO 1NTZE 1XTGB 1KYOD 1LS4A 2AXTE 5E3AA 1SQQE 3A3YB 5AW1B 2YMYA 1NU1D 3VP8A 5E79E 2KK1A 1JNMA 3UNGC 2YLDA 1K9MQ 1J1EC 3NMKA 1FFTC 1KILB 3UR3C 4GQHA 3NG1A 1OR3A 1SZIA 5KYYA 1SQQD 3KKBA 1KC8Q 1KILC 3GODA 4EI2A 3K1HA 2HPCB 3W2WA 3X2QC 2E74D 3H1IG 5E3CA 1IK7A 3NMDA 3RK2D 5COGA 3VMXA 2E74B 2YVKA 2YKZA 1ZXGA 3RK2B 3KDPB 2E87A 3OJAB 3CCQP 3H1HJ 2E74C 1H7IA 1RKEA 2LFDA 3RK2C 3RQGA 3FX0A 1NG1A 1LE4A 1NJIQ 1M56D 5KLVJ 3CI9A 1OR2A 1SMYF 1EQ7A 4FX5A 4PJLA 2JD3A 2H7VC 5L3VA 1UG7A 4KC9A 3ITKA 1JM0A 3TGUE 1Q86Q 4O6MA 1M56C 2WPVB 3K6BA 1VQ7P 1YJGA 1ORJA 2UUHA 2BEQD 1CW5A 1JMMA 1GM5A 3S84A 1PP9G 3SFEC 1BDJB 2YXQB 3TGUD 2R3SA 3CCRP 1ZW0A 3H2VA 4NY3A 3L74G 2KNCB 3L72E 4N4WA 4P9FA 2FYUE 4I6MC 1UFBA 2NUTA 2Q9BA 4G7HF 3AEDC 4LLHA 2IYOA 3M4CA 3S27A 1NBBA 3C9IA 1SQPG 3L72D 2J46A 1Y47A 2FYUD 1KB9E 4KT0J 2H7OA 2IXNA 1OIPA 3HNKA 2VCCA 3BRJA 4JJFA 2WT7A 1T6UA 2BCCE 3O8ZA 3M9HA 3B0UX 4OIPF 4PD4E 3PDMP 5KLVD 3EGXA 4MTFA 1D0ZA 2RD9A 1KB9D 1GL2D 2YWAA 3X1OA 3KYQA 1T6AA 2P6VA 2YLIA 4NTBA 1GMJA 5M1BA 2OYOA 3GWNA 5JT4A 1RE4A 2KS1B 1HTLC 2YL3A 2SPZA 1GU4A 2HSBA 1NTKG 2QIWA 4PD4D 3IQCA 4WY4A 1GL2C 3EQLF 3IN6A 1KN7A 1ZHWA 3HRNA 2HS5A 5IY5C 1L0LE 5KKZB 3L4FA 2ZAEB 2R7RA 4U7JA 1FNTc 1SFCD 5KKZC 3HLZA 1PL5A 2V4HA 4XPWA 1FZCB 3V5YA 3F5HA 2R7OA 4U3FJ 2J0WA 4HYTB 1SFCB 4N6JA 5CI8A 1FZCC 4RO0A 4PV1D 2YIUC 4LC1A 2WL8A 1VQ8P 1SFCC 4NC3A 5B1BC 1J8MF 2Y3GA 2L6GA 2ETSA 3ZSUA 1EDIA 2Y39A 1SQVK 2Y3DA 1SQXG 1LTAC 1N73B 1JCDA 2MYSA 2O1KA 1WOLA 5D92A 4OGQD 1LT1A 1H88A 2KXPB 4OD5A 3H1LG 1Q81Q 1BCCE 3AOUA 1Q7YQ 1G2CB 4BJTA 2IXOA 1MKMA 3FWLA 4OGQC 5H2FE 2QY9A 1B68A 2CYDA 4XPYA 1Q90D 1M2VB 3OA1A 2XLWA 1P84D 1BCCD 3QW1A 3DE8A 3O6QB 4U9EA 2W6BA 1N7SD 3AECC 3I5QA 2ZXXA 1IK9A 4IL6X 3NKDA 5TISE 3KXDA 4MVOA 4RBNA 4MQ9F 1NGMB 1NTZG 3E1RA 2AXCA 3TOLA 3R2PA 1E84A 4D6TE 2KLUA 1SQPK 1SQQG 1FBMA 3FDQA 2HKVA 4Z1MH 3FAPB 2EIKC 3PJSK 1M1JB 1DD3A 3H1KE 1YARO 4K3AA 1VL2A 1KV4A 2Q7CA 2TMVP 1M1JC 1ZVZA 4D6TD 2R03A 2N9BA 1MMNA 3BVHA 1MMAA 3B29A 1E86A 1QSPA 3FVYA 2JJLA 3H1KD 2Q9IA 2CGEA 3SNHA 3M0DC 1NKNA 1JCCA 3Q5PA 3B0VC 3AEGC 1WGWA 3S28A 1NTKK 2OG2A 5EGYA 4K1OA 5CBOA 3B5ND 3TNUB 2A68F 1D1AA 2XU6A 4E18A 2FXMA 1KILA 2LCHA 1QPUA 3B5NB 2J45A 4BEJA 3VMAA 2XNDH 1I4YA 3ASNC 1FDOA 3B5NC 3G4XA 2XV5A 2HPCA 1Y8AA 1W2BO 1W2WA 4XLPF 2KQ9A 3U5SA 4GKGA 1S5LH 2IX7C 3M9QA 3CMEP 5T3WA 4PR9A 1Z3IX 3L75D 3ATPA 1IFNA 3G9RA 5CJ4A 5AW4B 4HJGH 2OKUA 1SQXK 1PFIA 3H1JJ 4MVMA 2YZSA 3FAJA 3I56P 4WVZA 4DRJB 4CSAC 3NRHA 2LIGA 5DJTB 2P2UA 3L72G 1Z23A 2KJGA 4CS9C 3PLNA 4JEAA 2XLVA 3DXJF 2JWAA 1OCZC 2FFDC 1FDMA 5F28E 1PPJE 1BE3J 4G0HA 4KJMA 1TFKB 4H0LD 1KYOH 2VCBA 1EA8A 3VF0A 3TDKA 1GK6A 3RVYA 2HMQA 3CC7P 4XEKA 1NU1K 1HH0A 4I44A 4CIPA 1PPJD 2L9JA 1R5LA 2BCCG 1PGQA 3WHNA 2O01H 2KNCA 3GMAA 4L6RA 1NTZK 5E79H 2ZXOA 5B66E 1YHQP 1SQQK 3Q1MA 1JOGA 4I1LA 2W6AA 1KORA 1L2PA 4JTCB 4H13B 4IAQA 3CXHI 4DVYP 1Q0MA 1GGQA 1D0XA 4H13C 3SYNA 3L70J 1USEA 2D2CD 3AGTA 2EILC 1S72P 1L0LG 1K8AQ 2OTLP 4ZNCA 3VMZA 5KYWB 2D2CB 4W7ZA 4XEVA 2UUIA 3W8IA 2ZJSE 1OVVA 3BATA 3L71J 1FFHA 2D2CC 3HE5B 2YLGA 2O3JA 1VK5A 1GS9A 1IFDA 3OAKA 4YWQA 5AVTB 4CPGA 3S0XA 4GOEA 2P7JA 4YJWA 2KSFA 3U9MA 2JX0A 4BG0A 1GL2A 2KS1A 4MVQA 4CDVA 1CPRA 3TJ5A 5AW6B 5AW7B 1FMVA 2C0XA 2AWCA 2QE9A 2P67A 5APXA 2V26A 3EH2A 1Y6DA 1VYKA 3JYHA 4DJGA 3AE5C 3TF5A 1R8EA 3A0HE 2J9UA 3C62A 2NRGA 2GAQA 1P84I 2KNHA 1R5SA 3A2AA 2NUPB 1FZCA 5L0DA 1IJDB 1BCCG 3IHUA 3V2PA 3H1IJ 1SFCA 3WU2E 4E0HA 3RBXA 1W5CE 3RK3D 1NFOA 4CBEA 1NAFA 1NTME 1ZR4A 1GDTA 4RJTA 2Z5HA 3P8MC 2Z15A 3V2RA 1YITP 1FDIA 1WN0A 1EI7A 1BGYJ 3CWBE 1TKNA 2XLHA 2O01N 1FMWA 3PRJA 3C7JA 3T97B 3S29A 1NTMD 2KC3A 2FYUK 1D1CA 3S9OA 3O10A 4DBRA 3M79A 1EDLA 4N3YB 1FZEA 1G2CA 2IZ0A 3TYYA 1NAYA 1RHZB 4D6TG 1KB9H 3CCUP 2YMKA 1I4ZA 2AEJA 1EZVD 2EPNA 1SQVE 2HSQA 3H1KG 2JO1A 3FGAD 3O6QA 1HUCA 4PD4H 4MS2A 1SR2A 2GUVA 4IFFA 1GK4A 2G8YA 3F47A 4EBBA 3LS0A 5AVVB 2YL0A 2V3CC 2X51A 2KP8A 3HKKA 3TK1A 3HNIA 3RVZA 3EFOB 3BCCG 2QLAA 2WVRA 1WTYA 3L34A 2OU6A 2YL1A 1L0NE 3QTHA 5DVWA 1M1JA 2PRRA 1L0LK 3ABKC 5GTIE 2H7BA 1T3JA 2EPOA 2K3RA 2Y3BA 3E7KA 1SYQA 1E83A 4JCZA 2HV6A 4C7NA 2J59M 4H4KC 4WJ0A 3M0DA 1VQKP 3GHGC 1AQTA 1VQ6P 3IPMO 2B0JA 4OD4A 1LS1A 3WUTA 1FJPA 1PD0A 2FYZA 1RF0C 3GORA 3TNUA 5AVXB 3N0TA 1JB0J 1IC2A 3GEIA 1QVXA 3B5NA 2G3KA 2R7SA 5JLIA 2IYPA 1AVOA 4IFMA 1G1JA 2E42A 4MNDA 2A06G 2M3EA 5H2FH 4N06A 4IRUA 1AQ5A 1APCA 3P8CD 2YL7A 2KGOA 4MVUA 4XEFA 1RXQA 1PPJG 1BSHA 3R7CA 5BUOA 4HEAJ 5AC4A 1YQ3C 2W27A 5AW8B 4DBQA 2DYSC 4U5CE 4K35A 1JMWA 4WABA 4MW3A 1NLXA 3CX5D 5TISH 4JCHA 1ZR2A 1BDDA 1SQXJ 4JRZA 5JSLA 4CSAA 3W68A 3SXKA 3NMIA 4JEBA 2EPLX 4CS9A 1DOWA 2K9JA 4N6CA 1LTGC 3JRMO 3N2ZB 3DAGA 4U5BE 2FFDA 4Q5SF 1BDCA 3H1LJ 5AVSB 1KU2A 4RKUJ 3VM6A 1KTMA 3MHVA 2G62A 2HJMA 1VQ4P 2V7QH 2LQGA 3W4YA 1D0YA 2QM8A 3QVZA 3IAOA 3CCMP 4PJMA 4DJ9A 3VYIA 3GG2A 3FXEA 4JC7A 1OW6A 4LLEA 1J2JB 1KFMA 1S3JA 4NPEA 4O7GA 1EC5A 3L73E 2GUSA 1RJ9B 4O6YA 3EQ2A 1USDA 3LAYA 1BZ4A 3RQEA 4E0IA 1Q0DA 3U59A 4LDRA 2H88C 2J0XA 1HVVA 5AC5A 2E76B 1SP4A 1NU1E 3K33A 2IYLD 1X8YA 1JOCA 2E76C 5KYWA 3CPWO 4MVSA 2CCYA 4WGYA 1MNDA 2Q9CA 1N7LA 3TJ6A 3HE5A 1S7ZA 1J1EB 5TJHA 3E70C 2ITAA 3KZIE 2ZFCA 4CDYA 3FXHA 3GLMA 1VYIA 4NTAA 4MN4C 4BWNA 2R7QA 3A7OA 4K7BA 2QVAA 3CWBG 2XXAB 5E2QA 4DOJA 1SF8A 2J9WA 2QTVA 1VOMA 4LDKA 4UB6E 3RH3A 1EZVI 1TWHA 1LT9C 1X0TA 3S90A 5AVRB 1QKRA 4H44D 3KL4A 4BRYB 2XLOA 5JS5A 1TU3F 5CMZA 2KYHA 2NUPA 1ZOYC 1VQ5P 4L76A 4H44B 3NTNA 1T01A 2WSCH 1VQNP 5AVQB 3DJNB 2R7UA 3POVA 1AV1A 2W8ZA 4H44C 4E17A 2MHRA 4PK4A 2ZYAA 3RIPA 1SQVG 3V2QA 3VTPC 2A45I 4BXLA 5FZTA 1H6GA 3T97A 3MYIA 4CS7A 1FOSE 5HSWA 5B66H 4WGZA 2GFHA 4I1OB 2XNXA 4K0DA 3VAYA 1BR4A 1LJ2A 3O39A 2CNWD 3EZIA 5CIVA 5DS5A 1MMDA 2GWWA 1DIPA 2OJED 2YHSA 3N24A 2A0UA 5COMA 4XLNF 2VB6A 1IO4A 1Q0KA 1L0NG 2DI3A 4AL0A 4GOFA 5KJ7D 3SEOA 3RW0A 3G4ZA 1OFCX
chains in the Genus database with same CATH topology
2Q7CA 1M1JC 3HD7C 2OYHC 2R5DA 2N9BA 3IFMA 2PP6A 1RF1A 3HE4A 2I1JA 3BVHA 2YKPA 5KJ7C 3V5BA 1J1DB 2JJLA 2Q9IA 2YNYA 1YA9A 3M0DC 1NKNA 1JCCA 2CPSA 1J1DC 1NTKK 4HH2A 1GU5A 1RE3C 3B5ND 3TNUB 2KLVA 2XU6A 5AVYB 3VN0A 1LTSC 2FXMA 2ZXEB 4M3LA 1KILA 3B5NB 1URQA 3A5TA 1CZQA 3GHGA 3SWFA 5CHXA 3B5NC 1N73A 1WT6A 2XV5A 1X9VA 2HPCA 2IFNA 1NTMK 1GL2B 1IFIA 1RF0A 5AVUB 4GKGA 1WRGA 1H8AA 1N86A 1DX7A 2IX7C 3M9QA 2H7HA 4GT1A 4WB4A 1IFNA 2GM4A 5CJ4A 5AW4B 3V4QA 1SQXK 2M3BA 4IFDK 1PFIA 1AEPA 3HTKA 1QL1A 2PAJA 3L35A 5APTA 2WPSA 2KB7P 4OH8B 2WITA 3M91A 2KOGA 4AUWA 5AW0B 3LW5H 1A02F 2P2UA 4W80A 4JF7A 1LWUA 1QL2A 3BRVB 1JY2P 4O9BA 2FFDC 1L4AD 1FDMA 1LT9B 2HLOA 1L4AB 1EA8A 2YO2A 1GK6A 2I1KA 1L4AC 1NU1K 1HH0A 5AW2B 1FAVA 5KTBA 1KILD 2C9NY 3CL3D 2WT7B 1JTHA 1GZLA 1JY2O 2O01H 1N2DC 2OARA 1SQBK 1NTZK 1JY2N 3VP9A 3P7KA 3H6PA 1SQQK 1MZ9A 4C46A 5APWA 1L0NK 2HFED 4I1LA 4ZKUA 2W6AA 2WWWA 2NPSD 4WY4D 1YTZI 2A45G 4I2LC 1EQ1A 3OA7A 1CI6A 5APSA 1RE4C 2NPSB 4WY4B 1GD2E 1N7SB 3UIAA 3VMZA 1GW4A 3RL0D 2NPSC 4W7ZA 4WY4C 5CCHD 5AW3B 1ZV8A 2VRSA 3BASA 1N7SC 5AW9B 1NWQA 1DH3A 3BATA 3N7NA 3RL0B 3HE5B 2H8PD 2MJZA 2CPBA 1GS9A 2OYIC 1IFDA 3OAKA 5AVTB 2P7JA 3RL0C 5CCHC 1GL2A 4ZKPA 5AW6B 5AW7B 2C0XA 2P67A 5APXA 1MFZA 4C7NB 3MTUE 1NOHA 3M9BA 1SLQA 3KPEA 2R32A 2QM7A 1M7LA 2BASA 1NHLA 2O1JA 5AW5B 3A2AA 2LKMA 1FZCA 1IJDB 2P1JA 1HGZA 2M8RA 5APUA 3V2PA 1HWTC 1SFCA 2IPPA 2J58A 4EOTA 3RK3D 2WPRA 1NFOA 1NAFA 3HUSB 1ZR4A 1GDTA 1MUUA 2Z5HA 3P8MC 3V2RA 3P32A 5APVA 2C0WA 3HUSC 1LT9A 1RY3A 2HODA 2N1TD 1X79B 4C7RA 2KC3A 2FYUK 2N1TB 3BRTB 1S9KD 1FZAA 1W2EA 3VOPA 2N1TC 4EIJA 4N3YB 1FZEA 1G2CA 3TYYA 4AQRD 1LTJB 3PP5A 3L36A 5CCGD 3U1AA 1HBWA 1NKZB 1FOSF 2YKOA 2YO3A 1LTJC 1H89A 1CSBA 3MGNA 5AVZB 5APYA 2FFDB 1HUCA 5CCGC 1YTZT 2GUVA 3H32A 1MV8A 4IFFA 1FU1A 1GK4A 1T2KD 1RF1B 3HE4B 3L37A 1T8ZA 4XA4A 5AVVB 2KP8A 1RF1C 3TK1A 2A45H 1XTGB 1LS4A 1E5WA 3SWYA 3A3YB 5AW1B 2YMYA 1T2KC 3VP8A 4KHXA 5CJ0A 3MD0A 3VMYA 1JNMA 2Z4EA 1M1JA 3HD7A 1L0LK 1LE2A 1URQD 2OYHA 1LTIC 1J1EC 1JUNA 1T3JA 1KILB 5KJ7A 1URQB 2HG5D 1OR3A 4C7NA 5AVWB 2J59M 1KILC 3M0DA 1URQC 2HPCB 5BU8B 4N78E 3GHGC 1SVFA 1N73C 1RE3A 4WBAA 3NMDA 3RK2D 4Y99B 1FJPA 3VMXA 3WMM0 2FYZA 1RF0C 5BU5A 3RK2B 3KDPB 4Y99C 2WSEH 5AVXB 3TNUA 1IC2A 3OJAB 3KQGA 1LTBC 1H7IA 4N78D 3HTKB 1NFNA 3B5NA 3RK2C 2OYIB 1LE4A 4IFMA 1G1JA 2E42A 1OWAA 2KSJA 3CI9A 3I5CA 1OR2A 1AQ5A 3P8CD 1LWUB 4XE5B 1FJKA 1KQLA 1EQ7A 2L5GB 1LWUC 2W27A 5AW8B 1FZBA 2R5BA 1LTTC 1KZUB 1ZR2A 3MUDA 4DZOA 1CW5A 1JMMA 1LPEA 1OXZA 3S84A 2IFMA 1HJBA 3LIEA 3LIDA 1LTGC 3CLQA 4B86A 1JTHB 2FFDA 1VDFA 2FKWB 5AVSB 4JYCA 4I6MC 3RK3B 1S9KE 4LGDE 3E1IA 3U1CA 4LLHA 1IFJA 1L4AA 3RK3C 3C9IA 4AYCA 2QM8A 2WZ7A 1CI6B 3VYIA 2C9LY 3EFGA 1Z56A 1J2JB 1KFMA 2WT7A 1GTWA 1FZGA 3O8ZA 1GW3A 3M9HA 1NO4A 5KLVK 2GUSA 1GL2D 3EQ2A 3KYQA 1BZ4A 2Z5IA 3II6A 1ZN5A 3U59A 3M0AA 1RE4A 2R3CA 4GIFA 1HTLC 1HVVA 1GU4A 2XZRA 1SP4A 2NPSA 3M06A 4WY4A 1GL2C 3HRNA 1N7SA 1NH4A 1X8YA 1JOCA 3L4FA 2Q3IA 3V2NA 3MIWA 3N4XA 2OYIA 1N7LA 1SFCD 3G3ZA 1YYCA 1FZCB 3HE5A 5CCHA 1J1EB 4HYTB 1SFCB 4N6JA 1FZCC 2H43A 2ZFCA 2XKMA 4LC1A 1SFCC 3A7OA 2YKQA 3GHGB 1SQVK 2HODB 4DOJA 1LTAC 3TSIA 3NXSA 1N73B 1JCDA 1VPCA 1LT9C 2O1KA 5AVRB 1JY3P 5CMZA 1H88A 1LGHB 1JO5A 2JEEA 3B8EB 1IFMA 3NTNA 2WSCH 1G2CB 5AVQB 3HUSA 3P8CE 2WSFH 1A02J 1ZLLA 1B68A 5BVZA 3V2QA 3VTPC 2A45I 2KYVA 4W7YA 2E43A 1JY3O 3T97A 2W6BA 1N7SD 1KFNA 1FOSE 1G1IA 1AFOA 1T3UA 1XTCC 2N1TA 1IK9A 3H32B 2POHA 1JY3N 2XNXA 4RESB 1FZFA 1LTJA 3IR9A 2WPQA 3R2PA 1SQPK 2Q5UA 3HD7D 2WTYA 1FBMA 1IO4A 3V4WA 2XDJA 2HYNA 5CCGA 1HGVA 1M1JB 3HD7B 5KJ7D 4JYBA 5APQA 2OYHB 3NFQA 1DEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQ1 A;  1LS4 A;  1BZ4 A;  1GW4 A;  1LE2 A;  1H7I A;  3R2P A;  1NFN A;  1YA9 A;  2KC3 A;  1B68 A;  1LPE A;  1OR3 A;  1LE4 A;  3S84 A;  1GS9 A;  1NFO A;  1OR2 A;  1GW3 A;  1EA8 A;  1AEP A; 
#chains in the Genus database with same CATH topology
 1TR2 A;  3CMA P;  5CI9 A;  4LAC B;  3V6I A;  2BCC J;  2NPU A;  3FHD A;  3GAN A;  1ZW2 A;  2A69 F;  2XLD A;  2I1J A;  3LW5 J;  2W4B A;  5KJ7 C;  4D4N A;  4OWF A;  1KMI Z;  3ABV C;  1J1D B;  2YNY A;  3EFO A;  2RH0 A;  3DI5 A;  2WMM A;  5KLV E;  2Y69 C;  2DB4 A;  1OW8 A;  1AVY A;  1J1D C;  3NMJ A;  3H1H D;  5B5E E;  3A0H H;  1GU5 A;  4CIH A;  1T6I A;  2KLV A;  2KSE A;  2ZXE B;  4JJG A;  2B88 A;  3LEO A;  3WU2 H;  4H54 A;  3AE4 C;  3GHG A;  3UGO A;  1SQB J;  3CX5 I;  1OKK A;  1VTM P;  1Z6A A;  1X9V A;  3D70 A;  2CW0 F;  3PHF 2;  1NTM K;  2E75 D;  1AJY A;  1GL2 B;  1RF0 A;  4P9T A;  3IQ5 A;  4FWV A;  3CXH E;  5KLI B;  4I1M A;  4WB4 A;  5TJ5 E;  2GM4 A;  5KYU B;  3ZWI A;  2M3B A;  3DMD A;  4IFD K;  5KLI C;  1AEP A;  3FWN A;  2PAJ A;  1S2E A;  2LXB A;  2WVQ A;  3LES A;  3JC2 2;  4JTA B;  1U7M A;  2BE5 F;  2PNO A;  1JMB A;  2YIU B;  3CXH D;  4XPX A;  1NVO A;  2VH3 A;  1YI2 P;  1EDJ A;  4W80 A;  2QRX A;  3MP7 B;  4JF7 A;  1QL2 A;  3CEX A;  3BRV B;  1MFT A;  4KNW A;  3TOM A;  2KIK A;  4O9B A;  4JE9 A;  1L4A D;  4PV1 B;  1MNE A;  3AE1 C;  4IOI H;  1L4A B;  3U8V A;  2LR2 A;  1KQS O;  1XWJ A;  2YO2 A;  4PV1 C;  1G5Z A;  2BL2 A;  2JWD A;  1L4A C;  1QX8 A;  1JR8 A;  3ZTZ A;  3T6B A;  1P84 E;  2BEZ F;  3SWK A;  4OGQ B;  1RQV A;  3QMK A;  2OGU A;  4QMA A;  2EIM C;  1N2D C;  2OAR A;  3CC2 P;  2IXM A;  3L73 G;  3GF3 A;  1MZ9 A;  2GDC A;  2WZL A;  4C46 A;  5APW A;  4IAR A;  1L0N K;  1PZQ A;  2HFE D;  5GTI H;  2KI7 B;  3AE3 C;  4U3F E;  1YTZ I;  2JPU A;  2FXO A;  3OA7 A;  3Q6N A;  4MVR A;  1NU1 G;  3AQC A;  1N7S B;  3UIA A;  2YQY A;  5KYN A;  5CCH D;  1N8R Q;  1YIJ P;  3AE9 C;  1ZV8 A;  1N7S C;  4U3F D;  1NWQ A;  1M57 D;  2I15 A;  5L0F A;  4HFF B;  3R4Y A;  1RJ9 A;  2MJZ A;  4EBJ A;  2CPB A;  4P6I C;  2OYI C;  3L8J A;  1JRA A;  3BCC J;  5CCH C;  3ZDL A;  3D71 A;  1JPN A;  3TD7 A;  1PGP A;  2P7V A;  1M57 C;  4ONS A;  4ZKP A;  3GM3 A;  3QH9 A;  1MFZ A;  4C7N B;  2B0H A;  2AEF A;  3AJM A;  2R32 A;  2MKV A;  2QM7 A;  3PCV A;  2BAS A;  1NHL A;  1M8O B;  2ZVO B;  2I8D A;  4JQ0 D;  5AW5 B;  1ORY A;  3I55 P;  2Q9A A;  4EYY Q;  3SXZ A;  1XZP A;  2JR8 A;  3WUV A;  1HGZ A;  1K73 Q;  2M8R A;  1WMK A;  2QNL A;  5GTH E;  4EOT A;  2IPP A;  2J58 A;  2OTK E;  4KBL A;  3HUS B;  4OIR F;  1MUU A;  1FC2 C;  2WVN A;  3USS A;  3QZC A;  2NSF A;  5APV A;  3EJN A;  1BBH A;  3UMH A;  3HUS C;  2XXA A;  3L75 E;  1OCR C;  1LT9 A;  1RY3 A;  3RL0 g;  1VMA A;  1HJ0 A;  1S5L X;  2N1T D;  1AVO B;  4QI0 A;  4NTF A;  3Q7G A;  3C8V A;  2R05 A;  4BRY A;  2N1T B;  3V5Z A;  2FGY A;  3B0P A;  2ZYG A;  3BRT B;  3C1L A;  1S9K D;  1ZHY A;  1OW7 A;  2W6J H;  2L91 A;  3TGU G;  4BJ6 C;  1FZA A;  5B3I A;  2N1T C;  4LDQ A;  3GEE A;  1D1B A;  1XZQ A;  3UMK A;  5CCG D;  3U1A A;  1HBW A;  2YO3 A;  1OX3 A;  2WSC J;  1H89 A;  2UWJ E;  2K9J B;  4UDV A;  1CSB A;  3FOP A;  2QJP C;  2FFD B;  5CCG C;  1OCC C;  2FYU G;  1GQA A;  1YTZ T;  3KPH A;  3IF4 A;  2YEV A;  3T4R A;  3AEE C;  3C18 A;  2K88 A;  2PF4 E;  1T2K D;  2PP4 A;  1RF1 B;  4XA4 A;  1J8Y F;  3MLG A;  1HMD A;  4WWI A;  1RF1 C;  2AU5 A;  2CNW A;  4ER9 A;  2IDB A;  5KLV G;  1E5W A;  3SWY A;  4J7T A;  5COF A;  4H0L B;  1T2K C;  5CJ0 A;  2J9B A;  3VMY A;  1DOV A;  4TLF A;  1LE2 A;  3ZTM A;  1RCP A;  2FBW C;  1JAF A;  4H0L C;  4XQ1 A;  1IW7 F;  2AXT H;  2WSS H;  3CCL P;  5KJ7 A;  5L0H A;  1OVR A;  2HG5 D;  3AEF C;  1O3U A;  3KZI H;  4NQF A;  5A6J A;  3MYF A;  3H1J E;  5EFW B;  1YZC A;  2Y9Z A;  4DOZ A;  2IBZ D;  1TQG A;  2A6H F;  4WBA A;  3D6Y A;  4GEH A;  3WMM 0;  4UB8 E;  2FXP A;  1LI7 A;  4UB6 H;  5BU5 A;  2WSE H;  3H1J D;  3B4S A;  2L6F A;  1LTB C;  3RGU A;  1UII A;  4U5F E;  1BE3 E;  1H9T A;  2E5T A;  2QG4 A;  3JCU E;  5L3Q A;  3JRT A;  3CCV P;  1ZP0 C;  1RMV A;  2M5A B;  2Y0D A;  2KSJ A;  4HB1 A;  3AE2 C;  1LWU B;  3G6E P;  4XE5 B;  1FJK A;  1KQL A;  1QZX A;  3U3F A;  3WG7 C;  1OXB A;  1BE3 D;  4X0R A;  5L0G A;  2R44 A;  2L5G B;  3H25 A;  1LWU C;  1CPQ A;  2L6H A;  4ZLD A;  3RK3 E;  1FZB A;  5KYU A;  5L8R J;  3DD7 A;  5DS4 A;  3ZIB A;  2FAP B;  1SS1 A;  5EHH A;  4D4X A;  1KZU B;  3FOO A;  2HFI A;  2P10 A;  2B87 B;  1UIX A;  1HJB A;  3LID A;  3CLQ A;  3GM2 A;  1JTH B;  4C3D A;  3L70 E;  1YVI A;  3QW0 A;  4JYC A;  1G4W R;  3ZVR A;  1YJ9 P;  4AE4 A;  3RK3 B;  3JSZ A;  5JVE A;  3U1C A;  5K5G B;  1KD1 Q;  1L4A A;  3RK3 C;  4U3F G;  1Q82 Q;  4YL3 A;  2KZI A;  4AYC A;  3L70 D;  1SQV J;  3QWO C;  1YAU O;  2D5R B;  1CI6 B;  4JIO A;  3EFG A;  1EZV E;  3FMS A;  3KYI A;  2JKV A;  4IWB A;  1GTW A;  1FZG A;  3L71 D;  1FAP B;  5A6A A;  1T9K A;  1WAT A;  3JT1 A;  4DVZ A;  2Q3E A;  2XL6 A;  5KAI E;  5B5E H;  5KLV K;  1V55 C;  3W67 A;  2Z5I A;  3II6 A;  5KAF E;  1M2O A;  3JTL O;  3SP1 A;  2Y9Y A;  3M0A A;  3TUL A;  2R3C A;  1K40 A;  1L0N J;  1QVF O;  1YLM A;  1PP9 J;  3GEH A;  1A7V A;  4J30 B;  3M06 A;  2K1A A;  1HF9 A;  3CCE P;  3CD6 P;  3L74 J;  2OQM A;  1N7S A;  2J5U A;  1S05 A;  4W8P A;  1N1C A;  3V2N A;  1BGY E;  2J9V A;  3AQB A;  4PJN A;  2OYI A;  4L75 A;  2AWY A;  1OVU A;  3H1I D;  3CXH H;  5DLJ A;  5CCH A;  2DGJ A;  3SXM A;  1SQP J;  4YXW H;  4AX2 A;  1OXK A;  4ASW A;  2B89 A;  2H43 A;  1VB5 A;  2XKM A;  3F89 A;  3IQT A;  2P58 A;  1BGY D;  5GPG B;  3RBZ A;  2J8W A;  2YKQ A;  3L75 G;  1LIH A;  4R4L A;  1ZHX A;  3MX3 A;  3GHG B;  2HOD B;  1OZH A;  4DCK A;  3U9J A;  4R4M A;  3CCJ P;  5B3S C;  1VPC A;  4R32 A;  1JY3 P;  4OIQ F;  2IZ1 A;  2ZT9 D;  1JO5 A;  1H9G A;  3B8E B;  4JW1 A;  2ZT9 B;  1LP1 B;  3HUS A;  3P8C E;  2WSF H;  1NTK J;  2XL8 A;  3TQO A;  2ZT9 C;  1HY5 A;  1P84 H;  3NDB B;  2J7P D;  2A1D D;  2OOC A;  2E43 A;  2G3V A;  4O6N A;  4C3B A;  3AEB C;  3CX5 E;  4IL6 E;  1KFN A;  4BJ6 A;  2GA0 A;  1XTC C;  2N1T A;  3H32 B;  2POH A;  1JY3 N;  5B1A C;  4RES B;  2ZXW C;  3LJB A;  5L0I A;  1FZF A;  2QSI A;  3IR9 A;  2WPQ A;  3JCU Q;  4CDA A;  3HD7 D;  3JSV C;  2CK3 H;  3V4W A;  2IBZ I;  1U57 A;  2HYN A;  5CCG A;  1VQP P;  2H89 C;  1HGV A;  2IXP A;  3HD7 B;  2NZ2 A;  4JYB A;  5APQ A;  2OYH B;  1MQV A;  4JPZ B;  2IM8 A;  1DEB A;  1HW1 A;  3HD7 C;  2OYH C;  1QLE D;  1JEK A;  2PP6 A;  1RF1 A;  4QDL A;  3CZ6 A;  4A7P A;  1KNY A;  2YKP A;  4L74 A;  1ZHT A;  3L73 J;  3V5B A;  2OEV A;  2ZXR A;  2BC5 A;  3LNM B;  1YA9 A;  3NKE A;  1V74 B;  1QLE C;  1VQM P;  2R25 A;  2DYR C;  4HH2 A;  1RE3 C;  3DAF A;  1NU1 J;  1HW2 A;  1BE3 G;  1TWG A;  4GDO A;  5GTH H;  2HJ3 A;  2LFF A;  3A5T A;  1CZQ A;  2Q6Q A;  3SWF A;  1NTZ J;  5CHX A;  1C03 A;  2O01 J;  2QJY B;  3SSU A;  3LEV A;  3NYM A;  1YBK A;  4O79 A;  3RYL A;  3O6X A;  2XL4 A;  2IFN A;  1SQQ J;  1ZME C;  4FES A;  2QJY C;  4G7O F;  1IFI A;  1WRG A;  3H1L E;  2W45 A;  2PBE A;  2HMZ A;  4GT1 A;  1NU9 C;  1SQX D;  4Q7C A;  3FXD A;  2D4U A;  1QL1 A;  3S1K A;  1VF5 D;  3AGU A;  3H2U A;  5DJU B;  4I7Z B;  2WPS A;  5APT A;  3CC4 P;  4YN0 B;  4OH8 B;  3A0B E;  5A6K A;  3H1L D;  2M5A A;  2WIT A;  3MUD C;  4AUW A;  2LXC B;  3L70 G;  1ZU5 A;  1VQL P;  4I7Z C;  1O5H A;  1NTM G;  3ASO C;  1LWU A;  1JY2 P;  1VF5 C;  1O87 A;  1IFP A;  5L0C A;  2FYN B;  3DKA A;  4E7S A;  3L0I A;  4PJJ A;  2AEM A;  1Y4C A;  1LT9 B;  4YT2 A;  2FYN C;  3DZA A;  3PH0 A;  2I1K A;  1F1M A;  2R7W A;  1TWC A;  3C8Z A;  1EZV G;  5A6B D;  2R7T A;  2B87 A;  2P61 A;  3DE9 A;  5KTB A;  4IB4 A;  1KIL D;  2C9N Y;  5D91 A;  3CL3 D;  1M90 Q;  4BJ5 C;  3KH2 A;  1JTH A;  1GZL A;  4U5H A;  3TGU J;  3E9V A;  1NTZ D;  3HNJ A;  2HUJ A;  1JY2 N;  3VP9 A;  2XM0 A;  3H6P A;  4KNV A;  1PGJ A;  3W8H A;  2K9Y A;  4ZKU A;  2B9B A;  2X0C A;  3OWT A;  2NPS D;  2RKL A;  2A45 G;  1KQF B;  1CI6 A;  2NPS B;  1GD2 E;  3L72 J;  1Z7Q c;  2FYU J;  3RFY A;  2Y0C A;  1YZA A;  1BGY G;  3ABM C;  2NPS C;  3ZC4 A;  1EKY A;  5AW3 B;  2PX3 A;  2VRS A;  4U5E E;  4UB8 H;  4ULV A;  1AUE A;  2H8P D;  3AE6 C;  4FAP B;  5DS6 A;  4HKZ H;  4JUR I;  3JCU H;  2L81 A;  3SXY A;  256B A;  3H1H E;  1I5N A;  3MTU E;  1NOH A;  4DRH B;  3M9B A;  1A7D A;  2NSG A;  1M7L A;  4CJG A;  2O1J A;  2OQQ A;  5DQZ A;  2LKM A;  2P1J A;  2WPR A;  3Q5S A;  2EIJ C;  3OEO A;  4YT8 A;  4NCQ A;  2YXR B;  1QEX A;  1VQ9 P;  1L0L J;  3EZH A;  3Q2Y A;  3HNL A;  5T1D B;  4J32 B;  1X22 A;  2HOD A;  3M4B A;  1X79 B;  2OEX A;  4DRI B;  3DJU B;  5A69 A;  2VAS A;  4PJ0 E;  3U3B A;  1QQ3 A;  1M6T A;  2E75 B;  2N9Y B;  1LP1 A;  1Q2N A;  2DW3 A;  1LTJ B;  2RMZ A;  3PP5 A;  4AQR D;  1VLT A;  2E75 C;  2ZXP A;  3PTZ A;  5T3T A;  5K0I A;  1FOS F;  3LUT B;  1LTJ C;  2IBF A;  3EGD B;  1LKX A;  2WSF J;  2OTJ P;  3C63 A;  5APY A;  2BCC D;  5HV9 A;  2M4E A;  1BCC J;  1C17 M;  1CGO A;  2OJQ A;  5KAI H;  2J7P A;  4A4A A;  4ULW A;  3H32 A;  1MV8 A;  3T6J A;  4AE4 B;  3HE4 B;  3L37 A;  1T8Z A;  5KAF H;  3GWL A;  2I8B A;  4OIO F;  4XFJ A;  4GOD A;  2WZF A;  1DD4 A;  1SQB E;  3Q7L A;  4EHP A;  1K05 A;  2A45 H;  2GA1 A;  3U0C A;  4CJO A;  3HJC A;  3T6G B;  2M64 A;  3PHL A;  1WWP A;  3I5P A;  2RSE B;  4KHX A;  2O9X A;  3MD0 A;  2H8A A;  1L0L D;  2Z4E A;  3HD7 A;  1URQ D;  2OYH A;  1LTI C;  5BQI A;  1OCO C;  3MBG A;  1JUN A;  4JZA A;  1SQB D;  4EKW A;  2AVK A;  5JUA A;  1URQ B;  1NYH A;  3A9C A;  5AVW B;  1HMO A;  3NYJ A;  4D6T J;  1YQ4 C;  1URQ C;  1ST6 A;  2Q3T A;  5BU8 B;  4YL1 A;  4N78 E;  1V54 C;  2W4M A;  1SVF A;  1N73 C;  1RE3 A;  2A0B A;  2WB7 A;  3W2V A;  4Y99 B;  2XSE A;  3H1K J;  3EFF K;  2V7Q J;  3G4S P;  1U6H A;  4Y99 C;  1VLS A;  3ZQV A;  3KQG A;  1Z63 A;  4N78 D;  3HTK B;  1NFN A;  2OYI B;  2PGD A;  3EPV A;  4L73 A;  3HTK C;  1KYO I;  1D7M A;  3K7D A;  1OWA A;  3I5C A;  2WVO A;  2R9R B;  4Q4Z F;  4YT4 A;  3EG9 B;  1M1K Q;  3ZG1 A;  3LLK A;  3A11 A;  1L7C A;  1ZW3 A;  1RQU A;  3AG4 C;  3TK0 A;  2R7X A;  3S4R A;  4OVN F;  3CX5 H;  4IL6 H;  1H0T B;  2R5B A;  4LLC A;  1LTT C;  4YXD C;  1YDI A;  3L75 J;  1WAS A;  4RDA A;  3MUD A;  4DZO A;  1LPE A;  1OXZ A;  3AG2 C;  2LP4 A;  2IFM A;  3LIE A;  3ECS A;  4B86 A;  2Y0E A;  1VDF A;  2FKW B;  2CDQ A;  5EK0 A;  3WOD F;  2XRH A;  2JP3 A;  3G50 A;  3AG3 C;  1TFO B;  3G71 P;  5JP7 A;  3U2M A;  1S9K E;  4LGD E;  4KI2 A;  3E1I A;  4PFP A;  1T5O A;  1IFJ A;  4LER A;  3LLI A;  2WZ7 A;  4U5D E;  5BQG A;  5L0J A;  2K37 A;  4BJ5 A;  3BCC E;  4EBK A;  2C9L Y;  4NPF X;  2VCA A;  1Z56 A;  4C3E A;  5A6B A;  1GW3 A;  4B6I A;  2FFH A;  1R5I D;  4MVZ A;  2QEX P;  1NO4 A;  3AE8 C;  3BCC D;  2QJP B;  1PV3 A;  1Z5Z A;  2NG1 A;  1NSG B;  1ZN5 A;  5KYX B;  3F46 A;  4U5G A;  4GIF A;  5E33 A;  1Q0G A;  1KQG B;  2WZG A;  1R4T A;  2XZR A;  3AG1 C;  2NPS A;  3H1H G;  2P0N A;  1NH4 A;  2KW3 C;  4YK5 A;  2Q3I A;  3Q5R A;  3MIW A;  3K1I C;  3N4X A;  4EIY A;  3UMI A;  2QUP A;  3G3Z A;  1YYC A;  4Z9H A;  1EDK A;  2R02 A;  2A06 E;  3ABL C;  4GYT A;  5FCL A;  2IBZ E;  3C8G D;  3SFD C;  3EWK A;  2XM4 A;  3A0B H;  1YJN P;  4C7O B;  1EXI A;  3UGP A;  4DT0 A;  2KUB A;  1Y9B A;  3C8G B;  1OQC A;  3TSI A;  3NXS A;  2C04 A;  1KB9 I;  3K5B A;  3ZDM A;  2A06 D;  1C02 A;  2XLM A;  3B9Q A;  5BQH A;  1DEE G;  1LGH B;  2Q7R A;  3RKO F;  2JEE A;  5DQT A;  1CGM E;  1IFM A;  4IAO A;  4PD4 I;  3PMR A;  1NU7 D;  4BEM J;  2ZPA A;  4Z9J A;  2LD6 A;  1A02 J;  1ZLL A;  2HR3 A;  4H13 D;  3U2L A;  1FS0 E;  1ZHZ A;  1YYX A;  4CS8 C;  3QVY A;  5BVZ A;  2KZJ A;  1U7J A;  2KYV A;  4W7Y A;  2Q4F A;  2FY8 A;  1LNQ A;  1JY3 O;  1U0B B;  3SZR A;  2W83 C;  1G1I A;  1AFO A;  1T3U A;  3LS1 A;  1NTM J;  4U9D A;  4G78 A;  1FTS A;  3LNR A;  2W9Y A;  3Q3D A;  1V4A A;  4JTD B;  3KHU A;  2OCC C;  2A6E F;  2ASR A;  3OW2 O;  4BJ1 A;  1SQB G;  1LTJ A;  3CWB J;  4MTG A;  2Q5U A;  2WTY A;  3B71 A;  1RKC A;  3V5X A;  3EGD A;  2XDJ A;  1S4X A;  2QA4 P;  1A0B A;  4I3M A;  1A7E A;  2EPK X;  2MWQ A;  2ZD9 A;  1BR1 A;  2Q1K A;  3NFQ A;  4EIJ A;  4ZMD A;  2LSE A;  1EXJ A;  2Y3H A;  2R5D A;  3IFM A;  5KYY B;  1T6Q A;  3HE4 A;  1HE9 A;  3M1C B;  3RF3 A;  1AA0 A;  3L71 E;  1A41 A;  4RD9 A;  4W8K A;  3US6 A;  2CPS A;  2YRF A;  3VRC A;  1IZN B;  1LM3 B;  4AL1 A;  2G3A A;  4EDF A;  3MFN A;  3CAX A;  3GW6 A;  5AVY B;  3VN0 A;  1LTS C;  2M0B A;  1RKE B;  4M3L A;  2Q00 A;  3ZQY A;  3JYY A;  1URQ A;  1NZE A;  1G4U S;  3VYW A;  4E7Z A;  1YYJ A;  4PFO A;  2RN0 A;  3BEH A;  1N73 A;  1WT6 A;  1FR0 A;  2VC9 A;  3CQZ A;  5AGF A;  2XLE A;  4MW8 A;  4IGG A;  1K04 A;  1IZM A;  3H1I E;  5AVU B;  1H8A A;  1CGN A;  2JDI H;  1N86 A;  3IEE A;  3AEA C;  1DX7 A;  1ZU4 A;  2H7H A;  3CWB D;  2XS8 A;  3NYL A;  3V4Q A;  4IJJ A;  3HTK A;  4PJ0 H;  2HV7 A;  2L7A A;  4G7Z F;  4ANJ A;  3L35 A;  1M2V A;  3EHM A;  2KB7 P;  1HE1 A;  3M91 A;  3WUU A;  2KOG A;  5AW0 B;  3LW5 H;  1A02 F;  1RH5 B;  4MTO A;  3EG9 A;  2NUT B;  2C03 A;  3KMI A;  1JPJ A;  1G8X A;  4J7Y A;  3WAQ A;  1SQV D;  2HLO A;  4Z9I A;  1H0T A;  4AK9 A;  2PX0 A;  1ZZP A;  4TT3 H;  5CBN A;  2ICW G;  4DXW A;  3DWW A;  4HE8 D;  4YT5 A;  1LI5 A;  1YA7 O;  2AP3 A;  5AW2 B;  1FAV A;  4YL0 A;  5F5H A;  3Q6M A;  1PP9 E;  2WT7 B;  1MMG A;  2PFD A;  1JY2 O;  1OKK D;  3L74 E;  2KK7 A;  1SQB K;  1OMI A;  2E5Y A;  3L1M A;  4OIN F;  1FE6 A;  3P7K A;  4HFK B;  3EGX B;  4JVS A;  1L3P A;  2XS1 A;  1L0N D;  3IQ6 A;  2WQY C;  1YJW P;  1PP9 D;  5C39 A;  1VQO P;  2WWW A;  4WY4 D;  1SQP E;  3L74 D;  4I2L C;  5JRA A;  1EQ1 A;  3M15 A;  5APS A;  4QI2 A;  1RE4 C;  4WY4 B;  3D6Z A;  3AE7 C;  4NPD A;  4XWJ A;  1GW4 A;  4BPM A;  2W90 A;  3RL0 D;  3GF7 A;  3H65 A;  4WY4 C;  3MZW B;  4Y28 J;  1S1C X;  3BAS A;  3V7O A;  5AW9 B;  2IOQ A;  1BSN A;  1DH3 A;  2EIN C;  1ZYR F;  1SQP D;  3N7N A;  2R7V A;  3RL0 B;  3RQF A;  3EHN A;  3GM1 A;  2QJK B;  1PCX A;  4N6H A;  3RL0 C;  5KYX A;  2IBZ G;  2HZ8 A;  2PFX A;  3JZ0 A;  2QJK C;  3K1I A;  1NTK E;  3EH1 A;  2P1A A;  3H1J G;  1SLQ A;  3KPE A;  3I4U A;  4XTK A;  3CSK A;  2EPM X;  1PD1 A;  3CCS P;  4JBZ A;  4ASV A;  4JKV A;  5APU A;  1QVG O;  4M63 A;  1NTK D;  1HWT C;  5F5F A;  4F4B A;  1PIX A;  2ZYD A;  2QE7 H;  3ITF A;  4C7O A;  3P32 A;  1ZRT E;  2C0W A;  2LK4 A;  1S5L E;  3U8P A;  3C8G A;  3K66 A;  1Q0F A;  3O55 A;  1SQX E;  4YPC A;  4C7R A;  4CX9 A;  1PGO A;  3L8I A;  3DM9 B;  3J06 A;  1TWA A;  1ZRT D;  3T9O A;  1W2E A;  3VOP A;  4CS8 A;  1LVK A;  3L36 A;  1QGK B;  1NKZ B;  2YKO A;  1E85 A;  3DM5 A;  2WSE J;  4YTP C;  4ZLC A;  1E2X A;  4PAC A;  2F22 A;  2E76 D;  1BR2 A;  3MGN A;  1VF5 B;  2ZVN B;  5AVZ B;  1KYO E;  4A2N B;  1ORS C;  1FU1 A;  4EUK B;  3L73 D;  1KIL E;  3L71 G;  1E79 H;  1U89 A;  3KYJ A;  4EWC A;  3JSE O;  1NTZ E;  1XTG B;  1KYO D;  1LS4 A;  2AXT E;  5E3A A;  1SQQ E;  3A3Y B;  5AW1 B;  2YMY A;  1NU1 D;  3VP8 A;  5E79 E;  2KK1 A;  1JNM A;  3UNG C;  2YLD A;  1K9M Q;  1J1E C;  3NMK A;  1FFT C;  1KIL B;  3UR3 C;  4GQH A;  3NG1 A;  1OR3 A;  1SZI A;  5KYY A;  1SQQ D;  3KKB A;  1KC8 Q;  1KIL C;  3GOD A;  4EI2 A;  3K1H A;  2HPC B;  3W2W A;  3X2Q C;  2E74 D;  3H1I G;  5E3C A;  1IK7 A;  3NMD A;  3RK2 D;  5COG A;  3VMX A;  2E74 B;  2YVK A;  2YKZ A;  1ZXG A;  3RK2 B;  3KDP B;  2E87 A;  3OJA B;  3CCQ P;  3H1H J;  2E74 C;  1H7I A;  1RKE A;  2LFD A;  3RK2 C;  3RQG A;  3FX0 A;  1NG1 A;  1LE4 A;  1NJI Q;  1M56 D;  5KLV J;  3CI9 A;  1OR2 A;  1SMY F;  1EQ7 A;  4FX5 A;  4PJL A;  2JD3 A;  2H7V C;  5L3V A;  1UG7 A;  4KC9 A;  3ITK A;  1JM0 A;  3TGU E;  1Q86 Q;  4O6M A;  1M56 C;  2WPV B;  3K6B A;  1VQ7 P;  1YJG A;  1ORJ A;  2UUH A;  2BEQ D;  1CW5 A;  1JMM A;  1GM5 A;  3S84 A;  1PP9 G;  3SFE C;  1BDJ B;  2YXQ B;  3TGU D;  2R3S A;  3CCR P;  1ZW0 A;  3H2V A;  4NY3 A;  3L74 G;  2KNC B;  3L72 E;  4N4W A;  4P9F A;  2FYU E;  4I6M C;  1UFB A;  2NUT A;  2Q9B A;  4G7H F;  3AED C;  4LLH A;  2IYO A;  3M4C A;  3S27 A;  1NBB A;  3C9I A;  1SQP G;  3L72 D;  2J46 A;  1Y47 A;  2FYU D;  1KB9 E;  4KT0 J;  2H7O A;  2IXN A;  1OIP A;  3HNK A;  2VCC A;  3BRJ A;  4JJF A;  2WT7 A;  1T6U A;  2BCC E;  3O8Z A;  3M9H A;  3B0U X;  4OIP F;  4PD4 E;  3PDM P;  5KLV D;  3EGX A;  4MTF A;  1D0Z A;  2RD9 A;  1KB9 D;  1GL2 D;  2YWA A;  3X1O A;  3KYQ A;  1T6A A;  2P6V A;  2YLI A;  4NTB A;  1GMJ A;  5M1B A;  2OYO A;  3GWN A;  5JT4 A;  1RE4 A;  2KS1 B;  1HTL C;  2YL3 A;  2SPZ A;  1GU4 A;  2HSB A;  1NTK G;  2QIW A;  4PD4 D;  3IQC A;  4WY4 A;  1GL2 C;  3EQL F;  3IN6 A;  1KN7 A;  1ZHW A;  3HRN A;  2HS5 A;  5IY5 C;  1L0L E;  5KKZ B;  3L4F A;  2ZAE B;  2R7R A;  4U7J A;  1FNT c;  1SFC D;  5KKZ C;  3HLZ A;  1PL5 A;  2V4H A;  4XPW A;  1FZC B;  3V5Y A;  3F5H A;  2R7O A;  4U3F J;  2J0W A;  4HYT B;  1SFC B;  4N6J A;  5CI8 A;  1FZC C;  4RO0 A;  4PV1 D;  2YIU C;  4LC1 A;  2WL8 A;  1VQ8 P;  1SFC C;  4NC3 A;  5B1B C;  1J8M F;  2Y3G A;  2L6G A;  2ETS A;  3ZSU A;  1EDI A;  2Y39 A;  1SQV K;  2Y3D A;  1SQX G;  1LTA C;  1N73 B;  1JCD A;  2MYS A;  2O1K A;  1WOL A;  5D92 A;  4OGQ D;  1LT1 A;  1H88 A;  2KXP B;  4OD5 A;  3H1L G;  1Q81 Q;  1BCC E;  3AOU A;  1Q7Y Q;  1G2C B;  4BJT A;  2IXO A;  1MKM A;  3FWL A;  4OGQ C;  5H2F E;  2QY9 A;  1B68 A;  2CYD A;  4XPY A;  1Q90 D;  1M2V B;  3OA1 A;  2XLW A;  1P84 D;  1BCC D;  3QW1 A;  3DE8 A;  3O6Q B;  4U9E A;  2W6B A;  1N7S D;  3AEC C;  3I5Q A;  2ZXX A;  1IK9 A;  4IL6 X;  3NKD A;  5TIS E;  3KXD A;  4MVO A;  4RBN A;  4MQ9 F;  1NGM B;  1NTZ G;  3E1R A;  2AXC A;  3TOL A;  3R2P A;  1E84 A;  4D6T E;  2KLU A;  1SQP K;  1SQQ G;  1FBM A;  3FDQ A;  2HKV A;  4Z1M H;  3FAP B;  2EIK C;  3PJS K;  1M1J B;  1DD3 A;  3H1K E;  1YAR O;  4K3A A;  1VL2 A;  1KV4 A;  2Q7C A;  2TMV P;  1M1J C;  1ZVZ A;  4D6T D;  2R03 A;  2N9B A;  1MMN A;  3BVH A;  1MMA A;  3B29 A;  1E86 A;  1QSP A;  3FVY A;  2JJL A;  3H1K D;  2Q9I A;  2CGE A;  3SNH A;  3M0D C;  1NKN A;  1JCC A;  3Q5P A;  3B0V C;  3AEG C;  1WGW A;  3S28 A;  1NTK K;  2OG2 A;  5EGY A;  4K1O A;  5CBO A;  3B5N D;  3TNU B;  2A68 F;  1D1A A;  2XU6 A;  4E18 A;  2FXM A;  1KIL A;  2LCH A;  1QPU A;  3B5N B;  2J45 A;  4BEJ A;  3VMA A;  2XND H;  1I4Y A;  3ASN C;  1FDO A;  3B5N C;  3G4X A;  2XV5 A;  2HPC A;  1Y8A A;  1W2B O;  1W2W A;  4XLP F;  2KQ9 A;  3U5S A;  4GKG A;  1S5L H;  2IX7 C;  3M9Q A;  3CME P;  5T3W A;  4PR9 A;  1Z3I X;  3L75 D;  3ATP A;  1IFN A;  3G9R A;  5CJ4 A;  5AW4 B;  4HJG H;  2OKU A;  1SQX K;  1PFI A;  3H1J J;  4MVM A;  2YZS A;  3FAJ A;  3I56 P;  4WVZ A;  4DRJ B;  4CSA C;  3NRH A;  2LIG A;  5DJT B;  2P2U A;  3L72 G;  1Z23 A;  2KJG A;  4CS9 C;  3PLN A;  4JEA A;  2XLV A;  3DXJ F;  2JWA A;  1OCZ C;  2FFD C;  1FDM A;  5F28 E;  1PPJ E;  1BE3 J;  4G0H A;  4KJM A;  1TFK B;  4H0L D;  1KYO H;  2VCB A;  1EA8 A;  3VF0 A;  3TDK A;  1GK6 A;  3RVY A;  2HMQ A;  3CC7 P;  4XEK A;  1NU1 K;  1HH0 A;  4I44 A;  4CIP A;  1PPJ D;  2L9J A;  1R5L A;  2BCC G;  1PGQ A;  3WHN A;  2O01 H;  2KNC A;  3GMA A;  4L6R A;  1NTZ K;  5E79 H;  2ZXO A;  5B66 E;  1YHQ P;  1SQQ K;  3Q1M A;  1JOG A;  4I1L A;  2W6A A;  1KOR A;  1L2P A;  4JTC B;  4H13 B;  4IAQ A;  3CXH I;  4DVY P;  1Q0M A;  1GGQ A;  1D0X A;  4H13 C;  3SYN A;  3L70 J;  1USE A;  2D2C D;  3AGT A;  2EIL C;  1S72 P;  1L0L G;  1K8A Q;  2OTL P;  4ZNC A;  3VMZ A;  5KYW B;  2D2C B;  4W7Z A;  4XEV A;  2UUI A;  3W8I A;  2ZJS E;  1OVV A;  3BAT A;  3L71 J;  1FFH A;  2D2C C;  3HE5 B;  2YLG A;  2O3J A;  1VK5 A;  1GS9 A;  1IFD A;  3OAK A;  4YWQ A;  5AVT B;  4CPG A;  3S0X A;  4GOE A;  2P7J A;  4YJW A;  2KSF A;  3U9M A;  2JX0 A;  4BG0 A;  1GL2 A;  2KS1 A;  4MVQ A;  4CDV A;  1CPR A;  3TJ5 A;  5AW6 B;  5AW7 B;  1FMV A;  2C0X A;  2AWC A;  2QE9 A;  2P67 A;  5APX A;  2V26 A;  3EH2 A;  1Y6D A;  1VYK A;  3JYH A;  4DJG A;  3AE5 C;  3TF5 A;  1R8E A;  3A0H E;  2J9U A;  3C62 A;  2NRG A;  2GAQ A;  1P84 I;  2KNH A;  1R5S A;  3A2A A;  2NUP B;  1FZC A;  5L0D A;  1IJD B;  1BCC G;  3IHU A;  3V2P A;  3H1I J;  1SFC A;  3WU2 E;  4E0H A;  3RBX A;  1W5C E;  3RK3 D;  1NFO A;  4CBE A;  1NAF A;  1NTM E;  1ZR4 A;  1GDT A;  4RJT A;  2Z5H A;  3P8M C;  2Z15 A;  3V2R A;  1YIT P;  1FDI A;  1WN0 A;  1EI7 A;  1BGY J;  3CWB E;  1TKN A;  2XLH A;  2O01 N;  1FMW A;  3PRJ A;  3C7J A;  3T97 B;  3S29 A;  1NTM D;  2KC3 A;  2FYU K;  1D1C A;  3S9O A;  3O10 A;  4DBR A;  3M79 A;  1EDL A;  4N3Y B;  1FZE A;  1G2C A;  2IZ0 A;  3TYY A;  1NAY A;  1RHZ B;  4D6T G;  1KB9 H;  3CCU P;  2YMK A;  1I4Z A;  2AEJ A;  1EZV D;  2EPN A;  1SQV E;  2HSQ A;  3H1K G;  2JO1 A;  3FGA D;  3O6Q A;  1HUC A;  4PD4 H;  4MS2 A;  1SR2 A;  2GUV A;  4IFF A;  1GK4 A;  2G8Y A;  3F47 A;  4EBB A;  3LS0 A;  5AVV B;  2YL0 A;  2V3C C;  2X51 A;  2KP8 A;  3HKK A;  3TK1 A;  3HNI A;  3RVZ A;  3EFO B;  3BCC G;  2QLA A;  2WVR A;  1WTY A;  3L34 A;  2OU6 A;  2YL1 A;  1L0N E;  3QTH A;  5DVW A;  1M1J A;  2PRR A;  1L0L K;  3ABK C;  5GTI E;  2H7B A;  1T3J A;  2EPO A;  2K3R A;  2Y3B A;  3E7K A;  1SYQ A;  1E83 A;  4JCZ A;  2HV6 A;  4C7N A;  2J59 M;  4H4K C;  4WJ0 A;  3M0D A;  1VQK P;  3GHG C;  1AQT A;  1VQ6 P;  3IPM O;  2B0J A;  4OD4 A;  1LS1 A;  3WUT A;  1FJP A;  1PD0 A;  2FYZ A;  1RF0 C;  3GOR A;  3TNU A;  5AVX B;  3N0T A;  1JB0 J;  1IC2 A;  3GEI A;  1QVX A;  3B5N A;  2G3K A;  2R7S A;  5JLI A;  2IYP A;  1AVO A;  4IFM A;  1G1J A;  2E42 A;  4MND A;  2A06 G;  2M3E A;  5H2F H;  4N06 A;  4IRU A;  1AQ5 A;  1APC A;  3P8C D;  2YL7 A;  2KGO A;  4MVU A;  4XEF A;  1RXQ A;  1PPJ G;  1BSH A;  3R7C A;  5BUO A;  4HEA J;  5AC4 A;  1YQ3 C;  2W27 A;  5AW8 B;  4DBQ A;  2DYS C;  4U5C E;  4K35 A;  1JMW A;  4WAB A;  4MW3 A;  1NLX A;  3CX5 D;  5TIS H;  4JCH A;  1ZR2 A;  1BDD A;  1SQX J;  4JRZ A;  5JSL A;  4CSA A;  3W68 A;  3SXK A;  3NMI A;  4JEB A;  2EPL X;  4CS9 A;  1DOW A;  2K9J A;  4N6C A;  1LTG C;  3JRM O;  3N2Z B;  3DAG A;  4U5B E;  2FFD A;  4Q5S F;  1BDC A;  3H1L J;  5AVS B;  1KU2 A;  4RKU J;  3VM6 A;  1KTM A;  3MHV A;  2G62 A;  2HJM A;  1VQ4 P;  2V7Q H;  2LQG A;  3W4Y A;  1D0Y A;  2QM8 A;  3QVZ A;  3IAO A;  3CCM P;  4PJM A;  4DJ9 A;  3VYI A;  3GG2 A;  3FXE A;  4JC7 A;  1OW6 A;  4LLE A;  1J2J B;  1KFM A;  1S3J A;  4NPE A;  4O7G A;  1EC5 A;  3L73 E;  2GUS A;  1RJ9 B;  4O6Y A;  3EQ2 A;  1USD A;  3LAY A;  1BZ4 A;  3RQE A;  4E0I A;  1Q0D A;  3U59 A;  4LDR A;  2H88 C;  2J0X A;  1HVV A;  5AC5 A;  2E76 B;  1SP4 A;  1NU1 E;  3K33 A;  2IYL D;  1X8Y A;  1JOC A;  2E76 C;  5KYW A;  3CPW O;  4MVS A;  2CCY A;  4WGY A;  1MND A;  2Q9C A;  1N7L A;  3TJ6 A;  3HE5 A;  1S7Z A;  1J1E B;  5TJH A;  3E70 C;  2ITA A;  3KZI E;  2ZFC A;  4CDY A;  3FXH A;  3GLM A;  1VYI A;  4NTA A;  4MN4 C;  4BWN A;  2R7Q A;  3A7O A;  4K7B A;  2QVA A;  3CWB G;  2XXA B;  5E2Q A;  4DOJ A;  1SF8 A;  2J9W A;  2QTV A;  1VOM A;  4LDK A;  4UB6 E;  3RH3 A;  1EZV I;  1TWH A;  1LT9 C;  1X0T A;  3S90 A;  5AVR B;  1QKR A;  4H44 D;  3KL4 A;  4BRY B;  2XLO A;  5JS5 A;  1TU3 F;  5CMZ A;  2KYH A;  2NUP A;  1ZOY C;  1VQ5 P;  4L76 A;  4H44 B;  3NTN A;  1T01 A;  2WSC H;  1VQN P;  5AVQ B;  3DJN B;  2R7U A;  3POV A;  1AV1 A;  2W8Z A;  4H44 C;  4E17 A;  2MHR A;  4PK4 A;  2ZYA A;  3RIP A;  1SQV G;  3V2Q A;  3VTP C;  2A45 I;  4BXL A;  5FZT A;  1H6G A;  3T97 A;  3MYI A;  4CS7 A;  1FOS E;  5HSW A;  5B66 H;  4WGZ A;  2GFH A;  4I1O B;  2XNX A;  4K0D A;  3VAY A;  1BR4 A;  1LJ2 A;  3O39 A;  2CNW D;  3EZI A;  5CIV A;  5DS5 A;  1MMD A;  2GWW A;  1DIP A;  2OJE D;  2YHS A;  3N24 A;  2A0U A;  5COM A;  4XLN F;  2VB6 A;  1IO4 A;  1Q0K A;  1L0N G;  2DI3 A;  4AL0 A;  4GOF A;  5KJ7 D;  3SEO A;  3RW0 A;  3G4Z A;  1OFC X; 
#chains in the Genus database with same CATH homology
 2Q7C A;  1M1J C;  3HD7 C;  2OYH C;  2R5D A;  2N9B A;  3IFM A;  2PP6 A;  1RF1 A;  3HE4 A;  2I1J A;  3BVH A;  2YKP A;  5KJ7 C;  3V5B A;  1J1D B;  2JJL A;  2Q9I A;  2YNY A;  1YA9 A;  3M0D C;  1NKN A;  1JCC A;  2CPS A;  1J1D C;  1NTK K;  4HH2 A;  1GU5 A;  1RE3 C;  3B5N D;  3TNU B;  2KLV A;  2XU6 A;  5AVY B;  3VN0 A;  1LTS C;  2FXM A;  2ZXE B;  4M3L A;  1KIL A;  3B5N B;  1URQ A;  3A5T A;  1CZQ A;  3GHG A;  3SWF A;  5CHX A;  3B5N C;  1N73 A;  1WT6 A;  2XV5 A;  1X9V A;  2HPC A;  2IFN A;  1NTM K;  1GL2 B;  1IFI A;  1RF0 A;  5AVU B;  4GKG A;  1WRG A;  1H8A A;  1N86 A;  1DX7 A;  2IX7 C;  3M9Q A;  2H7H A;  4GT1 A;  4WB4 A;  1IFN A;  2GM4 A;  5CJ4 A;  5AW4 B;  3V4Q A;  1SQX K;  2M3B A;  4IFD K;  1PFI A;  1AEP A;  3HTK A;  1QL1 A;  2PAJ A;  3L35 A;  5APT A;  2WPS A;  2KB7 P;  4OH8 B;  2WIT A;  3M91 A;  2KOG A;  4AUW A;  5AW0 B;  3LW5 H;  1A02 F;  2P2U A;  4W80 A;  4JF7 A;  1LWU A;  1QL2 A;  3BRV B;  1JY2 P;  4O9B A;  2FFD C;  1L4A D;  1FDM A;  1LT9 B;  2HLO A;  1L4A B;  1EA8 A;  2YO2 A;  1GK6 A;  2I1K A;  1L4A C;  1NU1 K;  1HH0 A;  5AW2 B;  1FAV A;  5KTB A;  1KIL D;  2C9N Y;  3CL3 D;  2WT7 B;  1JTH A;  1GZL A;  1JY2 O;  2O01 H;  1N2D C;  2OAR A;  1SQB K;  1NTZ K;  1JY2 N;  3VP9 A;  3P7K A;  3H6P A;  1SQQ K;  1MZ9 A;  4C46 A;  5APW A;  1L0N K;  2HFE D;  4I1L A;  4ZKU A;  2W6A A;  2WWW A;  2NPS D;  4WY4 D;  1YTZ I;  2A45 G;  4I2L C;  1EQ1 A;  3OA7 A;  1CI6 A;  5APS A;  1RE4 C;  2NPS B;  4WY4 B;  1GD2 E;  1N7S B;  3UIA A;  3VMZ A;  1GW4 A;  3RL0 D;  2NPS C;  4W7Z A;  4WY4 C;  5CCH D;  5AW3 B;  1ZV8 A;  2VRS A;  3BAS A;  1N7S C;  5AW9 B;  1NWQ A;  1DH3 A;  3BAT A;  3N7N A;  3RL0 B;  3HE5 B;  2H8P D;  2MJZ A;  2CPB A;  1GS9 A;  2OYI C;  1IFD A;  3OAK A;  5AVT B;  2P7J A;  3RL0 C;  5CCH C;  1GL2 A;  4ZKP A;  5AW6 B;  5AW7 B;  2C0X A;  2P67 A;  5APX A;  1MFZ A;  4C7N B;  3MTU E;  1NOH A;  3M9B A;  1SLQ A;  3KPE A;  2R32 A;  2QM7 A;  1M7L A;  2BAS A;  1NHL A;  2O1J A;  5AW5 B;  3A2A A;  2LKM A;  1FZC A;  1IJD B;  2P1J A;  1HGZ A;  2M8R A;  5APU A;  3V2P A;  1HWT C;  1SFC A;  2IPP A;  2J58 A;  4EOT A;  3RK3 D;  2WPR A;  1NFO A;  1NAF A;  3HUS B;  1ZR4 A;  1GDT A;  1MUU A;  2Z5H A;  3P8M C;  3V2R A;  3P32 A;  5APV A;  2C0W A;  3HUS C;  1LT9 A;  1RY3 A;  2HOD A;  2N1T D;  1X79 B;  4C7R A;  2KC3 A;  2FYU K;  2N1T B;  3BRT B;  1S9K D;  1FZA A;  1W2E A;  3VOP A;  2N1T C;  4EIJ A;  4N3Y B;  1FZE A;  1G2C A;  3TYY A;  4AQR D;  1LTJ B;  3PP5 A;  3L36 A;  5CCG D;  3U1A A;  1HBW A;  1NKZ B;  1FOS F;  2YKO A;  2YO3 A;  1LTJ C;  1H89 A;  1CSB A;  3MGN A;  5AVZ B;  5APY A;  2FFD B;  1HUC A;  5CCG C;  1YTZ T;  2GUV A;  3H32 A;  1MV8 A;  4IFF A;  1FU1 A;  1GK4 A;  1T2K D;  1RF1 B;  3HE4 B;  3L37 A;  1T8Z A;  4XA4 A;  5AVV B;  2KP8 A;  1RF1 C;  3TK1 A;  2A45 H;  1XTG B;  1LS4 A;  1E5W A;  3SWY A;  3A3Y B;  5AW1 B;  2YMY A;  1T2K C;  3VP8 A;  4KHX A;  5CJ0 A;  3MD0 A;  3VMY A;  1JNM A;  2Z4E A;  1M1J A;  3HD7 A;  1L0L K;  1LE2 A;  1URQ D;  2OYH A;  1LTI C;  1J1E C;  1JUN A;  1T3J A;  1KIL B;  5KJ7 A;  1URQ B;  2HG5 D;  1OR3 A;  4C7N A;  5AVW B;  2J59 M;  1KIL C;  3M0D A;  1URQ C;  2HPC B;  5BU8 B;  4N78 E;  3GHG C;  1SVF A;  1N73 C;  1RE3 A;  4WBA A;  3NMD A;  3RK2 D;  4Y99 B;  1FJP A;  3VMX A;  3WMM 0;  2FYZ A;  1RF0 C;  5BU5 A;  3RK2 B;  3KDP B;  4Y99 C;  2WSE H;  5AVX B;  3TNU A;  1IC2 A;  3OJA B;  3KQG A;  1LTB C;  1H7I A;  4N78 D;  3HTK B;  1NFN A;  3B5N A;  3RK2 C;  2OYI B;  1LE4 A;  4IFM A;  1G1J A;  2E42 A;  1OWA A;  2KSJ A;  3CI9 A;  3I5C A;  1OR2 A;  1AQ5 A;  3P8C D;  1LWU B;  4XE5 B;  1FJK A;  1KQL A;  1EQ7 A;  2L5G B;  1LWU C;  2W27 A;  5AW8 B;  1FZB A;  2R5B A;  1LTT C;  1KZU B;  1ZR2 A;  3MUD A;  4DZO A;  1CW5 A;  1JMM A;  1LPE A;  1OXZ A;  3S84 A;  2IFM A;  1HJB A;  3LIE A;  3LID A;  1LTG C;  3CLQ A;  4B86 A;  1JTH B;  2FFD A;  1VDF A;  2FKW B;  5AVS B;  4JYC A;  4I6M C;  3RK3 B;  1S9K E;  4LGD E;  3E1I A;  3U1C A;  4LLH A;  1IFJ A;  1L4A A;  3RK3 C;  3C9I A;  4AYC A;  2QM8 A;  2WZ7 A;  1CI6 B;  3VYI A;  2C9L Y;  3EFG A;  1Z56 A;  1J2J B;  1KFM A;  2WT7 A;  1GTW A;  1FZG A;  3O8Z A;  1GW3 A;  3M9H A;  1NO4 A;  5KLV K;  2GUS A;  1GL2 D;  3EQ2 A;  3KYQ A;  1BZ4 A;  2Z5I A;  3II6 A;  1ZN5 A;  3U59 A;  3M0A A;  1RE4 A;  2R3C A;  4GIF A;  1HTL C;  1HVV A;  1GU4 A;  2XZR A;  1SP4 A;  2NPS A;  3M06 A;  4WY4 A;  1GL2 C;  3HRN A;  1N7S A;  1NH4 A;  1X8Y A;  1JOC A;  3L4F A;  2Q3I A;  3V2N A;  3MIW A;  3N4X A;  2OYI A;  1N7L A;  1SFC D;  3G3Z A;  1YYC A;  1FZC B;  3HE5 A;  5CCH A;  1J1E B;  4HYT B;  1SFC B;  4N6J A;  1FZC C;  2H43 A;  2ZFC A;  2XKM A;  4LC1 A;  1SFC C;  3A7O A;  2YKQ A;  3GHG B;  1SQV K;  2HOD B;  4DOJ A;  1LTA C;  3TSI A;  3NXS A;  1N73 B;  1JCD A;  1VPC A;  1LT9 C;  2O1K A;  5AVR B;  1JY3 P;  5CMZ A;  1H88 A;  1LGH B;  1JO5 A;  2JEE A;  3B8E B;  1IFM A;  3NTN A;  2WSC H;  1G2C B;  5AVQ B;  3HUS A;  3P8C E;  2WSF H;  1A02 J;  1ZLL A;  1B68 A;  5BVZ A;  3V2Q A;  3VTP C;  2A45 I;  2KYV A;  4W7Y A;  2E43 A;  1JY3 O;  3T97 A;  2W6B A;  1N7S D;  1KFN A;  1FOS E;  1G1I A;  1AFO A;  1T3U A;  1XTC C;  2N1T A;  1IK9 A;  3H32 B;  2POH A;  1JY3 N;  2XNX A;  4RES B;  1FZF A;  1LTJ A;  3IR9 A;  2WPQ A;  3R2P A;  1SQP K;  2Q5U A;  3HD7 D;  2WTY A;  1FBM A;  1IO4 A;  3V4W A;  2XDJ A;  2HYN A;  5CCG A;  1HGV A;  1M1J B;  3HD7 B;  5KJ7 D;  4JYB A;  5APQ A;  2OYH B;  3NFQ A;  1DEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...