3R2PA

2.2 angstrom crystal structure of c terminal truncated human apolipoprotein a-i reveals the assembly of hdl by dimerization.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
180
structure length
180
Chain Sequence
PPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-I
publication title Crystal Structure of C-terminal Truncated Apolipoprotein A-I Reveals the Assembly of High Density Lipoprotein (HDL) by Dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 68
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.20 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3r2pA02
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 3r2pA01
1OR2A 1GS9A 1LE4A 1H7IA 1AEPA 1NFOA 1EA8A 3S84A 1LPEA 1LS4A 1B68A 1OR3A 3R2PA 1GW4A 2KC3A 1LE2A 1EQ1A 1YA9A 1NFNA 1GW3A 1BZ4A
chains in the Genus database with same CATH superfamily
2JWDA 1O5HA 2B0JA 3VYIA 2LQGA 1OXZA 2ZJSE 4PR9A 1B68A 1Q0MA 1S7ZA 3HD7C 3GF7A 2OTKE 2MKVA 3HE5A 2WSCJ 3L71G 3RBZA 1OCOC 2YIUB 1LE2A 3O6QA 3I5PA 3A7OA 5COFA 1R5SA 3EGDA 2J9VA 1FZAA 2KNCB 2YRFA 4QI0A 2NZ2A 4J7YA 5APSA 2XLWA 4NCQA 4UDVA 4Z9IA 4PJMA 3EJNA 4UB8H 4O6NA 3EH2A 2I8DA 4OD5A 3H1KJ 2FY8A 2FYUJ 2V7QH 4RESB 4LDKA 1DH3A 3L70J 1ZP0C 2NUPA 1M57D 3L34A 2J0WA 4YK5A 1Q2NA 3IF4A 4CX9A 2XLDA 3VMAA 3FGAD 1L0NE 1HVVA 4FWVA 4X0RA 3ZQVA 3B5NA 4OWFA 2OYOA 1RCPA 1ZHTA 3L72G 1CPQA 3GG2A 2FFDC 4LDQA 3UR3C 3U0CA 1H7IA 3NKEA 4GOEA 1GGQA 2C9LY 3HNJA 1D7MA 3HE4A 5APVA 2QIWA 2Y3GA 3L75E 4HKZH 2Y9YA 1KILD 2W83C 3G6EP 1FU1A 4CJOA 4MVZA 1KC8Q 3EQ2A 2GWWA 3HE5B 3I5QA 4P6IC 1I4YA 2DYRC 1CGOA 1SYQA 2EIKC 2FBWC 2QJKC 1JPNA 1Q90D 3E1IA 1JMWA 1TR2A 4KBLA 4ZKPA 1GL2B 4I7ZB 2Z5IA 1TWGA 4OINF 2IFNA 2M3EA 2C0XA 5DJUB 5L0DA 4JRZA 2WZFA 2YEVA 4XEVA 2XU6A 1UFBA 2B9BA 3AG1C 5BQGA 2IYPA 3B8EB 2P61A 3ZDMA 1QSPA 3JZ0A 4JZAA 4BJ5A 1YTZI 2ASRA 3CC7P 2JPUA 1VF5B 1AV1A 2QJPC 4AX2A 4KI2A 1KYOI 1FE6A 4W7ZA 1HMOA 1Z5ZA 2M8RA 3CPWO 1NAFA 3NMIA 2BEQD 1JCCA 5BU5A 3CAXA 3OA1A 4LERA 2OU6A 3TQOA 1EC5A 1FDMA 3RK2C 5KAIH 1LWUA 4E17A 2E76D 3K66A 2OYIA 4K35A 1URQC 1SFCB 5COMA 2EIMC 2WWWA 3Q7GA 3WU2E 3LS1A 4WJ0A 5CHXA 2DI3A 2WZLA 4MW8A 4MVUA 1L0NJ 3VMZA 3EZIA 1M1JA 2KLUA 3M0AA 3AEFC 1QQ3A 1BCCD 1QPUA 5AW5B 5A6BA 2PX3A 1NSGB 4PJLA 3EFFK 1IFMA 4UB8E 3UIAA 2AXTH 3KZIE 2VCBA 1JMBA 4ZMDA 4MTOA 3L75J 1MMGA 2HS5A 1GK4A 1ZR2A 2L6FA 3O6XA 2EIJC 4ZLCA 3VMYA 1A02F 3TJ5A 1GU4A 5APQA 3AEAC 2C04A 2R7OA 3PH0A 1KV4A 3C9IA 1SQBD 1BGYG 2E5TA 3U59A 3G4SP 5AVRB 1C17M 3SWYA 3C62A 1EZVD 3UNGC 1PP9E 3M0DA 2IBZI 2KYHA 1M2VA 3L8JA 1PPJD 2FYUK 5T3TA 1N73A 1FMWA 2ZYGA 3MIWA 3R7CA 1NFNA 1KILA 3EGXA 4U9DA 4KJMA 3U1AA 4U7JA 1R4TA 1OW8A 1MFTA 2HR3A 3S1KA 1HH0A 4K0DA 3PMRA 4IL6H 2R7UA 2J9UA 4IFDK 2HPCB 5EK0A 4OIRF 4HFKB 1M1JB 1WASA 4C7OA 4BXLA 2KNHA 3H32A 1YVIA 1EDIA 3HKKA 2JO1A 3ASOC 1LTJA 3S28A 3VF0A 2BEZF 1NTZD 5CMZA 3MD0A 1KTMA 2EPMX 2OQMA 3SEOA 1JOCA 3NXSA 4NPEA 1M1KQ 256BA 2R5DA 2IBZE 2Y3HA 2GM4A 3P8CD 1SQQG 3EFOA 1DEBA 3K1IA 2GAQA 4EHPA 3MYIA 2CYDA 3G9RA 2YIUC 1V55C 1TWAA 3UGPA 3CXHI 3AG3C 3FWLA 3H25A 1G1JA 2V7QJ 3FOOA 1G5ZA 3GWLA 1PPJE 3GWNA 3KYIA 2Q9CA 5KAIE 3C7JA 1YIJP 3H1LG 3PDMP 1WTYA 4NQFA 1Y6DA 1SQVE 2JWAA 3ABKC 1MZ9A 3MBGA 1IK7A 2ZXXA 5JSLA 1ZOYC 2F22A 4WWIA 3SXYA 4YJWA 4IJJA 1D1AA 1MQVA 4GOFA 3FX0A 1M8OB 1PGPA 2AXTE 3L36A 3WUTA 2JX0A 4Z1MH 2G3KA 5E3CA 2IFMA 1U57A 3I5CA 4U5BE 1A41A 2IDBA 3HUSB 1H0TB 1N7SD 1RH5B 4HYTB 5EFWB 1ORSC 3LS0A 3U8VA 3CXHE 4CSAA 4PK4A 1ZN5A 1S3JA 1EA8A 2KS1A 5KYUA 4MN4C 1BCCJ 3ABVC 2I15A 2J9WA 3E9VA 3ZQYA 3TOMA 4GT1A 1L0NK 5JT4A 3AE8C 4AL0A 3W8IA 1HWTC 3QVYA 1P84H 2QY9A 1NTKD 4RD9A 1SQXD 3FHDA 1DEEG 1GL2C 1YJNP 4I7ZC 2KZIA 3GF3A 5EHHA 3ASNC 3II6A 1FR0A 4E0IA 1N7LA 3K33A 1CGME 1EXJA 2E76B 1FZFA 4CDVA 3ITKA 5B1BC 4IL6E 3JCUH 1S4XA 1URQD 1L0LE 1VQ4P 2HYNA 4F4BA 3ATPA 3RK3E 1VMAA 4FAPB 2HODB 3ITFA 4XLPF 3J06A 1AUEA 1LP1A 4G0HA 4NTFA 5KAFE 2L6GA 2YKQA 1S9KD 3CMAP 3O55A 2PRRA 2L9JA 4LLHA 2Z4EA 3M9BA 1SQVJ 5L0IA 3AQBA 1IK9A 1BDDA 1RQVA 1SFCC 1KMIZ 1SQPD 3VN0A 2G62A 2XL4A 1GDTA 1USEA 1VQ8P 3SYNA 1ZU5A 3BASA 1NU1E 3US6A 3L73E 1E85A 4BEJA 1NTZJ 2L91A 1VQ7P 1IW7F 3WUVA 3IQCA 2FFDA 2J45A 4EOTA 2SPZA 5L0JA 3P7KA 3W68A 5KLIB 3TYYA 2K9JA 1ZV8A 1P84I 1E83A 1VQPP 2R7RA 2EINC 1QLED 1BCCG 3AE2C 3FXDA 3FXEA 2H89C 1NVOA 2M0BA 3CCSP 1QL2A 1XWJA 1PCXA 2DB4A 5AW8B 1BDJB 4AE4B 1TKNA 3MFNA 2XKMA 2NRGA 3A0HE 2KIKA 1R5LA 3S84A 5AW7B 1YDIA 1N7SA 4JE9A 3S0XA 2PFXA 2Q6QA 4L6RA 3V2QA 1L0LJ 2Q9IA 4QDLA 1OCCC 1NOHA 2HMQA 4R32A 4CS7A 4JC7A 1SQBG 3PLNA 1G2CA 4PD4I 1EZVG 1P84E 3EZHA 2H88C 1TQGA 3DMDA 3L71E 4WBAA 4U5EE 1M1JC 1LT9A 4ZNCA 2IYOA 2M5AB 3MP7B 1RJ9A 4DVZA 3EHMA 1TFKB 4JTDB 2K9JB 3U1CA 1K04A 4I2LC 1URQA 1GQAA 3CX5H 3O8ZA 2BCCD 2M4EA 1DIPA 1IFJA 2KB7P 3QWOC 1M57C 1NTKJ 2V26A 1NU1J 1SQXJ 1MNDA 5E33A 3L73J 4AK9A 1T6IA 2N9YB 5COGA 1LTIC 1E84A 3E1RA 2L6HA 5B3IA 3CCQP 2WQYC 1NTZG 1VOMA 1I4ZA 4PV1B 4PD4E 2IX7C 2WPVB 3L72E 1S5LH 1N7SB 4I1OB 4JKVA 1LTTC 1Q0KA 4O6YA 1X22A 2QNLA 3CI9A 4JEBA 1T2KD 1N73C 2X0CA 1KILC 1XTCC 4Q4ZF 2R02A 3M4BA 2QLAA 2CPSA 3AE5C 4WY4D 2D5RB 3SWFA 4BJ6C 1OVVA 5B1AC 3ZDLA 4NTAA 4H44B 1OCZC 2QUPA 3CCVP 1LTGC 2KXPB 2XLHA 5AW1B 1AQ5A 1JY2P 1LT9B 1SQPJ 2NSGA 1GL2D 1YHQP 4XPWA 2G8YA 1CI6A 1S1CX 1SQVK 3HUSC 2IXMA 2RMZA 3CD6P 1YZCA 3AEBC 4EBBA 3F46A 3CX5D 3DE9A 1NTMD 4C7NA 4IAQA 4YXDC 2QEXP 2W6BA 3HRNA 2Q9AA 3CMEP 1LE4A 1Z3IX 3L71J 1A02J 5DQTA 1BE3D 5H2FH 1LS4A 4J30B 4PFPA 1FS0E 1NTZK 2N1TD 5KLVD 1ZR4A 4DXWA 1VF5D 2P58A 4A7PA 1WWPA 4BJTA 3RL0B 1EDKA 2J9BA 3M15A 3PCVA 4XLNF 3JYYA 2WT7B 1Z7Qc 3H2VA 2R44A 1GM5A 3C8GB 3FOPA 4D6TG 1LI7A 2XNXA 5CI9A 1VLTA 2IPPA 2E76C 1PFIA 3N4XA 4NPFX 4PJJA 3TK0A 1SFCD 1NTKG 4HFFB 1SQXG 2IZ1A 1WOLA 3HNLA 2QSIA 3ZVRA 4YWQA 1CPRA 2VRSA 4DOZA 1HJ0A 4OVNF 1VL2A 3L72J 3OAKA 3ZTMA 4E7SA 5L8RJ 2WB7A 3CX5E 2XL6A 3TDKA 3DAFA 2OYHB 4XPYA 1H89A 2Q3IA 3PJSK 1L0LK 3ZWIA 3NYMA 4J7TA 5K5GB 4BJ1A 1SVFA 2Y0DA 3U5SA 1SP4A 3K5BA 1HE9A 3GM1A 4K1OA 2NPSB 5AW9B 2I1KA 3POVA 1VQMP 2R7QA 1S5LE 4MVMA 4YL3A 1BGYE 1SQQD 1SQPG 3GW6A 5DLJA 4EWCA 2YVKA 2R3SA 3TULA 4GEHA 3AE7C 1NFOA 2IXOA 5A6JA 2O1JA 2Y3DA 4ASWA 1N86A 3DD7A 1NTKK 1KB9H 4U3FG 1NU1K 1SQXK 1ZRTD 3H1LD 3JSEO 1HUCA 3X2QC 1VYIA 4C3DA 5AGFA 2PFDA 4BG0A 1R5ID 2IBFA 1GL2A 1BSNA 4GKGA 3VM6A 3CZ6A 5AVVB 5F5FA 2JD3A 2LFDA 4P9TA 2X51A 3I4UA 2XLOA 3V2RA 3PHLA 3N24A 3V4WA 3GEHA 2HMZA 5H2FE 1H9GA 3E70C 3T97B 2W4MA 2N1TA 1RF1B 2HFIA 1AVOB 3GLMA 1AFOA 1HGZA 1SQQE 1E5WA 4JYCA 3G4XA 2YLDA 1JO5A 1RXQA 2LXBA 1Q81Q 1SQPK 1NBBA 2UUIA 1NTMJ 2HSQA 1Y4CA 4C3EA 2ICWG 2YLIA 2V3CC 2A6EF 3NG1A 5AVQB 3X1OA 1SFCA 4CJGA 3H1LE 2FGYA 1J2JB 1KB9D 2Q5UA 3CCJP 4H13B 3H2UA 5EGYA 2MWQA 1YJ9P 4WY4B 1T6QA 5APUA 4E7ZA 2V4HA 4K7BA 2LD6A 2QM7A 1XZPA 5AC5A 3ZSUA 4W80A 1ZMEC 1BGYJ 2R03A 2ZXOA 2BCCG 4PV1C 5BU8B 1U6HA 1ZW2A 1JY3O 5L0GA 3L35A 1PGQA 4CIPA 3ABLC 1N7SC 1VQ6P 3NKDA 2E74B 1VPCA 2XM4A 2A69F 3Q1MA 1OCRC 2XL8A 2A06D 1YYXA 1NU9C 4PJNA 2OOCA 3AG2C 1K9MQ 3JSZA 3K6BA 1IFIA 4OD4A 2HZ8A 1MMDA 3IN6A 2IZ0A 1T6AA 3RQFA 3ZG1A 4XFJA 3B0PA 2N1TB 2WSFH 4H44C 3TGUD 1LS1A 1KORA 5DJTB 3MUDC 4HEAJ 3W8HA 1LT9C 2R7VA 5KYXB 2ZVOB 3GMAA 2WITA 3VTPC 3BRVB 1KB9E 4MTFA 2AEMA 1YZAA 1YA7O 3AQCA 1KILE 4W8KA 3W67A 1C02A 1KYOD 1CGNA 3BCCD 5KYNA 2J0XA 2HPCA 1SQQJ 2A68F 3SP1A 3G3ZA 3KKBA 1NAYA 2CCYA 2HV6A 5TISH 1HF9A 1OXBA 2Q3EA 5L0HA 1VTMP 3V7OA 2WMMA 4DT0A 2PBEA 1NTMG 4YPCA 4EDFA 1KQLA 2DGJA 2OG2A 4C46A 4DVYP 1D0YA 3H1LJ 2WPSA 1VB5A 4CBEA 1BE3G 3BRTB 5TJHA 4BRYB 2L5GB 2YNYA 4OIOF 5KLVG 5BUOA 1QX8A 3LJBA 3U3FA 3SWKA 1OW6A 2YL7A 5FZTA 3VYWA 2LK4A 3EG9B 2I8BA 2TMVP 3QVZA 2OTJP 3L0IA 2B88A 2XS1A 4NPDA 3ECSA 1Q7YQ 1ZW0A 1H9TA 3DI5A 2FFHA 3AECC 1NGMB 2A1DD 2OYHC 5DVWA 2FKWB 1HE1A 2KSJA 3MHVA 4Y28J 3WAQA 3TSIA 1QLEC 2NG1A 4BWNA 5L0FA 1YQ3C 4BJ6A 1BCCE 1ZHXA 2NPSC 1K40A 2QE9A 2HSBA 3H1ID 4B86A 3B9QA 1J1EB 3H1HD 1NTMK 4FX5A 3HUSA 2MJZA 1H0TA 3GEIA 1VDFA 2YL0A 1YA9A 2P2UA 1UIIA 3DE8A 4DZOA 3NFQA 4ZKUA 1OKKD 5D91A 3RYLA 2R7XA 1Q0FA 1OW7A 5GTHH 2C0WA 1SQBE 4L76A 3PRJA 3ZC4A 3AEDC 2OJQA 3DM9B 5DS6A 1EZVE 2JR8A 2O01H 4ANJA 5FCLA 2GUVA 2P7VA 4IWBA 3SNHA 2H43A 5B3SC 4LDRA 4XWJA 2AU5A 2R32A 2CGEA 2VCAA 2YQYA 2HODA 2YXQB 2XXAA 3SSUA 5TISE 1RF1C 4DOJA 4YTPC 1VQ5P 1VLSA 3LIEA 2CK3H 2XZRA 1FBMA 3OWTA 3AGTA 1FMVA 3A0BH 1LM3B 3A9CA 5E79H 2EPOA 1NTZE 3UMKA 4UB6H 3BCCJ 4PV1D 4GYTA 4HB1A 2KK7A 3VMXA 1OR2A 2B89A 4AUWA 1W2BO 1BSHA 1BR2A 1Y47A 2WPRA 1T2KC 4KC9A 2KSEA 3P8CE 1SQQK 3EH1A 4WY4C 5CIVA 4D6TD 2ZAEB 2KLVA 1X8YA 4C7RA 1HMDA 4L73A 2Q4FA 3JRMO 4PACA 4G7OF 2PGDA 4H44D 3D6ZA 1V74B 3Q5SA 5HV9A 5AW2B 1T3UA 2LFFA 2BL2A 2RN0A 3F5HA 2H7HA 3SXZA 3L4FA 2E74C 2YKZA 3QH9A 1DOWA 1FTSA 2H8AA 1SQBJ 2WSFJ 4O7GA 1X9VA 4BEMJ 4H54A 4AE4A 3RKOF 1A7VA 2XXAB 5KTBA 5CCHC 1G8XA 2OQQA 4W8PA 5GPGB 3UGOA 2N1TC 2K37A 1VK5A 1VF5C 2P7JA 2Y9ZA 3RF3A 1E79H 4AYCA 3FVYA 2A06G 3RL0D 4GQHA 3T9OA 1PGOA 1OMIA 3JCUQ 3HNIA 1KQGB 2QM8A 1OKKA 3AE1C 1C03A 3N2ZB 4NC3A 3C8GD 1R8EA 4U5DE 1USDA 1H6GA 4IGGA 2WTYA 1GW4A 1L3PA 5GTHE 4H0LB 4MNDA 4D6TE 1OVRA 4IOIH 3TGUG 2CW0F 2VCCA 3H1HJ 3JSVC 2KC3A 1A7EA 2O9XA 1FJPA 4XQ1A 4EUKB 3AE3C 2GA1A 3HTKB 1N2DC 1NTKE 2R25A 2H7BA 3AJMA 1SQXE 5BVZA 2CDQA 4U3FD 2OEVA 2M5AA 2XM0A 1FJKA 2A0BA 3WUUA 3HLZA 3BCCG 1CZQA 4A4AA 4N78D 1MMAA 3IQ6A 3CCLP 4XEFA 2JEEA 4RJTA 3R2PA 2A6HF 3M91A 2D2CB 1QGKB 4J32B 3SZRA 4HH2A 1AJYA 2W4BA 3L74D 3P32A 2LP4A 1W2EA 3DJUB 2NPSD 1S9KE 3LLKA 1V54C 3HJCA 2IM8A 1T5OA 1TWHA 4PFOA 4OGQB 3RQGA 1RY3A 1LKXA 3R4YA 1Y8AA 2FYNB 2C03A 2ZXPA 3EWKA 2NUTB 5KJ7C 1LPEA 3BVHA 3OA7A 4JTCB 1PIXA 2R05A 5AVXB 1EXIA 4I44A 5AC4A 1NU7D 1SQPE 5APXA 2WSSH 4XEKA 3HD7B 3L1MA 4KNVA 3SFDC 4U5CE 3TJ6A 1JM0A 3EQLF 1GW3A 2Y0EA 3H1JD 2C9NY 2YL1A 4U3FE 3FAJA 3IHUA 4DRIB 1U0BB 3DJNB 2WSCH 2XLEA 3MUDA 1VQ9P 4IARA 1XTGB 3U9JA 3VRCA 3H6PA 4ONSA 3FAPB 5JS5A 3OEOA 4WVZA 2K3RA 4G7HF 2L81A 1Z56A 2K88A 3JCUE 1NG1A 4D6TJ 2B0HA 3RFYA 1LGHB 3H65A 1OFCX 1FOSF 1ZLLA 3MYFA 3H1IG 4JJFA 3H1HG 1QKRA 5AVWB 2YWAA 3CCEP 3L37A 2R3CA 4H4KC 4YXWH 2W8ZA 2HJ3A 4OH8B 1OR3A 5APTA 2IXPA 3NTNA 4AQRD 2WT7A 4CPGA 1FZCA 3U8PA 2ZXWC 1RF0C 3C8GA 5AVUB 5BQHA 4E18A 4R4MA 1ORJA 1IFNA 2P0NA 2XSEA 1TWCA 3B0VC 2EPNA 4E0HA 2GDCA 1IFPA 1SQBK 1JUNA 2GA0A 3WMM0 1KD1Q 1G1IA 1NHLA 1GZLA 2PAJA 3RK3B 4H13D 1I5NA 1AVYA 3UMIA 2YHSA 1FC2C 1QL1A 1NJIQ 5JUAA 5A6AA 1G4US 3DXJF 3MTUE 3NRHA 5M1BA 1HJBA 3BRJA 1OQCA 2M3BA 3KPEA 3NMDA 3O39A 2OYHA 2J46A 3AE4C 4MVSA 2RD9A 1LT1A 2BCCE 3RW0A 3KYQA 3RL0g 2E74D 4I6MC 4D4NA 2IYLD 4U3FJ 3H1KD 2FYUD 2DW3A 2NPSA 1OZHA 3L70D 1Q82Q 3CX5I 5L3VA 5CCHD 3QZCA 5KYWB 2ITAA 1YARO 4EI2A 2NSFA 3LAYA 5JRAA 2YLGA 1EKYA 3M06A 3B0UX 3RVZA 3RK2B 1OVUA 5K0IA 1FZCB 3FXHA 4YN0B 2O1KA 3GM3A 3GEEA 1WT6A 4WABA 5DS4A 1JPJA 1YYCA 3CC4P 1FNTc 4CDAA 4RDAA 2HV7A 1Z23A 5AW6B 5A69A 4YT2A 3OW2O 2P6VA 2ZVNB 1HGVA 2A45G 1E86A 1DX7A 1OWAA 5F28E 3V2NA 2AXCA 3VAYA 2XLVA 1YAUO 1LI5A 1D1BA 2W6JH 1S05A 1LTBC 3D71A 3O10A 2G3AA 1NTME 5CBNA 3A3YB 1CSBA 3GHGB 1QVFO 3BEHA 4FESA 2QE7H 4MQ9F 4H0LC 2XDJA 1BE3E 1WN0A 3T97A 3GM2A 3MLGA 1RF1A 1AVOA 2GUSA 3RGUA 1W2WA 2H7OA 5KLVE 3HTKC 4XTKA 2B87B 1JR8A 1JY2N 3QW1A 3AG4C 4JCHA 4N4WA 3G71P 1LIHA 2I1JA 2E5YA 1YITP 2BCCJ 3EFGA 3TF5A 1Q86Q 3AE6C 3A11A 2UUHA 5KJ7D 5KLIC 3AGUA 1IC2A 2BE5F 1EDJA 1JAFA 2PF4E 1JTHB 4LC1A 3CCUP 2J5UA 3SXMA 5B5EH 1M6TA 3FMSA 4WGZA 4JVSA 3LNMB 3U2MA 4WY4A 4LACB 3PP5A 2WVQA 2YMYA 3KPHA 1ZYRF 4EKWA 2ZT9B 4YL1A 4OGQC 4O79A 1FDIA 2FYNC 4JPZB 1GU5A 1GTWA 2JKVA 3N7NA 1AEPA 3L74G 3PTZA 1FZBA 1KNYA 5AVZB 1J8YF 2PP4A 4LLEA 1L4AB 4MVRA 5E2QA 3I55P 5AVYB 3EPVA 2L7AA 3LUTB 3L75D 3WU2H 5CCHA 1NLXA 3TNUB 3V6IA 4U5FE 3IAOA 2M64A 4O9BA 2HG5D 1M2OA 4PJ0H 1FAVA 5A6BD 4QMAA 1K73Q 5AW0B 3E7KA 2RSEB 5KYXA 1RE3A 2AP3A 1LTAC 2POHA 2RH0A 3KZIH 3MZWB 1T9KA 3H1JG 4YL0A 3W4YA 1BE3J 4B6IA 1ZW3A 3CL3D 1ZRTE 2OKUA 2OGUA 1KYOH 5KLVJ 1EQ1A 5BQIA 2KW3C 3C8VA 2HKVA 3PHF2 2E75B 1KB9I 3CWBG 5L3QA 2R7TA 5T1DB 1RQUA 1GS9A 2LCHA 2OEXA 4Y99B 1YYJA 3SFEC 5APYA 2O3JA 1YJWP 3CCRP 1D1CA 2Q00A 4BRYA 3V5ZA 4CS9A 3TK1A 3NMKA 1FFTC 2KQ9A 1RKCA 1MV8A 3M1CB 1JB0J 1DD3A 4M63A 2J7PD 3MGNA 2J8WA 3KYJA 3RK3C 3EG9A 5AVSB 1FOSE 2W6AA 1Z63A 3O6QB 4LGDE 3M9HA 3M79A 3EGDB 2H7VC 4JF7A 5KJ7A 3M4CA 4IL6X 2RKLA 1BR1A 1U7MA 3JC22 3Q2YA 2DYSC 1YI2P 1VQOP 5B5EE 1IJDB 3KQGA 1HY5A 1O87A 2NUPB 1ZHZA 3T6JA 3B4SA 1D0ZA 4JBZA 1YJGA 3DM5A 2P1AA 4N6HA 2WZGA 2QJYB 3B5NB 3KH2A 5B66H 1M56C 2XRHA 1PL5A 1KU2A 2WSEH 3S9OA 1NYHA 1NH4A 2FXOA 2W45A 3RL0C 1L7CA 3F47A 1PP9D 2YO2A 3W2VA 3H1KG 2FYUG 4W7YA 3M9QA 1FZCC 1MMNA 3W2WA 2A06E 5DS5A 3L70G 2Z5HA 3HE4B 3TD7A 3CCMP 4TLFA 1RKEA 4R4LA 4H0LD 3CSKA 1E2XA 4PJ0E 2NPUA 3TGUE 3ZIBA 3S90A 4IRUA 3V5YA 1LTSC 1XZQA 1RF0A 2WVRA 1A7DA 4KNWA 5DQZA 1PV3A 5JP7A 3KHUA 2EPLX 1KYOE 3GHGC 2ZPAA 2ZD9A 2XS8A 3BCCE 5CJ4A 1O3UA 3CXHH 1EZVI 3Q7LA 2D2CD 1RHZB 1DOVA 1X79B 1KZUB 1LJ2A 4CS8A 3Q5RA 2HFED 2IBZD 4IB4A 3GANA 1J1DB 1T8ZA 3F89A 5E3AA 4OGQD 2AWYA 3U3BA 4CDYA 4XA4A 3T6BA 1MFZA 1X0TA 2QA4P 1VYKA 2LSEA 4OIPF 2R7SA 4JURI 4Q5SF 1LWUB 1PGJA 2OYIB 4ULVA 2J7PA 4DBQA 3HD7D 5KLVK 1N8RQ 1SQVD 3K7DA 1RKEB 2YKOA 5D92A 1RE4C 1KQFB 2VASA 1T3JA 2JDIH 1FZGA 3LW5H 2ZT9C 5KAFH 4KHXA 1NKNA 1M90Q 4IFFA 4M3LA 2A45H 2OJED 4DBRA 1G4WR 4Z9HA 5CI8A 4NY3A 2KJGA 3IQTA 1JRAA 2PX0A 1UG7A 1L4AC 2KP8A 3CXHD 4DRHB 1DD4A 2KOGA 1SLQA 3TGUJ 1L0NG 3IPMO 2MHRA 3H1IE 3S27A 5B66E 3DZAA 2P67A 1KN7A 1AQTA 4WGYA 3H1HE 3RQEA 4JJGA 2KZJA 2MYSA 1ORYA 3GORA 4MTGA 4YT4A 2ZXEB 3U9MA 4GIFA 3HNKA 3LESA 2XV5A 4JQ0D 1M2VB 3QTHA 3L75G 1QEXA 2HUJA 5KYYA 1YLMA 4EIYA 1N73B 4GDOA 1KILB 2W90A 3EGXB 1SF8A 3NYJA 3FDQA 1ZZPA 1JMMA 1L0LD 3HTKA 4I1MA 4H13C 3VP8A 3RK3D 1LVKA 2YL3A 3G50A 1PP9J 1PZQA 4GODA 1FFHA 2AWCA 2E75C 1IZMA 4C7OB 2YXRB 5CCGC 4AL1A 1NZEA 4D4XA 3A0HH 1T01A 3H32B 1JY2O 4EIJA 4Y99C 1WGWA 2AEFA 1JY3P 3V5XA 1LTJB 5TJ5E 3CC2P 2Z15A 2IXNA 4KT0J 2A45I 2UWJE 3SXKA 3S4RA 2EPKX 1QVXA 5CJ0A 2IOQA 3AOUA 4WB4A 5AVTB 3EFOB 4N3YB 2ETSA 1H8AA 4O6MA 1NU1D 3L73D 1LNQA 1JOGA 2NUTA 1N1CA 2JJLA 1M56D 1IFDA 3LEVA 4NTBA 4EBJA 3FWNA 1V4AA 1AA0A 3MX3A 1WRGA 3RK2D 4I1LA 3KDPB 1RE3C 4CIHA 3HD7A 5KYYB 1ZHWA 3Q5PA 2OTLP 2KGOA 3B29A 3CEXA 3H1IJ 1TFOB 4C3BA 1H88A 3P8MC 3S29A 2WSEJ 4MVOA 1Q0DA 3AE9C 1M7LA 1FAPB 3IFMA 3USSA 5CBOA 4MVQA 4U9EA 1YTZT 2QJYC 3B5NC 3IQ5A 2P10A 5A6KA 4LLCA 2N9BA 4N6JA 3VP9A 2WPQA 2GFHA 2H8PD 4PD4H 2PNOA 2OARA 3LLIA 4XPXA 2G3VA 2LIGA 3ZTZA 1ZXGA 2KS1B 4CS9C 5KYUB 1WATA 5KKZB 5HSWA 2WL8A 2Y3BA 1NKZB 1HW2A 1S5LX 1NWQA 2LKMA 5T3WA 1P84D 1PP9G 2W9YA 3A0BE 1JY3N 2R9RB 2YZSA 3L71D 5E79E 1KQSO 4UB6E 2J58A 2ZYDA 1YQ4C 2BASA 5F5HA 3AEEC 4ZLDA 2QVAA 4MS2A 2W27A 4K3AA 4ULWA 2CPBA 3N0TA 1OIPA 5AW3B 2Y69C 4ASVA 1SZIA 4JYBA 3V2PA 2AEJA 4RBNA 4ER9A 4OIQF 5APWA 3QW0A 1YBKA 3NYLA 5JLIA 1BBHA 3T6GB 1LP1B 1J1DC 2YO3A 2ZFCA 3WHNA 1IZNB 3JTLO 4BJ5C 2WVOA 2ZT9D 2Q3TA 3JT1A 4RO0A 1S72P 2QTVA 2EILC 3DWWA 1J1EC 1PD1A 4N78E 3TOLA 4N6CA 1D0XA 3CLQA 1ZU4A 3BATA 1CW5A 1FZEA 3CWBD 4PD4D 3L72D 3L74E 1LWUC 2IBZG 1TU3F 2R5BA 2OYIC 1Q0GA 1L4AD 3LW5J 1A0BA 4IAOA 1QZXA 1MUUA 3UMHA 3C63A 2AVKA 2O01J 3V5BA 5KYWA 1PPJG 3T4RA 2Q1KA 4G78A 1VQLP 3OJAB 4RKUJ 3C18A 2FFDB 2KK1A 2VB6A 1JCDA 3D6YA 1JNMA 3ABMC 1APCA 1SS1A 1SQVG 4DCKA 1SR2A 2WZ7A 1EQ7A 3KXDA 5GTIH 3Q3DA 3NDBB 2LR2A 1RMVA 2YMKA 1SMYF 2CNWD 1BDCA 1HBWA 5AW4B 2FYZA 3H1JE 1BZ4A 5L0CA 3B71A 3LEOA 3IEEA 4EBKA 1BR4A 4CS8C 4IFMA 2QJKB 3D70A 4HJGH 4JTAB 2E75D 3L8IA 5C39A 2P1JA 5CCGD 3QMKA 4L75A 3CWBE 4XE5B 2XNDH 2YKPA 3M0DC 1IO4A 3WG7C 3GHGA 3K1HA 3GODA 3V4QA 1Z6AA 2E43A 4YT5A 4G7ZF 1S2EA 1ST6A 3Q6NA 1K8AQ 2HJMA 1MNEA 1NO4A 1KFMA 4N06A 3G4ZA 2O01N 1G2CB 2B87A 1ZHYA 4DJGA 1GMJA 2QJPB 2J59M 1GD2E 4TT3H 2Y0CA 3WODF 3EHNA 2FXMA 1OXKA 1J8MF 1U7JA 1RJ9B 4DRJB 1LTJC 3CQZA 2KI7B 2ZYAA 2E42A 3L74J 4JEAA 4U5GA 1EI7A 2VH3A 1JTHA 1L0LG 4JCZA 2FAPB 2OCCC 1MKMA 1URQB 2Q7CA 4U5HA 1UIXA 4Z9JA 1HTLC 1W5CE 1RE4A 4QI2A 4L74A 2KUBA 2Q9BA 3K1IC 3RH3A 2A0UA 3C1LA 1F1MA 3KL4A 1ZVZA 4YT8A 2KYVA 1JEKA 3B5ND 2VC9A 4HE8D 2E87A 4A2NB 3RBXA 3DAGA 1BGYD 1VQKP 4I3MA 1L2PA 2D4UA 3LNRA 1L4AA 3H1JJ 1EDLA 4BPMA 3H1KE 1GK6A 2FYUE 2HLOA 1NU1G 3L70E 3L73G 3TNUA 1KFNA 3VOPA 4Q7CA 3AEGC 4MW3A 3RIPA 3A2AA 3RVYA 3U2LA 2KNCA 3I56P 1K05A 2FXPA 1Y9BA 3CWBJ 1U89A 2BC5A 2PP6A 3C8ZA 5GTIE 2Q7RA 4P9FA 3JYHA 1PD0A 1CI6B 2CNWA 1QVGO 4CSAC 2KSFA 4JW1A 2JP3A 2D2CC 4C7NB 1VQNP 1WMKA 5KKZC 3JRTA 3Q6MA 2K1AA 1HW1A 4DJ9A 4EYYQ 2K9YA 5IY5C 1FDOA 3LIDA 2XLMA 3IR9A 1T6UA 1OX3A 4JIOA 2ZXRA 3DKAA 3KMIA 5CCGA 2Y39A 3A5TA 2R7WA 2WVNA 5JVEA 1L0ND 2QG4A 2QRXA 3NMJA 2LXCB
chains in the Genus database with same CATH topology
1LTIC 3VYIA 2H7HA 3L4FA 1OXZA 1B68A 3HD7C 1X9VA 3HE5A 1LTSC 1RF0A 2IX7C 1N7SB 5CCHC 5KTBA 1LE2A 1LTTC 3A7OA 2N1TC 3GHGC 5CJ4A 3CI9A 1T2KD 1N73C 1FZAA 2P7JA 5APSA 1KILC 4AYCA 1X79B 3RL0D 1KZUB 1XTCC 2CPSA 4WY4D 3SWFA 2HFED 2QM8A 4RESB 1J1DB 1T8ZA 1DH3A 2WTYA 1GW4A 1LTGC 5AW1B 4XA4A 1AQ5A 1JY2P 1LT9B 1GL2D 1MFZA 2KC3A 1FJPA 3HTKB 1CI6A 1SQVK 3HUSC 1N2DC 1HVVA 3B5NA 1LWUB 5BVZA 2OYIB 4C7NA 3HD7D 5KLVK 1FJKA 2W6BA 2FFDC 3HRNA 1LE4A 1A02J 1H7IA 2YKOA 1CZQA 4N78D 1LS4A 2C9LY 1RE4C 2JEEA 1NTZK 1T3JA 3R2PA 2N1TD 1FZGA 3LW5H 3HE4A 3M91A 1ZR4A 5APVA 4KHXA 4HH2A 1NKNA 1KILD 3RL0B 4IFFA 3P32A 4M3LA 1FU1A 2A45H 2WT7B 1W2EA 3EQ2A 3HE5B 2NPSD 1S9KE 2XNXA 2IPPA 1PFIA 1RY3A 3N4XA 3E1IA 1L4AC 2KP8A 1SFCD 2KOGA 4ZKPA 1GL2B 1SLQA 2Z5IA 5KJ7C 1LPEA 3BVHA 3OA7A 2IFNA 2C0XA 5AVXB 2P67A 5APXA 2XU6A 3HD7B 2VRSA 2ZXEB 3OAKA 4GIFA 3B8EB 1GW3A 2C9NY 2XV5A 2OYHB 1H89A 1YTZI 2Q3IA 1L0LK 2WSCH 1N73B 3MUDA 1KILB 4W7ZA 1XTGB 1SVFA 2M8RA 1NAFA 3H6PA 1JCCA 1SP4A 1JMMA 3HTKA 5BU5A 2NPSB 5AW9B 3VP8A 3RK3D 2I1KA 1FDMA 3RK2C 1Z56A 1LWUA 2OYIA 1URQC 1SFCB 1LGHB 2WWWA 5CCGC 1FOSF 1ZLLA 5CHXA 3H32B 1JY2O 4EIJA 4Y99C 1JY3P 1LTJB 3VMZA 1M1JA 5AVWB 3M0AA 3L37A 5AW5B 2R3CA 1NFOA 2O1JA 1N86A 2A45I 1NTKK 4OH8B 1OR3A 1IFMA 1NU1K 3UIAA 5APTA 3NTNA 4AQRD 1SQXK 2WT7A 1FZCA 1HUCA 5CJ0A 1RF0C 4WB4A 5AVUB 5AVTB 4N3YB 1H8AA 1IFNA 1GK4A 1ZR2A 1GL2A 1SQBK 3VMYA 1JUNA 2JJLA 1A02F 4GKGA 1IFDA 3WMM0 1G1IA 1NHLA 5AVVB 5APQA 1GU4A 1GZLA 2PAJA 3RK3B 1WRGA 3RK2D 3V2RA 4I1LA 3C9IA 3KDPB 1RE3C 1QL1A 3HD7A 3V4WA 3U59A 3MTUE 5AVRB 3SWYA 1HJBA 2M3BA 3M0DA 3KPEA 3NMDA 2N1TA 1H88A 1RF1B 3P8MC 2OYHA 2FYUK 1M7LA 1AFOA 3IFMA 1N73A 1HGZA 3KYQA 3MIWA 1NFNA 1E5WA 1KILA 4JYCA 4I6MC 3U1AA 1YTZT 3B5NC 1JO5A 1HH0A 1SQPK 2N9BA 2NPSA 4N6JA 3VP9A 4IFDK 2WPQA 2HPCB 2H8PD 2OARA 5CCHD 5AVQB 1M1JB 1SFCA 3H32A 1J2JB 3M06A 2Q5UA 1LTJA 1NKZB 3RK2B 4WY4B 5CMZA 3MD0A 5APUA 1NWQA 1FZCB 2LKMA 1JOCA 2QM7A 3NXSA 1JY3N 2O1KA 4W80A 1WT6A 1YYCA 2R5DA 2J58A 5AW6B 5BU8B 1JY3O 3P8CD 2GM4A 1DEBA 3L35A 2BASA 1HGVA 1N7SC 2A45G 2W27A 1DX7A 1OWAA 1VPCA 2CPBA 3V2NA 5AW3B 1G1JA 4JYBA 3V2PA 1IFIA 5APWA 1LTBC 3A3YB 1CSBA 2N1TB 3GHGB 1J1DC 2WSFH 2YO3A 2ZFCA 1MZ9A 2XDJA 1J1EC 1LT9C 4N78E 3T97A 1RF1A 2GUSA 3CLQA 2WITA 3BATA 1CW5A 1FZEA 3VTPC 3BRVB 1JY2N 3L36A 1LWUC 2R5BA 2OYIC 2IFMA 1L4AD 2I1JA 3EFGA 3I5CA 2HPCA 1MUUA 5KJ7D 1IC2A 3HUSB 1N7SD 4HYTB 3V5BA 1JTHB 3G3ZA 4LC1A 1ZN5A 3OJAB 1EA8A 2FFDB 1JCDA 1JNMA 4GT1A 1L0NK 4WY4A 3PP5A 1KQLA 4C46A 2WZ7A 1HWTC 1EQ7A 2WPSA 2YMYA 3BRTB 2L5GB 2YNYA 1HBWA 5AW4B 2FYZA 1GU5A 1GTWA 1GL2C 3N7NA 1AEPA 1BZ4A 3II6A 1FZBA 5AVZB 1N7LA 4IFMA 1FZFA 1L4AB 1URQD 2P1JA 2HYNA 5AVYB 5CCGD 4XE5B 2HODB 2YKPA 3M0DC 3TNUB 5CCHA 1IO4A 3GHGA 2OYHC 2FKWB 3V4QA 4O9BA 2HG5D 2KSJA 2YKQA 1FAVA 1S9KD 2E43A 5AW0B 3TSIA 4LLHA 1NO4A 1KFMA 2Z4EA 1RE3A 2NPSC 3M9BA 1G2CB 1LTAC 2POHA 2J59M 1GD2E 1IK9A 1SFCC 4B86A 3CL3D 3VN0A 1J1EB 1NTMK 1GDTA 2FXMA 3HUSA 2MJZA 1EQ1A 1LTJC 2E42A 1VDFA 3BASA 1JTHA 1YA9A 2P2UA 4DZOA 1URQB 3NFQA 2Q7CA 4ZKUA 2FFDA 4EOTA 1HTLC 3P7KA 1GS9A 4Y99B 3TYYA 1ZV8A 2C0WA 5APYA 1RE4A 3TK1A 2KYVA 1MV8A 2O01H 3B5ND 1QL2A 2GUVA 3MGNA 2H43A 5AW8B 3RK3C 5AVSB 1FOSE 2W6AA 2XKMA 4LGDE 3M9HA 2R32A 1L4AA 1GK6A 2HLOA 4JF7A 5KJ7A 3S84A 2HODA 5AW7B 1N7SA 3TNUA 1KFNA 3VOPA 1RF1C 3A2AA 4DOJA 1IJDB 3LIEA 3V2QA 2XZRA 1FBMA 2Q9IA 3KQGA 1NOHA 2PP6A 1G2CA 1CI6B 3VMXA 4WBAA 1OR2A 1M1JC 4AUWA 1LT9A 3B5NB 2WPRA 1T2KC 4C7NB 3P8CE 2WSEH 1NH4A 3RL0C 1SQQK 2YO2A 4WY4C 3LIDA 3U1CA 2KLVA 1X8YA 3IR9A 3M9QA 4W7YA 4C7RA 1FZCC 4I2LC 1URQA 3O8ZA 5CCGA 2Z5HA 3HE4B 3A5TA 1IFJA 2KB7P 5AW2B 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR2 A;  1GS9 A;  1LE4 A;  1H7I A;  1AEP A;  1NFO A;  1EA8 A;  3S84 A;  1LPE A;  1LS4 A;  1B68 A;  1OR3 A;  3R2P A;  1GW4 A;  2KC3 A;  1LE2 A;  1EQ1 A;  1YA9 A;  1NFN A;  1GW3 A;  1BZ4 A; 
#chains in the Genus database with same CATH topology
 2JWD A;  1O5H A;  2B0J A;  3VYI A;  2LQG A;  1OXZ A;  2ZJS E;  4PR9 A;  1B68 A;  1Q0M A;  1S7Z A;  3HD7 C;  3GF7 A;  2OTK E;  2MKV A;  3HE5 A;  2WSC J;  3L71 G;  3RBZ A;  1OCO C;  2YIU B;  1LE2 A;  3O6Q A;  3I5P A;  3A7O A;  5COF A;  1R5S A;  3EGD A;  2J9V A;  1FZA A;  2KNC B;  2YRF A;  4QI0 A;  2NZ2 A;  4J7Y A;  5APS A;  2XLW A;  4NCQ A;  4UDV A;  4Z9I A;  4PJM A;  3EJN A;  4UB8 H;  4O6N A;  3EH2 A;  2I8D A;  4OD5 A;  3H1K J;  2FY8 A;  2FYU J;  2V7Q H;  4RES B;  4LDK A;  1DH3 A;  3L70 J;  1ZP0 C;  2NUP A;  1M57 D;  3L34 A;  2J0W A;  4YK5 A;  1Q2N A;  3IF4 A;  4CX9 A;  2XLD A;  3VMA A;  3FGA D;  1L0N E;  1HVV A;  4FWV A;  4X0R A;  3ZQV A;  3B5N A;  4OWF A;  2OYO A;  1RCP A;  1ZHT A;  3L72 G;  1CPQ A;  3GG2 A;  2FFD C;  4LDQ A;  3UR3 C;  3U0C A;  1H7I A;  3NKE A;  4GOE A;  1GGQ A;  2C9L Y;  3HNJ A;  1D7M A;  3HE4 A;  5APV A;  2QIW A;  2Y3G A;  3L75 E;  4HKZ H;  2Y9Y A;  1KIL D;  2W83 C;  3G6E P;  1FU1 A;  4CJO A;  4MVZ A;  1KC8 Q;  3EQ2 A;  2GWW A;  3HE5 B;  3I5Q A;  4P6I C;  1I4Y A;  2DYR C;  1CGO A;  1SYQ A;  2EIK C;  2FBW C;  2QJK C;  1JPN A;  1Q90 D;  3E1I A;  1JMW A;  1TR2 A;  4KBL A;  4ZKP A;  1GL2 B;  4I7Z B;  2Z5I A;  1TWG A;  4OIN F;  2IFN A;  2M3E A;  2C0X A;  5DJU B;  5L0D A;  4JRZ A;  2WZF A;  2YEV A;  4XEV A;  2XU6 A;  1UFB A;  2B9B A;  3AG1 C;  5BQG A;  2IYP A;  3B8E B;  2P61 A;  3ZDM A;  1QSP A;  3JZ0 A;  4JZA A;  4BJ5 A;  1YTZ I;  2ASR A;  3CC7 P;  2JPU A;  1VF5 B;  1AV1 A;  2QJP C;  4AX2 A;  4KI2 A;  1KYO I;  1FE6 A;  4W7Z A;  1HMO A;  1Z5Z A;  2M8R A;  3CPW O;  1NAF A;  3NMI A;  2BEQ D;  1JCC A;  5BU5 A;  3CAX A;  3OA1 A;  4LER A;  2OU6 A;  3TQO A;  1EC5 A;  1FDM A;  3RK2 C;  5KAI H;  1LWU A;  4E17 A;  2E76 D;  3K66 A;  2OYI A;  4K35 A;  1URQ C;  1SFC B;  5COM A;  2EIM C;  2WWW A;  3Q7G A;  3WU2 E;  3LS1 A;  4WJ0 A;  5CHX A;  2DI3 A;  2WZL A;  4MW8 A;  4MVU A;  1L0N J;  3VMZ A;  3EZI A;  1M1J A;  2KLU A;  3M0A A;  3AEF C;  1QQ3 A;  1BCC D;  1QPU A;  5AW5 B;  5A6B A;  2PX3 A;  1NSG B;  4PJL A;  3EFF K;  1IFM A;  4UB8 E;  3UIA A;  2AXT H;  3KZI E;  2VCB A;  1JMB A;  4ZMD A;  4MTO A;  3L75 J;  1MMG A;  2HS5 A;  1GK4 A;  1ZR2 A;  2L6F A;  3O6X A;  2EIJ C;  4ZLC A;  3VMY A;  1A02 F;  3TJ5 A;  1GU4 A;  5APQ A;  3AEA C;  2C04 A;  2R7O A;  3PH0 A;  1KV4 A;  3C9I A;  1SQB D;  1BGY G;  2E5T A;  3U59 A;  3G4S P;  5AVR B;  1C17 M;  3SWY A;  3C62 A;  1EZV D;  3UNG C;  1PP9 E;  3M0D A;  2IBZ I;  2KYH A;  1M2V A;  3L8J A;  1PPJ D;  2FYU K;  5T3T A;  1N73 A;  1FMW A;  2ZYG A;  3MIW A;  3R7C A;  1NFN A;  1KIL A;  3EGX A;  4U9D A;  4KJM A;  3U1A A;  4U7J A;  1R4T A;  1OW8 A;  1MFT A;  2HR3 A;  3S1K A;  1HH0 A;  4K0D A;  3PMR A;  4IL6 H;  2R7U A;  2J9U A;  4IFD K;  2HPC B;  5EK0 A;  4OIR F;  4HFK B;  1M1J B;  1WAS A;  4C7O A;  4BXL A;  2KNH A;  3H32 A;  1YVI A;  1EDI A;  3HKK A;  2JO1 A;  3ASO C;  1LTJ A;  3S28 A;  3VF0 A;  2BEZ F;  1NTZ D;  5CMZ A;  3MD0 A;  1KTM A;  2EPM X;  2OQM A;  3SEO A;  1JOC A;  3NXS A;  4NPE A;  1M1K Q;  256B A;  2R5D A;  2IBZ E;  2Y3H A;  2GM4 A;  3P8C D;  1SQQ G;  3EFO A;  1DEB A;  3K1I A;  2GAQ A;  4EHP A;  3MYI A;  2CYD A;  3G9R A;  2YIU C;  1V55 C;  1TWA A;  3UGP A;  3CXH I;  3AG3 C;  3FWL A;  3H25 A;  1G1J A;  2V7Q J;  3FOO A;  1G5Z A;  3GWL A;  1PPJ E;  3GWN A;  3KYI A;  2Q9C A;  5KAI E;  3C7J A;  1YIJ P;  3H1L G;  3PDM P;  1WTY A;  4NQF A;  1Y6D A;  1SQV E;  2JWA A;  3ABK C;  1MZ9 A;  3MBG A;  1IK7 A;  2ZXX A;  5JSL A;  1ZOY C;  2F22 A;  4WWI A;  3SXY A;  4YJW A;  4IJJ A;  1D1A A;  1MQV A;  4GOF A;  3FX0 A;  1M8O B;  1PGP A;  2AXT E;  3L36 A;  3WUT A;  2JX0 A;  4Z1M H;  2G3K A;  5E3C A;  2IFM A;  1U57 A;  3I5C A;  4U5B E;  1A41 A;  2IDB A;  3HUS B;  1H0T B;  1N7S D;  1RH5 B;  4HYT B;  5EFW B;  1ORS C;  3LS0 A;  3U8V A;  3CXH E;  4CSA A;  4PK4 A;  1ZN5 A;  1S3J A;  1EA8 A;  2KS1 A;  5KYU A;  4MN4 C;  1BCC J;  3ABV C;  2I15 A;  2J9W A;  3E9V A;  3ZQY A;  3TOM A;  4GT1 A;  1L0N K;  5JT4 A;  3AE8 C;  4AL0 A;  3W8I A;  1HWT C;  3QVY A;  1P84 H;  2QY9 A;  1NTK D;  4RD9 A;  1SQX D;  3FHD A;  1DEE G;  1GL2 C;  1YJN P;  4I7Z C;  2KZI A;  3GF3 A;  5EHH A;  3ASN C;  3II6 A;  1FR0 A;  4E0I A;  1N7L A;  3K33 A;  1CGM E;  1EXJ A;  2E76 B;  1FZF A;  4CDV A;  3ITK A;  5B1B C;  4IL6 E;  3JCU H;  1S4X A;  1URQ D;  1L0L E;  1VQ4 P;  2HYN A;  4F4B A;  3ATP A;  3RK3 E;  1VMA A;  4FAP B;  2HOD B;  3ITF A;  4XLP F;  3J06 A;  1AUE A;  1LP1 A;  4G0H A;  4NTF A;  5KAF E;  2L6G A;  2YKQ A;  1S9K D;  3CMA P;  3O55 A;  2PRR A;  2L9J A;  4LLH A;  2Z4E A;  3M9B A;  1SQV J;  5L0I A;  3AQB A;  1IK9 A;  1BDD A;  1RQV A;  1SFC C;  1KMI Z;  1SQP D;  3VN0 A;  2G62 A;  2XL4 A;  1GDT A;  1USE A;  1VQ8 P;  3SYN A;  1ZU5 A;  3BAS A;  1NU1 E;  3US6 A;  3L73 E;  1E85 A;  4BEJ A;  1NTZ J;  2L91 A;  1VQ7 P;  1IW7 F;  3WUV A;  3IQC A;  2FFD A;  2J45 A;  4EOT A;  2SPZ A;  5L0J A;  3P7K A;  3W68 A;  5KLI B;  3TYY A;  2K9J A;  1ZV8 A;  1P84 I;  1E83 A;  1VQP P;  2R7R A;  2EIN C;  1QLE D;  1BCC G;  3AE2 C;  3FXD A;  3FXE A;  2H89 C;  1NVO A;  2M0B A;  3CCS P;  1QL2 A;  1XWJ A;  1PCX A;  2DB4 A;  5AW8 B;  1BDJ B;  4AE4 B;  1TKN A;  3MFN A;  2XKM A;  2NRG A;  3A0H E;  2KIK A;  1R5L A;  3S84 A;  5AW7 B;  1YDI A;  1N7S A;  4JE9 A;  3S0X A;  2PFX A;  2Q6Q A;  4L6R A;  3V2Q A;  1L0L J;  2Q9I A;  4QDL A;  1OCC C;  1NOH A;  2HMQ A;  4R32 A;  4CS7 A;  4JC7 A;  1SQB G;  3PLN A;  1G2C A;  4PD4 I;  1EZV G;  1P84 E;  3EZH A;  2H88 C;  1TQG A;  3DMD A;  3L71 E;  4WBA A;  4U5E E;  1M1J C;  1LT9 A;  4ZNC A;  2IYO A;  2M5A B;  3MP7 B;  1RJ9 A;  4DVZ A;  3EHM A;  1TFK B;  4JTD B;  2K9J B;  3U1C A;  1K04 A;  4I2L C;  1URQ A;  1GQA A;  3CX5 H;  3O8Z A;  2BCC D;  2M4E A;  1DIP A;  1IFJ A;  2KB7 P;  3QWO C;  1M57 C;  1NTK J;  2V26 A;  1NU1 J;  1SQX J;  1MND A;  5E33 A;  3L73 J;  4AK9 A;  1T6I A;  2N9Y B;  5COG A;  1LTI C;  1E84 A;  3E1R A;  2L6H A;  5B3I A;  3CCQ P;  2WQY C;  1NTZ G;  1VOM A;  1I4Z A;  4PV1 B;  4PD4 E;  2IX7 C;  2WPV B;  3L72 E;  1S5L H;  1N7S B;  4I1O B;  4JKV A;  1LTT C;  1Q0K A;  4O6Y A;  1X22 A;  2QNL A;  3CI9 A;  4JEB A;  1T2K D;  1N73 C;  2X0C A;  1KIL C;  1XTC C;  4Q4Z F;  2R02 A;  3M4B A;  2QLA A;  2CPS A;  3AE5 C;  4WY4 D;  2D5R B;  3SWF A;  4BJ6 C;  1OVV A;  5B1A C;  3ZDL A;  4NTA A;  4H44 B;  1OCZ C;  2QUP A;  3CCV P;  1LTG C;  2KXP B;  2XLH A;  5AW1 B;  1AQ5 A;  1JY2 P;  1LT9 B;  1SQP J;  2NSG A;  1GL2 D;  1YHQ P;  4XPW A;  2G8Y A;  1CI6 A;  1S1C X;  1SQV K;  3HUS C;  2IXM A;  2RMZ A;  3CD6 P;  1YZC A;  3AEB C;  4EBB A;  3F46 A;  3CX5 D;  3DE9 A;  1NTM D;  4C7N A;  4IAQ A;  4YXD C;  2QEX P;  2W6B A;  3HRN A;  2Q9A A;  3CME P;  1LE4 A;  1Z3I X;  3L71 J;  1A02 J;  5DQT A;  1BE3 D;  5H2F H;  1LS4 A;  4J30 B;  4PFP A;  1FS0 E;  1NTZ K;  2N1T D;  5KLV D;  1ZR4 A;  4DXW A;  1VF5 D;  2P58 A;  4A7P A;  1WWP A;  4BJT A;  3RL0 B;  1EDK A;  2J9B A;  3M15 A;  3PCV A;  4XLN F;  3JYY A;  2WT7 B;  1Z7Q c;  3H2V A;  2R44 A;  1GM5 A;  3C8G B;  3FOP A;  4D6T G;  1LI7 A;  2XNX A;  5CI9 A;  1VLT A;  2IPP A;  2E76 C;  1PFI A;  3N4X A;  4NPF X;  4PJJ A;  3TK0 A;  1SFC D;  1NTK G;  4HFF B;  1SQX G;  2IZ1 A;  1WOL A;  3HNL A;  2QSI A;  3ZVR A;  4YWQ A;  1CPR A;  2VRS A;  4DOZ A;  1HJ0 A;  4OVN F;  1VL2 A;  3L72 J;  3OAK A;  3ZTM A;  4E7S A;  5L8R J;  2WB7 A;  3CX5 E;  2XL6 A;  3TDK A;  3DAF A;  2OYH B;  4XPY A;  1H89 A;  2Q3I A;  3PJS K;  1L0L K;  3ZWI A;  3NYM A;  4J7T A;  5K5G B;  4BJ1 A;  1SVF A;  2Y0D A;  3U5S A;  1SP4 A;  3K5B A;  1HE9 A;  3GM1 A;  4K1O A;  2NPS B;  5AW9 B;  2I1K A;  3POV A;  1VQM P;  2R7Q A;  1S5L E;  4MVM A;  4YL3 A;  1BGY E;  1SQQ D;  1SQP G;  3GW6 A;  5DLJ A;  4EWC A;  2YVK A;  2R3S A;  3TUL A;  4GEH A;  3AE7 C;  1NFO A;  2IXO A;  5A6J A;  2O1J A;  2Y3D A;  4ASW A;  1N86 A;  3DD7 A;  1NTK K;  1KB9 H;  4U3F G;  1NU1 K;  1SQX K;  1ZRT D;  3H1L D;  3JSE O;  1HUC A;  3X2Q C;  1VYI A;  4C3D A;  5AGF A;  2PFD A;  4BG0 A;  1R5I D;  2IBF A;  1GL2 A;  1BSN A;  4GKG A;  3VM6 A;  3CZ6 A;  5AVV B;  5F5F A;  2JD3 A;  2LFD A;  4P9T A;  2X51 A;  3I4U A;  2XLO A;  3V2R A;  3PHL A;  3N24 A;  3V4W A;  3GEH A;  2HMZ A;  5H2F E;  1H9G A;  3E70 C;  3T97 B;  2W4M A;  2N1T A;  1RF1 B;  2HFI A;  1AVO B;  3GLM A;  1AFO A;  1HGZ A;  1SQQ E;  1E5W A;  4JYC A;  3G4X A;  2YLD A;  1JO5 A;  1RXQ A;  2LXB A;  1Q81 Q;  1SQP K;  1NBB A;  2UUI A;  1NTM J;  2HSQ A;  1Y4C A;  4C3E A;  2ICW G;  2YLI A;  2V3C C;  2A6E F;  3NG1 A;  5AVQ B;  3X1O A;  1SFC A;  4CJG A;  3H1L E;  2FGY A;  1J2J B;  1KB9 D;  2Q5U A;  3CCJ P;  4H13 B;  3H2U A;  5EGY A;  2MWQ A;  1YJ9 P;  4WY4 B;  1T6Q A;  5APU A;  4E7Z A;  2V4H A;  4K7B A;  2LD6 A;  2QM7 A;  1XZP A;  5AC5 A;  3ZSU A;  4W80 A;  1ZME C;  1BGY J;  2R03 A;  2ZXO A;  2BCC G;  4PV1 C;  5BU8 B;  1U6H A;  1ZW2 A;  1JY3 O;  5L0G A;  3L35 A;  1PGQ A;  4CIP A;  3ABL C;  1N7S C;  1VQ6 P;  3NKD A;  2E74 B;  1VPC A;  2XM4 A;  2A69 F;  3Q1M A;  1OCR C;  2XL8 A;  2A06 D;  1YYX A;  1NU9 C;  4PJN A;  2OOC A;  3AG2 C;  1K9M Q;  3JSZ A;  3K6B A;  1IFI A;  4OD4 A;  2HZ8 A;  1MMD A;  3IN6 A;  2IZ0 A;  1T6A A;  3RQF A;  3ZG1 A;  4XFJ A;  3B0P A;  2N1T B;  2WSF H;  4H44 C;  3TGU D;  1LS1 A;  1KOR A;  5DJT B;  3MUD C;  4HEA J;  3W8H A;  1LT9 C;  2R7V A;  5KYX B;  2ZVO B;  3GMA A;  2WIT A;  3VTP C;  3BRV B;  1KB9 E;  4MTF A;  2AEM A;  1YZA A;  1YA7 O;  3AQC A;  1KIL E;  4W8K A;  3W67 A;  1C02 A;  1KYO D;  1CGN A;  3BCC D;  5KYN A;  2J0X A;  2HPC A;  1SQQ J;  2A68 F;  3SP1 A;  3G3Z A;  3KKB A;  1NAY A;  2CCY A;  2HV6 A;  5TIS H;  1HF9 A;  1OXB A;  2Q3E A;  5L0H A;  1VTM P;  3V7O A;  2WMM A;  4DT0 A;  2PBE A;  1NTM G;  4YPC A;  4EDF A;  1KQL A;  2DGJ A;  2OG2 A;  4C46 A;  4DVY P;  1D0Y A;  3H1L J;  2WPS A;  1VB5 A;  4CBE A;  1BE3 G;  3BRT B;  5TJH A;  4BRY B;  2L5G B;  2YNY A;  4OIO F;  5KLV G;  5BUO A;  1QX8 A;  3LJB A;  3U3F A;  3SWK A;  1OW6 A;  2YL7 A;  5FZT A;  3VYW A;  2LK4 A;  3EG9 B;  2I8B A;  2TMV P;  3QVZ A;  2OTJ P;  3L0I A;  2B88 A;  2XS1 A;  4NPD A;  3ECS A;  1Q7Y Q;  1ZW0 A;  1H9T A;  3DI5 A;  2FFH A;  3AEC C;  1NGM B;  2A1D D;  2OYH C;  5DVW A;  2FKW B;  1HE1 A;  2KSJ A;  3MHV A;  4Y28 J;  3WAQ A;  3TSI A;  1QLE C;  2NG1 A;  4BWN A;  5L0F A;  1YQ3 C;  4BJ6 A;  1BCC E;  1ZHX A;  2NPS C;  1K40 A;  2QE9 A;  2HSB A;  3H1I D;  4B86 A;  3B9Q A;  1J1E B;  3H1H D;  1NTM K;  4FX5 A;  3HUS A;  2MJZ A;  1H0T A;  3GEI A;  1VDF A;  2YL0 A;  1YA9 A;  2P2U A;  1UII A;  3DE8 A;  4DZO A;  3NFQ A;  4ZKU A;  1OKK D;  5D91 A;  3RYL A;  2R7X A;  1Q0F A;  1OW7 A;  5GTH H;  2C0W A;  1SQB E;  4L76 A;  3PRJ A;  3ZC4 A;  3AED C;  2OJQ A;  3DM9 B;  5DS6 A;  1EZV E;  2JR8 A;  2O01 H;  4ANJ A;  5FCL A;  2GUV A;  2P7V A;  4IWB A;  3SNH A;  2H43 A;  5B3S C;  4LDR A;  4XWJ A;  2AU5 A;  2R32 A;  2CGE A;  2VCA A;  2YQY A;  2HOD A;  2YXQ B;  2XXA A;  3SSU A;  5TIS E;  1RF1 C;  4DOJ A;  4YTP C;  1VQ5 P;  1VLS A;  3LIE A;  2CK3 H;  2XZR A;  1FBM A;  3OWT A;  3AGT A;  1FMV A;  3A0B H;  1LM3 B;  3A9C A;  5E79 H;  2EPO A;  1NTZ E;  3UMK A;  4UB6 H;  3BCC J;  4PV1 D;  4GYT A;  4HB1 A;  2KK7 A;  3VMX A;  1OR2 A;  2B89 A;  4AUW A;  1W2B O;  1BSH A;  1BR2 A;  1Y47 A;  2WPR A;  1T2K C;  4KC9 A;  2KSE A;  3P8C E;  1SQQ K;  3EH1 A;  4WY4 C;  5CIV A;  4D6T D;  2ZAE B;  2KLV A;  1X8Y A;  4C7R A;  1HMD A;  4L73 A;  2Q4F A;  3JRM O;  4PAC A;  4G7O F;  2PGD A;  4H44 D;  3D6Z A;  1V74 B;  3Q5S A;  5HV9 A;  5AW2 B;  1T3U A;  2LFF A;  2BL2 A;  2RN0 A;  3F5H A;  2H7H A;  3SXZ A;  3L4F A;  2E74 C;  2YKZ A;  3QH9 A;  1DOW A;  1FTS A;  2H8A A;  1SQB J;  2WSF J;  4O7G A;  1X9V A;  4BEM J;  4H54 A;  4AE4 A;  3RKO F;  1A7V A;  2XXA B;  5KTB A;  5CCH C;  1G8X A;  2OQQ A;  4W8P A;  5GPG B;  3UGO A;  2N1T C;  2K37 A;  1VK5 A;  1VF5 C;  2P7J A;  2Y9Z A;  3RF3 A;  1E79 H;  4AYC A;  3FVY A;  2A06 G;  3RL0 D;  4GQH A;  3T9O A;  1PGO A;  1OMI A;  3JCU Q;  3HNI A;  1KQG B;  2QM8 A;  1OKK A;  3AE1 C;  1C03 A;  3N2Z B;  4NC3 A;  3C8G D;  1R8E A;  4U5D E;  1USD A;  1H6G A;  4IGG A;  2WTY A;  1GW4 A;  1L3P A;  5GTH E;  4H0L B;  4MND A;  4D6T E;  1OVR A;  4IOI H;  3TGU G;  2CW0 F;  2VCC A;  3H1H J;  3JSV C;  2KC3 A;  1A7E A;  2O9X A;  1FJP A;  4XQ1 A;  4EUK B;  3AE3 C;  2GA1 A;  3HTK B;  1N2D C;  1NTK E;  2R25 A;  2H7B A;  3AJM A;  1SQX E;  5BVZ A;  2CDQ A;  4U3F D;  2OEV A;  2M5A A;  2XM0 A;  1FJK A;  2A0B A;  3WUU A;  3HLZ A;  3BCC G;  1CZQ A;  4A4A A;  4N78 D;  1MMA A;  3IQ6 A;  3CCL P;  4XEF A;  2JEE A;  4RJT A;  3R2P A;  2A6H F;  3M91 A;  2D2C B;  1QGK B;  4J32 B;  3SZR A;  4HH2 A;  1AJY A;  2W4B A;  3L74 D;  3P32 A;  2LP4 A;  1W2E A;  3DJU B;  2NPS D;  1S9K E;  3LLK A;  1V54 C;  3HJC A;  2IM8 A;  1T5O A;  1TWH A;  4PFO A;  4OGQ B;  3RQG A;  1RY3 A;  1LKX A;  3R4Y A;  1Y8A A;  2FYN B;  2C03 A;  2ZXP A;  3EWK A;  2NUT B;  5KJ7 C;  1LPE A;  3BVH A;  3OA7 A;  4JTC B;  1PIX A;  2R05 A;  5AVX B;  1EXI A;  4I44 A;  5AC4 A;  1NU7 D;  1SQP E;  5APX A;  2WSS H;  4XEK A;  3HD7 B;  3L1M A;  4KNV A;  3SFD C;  4U5C E;  3TJ6 A;  1JM0 A;  3EQL F;  1GW3 A;  2Y0E A;  3H1J D;  2C9N Y;  2YL1 A;  4U3F E;  3FAJ A;  3IHU A;  4DRI B;  1U0B B;  3DJN B;  2WSC H;  2XLE A;  3MUD A;  1VQ9 P;  4IAR A;  1XTG B;  3U9J A;  3VRC A;  3H6P A;  4ONS A;  3FAP B;  5JS5 A;  3OEO A;  4WVZ A;  2K3R A;  4G7H F;  2L81 A;  1Z56 A;  2K88 A;  3JCU E;  1NG1 A;  4D6T J;  2B0H A;  3RFY A;  1LGH B;  3H65 A;  1OFC X;  1FOS F;  1ZLL A;  3MYF A;  3H1I G;  4JJF A;  3H1H G;  1QKR A;  5AVW B;  2YWA A;  3CCE P;  3L37 A;  2R3C A;  4H4K C;  4YXW H;  2W8Z A;  2HJ3 A;  4OH8 B;  1OR3 A;  5APT A;  2IXP A;  3NTN A;  4AQR D;  2WT7 A;  4CPG A;  1FZC A;  3U8P A;  2ZXW C;  1RF0 C;  3C8G A;  5AVU B;  5BQH A;  4E18 A;  4R4M A;  1ORJ A;  1IFN A;  2P0N A;  2XSE A;  1TWC A;  3B0V C;  2EPN A;  4E0H A;  2GDC A;  1IFP A;  1SQB K;  1JUN A;  2GA0 A;  3WMM 0;  1KD1 Q;  1G1I A;  1NHL A;  1GZL A;  2PAJ A;  3RK3 B;  4H13 D;  1I5N A;  1AVY A;  3UMI A;  2YHS A;  1FC2 C;  1QL1 A;  1NJI Q;  5JUA A;  5A6A A;  1G4U S;  3DXJ F;  3MTU E;  3NRH A;  5M1B A;  1HJB A;  3BRJ A;  1OQC A;  2M3B A;  3KPE A;  3NMD A;  3O39 A;  2OYH A;  2J46 A;  3AE4 C;  4MVS A;  2RD9 A;  1LT1 A;  2BCC E;  3RW0 A;  3KYQ A;  3RL0 g;  2E74 D;  4I6M C;  4D4N A;  2IYL D;  4U3F J;  3H1K D;  2FYU D;  2DW3 A;  2NPS A;  1OZH A;  3L70 D;  1Q82 Q;  3CX5 I;  5L3V A;  5CCH D;  3QZC A;  5KYW B;  2ITA A;  1YAR O;  4EI2 A;  2NSF A;  3LAY A;  5JRA A;  2YLG A;  1EKY A;  3M06 A;  3B0U X;  3RVZ A;  3RK2 B;  1OVU A;  5K0I A;  1FZC B;  3FXH A;  4YN0 B;  2O1K A;  3GM3 A;  3GEE A;  1WT6 A;  4WAB A;  5DS4 A;  1JPJ A;  1YYC A;  3CC4 P;  1FNT c;  4CDA A;  4RDA A;  2HV7 A;  1Z23 A;  5AW6 B;  5A69 A;  4YT2 A;  3OW2 O;  2P6V A;  2ZVN B;  1HGV A;  2A45 G;  1E86 A;  1DX7 A;  1OWA A;  5F28 E;  3V2N A;  2AXC A;  3VAY A;  2XLV A;  1YAU O;  1LI5 A;  1D1B A;  2W6J H;  1S05 A;  1LTB C;  3D71 A;  3O10 A;  2G3A A;  1NTM E;  5CBN A;  3A3Y B;  1CSB A;  3GHG B;  1QVF O;  3BEH A;  4FES A;  2QE7 H;  4MQ9 F;  4H0L C;  2XDJ A;  1BE3 E;  1WN0 A;  3T97 A;  3GM2 A;  3MLG A;  1RF1 A;  1AVO A;  2GUS A;  3RGU A;  1W2W A;  2H7O A;  5KLV E;  3HTK C;  4XTK A;  2B87 B;  1JR8 A;  1JY2 N;  3QW1 A;  3AG4 C;  4JCH A;  4N4W A;  3G71 P;  1LIH A;  2I1J A;  2E5Y A;  1YIT P;  2BCC J;  3EFG A;  3TF5 A;  1Q86 Q;  3AE6 C;  3A11 A;  2UUH A;  5KJ7 D;  5KLI C;  3AGU A;  1IC2 A;  2BE5 F;  1EDJ A;  1JAF A;  2PF4 E;  1JTH B;  4LC1 A;  3CCU P;  2J5U A;  3SXM A;  5B5E H;  1M6T A;  3FMS A;  4WGZ A;  4JVS A;  3LNM B;  3U2M A;  4WY4 A;  4LAC B;  3PP5 A;  2WVQ A;  2YMY A;  3KPH A;  1ZYR F;  4EKW A;  2ZT9 B;  4YL1 A;  4OGQ C;  4O79 A;  1FDI A;  2FYN C;  4JPZ B;  1GU5 A;  1GTW A;  2JKV A;  3N7N A;  1AEP A;  3L74 G;  3PTZ A;  1FZB A;  1KNY A;  5AVZ B;  1J8Y F;  2PP4 A;  4LLE A;  1L4A B;  4MVR A;  5E2Q A;  3I55 P;  5AVY B;  3EPV A;  2L7A A;  3LUT B;  3L75 D;  3WU2 H;  5CCH A;  1NLX A;  3TNU B;  3V6I A;  4U5F E;  3IAO A;  2M64 A;  4O9B A;  2HG5 D;  1M2O A;  4PJ0 H;  1FAV A;  5A6B D;  4QMA A;  1K73 Q;  5AW0 B;  3E7K A;  2RSE B;  5KYX A;  1RE3 A;  2AP3 A;  1LTA C;  2POH A;  2RH0 A;  3KZI H;  3MZW B;  1T9K A;  3H1J G;  4YL0 A;  3W4Y A;  1BE3 J;  4B6I A;  1ZW3 A;  3CL3 D;  1ZRT E;  2OKU A;  2OGU A;  1KYO H;  5KLV J;  1EQ1 A;  5BQI A;  2KW3 C;  3C8V A;  2HKV A;  3PHF 2;  2E75 B;  1KB9 I;  3CWB G;  5L3Q A;  2R7T A;  5T1D B;  1RQU A;  1GS9 A;  2LCH A;  2OEX A;  4Y99 B;  1YYJ A;  3SFE C;  5APY A;  2O3J A;  1YJW P;  3CCR P;  1D1C A;  2Q00 A;  4BRY A;  3V5Z A;  4CS9 A;  3TK1 A;  3NMK A;  1FFT C;  2KQ9 A;  1RKC A;  1MV8 A;  3M1C B;  1JB0 J;  1DD3 A;  4M63 A;  2J7P D;  3MGN A;  2J8W A;  3KYJ A;  3RK3 C;  3EG9 A;  5AVS B;  1FOS E;  2W6A A;  1Z63 A;  3O6Q B;  4LGD E;  3M9H A;  3M79 A;  3EGD B;  2H7V C;  4JF7 A;  5KJ7 A;  3M4C A;  4IL6 X;  2RKL A;  1BR1 A;  1U7M A;  3JC2 2;  3Q2Y A;  2DYS C;  1YI2 P;  1VQO P;  5B5E E;  1IJD B;  3KQG A;  1HY5 A;  1O87 A;  2NUP B;  1ZHZ A;  3T6J A;  3B4S A;  1D0Z A;  4JBZ A;  1YJG A;  3DM5 A;  2P1A A;  4N6H A;  2WZG A;  2QJY B;  3B5N B;  3KH2 A;  5B66 H;  1M56 C;  2XRH A;  1PL5 A;  1KU2 A;  2WSE H;  3S9O A;  1NYH A;  1NH4 A;  2FXO A;  2W45 A;  3RL0 C;  1L7C A;  3F47 A;  1PP9 D;  2YO2 A;  3W2V A;  3H1K G;  2FYU G;  4W7Y A;  3M9Q A;  1FZC C;  1MMN A;  3W2W A;  2A06 E;  5DS5 A;  3L70 G;  2Z5H A;  3HE4 B;  3TD7 A;  3CCM P;  4TLF A;  1RKE A;  4R4L A;  4H0L D;  3CSK A;  1E2X A;  4PJ0 E;  2NPU A;  3TGU E;  3ZIB A;  3S90 A;  4IRU A;  3V5Y A;  1LTS C;  1XZQ A;  1RF0 A;  2WVR A;  1A7D A;  4KNW A;  5DQZ A;  1PV3 A;  5JP7 A;  3KHU A;  2EPL X;  1KYO E;  3GHG C;  2ZPA A;  2ZD9 A;  2XS8 A;  3BCC E;  5CJ4 A;  1O3U A;  3CXH H;  1EZV I;  3Q7L A;  2D2C D;  1RHZ B;  1DOV A;  1X79 B;  1KZU B;  1LJ2 A;  4CS8 A;  3Q5R A;  2HFE D;  2IBZ D;  4IB4 A;  3GAN A;  1J1D B;  1T8Z A;  3F89 A;  5E3A A;  4OGQ D;  2AWY A;  3U3B A;  4CDY A;  4XA4 A;  3T6B A;  1MFZ A;  1X0T A;  2QA4 P;  1VYK A;  2LSE A;  4OIP F;  2R7S A;  4JUR I;  4Q5S F;  1LWU B;  1PGJ A;  2OYI B;  4ULV A;  2J7P A;  4DBQ A;  3HD7 D;  5KLV K;  1N8R Q;  1SQV D;  3K7D A;  1RKE B;  2YKO A;  5D92 A;  1RE4 C;  1KQF B;  2VAS A;  1T3J A;  2JDI H;  1FZG A;  3LW5 H;  2ZT9 C;  5KAF H;  4KHX A;  1NKN A;  1M90 Q;  4IFF A;  4M3L A;  2A45 H;  2OJE D;  4DBR A;  1G4W R;  4Z9H A;  5CI8 A;  4NY3 A;  2KJG A;  3IQT A;  1JRA A;  2PX0 A;  1UG7 A;  1L4A C;  2KP8 A;  3CXH D;  4DRH B;  1DD4 A;  2KOG A;  1SLQ A;  3TGU J;  1L0N G;  3IPM O;  2MHR A;  3H1I E;  3S27 A;  5B66 E;  3DZA A;  2P67 A;  1KN7 A;  1AQT A;  4WGY A;  3H1H E;  3RQE A;  4JJG A;  2KZJ A;  2MYS A;  1ORY A;  3GOR A;  4MTG A;  4YT4 A;  2ZXE B;  3U9M A;  4GIF A;  3HNK A;  3LES A;  2XV5 A;  4JQ0 D;  1M2V B;  3QTH A;  3L75 G;  1QEX A;  2HUJ A;  5KYY A;  1YLM A;  4EIY A;  1N73 B;  4GDO A;  1KIL B;  2W90 A;  3EGX B;  1SF8 A;  3NYJ A;  3FDQ A;  1ZZP A;  1JMM A;  1L0L D;  3HTK A;  4I1M A;  4H13 C;  3VP8 A;  3RK3 D;  1LVK A;  2YL3 A;  3G50 A;  1PP9 J;  1PZQ A;  4GOD A;  1FFH A;  2AWC A;  2E75 C;  1IZM A;  4C7O B;  2YXR B;  5CCG C;  4AL1 A;  1NZE A;  4D4X A;  3A0H H;  1T01 A;  3H32 B;  1JY2 O;  4EIJ A;  4Y99 C;  1WGW A;  2AEF A;  1JY3 P;  3V5X A;  1LTJ B;  5TJ5 E;  3CC2 P;  2Z15 A;  2IXN A;  4KT0 J;  2A45 I;  2UWJ E;  3SXK A;  3S4R A;  2EPK X;  1QVX A;  5CJ0 A;  2IOQ A;  3AOU A;  4WB4 A;  5AVT B;  3EFO B;  4N3Y B;  2ETS A;  1H8A A;  4O6M A;  1NU1 D;  3L73 D;  1LNQ A;  1JOG A;  2NUT A;  1N1C A;  2JJL A;  1M56 D;  1IFD A;  3LEV A;  4NTB A;  4EBJ A;  3FWN A;  1V4A A;  1AA0 A;  3MX3 A;  1WRG A;  3RK2 D;  4I1L A;  3KDP B;  1RE3 C;  4CIH A;  3HD7 A;  5KYY B;  1ZHW A;  3Q5P A;  2OTL P;  2KGO A;  3B29 A;  3CEX A;  3H1I J;  1TFO B;  4C3B A;  1H88 A;  3P8M C;  3S29 A;  2WSE J;  4MVO A;  1Q0D A;  3AE9 C;  1M7L A;  1FAP B;  3IFM A;  3USS A;  5CBO A;  4MVQ A;  4U9E A;  1YTZ T;  2QJY C;  3B5N C;  3IQ5 A;  2P10 A;  5A6K A;  4LLC A;  2N9B A;  4N6J A;  3VP9 A;  2WPQ A;  2GFH A;  2H8P D;  4PD4 H;  2PNO A;  2OAR A;  3LLI A;  4XPX A;  2G3V A;  2LIG A;  3ZTZ A;  1ZXG A;  2KS1 B;  4CS9 C;  5KYU B;  1WAT A;  5KKZ B;  5HSW A;  2WL8 A;  2Y3B A;  1NKZ B;  1HW2 A;  1S5L X;  1NWQ A;  2LKM A;  5T3W A;  1P84 D;  1PP9 G;  2W9Y A;  3A0B E;  1JY3 N;  2R9R B;  2YZS A;  3L71 D;  5E79 E;  1KQS O;  4UB6 E;  2J58 A;  2ZYD A;  1YQ4 C;  2BAS A;  5F5H A;  3AEE C;  4ZLD A;  2QVA A;  4MS2 A;  2W27 A;  4K3A A;  4ULW A;  2CPB A;  3N0T A;  1OIP A;  5AW3 B;  2Y69 C;  4ASV A;  1SZI A;  4JYB A;  3V2P A;  2AEJ A;  4RBN A;  4ER9 A;  4OIQ F;  5APW A;  3QW0 A;  1YBK A;  3NYL A;  5JLI A;  1BBH A;  3T6G B;  1LP1 B;  1J1D C;  2YO3 A;  2ZFC A;  3WHN A;  1IZN B;  3JTL O;  4BJ5 C;  2WVO A;  2ZT9 D;  2Q3T A;  3JT1 A;  4RO0 A;  1S72 P;  2QTV A;  2EIL C;  3DWW A;  1J1E C;  1PD1 A;  4N78 E;  3TOL A;  4N6C A;  1D0X A;  3CLQ A;  1ZU4 A;  3BAT A;  1CW5 A;  1FZE A;  3CWB D;  4PD4 D;  3L72 D;  3L74 E;  1LWU C;  2IBZ G;  1TU3 F;  2R5B A;  2OYI C;  1Q0G A;  1L4A D;  3LW5 J;  1A0B A;  4IAO A;  1QZX A;  1MUU A;  3UMH A;  3C63 A;  2AVK A;  2O01 J;  3V5B A;  5KYW A;  1PPJ G;  3T4R A;  2Q1K A;  4G78 A;  1VQL P;  3OJA B;  4RKU J;  3C18 A;  2FFD B;  2KK1 A;  2VB6 A;  1JCD A;  3D6Y A;  1JNM A;  3ABM C;  1APC A;  1SS1 A;  1SQV G;  4DCK A;  1SR2 A;  2WZ7 A;  1EQ7 A;  3KXD A;  5GTI H;  3Q3D A;  3NDB B;  2LR2 A;  1RMV A;  2YMK A;  1SMY F;  2CNW D;  1BDC A;  1HBW A;  5AW4 B;  2FYZ A;  3H1J E;  1BZ4 A;  5L0C A;  3B71 A;  3LEO A;  3IEE A;  4EBK A;  1BR4 A;  4CS8 C;  4IFM A;  2QJK B;  3D70 A;  4HJG H;  4JTA B;  2E75 D;  3L8I A;  5C39 A;  2P1J A;  5CCG D;  3QMK A;  4L75 A;  3CWB E;  4XE5 B;  2XND H;  2YKP A;  3M0D C;  1IO4 A;  3WG7 C;  3GHG A;  3K1H A;  3GOD A;  3V4Q A;  1Z6A A;  2E43 A;  4YT5 A;  4G7Z F;  1S2E A;  1ST6 A;  3Q6N A;  1K8A Q;  2HJM A;  1MNE A;  1NO4 A;  1KFM A;  4N06 A;  3G4Z A;  2O01 N;  1G2C B;  2B87 A;  1ZHY A;  4DJG A;  1GMJ A;  2QJP B;  2J59 M;  1GD2 E;  4TT3 H;  2Y0C A;  3WOD F;  3EHN A;  2FXM A;  1OXK A;  1J8M F;  1U7J A;  1RJ9 B;  4DRJ B;  1LTJ C;  3CQZ A;  2KI7 B;  2ZYA A;  2E42 A;  3L74 J;  4JEA A;  4U5G A;  1EI7 A;  2VH3 A;  1JTH A;  1L0L G;  4JCZ A;  2FAP B;  2OCC C;  1MKM A;  1URQ B;  2Q7C A;  4U5H A;  1UIX A;  4Z9J A;  1HTL C;  1W5C E;  1RE4 A;  4QI2 A;  4L74 A;  2KUB A;  2Q9B A;  3K1I C;  3RH3 A;  2A0U A;  3C1L A;  1F1M A;  3KL4 A;  1ZVZ A;  4YT8 A;  2KYV A;  1JEK A;  3B5N D;  2VC9 A;  4HE8 D;  2E87 A;  4A2N B;  3RBX A;  3DAG A;  1BGY D;  1VQK P;  4I3M A;  1L2P A;  2D4U A;  3LNR A;  1L4A A;  3H1J J;  1EDL A;  4BPM A;  3H1K E;  1GK6 A;  2FYU E;  2HLO A;  1NU1 G;  3L70 E;  3L73 G;  3TNU A;  1KFN A;  3VOP A;  4Q7C A;  3AEG C;  4MW3 A;  3RIP A;  3A2A A;  3RVY A;  3U2L A;  2KNC A;  3I56 P;  1K05 A;  2FXP A;  1Y9B A;  3CWB J;  1U89 A;  2BC5 A;  2PP6 A;  3C8Z A;  5GTI E;  2Q7R A;  4P9F A;  3JYH A;  1PD0 A;  1CI6 B;  2CNW A;  1QVG O;  4CSA C;  2KSF A;  4JW1 A;  2JP3 A;  2D2C C;  4C7N B;  1VQN P;  1WMK A;  5KKZ C;  3JRT A;  3Q6M A;  2K1A A;  1HW1 A;  4DJ9 A;  4EYY Q;  2K9Y A;  5IY5 C;  1FDO A;  3LID A;  2XLM A;  3IR9 A;  1T6U A;  1OX3 A;  4JIO A;  2ZXR A;  3DKA A;  3KMI A;  5CCG A;  2Y39 A;  3A5T A;  2R7W A;  2WVN A;  5JVE A;  1L0N D;  2QG4 A;  2QRX A;  3NMJ A;  2LXC B; 
#chains in the Genus database with same CATH homology
 1LTI C;  3VYI A;  2H7H A;  3L4F A;  1OXZ A;  1B68 A;  3HD7 C;  1X9V A;  3HE5 A;  1LTS C;  1RF0 A;  2IX7 C;  1N7S B;  5CCH C;  5KTB A;  1LE2 A;  1LTT C;  3A7O A;  2N1T C;  3GHG C;  5CJ4 A;  3CI9 A;  1T2K D;  1N73 C;  1FZA A;  2P7J A;  5APS A;  1KIL C;  4AYC A;  1X79 B;  3RL0 D;  1KZU B;  1XTC C;  2CPS A;  4WY4 D;  3SWF A;  2HFE D;  2QM8 A;  4RES B;  1J1D B;  1T8Z A;  1DH3 A;  2WTY A;  1GW4 A;  1LTG C;  5AW1 B;  4XA4 A;  1AQ5 A;  1JY2 P;  1LT9 B;  1GL2 D;  1MFZ A;  2KC3 A;  1FJP A;  3HTK B;  1CI6 A;  1SQV K;  3HUS C;  1N2D C;  1HVV A;  3B5N A;  1LWU B;  5BVZ A;  2OYI B;  4C7N A;  3HD7 D;  5KLV K;  1FJK A;  2W6B A;  2FFD C;  3HRN A;  1LE4 A;  1A02 J;  1H7I A;  2YKO A;  1CZQ A;  4N78 D;  1LS4 A;  2C9L Y;  1RE4 C;  2JEE A;  1NTZ K;  1T3J A;  3R2P A;  2N1T D;  1FZG A;  3LW5 H;  3HE4 A;  3M91 A;  1ZR4 A;  5APV A;  4KHX A;  4HH2 A;  1NKN A;  1KIL D;  3RL0 B;  4IFF A;  3P32 A;  4M3L A;  1FU1 A;  2A45 H;  2WT7 B;  1W2E A;  3EQ2 A;  3HE5 B;  2NPS D;  1S9K E;  2XNX A;  2IPP A;  1PFI A;  1RY3 A;  3N4X A;  3E1I A;  1L4A C;  2KP8 A;  1SFC D;  2KOG A;  4ZKP A;  1GL2 B;  1SLQ A;  2Z5I A;  5KJ7 C;  1LPE A;  3BVH A;  3OA7 A;  2IFN A;  2C0X A;  5AVX B;  2P67 A;  5APX A;  2XU6 A;  3HD7 B;  2VRS A;  2ZXE B;  3OAK A;  4GIF A;  3B8E B;  1GW3 A;  2C9N Y;  2XV5 A;  2OYH B;  1H89 A;  1YTZ I;  2Q3I A;  1L0L K;  2WSC H;  1N73 B;  3MUD A;  1KIL B;  4W7Z A;  1XTG B;  1SVF A;  2M8R A;  1NAF A;  3H6P A;  1JCC A;  1SP4 A;  1JMM A;  3HTK A;  5BU5 A;  2NPS B;  5AW9 B;  3VP8 A;  3RK3 D;  2I1K A;  1FDM A;  3RK2 C;  1Z56 A;  1LWU A;  2OYI A;  1URQ C;  1SFC B;  1LGH B;  2WWW A;  5CCG C;  1FOS F;  1ZLL A;  5CHX A;  3H32 B;  1JY2 O;  4EIJ A;  4Y99 C;  1JY3 P;  1LTJ B;  3VMZ A;  1M1J A;  5AVW B;  3M0A A;  3L37 A;  5AW5 B;  2R3C A;  1NFO A;  2O1J A;  1N86 A;  2A45 I;  1NTK K;  4OH8 B;  1OR3 A;  1IFM A;  1NU1 K;  3UIA A;  5APT A;  3NTN A;  4AQR D;  1SQX K;  2WT7 A;  1FZC A;  1HUC A;  5CJ0 A;  1RF0 C;  4WB4 A;  5AVU B;  5AVT B;  4N3Y B;  1H8A A;  1IFN A;  1GK4 A;  1ZR2 A;  1GL2 A;  1SQB K;  3VMY A;  1JUN A;  2JJL A;  1A02 F;  4GKG A;  1IFD A;  3WMM 0;  1G1I A;  1NHL A;  5AVV B;  5APQ A;  1GU4 A;  1GZL A;  2PAJ A;  3RK3 B;  1WRG A;  3RK2 D;  3V2R A;  4I1L A;  3C9I A;  3KDP B;  1RE3 C;  1QL1 A;  3HD7 A;  3V4W A;  3U59 A;  3MTU E;  5AVR B;  3SWY A;  1HJB A;  2M3B A;  3M0D A;  3KPE A;  3NMD A;  2N1T A;  1H88 A;  1RF1 B;  3P8M C;  2OYH A;  2FYU K;  1M7L A;  1AFO A;  3IFM A;  1N73 A;  1HGZ A;  3KYQ A;  3MIW A;  1NFN A;  1E5W A;  1KIL A;  4JYC A;  4I6M C;  3U1A A;  1YTZ T;  3B5N C;  1JO5 A;  1HH0 A;  1SQP K;  2N9B A;  2NPS A;  4N6J A;  3VP9 A;  4IFD K;  2WPQ A;  2HPC B;  2H8P D;  2OAR A;  5CCH D;  5AVQ B;  1M1J B;  1SFC A;  3H32 A;  1J2J B;  3M06 A;  2Q5U A;  1LTJ A;  1NKZ B;  3RK2 B;  4WY4 B;  5CMZ A;  3MD0 A;  5APU A;  1NWQ A;  1FZC B;  2LKM A;  1JOC A;  2QM7 A;  3NXS A;  1JY3 N;  2O1K A;  4W80 A;  1WT6 A;  1YYC A;  2R5D A;  2J58 A;  5AW6 B;  5BU8 B;  1JY3 O;  3P8C D;  2GM4 A;  1DEB A;  3L35 A;  2BAS A;  1HGV A;  1N7S C;  2A45 G;  2W27 A;  1DX7 A;  1OWA A;  1VPC A;  2CPB A;  3V2N A;  5AW3 B;  1G1J A;  4JYB A;  3V2P A;  1IFI A;  5APW A;  1LTB C;  3A3Y B;  1CSB A;  2N1T B;  3GHG B;  1J1D C;  2WSF H;  2YO3 A;  2ZFC A;  1MZ9 A;  2XDJ A;  1J1E C;  1LT9 C;  4N78 E;  3T97 A;  1RF1 A;  2GUS A;  3CLQ A;  2WIT A;  3BAT A;  1CW5 A;  1FZE A;  3VTP C;  3BRV B;  1JY2 N;  3L36 A;  1LWU C;  2R5B A;  2OYI C;  2IFM A;  1L4A D;  2I1J A;  3EFG A;  3I5C A;  2HPC A;  1MUU A;  5KJ7 D;  1IC2 A;  3HUS B;  1N7S D;  4HYT B;  3V5B A;  1JTH B;  3G3Z A;  4LC1 A;  1ZN5 A;  3OJA B;  1EA8 A;  2FFD B;  1JCD A;  1JNM A;  4GT1 A;  1L0N K;  4WY4 A;  3PP5 A;  1KQL A;  4C46 A;  2WZ7 A;  1HWT C;  1EQ7 A;  2WPS A;  2YMY A;  3BRT B;  2L5G B;  2YNY A;  1HBW A;  5AW4 B;  2FYZ A;  1GU5 A;  1GTW A;  1GL2 C;  3N7N A;  1AEP A;  1BZ4 A;  3II6 A;  1FZB A;  5AVZ B;  1N7L A;  4IFM A;  1FZF A;  1L4A B;  1URQ D;  2P1J A;  2HYN A;  5AVY B;  5CCG D;  4XE5 B;  2HOD B;  2YKP A;  3M0D C;  3TNU B;  5CCH A;  1IO4 A;  3GHG A;  2OYH C;  2FKW B;  3V4Q A;  4O9B A;  2HG5 D;  2KSJ A;  2YKQ A;  1FAV A;  1S9K D;  2E43 A;  5AW0 B;  3TSI A;  4LLH A;  1NO4 A;  1KFM A;  2Z4E A;  1RE3 A;  2NPS C;  3M9B A;  1G2C B;  1LTA C;  2POH A;  2J59 M;  1GD2 E;  1IK9 A;  1SFC C;  4B86 A;  3CL3 D;  3VN0 A;  1J1E B;  1NTM K;  1GDT A;  2FXM A;  3HUS A;  2MJZ A;  1EQ1 A;  1LTJ C;  2E42 A;  1VDF A;  3BAS A;  1JTH A;  1YA9 A;  2P2U A;  4DZO A;  1URQ B;  3NFQ A;  2Q7C A;  4ZKU A;  2FFD A;  4EOT A;  1HTL C;  3P7K A;  1GS9 A;  4Y99 B;  3TYY A;  1ZV8 A;  2C0W A;  5APY A;  1RE4 A;  3TK1 A;  2KYV A;  1MV8 A;  2O01 H;  3B5N D;  1QL2 A;  2GUV A;  3MGN A;  2H43 A;  5AW8 B;  3RK3 C;  5AVS B;  1FOS E;  2W6A A;  2XKM A;  4LGD E;  3M9H A;  2R32 A;  1L4A A;  1GK6 A;  2HLO A;  4JF7 A;  5KJ7 A;  3S84 A;  2HOD A;  5AW7 B;  1N7S A;  3TNU A;  1KFN A;  3VOP A;  1RF1 C;  3A2A A;  4DOJ A;  1IJD B;  3LIE A;  3V2Q A;  2XZR A;  1FBM A;  2Q9I A;  3KQG A;  1NOH A;  2PP6 A;  1G2C A;  1CI6 B;  3VMX A;  4WBA A;  1OR2 A;  1M1J C;  4AUW A;  1LT9 A;  3B5N B;  2WPR A;  1T2K C;  4C7N B;  3P8C E;  2WSE H;  1NH4 A;  3RL0 C;  1SQQ K;  2YO2 A;  4WY4 C;  3LID A;  3U1C A;  2KLV A;  1X8Y A;  3IR9 A;  3M9Q A;  4W7Y A;  4C7R A;  1FZC C;  4I2L C;  1URQ A;  3O8Z A;  5CCG A;  2Z5H A;  3HE4 B;  3A5T A;  1IFJ A;  2KB7 P;  5AW2 B;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...