3R2PA

2.2 angstrom crystal structure of c terminal truncated human apolipoprotein a-i reveals the assembly of hdl by dimerization.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
180
structure length
180
Chain Sequence
PPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Apolipoprotein A-I
publication title Crystal Structure of C-terminal Truncated Apolipoprotein A-I Reveals the Assembly of High Density Lipoprotein (HDL) by Dimerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.20 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3r2pA02
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 3r2pA01
1OR2A 1NFNA 1EA8A 1LS4A 1B68A 1GS9A 1YA9A 1H7IA 1LE2A 1GW3A 1OR3A 1AEPA 1EQ1A 1LE4A 1NFOA 3R2PA 1BZ4A 2KC3A 3S84A 1GW4A 1LPEA
chains in the Genus database with same CATH superfamily
4LDKA 1UIXA 5F5HA 5CCGD 2YZSA 1QLED 1KB9I 3ZC4A 3KYIA 2Y0CA 3M15A 4I44A 2ZXOA 1SQXG 2Y0EA 2QSIA 2MJZA 3HD7D 3EZHA 5M1BA 2JEEA 1HW1A 2A06E 1URQB 3CWBG 3VMYA 2WMMA 1FJKA 3VYWA 2ZYGA 3VMAA 3H1KD 1WN0A 2J0WA 3HNJA 2HUJA 1MZ9A 2YLDA 3CL3D 1ZR2A 1WT6A 1OR2A 3EFOB 1JPJA 1IFIA 2IZ0A 4RDAA 2QRXA 5DS6A 1NTKD 2DB4A 3HLZA 4G0HA 4Y99C 4IL6E 3K6BA 1KYOE 1X0TA 3KMIA 2QLAA 1SP4A 2K9JB 5E3AA 2NG1A 1QEXA 4ULWA 3LNMB 1N7SB 3UMHA 1EDJA 1OCRC 2P1AA 3V2QA 1NTKJ 1FJPA 2FFDC 4ASWA 1BBHA 2BL2A 5GPGB 4CX9A 2CPSA 4QMAA 1DH3A 2R25A 3M06A 1G4US 1FDIA 2XM4A 1T6UA 5JP7A 1NTZK 3U59A 3RQGA 3H1KE 1X79B 1S1CX 2N9YB 2E5TA 1KQFB 2E74B 4OD4A 3RH3A 4I1MA 4NCQA 1TWCA 3HE5B 3EQLF 3H1JD 4NPFX 2JX0A 4WGYA 2KLUA 3JCUQ 2G62A 1D1BA 1C03A 4GDOA 3W68A 1VYKA 3JYHA 1SQXK 2R7SA 1JEKA 2XU6A 1TKNA 2WQYC 3CCMP 5B1BC 3H1JJ 1FAPB 2AEFA 2LK4A 4LLEA 3AEDC 1PP9G 3HUSA 1T2KC 1EZVG 2I1KA 2WZGA 4OD5A 3USSA 3SP1A 3V2PA 1A7EA 1AUEA 3KYJA 1ZOYC 3TULA 1JMBA 5AVWB 1IZMA 3AG1C 4IAQA 4OIOF 1GU4A 2Q4FA 1V55C 4CDVA 3GM1A 4U3FG 4AL0A 4BEMJ 2YWAA 3HE4A 3Q1MA 3MP7B 2J9UA 2G3AA 2Q00A 3GEEA 5GTHH 1KZUB 3JCUH 1VQMP 5JSLA 4JCZA 3L75D 2WVQA 5CCGC 3S0XA 1OKKA 1QLEC 3SWYA 4CBEA 1NU7D 3H1ID 3RBZA 2HPCB 3H1LG 3HNLA 2QJYC 1HTLC 2IBZI 4Q7CA 5DS5A 4I3MA 2HLOA 2JWDA 3SEOA 3L8IA 4KBLA 4I1OB 1M90Q 1OR3A 4LDRA 3RL0B 1OMIA 1BE3G 2PX3A 1JY3O 1KORA 1H8AA 5KAFH 1VTMP 3L75J 2OYHB 2EILC 3AE1C 4IAOA 1K73Q 2WSEH 3W67A 2K37A 2P61A 4E0IA 3H1IJ 1JNMA 1NVOA 1N73B 5E79H 3V5YA 3DJNB 3TF5A 2GWWA 1I4YA 4JJGA 2XLDA 1EQ7A 5KLVE 2FFHA 3T97B 4BG0A 4JBZA 1RMVA 1OW6A 3RQFA 2KUBA 1M56C 1WWPA 4H13B 3EGXA 2M5AB 3S9OA 5A6AA 2JR8A 1T01A 1D0XA 2D5RB 2YL3A 1LM3B 4BJ6A 2FXMA 3H1IE 1A02J 2YKOA 4GEHA 4MNDA 3VP9A 3MHVA 1ZW0A 3H32B 1VOMA 4YK5A 1EDLA 1CW5A 1Y4CA 4H13D 3ATPA 2FYNC 2DI3A 1NTKK 2M0BA 3I5PA 1G2CA 1DEBA 2KGOA 1K8AQ 3T9OA 1G5ZA 3GEHA 4IGGA 4OIPF 1NJIQ 3GHGB 4BPMA 1IFJA 1E79H 1AJYA 2Y3GA 1XTGB 3B0PA 1T3UA 1LTAC 3VTPC 2XL4A 4KNVA 3ZVRA 2NZ2A 1V4AA 2MKVA 2M3EA 2Y3BA 4MW3A 4YN0B 3F5HA 4G78A 2L6FA 1JMWA 3LEVA 3JYYA 2VCBA 1JPNA 1TWHA 4XFJA 3DJUB 1Y9BA 1HMDA 3LW5J 2Y69C 1YA9A 3QW0A 2AXTH 3NYMA 2KYVA 2N1TA 1VDFA 4NPEA 3D70A 2G8YA 3FWNA 4Q5SF 1FDMA 2J9BA 3RK3B 1RJ9B 4O6YA 3I5QA 1SQPD 2WVRA 1YYXA 3CAXA 3V4WA 4EIJA 1NU1G 4BJ5C 1Q0DA 3M0AA 2P0NA 1FBMA 3C1LA 2OQMA 1PV3A 1VF5C 3MBGA 1T6AA 3L70G 5H2FE 2AVKA 2H43A 5DJUB 2L6GA 2HS5A 3RK3D 1SQPJ 3M9QA 2R7XA 1VL2A 2KIKA 1GL2A 4MTGA 1VB5A 3KYQA 3B5NB 5CI9A 1EC5A 1G1JA 2A45H 4O7GA 1A7VA 2YO3A 1QVFO 4AE4B 5KYXA 2M64A 2Q3EA 3NMJA 1FZBA 1YDIA 5E3CA 1W2BO 3CD6P 2HFIA 3DKAA 4DOZA 1OKKD 3RYLA 3GEIA 2KNCA 1K40A 2ZYDA 3TYYA 3JRMO 2ZXPA 1BSNA 4YT2A 3A3YB 2UUIA 2GA1A 4JRZA 1MNDA 3U1AA 1BR2A 1RXQA 1YI2P 5APSA 3SZRA 3PLNA 3SWKA 1LI5A 2UUHA 1OCCC 1ZHXA 3CPWO 1IO4A 3G3ZA 1WGWA 3B9QA 1RCPA 1XWJA 1LKXA 2KZJA 2EPMX 3G9RA 2FYUD 3FAJA 1ZXGA 2EIMC 1H0TB 3B29A 5KKZB 4PD4E 1NFOA 4EBJA 2XLMA 1VQ9P 3W8IA 2AXCA 4PJJA 1AVOB 1JY3P 3WUVA 4AYCA 4IL6H 1KYOH 4YT5A 4L76A 3WODF 1G4WR 3BRVB 3TOMA 1EDIA 3BCCJ 2FYUJ 1O3UA 2AP3A 4JTAB 4LDQA 1SQVG 2R7TA 4CS8A 1OXKA 1QZXA 4MVUA 1KD1Q 2LCHA 3TQOA 1XZQA 1ZVZA 2EIJC 2KJGA 1AQTA 5T1DB 2CCYA 2JD3A 5AW5B 2H8AA 1BR1A 4ONSA 2QIWA 1YITP 3Q5RA 1Q81Q 1FAVA 4WY4A 1M8OB 5KYYA 1LJ2A 3CXHI 4H44C 3RKOF 1LVKA 2OTKE 1VQ5P 2GDCA 4CDAA 2XLVA 4O6NA 4EBBA 1M1JA 2IBZG 1LNQA 2H7BA 1ZZPA 1DX7A 1BCCD 2Q6QA 4YL3A 3H1HJ 1Z3IX 4NQFA 3HKKA 3U3BA 1R5SA 4IFFA 2IZ1A 2N1TD 1KQSO 3I55P 5KAIE 2X0CA 1RE4C 3EQ2A 2LQGA 2OYIA 3D71A 5DQZA 1BDJB 3L72G 1BCCJ 1GZLA 3LAYA 1J8MF 3V5BA 3HUSC 3MLGA 4TLFA 1CGNA 5L0FA 3SXZA 3L37A 3BCCG 3O10A 4GOEA 4OVNF 4DJGA 1CPQA 1QSPA 1NHLA 3GG2A 3DAGA 1N8RQ 2WL8A 4N4WA 1EXJA 2B88A 4LGDE 1SQPK 2R3SA 1VPCA 2V7QJ 1BCCE 3L36A 1JTHB 1GTWA 1GL2D 1KU2A 1HE1A 3MZWB 3AOUA 3AEFC 1OW8A 3FGAD 3QZCA 3CCEP 5KYNA 1NZEA 3L34A 5AVRB 1YZCA 1IK9A 1VQ4P 1TU3F 1X9VA 3VMXA 4J7TA 3OW2O 1ZRTD 5BQGA 3K7DA 4JYBA 3H1HG 5A69A 4ANJA 1USEA 1GK6A 2NUTB 4HH2A 4EHPA 3MIWA 2YVKA 4PK4A 2A1DD 1M2VA 3K66A 3N2ZB 2KZIA 2WITA 3HD7A 2JO1A 1H88A 2A0BA 2Q3TA 4E0HA 4Y28J 4FAPB 3MD0A 4R4MA 1RKEB 2NSFA 1S9KE 4JZAA 3AEGC 2B87B 1FFHA 2ZPAA 2GAQA 2LFFA 3V5ZA 1X22A 4A2NB 3PHLA 1LWUB 2YRFA 4EYYQ 3S28A 3A7OA 3K1IA 3ZIBA 2ZJSE 4YWQA 3V7OA 4BJ6C 4IRUA 2KSFA 2E75B 1YBKA 1URQA 3H2VA 1N1CA 2N9BA 3E7KA 2OTJP 3NXSA 3UIAA 2XLOA 3WMM0 3IEEA 2ZXXA 1ZRTE 1K05A 5APXA 1E2XA 5DLJA 2KOGA 1KFNA 1RF0A 1ZN5A 2FYUK 1JB0J 3EFOA 4C7RA 1SMYF 2JPUA 3VF0A 2QE7H 4OIRF 2I15A 3CXHD 3F46A 2QG4A 1NU9C 2K9JA 2LIGA 4JF7A 1CZQA 5APYA 1N7SA 3CSKA 2WSFJ 3S1KA 1SQXD 2HJ3A 2BCCG 2FY8A 2NPUA 3O39A 3CWBD 3G4SP 3C8GB 1J1EB 3QVYA 4LERA 1LTGC 1Q86Q 4IL6X 2HODB 1ORYA 2E42A 2WSSH 2FBWC 5EHHA 5K5GB 1OX3A 1LPEA 3W8HA 2H89C 2YHSA 2L5GB 2P67A 2D4UA 2V4HA 1ZHTA 3DWWA 2XM0A 3AQBA 3C8GD 3DE8A 5TJ5E 1W5CE 3JT1A 3U8VA 3HE5A 1YLMA 1AEPA 4JQ0D 3LS0A 1X8YA 1L0LG 3SSUA 3DD7A 4KNWA 1GL2C 2SPZA 2W6BA 4H4KC 1GGQA 2LP4A 1SQXE 4L6RA 5H2FH 1FNTc 3WUUA 1S5LE 1FMWA 3CWBE 1Q0KA 1A41A 1D7MA 2ZT9B 5APQA 3AE8C 3LLKA 4CIHA 3ECSA 1P84E 1LE2A 5KTBA 4PV1B 2AU5A 2NUPB 1JCDA 2GFHA 4XLNF 4IARA 4NTBA 5B66E 1FZEA 2ZT9D 2L7AA 2HJMA 5CJ0A 2HMQA 3G4ZA 2QJYB 3CX5I 1NYHA 4RBNA 1FOSF 1UIIA 4PV1D 3CCSP 4U5GA 3KDPB 3MYFA 3HRNA 2HPCA 3OWTA 1PGOA 1BR4A 3DZAA 2IX7C 3EH2A 2OG2A 3NYJA 4LC1A 5L8RJ 2M4EA 1PP9D 2D2CB 3FDQA 1EZVD 5L3VA 3E1IA 3T6GB 4ZLDA 1B68A 2B0HA 3CCRP 4U5BE 1Q7YQ 3AE4C 3MYIA 2OYHA 1O87A 4JC7A 4U9EA 2IXOA 4PD4H 3ITFA 5BVZA 1N73A 3CMAP 5CMZA 1URQD 3Q3DA 3EG9B 4U3FD 1LTTC 2R7RA 4CS8C 3S4RA 3U8PA 3CQZA 2OU6A 2Y0DA 2HKVA 1KQLA 3T97A 2IXPA 1PP9J 1YYJA 4G7OF 2QNLA 3U1CA 2D2CD 2M5AA 2W4MA 2CW0F 3UR3C 1VQNP 4YL1A 4WY4C 3H1LD 1SFCB 2QJKC 3JRTA 4U3FJ 2WB7A 2VRSA 1BE3D 1N7SD 4YTPC 3U9JA 1BGYG 3H32A 3V4QA 2OEXA 5AVSB 2KS1B 2XNDH 1EZVE 3MGNA 1DD4A 2A06G 2A0UA 3QW1A 3H1LJ 1YTZI 1NTKE 4W8KA 5JS5A 3H6PA 3TK1A 3A0HE 1MKMA 3GHGA 3R7CA 2QVAA 2YKQA 4JE9A 2Z5IA 4Z9JA 1O5HA 1QVGO 1BE3J 2VASA 1L7CA 1DOVA 2E74D 2KK1A 5KAIH 2IOQA 3PDMP 4L74A 3FOOA 4JKVA 5EFWB 2O9XA 1AQ5A 5AVXB 1SR2A 4U7JA 4AQRD 1MNEA 1XZPA 4P9FA 3SFDC 3BATA 2WTYA 3FX0A 2R02A 1RJ9A 2J8WA 1E84A 1VF5B 4GQHA 2H7OA 1T3JA 4CJGA 3X2QC 5CCHD 1TQGA 3KPHA 3NTNA 1GW3A 3WG7C 3E1RA 4C7OB 4C7NB 2WSCH 5BU8B 3O6QB 3H1JE 4OWFA 1IFMA 1UFBA 4BRYB 2B0JA 2J7PA 3POVA 4EI2A 1TWAA 3L74J 4OH8B 1D0ZA 1KB9D 3KL4A 1OQCA 4XEFA 1JRAA 1YARO 3HD7C 3B5NA 3TGUG 2LSEA 2P58A 1M6TA 2KQ9A 1PGPA 4JURI 3W4YA 2IFMA 4OGQB 4N6CA 5E33A 2OARA 3IR9A 2OJQA 2R03A 4I6MC 4AE4A 3LJBA 3BEHA 4BXLA 3ASOC 2ASRA 3NKEA 2YNYA 2PFXA 3L4FA 3AG2C 1AV1A 2ZXRA 3U0CA 3CZ6A 1NU1D 2J46A 3K1IC 3H65A 2XLHA 2RH0A 3A9CA 2Q9CA 4HB1A 1SQBG 3L70D 3VM6A 2QJPB 3CEXA 3U9MA 1URQC 4DBRA 1ORSC 3ABMC 3LUTB 4QI2A 1E85A 1FZAA 3D6ZA 1PL5A 4MW8A 3SXYA 3RL0D 1FZGA 2Y9YA 3NG1A 3KHUA 1JY2O 3L75E 3CC4P 2YQYA 4YT8A 1RF0C 2IFNA 1NU1J 2Y9ZA 4BJ1A 1KB9E 5K0IA 2DGJA 1OXZA 1GW4A 3BRTB 4BEJA 1OW7A 1QKRA 3L70J 1H0TA 1NG1A 2DW3A 5TJHA 1CGOA 3L74G 2K1AA 3M0DA 1ORJA 4PFPA 1AVOA 4UB8E 4R4LA 4W7YA 2CK3H 2ZXWC 3PP5A 4JVSA 2RMZA 3F47A 1YJNP 2C9LY 3VAYA 1PD1A 1NU1E 1L2PA 1TFOB 4U5FE 2L81A 1M2OA 3AE7C 1DEEG 3TDKA 3L70E 2P6VA 1EA8A 3JZ0A 2QM8A 4JEAA 2FXPA 3PMRA 3SFEC 4H44B 3DE9A 3AJMA 1FE6A 5F5FA 1LTJC 3GF7A 2CPBA 3SXKA 1V74B 1YQ4C 1Y8AA 5KLVG 2XV5A 2E74C 2YMKA 1F1MA 2R7WA 2YL7A 1K9MQ 1L0NJ 2IPPA 1DD3A 2WZLA 3EHMA 256BA 1YVIA 4U9DA 3I5CA 3NMIA 1JO5A 5KYWB 2OQQA 2XLEA 3I4UA 1RF1B 2WSFH 4HYTB 2RN0A 1YHQP 5AW3B 4R32A 3ZG1A 3LS1A 1OIPA 2BE5F 5B3SC 1SQVD 4UB6E 3R4YA 4MVQA 4UDVA 3CMEP 5T3WA 5AVUB 2OYOA 2XS8A 2IDBA 4MTFA 3L73J 4WVZA 1LE4A 2YLIA 2ZAEB 2E43A 5COFA 4GT1A 4M3LA 4CS7A 1DIPA 3MX3A 1U57A 1S5LH 2H7HA 1Y6DA 1Z56A 1R4TA 1JY3N 2R9RB 1SQQJ 3M9HA 3DM5A 1SQVJ 3DMDA 4K0DA 3SXMA 1E83A 2IBZD 4EDFA 1C02A 4MVMA 2J7PD 1P84H 3AE3C 4MTOA 2YXQB 5KJ7D 4N78D 1KNYA 3QVZA 4NY3A 5T3TA 5COMA 3ZWIA 2O1JA 1ZMEC 4D6TG 1U7MA 1SQPE 1JTHA 5AW8B 2EINC 3B5ND 1IZNB 2L91A 2YIUB 1L0NG 1J1DB 4W80A 3WU2E 5B66H 2C0WA 1NGMB 4J32B 1MMDA 1AA0A 3IPMO 2C9NY 4I7ZB 3L72D 3OA1A 5APVA 2XLWA 1NH4A 2IYLD 4J30B 5APUA 4H0LB 2XRHA 4N3YB 5BUOA 2I8DA 3RK3E 1NLXA 1MMNA 3BCCD 2OYHC 1QL2A 4P9TA 2NUTA 5AW0B 3M4BA 5L0GA 5AW2B 2HV6A 1N73C 1QVXA 1ZHYA 3WUTA 1BZ4A 2IBZE 3L72J 3L73G 2OKUA 1YJ9P 1RKEA 4E18A 2NPSB 1JM0A 4EUKB 2B87A 1NU1K 4H13C 2R3CA 4H0LD 4N78E 1NO4A 2IXNA 5APWA 3V2NA 1SQQG 3PHF2 1LWUA 3B0VC 4NTFA 3HTKB 4OIQF 1EQ1A 1L4AB 3H1HD 1FZCB 1HUCA 4GODA 3L72E 3S84A 4U5EE 3LIEA 4YT4A 1KILB 1JY2P 4BJTA 1OWAA 4IJJA 3ZSUA 3BCCE 2FYUE 1SZIA 1PGQA 2E5YA 2JKVA 3M9BA 1HWTC 3GHGC 3OA7A 2OEVA 3FHDA 5GTIE 3CI9A 2VCAA 2MYSA 1L4AD 2OTLP 1N86A 2ZXEB 2XL8A 3A0HH 2ZVNB 1LI7A 3U2MA 1KILD 2FGYA 1TR2A 2G3VA 2HR3A 1CI6B 4MQ9F 4PACA 2A69F 2W45A 3EGDB 1MV8A 2B89A 1LT9B 5A6KA 2PFDA 3C8GA 4DXWA 3DI5A 1FFTC 1U7JA 3RK2B 4RD9A 5AVZB 1ZYRF 3PRJA 2HODA 4CIPA 3H1HE 2JDIH 1GU5A 3RK3C 5L0DA 2A45I 3TK0A 1FU1A 5A6JA 1RQUA 4YXDC 2YO2A 1CSBA 1BDDA 2PGDA 3MTUE 1A02F 3TNUB 3NYLA 2KYHA 3RK2D 1C17M 1FR0A 1JR8A 1LS4A 4GOFA 3C7JA 1Z5ZA 5AVQB 1KFMA 3L71J 2BCCD 1PFIA 1SQVK 3Q7LA 3P8MC 1H6GA 2W8ZA 2ZYAA 3BASA 3U2LA 5KYUB 2OGUA 5L0IA 5BQIA 1ZHWA 1FTSA 2EPKX 1U6HA 1WRGA 3FAPB 2E76B 2XS1A 2BCCJ 3ABKC 4XA4A 1YIJP 3QWOC 3CC7P 3GLMA 1S72P 1KV4A 4XEVA 2NUPA 2YLGA 3Q7GA 1NAYA 3O55A 2XXAB 2W9YA 4YXWH 1S5LX 5AW1B 2C0XA 4G7HF 1HH0A 5HSWA 1KYOI 1L0LD 3EPVA 3PTZA 2J58A 4DRJB 1SYQA 4J7YA 2WT7B 2H8PD 2W27A 2LKMA 2XZRA 1HF9A 3FOPA 5KLIC 1FS0E 2E76D 4CDYA 2ZFCA 5L0HA 2BCCE 3AE9C 2G3KA 4DJ9A 1OXBA 1YYCA 2R7UA 2PP4A 4YPCA 3EFFK 1MMAA 4QI0A 1OVVA 2Q7CA 1HJBA 5KKZC 1E86A 5B1AC 4HE8D 2ZVOB 2PBEA 1L0LJ 2IYOA 4Y99B 1KB9H 3M0DC 2K3RA 3GODA 3L71G 3SNHA 1VLTA 3BVHA 1OCOC 4CSAA 3JSZA 1NKNA 1SLQA 2KK7A 1ZU4A 1NBBA 3Q5SA 4WB4A 2E75D 2P1JA 1J8YF 1NFNA 1KMIZ 4C46A 3EG9A 1OFCX 2FFDB 4UB8H 1H89A 2W90A 1ZW2A 3NRHA 3LNRA 2E87A 1A7DA 3N4XA 2J5UA 4N6JA 5AW4B 4DRHB 2N1TC 2Z15A 2BEZF 1SFCA 5DQTA 3QH9A 1Z63A 2HSQA 4H54A 1NTMD 3UNGC 4PJMA 2IYPA 2WPVB 2ICWG 1MQVA 4HKZH 2EPOA 2LD6A 3P7KA 3U5SA 2CNWA 2PNOA 2KS1A 5B5EE 3ZQYA 4XPYA 3IQ5A 3WHNA 4JIOA 3SYNA 2WPRA 3TD7A 2KB7P 1NTMJ 3CXHE 4MVRA 3OAKA 1U89A 1H9TA 4P6IC 1MFZA 2PF4E 2XNXA 2CYDA 1WATA 2XL6A 2OCCC 3EH1A 2L6HA 3LW5H 4UB6H 3ABLC 2WVNA 1Q0MA 5CCHA 5TISE 1T9KA 3II6A 1PPJG 2R44A 1VQ8P 1EI7A 1BGYD 3FXHA 4K35A 1WTYA 3H25A 2BEQD 3TJ5A 1M57D 1K04A 2A06D 3T6JA 4JYCA 4I1LA 2R5BA 1LTBC 3IF4A 3ZDMA 1I5NA 4YL0A 1HBWA 4C7OA 1PIXA 1T2KD 3US6A 3N0TA 4A4AA 4ZLCA 1NTZG 1Q82Q 1WMKA 3O6QA 1BGYJ 4DOJA 1VQLP 2Y3DA 4IB4A 1PD0A 3LIDA 2KSJA 4BWNA 4EOTA 3WU2H 3N24A 1VQKP 4O79A 4MVSA 3KH2A 4CS9A 1NTMG 4PJLA 1S05A 2WPQA 3D6YA 3DXJF 2VCCA 2WZFA 4I2LC 2PRRA 2GUSA 4N06A 3M4CA 3I56P 4ER9A 1BGYE 1T6IA 3EFGA 3CCVP 4Q4ZF 3UMIA 3P32A 3GM3A 2W83C 2A45G 1LWUC 3HNIA 3OJAB 4Z9HA 3S27A 5D92A 4LLHA 1L0LK 2E75C 2J59M 5D91A 2QUPA 4F4BA 2FYZA 3UMKA 2V26A 1RE3A 3C18A 3C8ZA 2KP8A 1S7ZA 1W2EA 1OCZC 3TGUD 1M56D 1M1JC 1MUUA 2FYNB 3H1KJ 1HVVA 3RGUA 3H2UA 2W4BA 3C62A 4LACB 3AG4C 1PP9E 1BDCA 2HMZA 5CI8A 4X0RA 1SFCD 1IK7A 2BASA 3TGUJ 5GTIH 1SQBD 1USDA 2OYIC 3IQTA 3A11A 4U3FE 3OEOA 4IFMA 1J1EC 3JSVC 2Q5UA 3A0BE 1NOHA 1LTJB 2CNWD 4U5CE 2OJED 3AECC 1CPRA 4NTAA 3H1LE 2WPSA 1NTMK 4FWVA 1SQBJ 1A0BA 4DRIB 3M91A 1S3JA 3TGUE 1VQ7P 4HFFB 1GS9A 3IQ6A 2A6HF 1LGHB 2R7VA 3L74D 3AGUA 5KYWA 1BE3E 2R05A 3EZIA 1GD2E 1RF1A 4KC9A 1ZP0C 1GMJA 1PCXA 4GYTA 3RF3A 3GF3A 1M57C 2YKZA 2PAJA 3NKDA 3T4RA 1RE4A 1S4XA 1PZQA 2J45A 3H1KG 3B71A 3Q2YA 1KQGB 2YXRB 3AEBC 2HSBA 1SQBE 3VMZA 5AVVB 2K9YA 4KHXA 3U3FA 2ETSA 2TMVP 3IQCA 2ZT9C 5KJ7A 2RSEB 1NTKG 1UG7A 3AG3C 5AC4A 4PJ0E 1LP1B 4L73A 1IC2A 2J0XA 4IWBA 3CX5D 3W2VA 1VF5D 5KLVD 3O6XA 2KNHA 4PV1C 1VYIA 1ZV8A 3GWLA 4FX5A 4RJTA 4ULVA 2FKWB 3GWNA 2V7QH 4DT0A 1JOCA 2KW3C 2KC3A 5CBNA 4K3AA 3L8JA 1VLSA 3GORA 1HW2A 3L74E 4PD4I 3KZIE 1Q90D 5KLVJ 3EWKA 3KXDA 3QMKA 4HJGH 1FC2C 2XKMA 1NKZB 4OGQD 4XPXA 2LXBA 4KT0J 3RVZA 4KI2A 1ZLLA 1KC8Q 1YJGA 4E7SA 2FAPB 1VK5A 4JJFA 5BQHA 2D2CC 2QA4P 1R5ID 4K7BA 4AK9A 4CSAC 2P10A 2PP6A 3CX5E 3H1JG 4K1OA 3CCLP 2QY9A 4NPDA 3M1CB 4WABA 5FCLA 3RFYA 1N7SC 4D6TD 3UGPA 2NPSA 1LTIC 4YJWA 2A6EF 2K88A 3IN6A 2POHA 1L0ND 1QL1A 1VMAA 2P2UA 1SFCC 4RKUJ 1W2WA 3CLQA 1EXIA 1RH5B 2JWAA 2YEVA 3HTKA 4CPGA 2AEJA 5AW9B 1L4AA 1EKYA 3MUDA 1FZCA 4D6TJ 3C8VA 1H7IA 1N2DC 1D1AA 1NAFA 1HGZA 4L75A 2I1JA 2AEMA 1KILA 4HFKB 2O3JA 5A6BA 5COGA 4D4XA 2L9JA 5AVYB 4C3DA 4TT3H 2Z4EA 2P7VA 1T5OA 4XEKA 3L73D 3B0UX 3L75G 5B5EH 4DVYP 2VB6A 2YKPA 2RD9A 5JRAA 2O01J 2ITAA 3H1IG 4H44D 2IXMA 2B9BA 5AC5A 4D6TE 1M7LA 1SS1A 2R7OA 1SQQD 1SQBK 2M3BA 3CXHH 3ITKA 4DVZA 5CCHC 1L0NE 3HUSB 4B6IA 1CI6A 1LIHA 3EGDA 3LEOA 3X1OA 2KLVA 1LT9A 2CDQA 2MHRA 2KI7B 4NC3A 1N7LA 3FXDA 4GKGA 1YTZT 2M8RA 1IW7F 1S2EA 2LXCB 2X51A 1YAUO 5TISH 3ZDLA 4AL1A 3G6EP 3HE4B 1OVUA 3ABVC 4DCKA 1IFPA 1T8ZA 4XPWA 2R7QA 3E9VA 3WAQA 2JP3A 3TNUA 3L73E 4JEBA 1JAFA 1EDKA 2NRGA 1VQ6P 4M63A 3ASNC 3EHNA 5JLIA 1U0BB 3ZTZA 1AFOA 2YL0A 4MS2A 4PD4D 1IFDA 1T6QA 3GM2A 1HGVA 1SQQE 3O8ZA 1JY2N 1SQVE 4CS9C 2WVOA 1HJ0A 4DBQA 3V5XA 5KYUA 1R5LA 1D0YA 4OGQC 5C39A 3Q5PA 1IJDB 3GMAA 3L35A 3RL0C 3M79A 3AE6C 4CJOA 3IAOA 5KLVK 5CIVA 1GQAA 1Q0GA 2AWYA 5JVEA 2Q7RA 4MVZA 4W8PA 1RY3A 2IBFA 3EGXB 3K33A 2V3CC 4Z9IA 1KN7A 4JPZB 5AGFA 5CJ4A 2QJPC 5KLIB 2XXAA 3RW0A 2NSGA 3RBXA 5JT4A 3DM9B 1RE3C 2WT7A 4IFDK 2Q9IA 3CCUP 5E2QA 4RESB 4EBKA 3G4XA 1G2CB 3A2AA 2NPSD 3PJSK 1SQPG 3RL0g 1G1IA 2DYSC 3S90A 5FZTA 1WASA 1Q0FA 1SVFA 2R5DA 1HY5A 3AQCA 2Y39A 5EK0A 2HFED 2IM8A 2P7JA 2QTVA 3LESA 4LLCA 4JTCB 1RQVA 1YA7O 5F28E 3W2WA 4ZKUA 4QDLA 2A68F 3ZQVA 1H9GA 2DYRC 2FFDA 1IFNA 1I4ZA 2HG5D 2N1TB 1JOGA 5B3IA 1L0NK 3CCJP 3KQGA 4W7ZA 1KTMA 5A6BD 2I8BA 3AEAC 3VP8A 1Z23A 3JC22 3Q6NA 1OZHA 5CBOA 4XE5B 3A0BH 3KKBA 2W6AA 4EIYA 3TSIA 4EWCA 2O1KA 1V54C 3NFQA 4O6MA 1RF1C 3L71D 3VRCA 1NWQA 1GK4A 3J06A 4GIFA 4JCHA 2WSCJ 1P84I 2Q1KA 1GM5A 2MWQA 1E5WA 2PX0A 1WOLA 3UGOA 2WWWA 5L0CA 3RVYA 1GL2B 1FOSE 5JUAA 4N6HA 2AWCA 5KJ7C 1SQQK 2FXOA 2FYUG 2GUVA 3GW6A 3RQEA 5KYXB 4XQ1A 1KILE 1YQ3C 3B5NC 1YJWP 1MMGA 3G50A 2KSEA 1S9KD 3CC2P 4RO0A 3EJNA 2KNCB 1JUNA 4D4NA 1RHZB 4PJNA 3F89A 4PJ0H 3JSEO 2Q9AA 1PGJA 2J9WA 5GTHE 3JCUE 2WSEJ 3L0IA 2WZ7A 4XLPF 1GDTA 3CCQP 4ASVA 3L71E 2H7VC 1XTCC 4A7PA 4XWJA 1NSGB 2ZD9A 2YIUC 5CHXA 1J1DC 3K1HA 5BU5A 2KXPB 3AE5C 3ZTMA 3AEEC 3V2RA 5CCGA 5APTA 4I7ZC 1Z6AA 4DZOA 3KZIH 2RKLA 5KAFE 4U5DE 2Q3IA 1CGME 5DJTB 4H0LC 1JCCA 1BSHA 2QM7A 5E79E 2EPNA 4IOIH 1QQ3A 2HYNA 1ZU5A 1HE9A 3PCVA 1PPJD 2R32A 4JW1A 4EKWA 5AVTB 1BCCG 2Z5HA 3NMKA 2LR2A 4E7ZA 5IY5C 3B8EB 3HJCA 1FDOA 2F22A 3A5TA 2OOCA 3G71P 1QX8A 1TWGA 4PFOA 3CX5H 2NPSC 3L1MA 2HV7A 1HMOA 3P8CD 2C03A 2EIKC 3C9IA 3IHUA 5EGYA 3FVYA 3PH0A 4JTDB 1RKCA 3VN0A 3FMSA 1QGKB 4O9BA 3N7NA 1EZVI 1NTZD 3HTKC 1J2JB 3B4SA 4WY4B 3FXEA 5KYYB 4KJMA 2QJKB 3QTHA 3TJ6A 3AGTA 2QE9A 2O01N 1L4AC 1L0LE 3MUDC 1FZCC 2YL1A 3BRJA 3IFMA 3MFNA 1M1JB 2BC5A 1Z7Qc 3NMDA 3R2PA 1KILC 4HEAJ 1FZFA 1YZAA 4ZNCA 2W6JH 3GANA 1M1KQ 4B86A 4Z1MH 4ZMDA 1ZW3A 1PPJE 1NTZJ 1Y47A 3DAFA 3C63A 1LTSC 4ZKPA 2HZ8A 1ZR4A 4WY4D 2VH3A 4C3EA 1LT1A 4WWIA 2Q9BA 4C3BA 4MN4C 3KPEA 4XTKA 4OINF 3VYIA 2OYIB 3TOLA 3E70C 1APCA 3P8CE 1VQPP 2UWJE 2GA0A 2AXTE 4WJ0A 1OVRA 1P84D 1ST6A 1LT9C 2EPLX 2CGEA 4WGZA 1Q2NA 1NTZE 3RK2C 5DVWA 1DOWA 2C04A 3VOPA 1G8XA 3Q6MA 2YMYA 1SQXJ 1LTJA 3LLIA 3V6IA 2XSEA 3S29A 5DS4A 1QPUA 3CWBJ 2GM4A 4E17A 2XDJA 1LS1A 5AW7B 2LFDA 3HNKA 3T6BA 3FWLA 1NTME 1L3PA 3NDBB 4MVOA 2O01H 4FESA 2VC9A 1TFKB 4BJ5A 1MFTA 3SWFA 2QEXP 4WBAA 1ZHZA 3AE2C 3K5BA 1JMMA 5HV9A 4C7NA 2J9VA 2H88C 1VQOP 4BRYA 1M2VB 5L0JA 4G7ZF 1R8EA 1SF8A 4AX2A 3HD7B 1KYOD 5AW6B 4AUWA 1FMVA 1AVYA 2Y3HA 4PR9A 1D1CA 3JTLO 1LP1A 2E76C 3RIPA 2JJLA 5L3QA 4U5HA
chains in the Genus database with same CATH topology
3MIWA 2C9NY 5CCGD 2WITA 5APVA 3HD7A 1H88A 1NH4A 2XKMA 5APUA 4N3YB 3MD0A 1NKZB 2MJZA 3HD7D 1S9KE 1QL2A 2OYHC 2JEEA 5AW0B 1URQB 1ZLLA 3VMYA 5AW2B 1N73C 1FJKA 1LWUB 1BZ4A 3A7OA 1MZ9A 3CL3D 1ZR2A 1WT6A 2NPSB 2PP6A 1OR2A 1IFIA 1NU1K 1URQA 2R3CA 4N78E 2N9BA 1NO4A 3NXSA 5APWA 4Y99C 3UIAA 3V2NA 3WMM0 1LWUA 1SP4A 5APXA 1N7SC 2KOGA 3HTKB 1KFNA 1RF0A 1ZN5A 2FYUK 2NPSA 1LTIC 4C7RA 1EQ1A 1N7SB 1L4AB 2POHA 1FZCB 1HUCA 3S84A 1QL1A 2P2UA 1SFCC 3V2QA 3LIEA 1FJPA 1KILB 3CLQA 2FFDC 1JY2P 1OWAA 3HTKA 4JF7A 1CZQA 5APYA 2CPSA 5AW9B 1N7SA 1DH3A 1L4AA 3M06A 3M9BA 3MUDA 1FZCA 3GHGC 1HWTC 3OA7A 1NTZK 1H7IA 1N2DC 3U59A 1NAFA 1HGZA 1X79B 2I1JA 3CI9A 1KILA 1L4AD 1J1EB 5AVYB 1N86A 2ZXEB 2Z4EA 1LTGC 2HODB 1KILD 2E42A 1LPEA 1CI6B 3HE5B 1MV8A 1LT9B 2YKPA 2L5GB 2P67A 3RK2B 1M7LA 5AVZB 1SQBK 2HODA 2M3BA 1SQXK 5CCHC 2XU6A 1GU5A 3HUSB 3RK3C 1CI6A 3HE5A 1AEPA 2A45I 2KLVA 1LT9A 1FU1A 1X8YA 1N7LA 4GKGA 1YTZT 2M8RA 2YO2A 1CSBA 3MTUE 1A02F 1GL2C 3TNUB 2W6BA 3HUSA 3RK2D 1T2KC 2I1KA 3HE4B 1LS4A 5AVQB 1KFMA 3V2PA 1T8ZA 1PFIA 5AVWB 1SQVK 5APQA 3P8MC 1GU4A 3TNUA 1LE2A 5KTBA 3BASA 3HE4A 1JCDA 1AFOA 1KZUB 1IFDA 5CCGC 1HGVA 3O8ZA 1JY2N 3SWYA 1WRGA 2HPCB 1FZEA 4XA4A 1HTLC 5CJ0A 2HLOA 1IJDB 3RL0C 3L35A 5KLVK 1FOSF 1OR3A 3RL0B 5AW1B 3KDPB 1JY3O 3HRNA 2C0XA 1H8AA 2HPCA 1HH0A 2OYHB 1RY3A 2J58A 2IX7C 2WSEH 2WT7B 2H8PD 2W27A 2LKMA 2XZRA 1JNMA 1N73B 5CJ4A 4LC1A 2ZFCA 3E1IA 1EQ7A 1B68A 1YYCA 2OYHA 2Q7CA 1HJBA 1RE3C 5BVZA 2WT7A 1N73A 4IFDK 5CMZA 2Q9IA 1URQD 4Y99B 1LTTC 3M0DC 4RESB 1KQLA 2FXMA 3T97A 3BVHA 1G2CB 1A02J 1NKNA 1SLQA 2YKOA 3U1CA 3A2AA 2NPSD 3VP9A 4WB4A 1G1IA 2P1JA 1NFNA 4WY4C 4C46A 3H32B 1SFCB 1SVFA 1CW5A 2R5DA 2FFDB 1H89A 1NTKK 2HFED 1G2CA 1DEBA 2P7JA 3N4XA 2VRSA 4N6JA 3GHGB 1N7SD 4ZKUA 5AW4B 1IFJA 3H32A 2N1TC 3V4QA 5AVSB 1SFCA 1XTGB 1LTAC 1T3UA 3VTPC 2FFDA 1IFNA 3MGNA 2HG5D 2N1TB 1L0NK 1YTZI 3KQGA 4W7ZA 3H6PA 3TK1A 3VP8A 3P7KA 3GHGA 4XE5B 2W6AA 2YKQA 3TSIA 2Z5IA 1YA9A 2KYVA 2N1TA 2O1KA 1VDFA 2WPRA 2KB7P 3NFQA 1RF1C 3OAKA 1NWQA 1FDMA 1GK4A 4GIFA 3RK3B 1AQ5A 1MFZA 2XNXA 5AVXB 4AQRD 3V4WA 4EIJA 3LW5H 1E5WA 3BATA 3M0AA 2WTYA 2WWWA 1FBMA 1GL2B 5CCHA 1FOSE 3II6A 5KJ7C 1SQQK 2H43A 1T3JA 2GUVA 5CCHD 3NTNA 1GW3A 3RK3D 3B5NC 2WSCH 4C7NB 5BU8B 3M9QA 1S9KD 1GL2A 3KYQA 3B5NB 4JYCA 1IFMA 4I1LA 1JUNA 2R5BA 1G1JA 2A45H 1LTBC 4OH8B 2YO3A 1HBWA 1T2KD 1FZBA 2WZ7A 1GDTA 4DOJA 3HD7C 3B5NA 1XTCC 3LIDA 2KSJA 3TYYA 4EOTA 5CHXA 2IFMA 1J1DC 2OARA 3IR9A 5BU5A 4I6MC 3A3YB 2YNYA 3V2RA 5CCGA 5APTA 4DZOA 3L4FA 2WPQA 3U1AA 2Q3IA 5APSA 1JCCA 4I2LC 2QM7A 2GUSA 1IO4A 3G3ZA 2HYNA 2R32A 1URQC 5AVTB 2Z5HA 1FZAA 3EFGA 3P32A 3B8EB 3RL0D 1FZGA 2A45G 1LWUC 3A5TA 3OJAB 1NFOA 1JY2O 1RF0C 2NPSC 2IFNA 4LLHA 3P8CD 1L0LK 3C9IA 1OXZA 2J59M 1GW4A 3BRTB 2FYZA 1JY3P 3VN0A 4AYCA 4O9BA 3N7NA 1RE3A 3BRVB 2KP8A 1W2EA 1J2JB 4WY4B 3M0DA 1M1JC 1L4AC 1MUUA 4W7YA 1FZCC 3PP5A 1HVVA 3IFMA 1M1JB 2C9LY 5AW5B 3NMDA 3R2PA 1KILC 1FZFA 1FAVA 4WY4A 4B86A 1SFCD 1EA8A 2QM8A 1LTSC 4ZKPA 1ZR4A 2BASA 4WY4D 1M1JA 2OYIC 1DX7A 1LTJC 4IFMA 2CPBA 1J1EC 3KPEA 2Q5UA 2XV5A 3VYIA 2OYIB 1NOHA 1LTJB 2IPPA 3P8CE 4IFFA 3I5CA 1JO5A 2N1TD 1LT9C 1RF1B 2WSFH 2WPSA 1NTMK 1RE4C 3EQ2A 4HYTB 3RK2C 3M91A 5AW3B 3VOPA 2OYIA 2YMYA 1LTJA 1GZLA 1GS9A 3V5BA 3HUSC 1LGHB 2GM4A 2XDJA 1GD2E 5AW7B 1RF1A 5AVUB 3L37A 2PAJA 1LE4A 1RE4A 2E43A 1NHLA 4GT1A 4M3LA 2O01H 2H7HA 1Z56A 3VMZA 3SWFA 5AVVB 1JY3N 4LGDE 1SQPK 3M9HA 4KHXA 1VPCA 3L36A 1JTHB 1GTWA 1GL2D 5KJ7A 4WBAA 1JMMA 4C7NA 1IC2A 5AVRB 4N78D 1IK9A 5KJ7D 1ZV8A 2O1JA 1X9VA 3HD7B 5AW6B 3VMXA 4AUWA 1JTHA 5AW8B 2FKWB 4JYBA 3B5ND 1JOCA 2KC3A 1J1DB 4W80A 2JJLA 2C0WA 1GK6A 4HH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR2 A;  1NFN A;  1EA8 A;  1LS4 A;  1B68 A;  1GS9 A;  1YA9 A;  1H7I A;  1LE2 A;  1GW3 A;  1OR3 A;  1AEP A;  1EQ1 A;  1LE4 A;  1NFO A;  3R2P A;  1BZ4 A;  2KC3 A;  3S84 A;  1GW4 A;  1LPE A; 
#chains in the Genus database with same CATH topology
 4LDK A;  1UIX A;  5F5H A;  5CCG D;  2YZS A;  1QLE D;  1KB9 I;  3ZC4 A;  3KYI A;  2Y0C A;  3M15 A;  4I44 A;  2ZXO A;  1SQX G;  2Y0E A;  2QSI A;  2MJZ A;  3HD7 D;  3EZH A;  5M1B A;  2JEE A;  1HW1 A;  2A06 E;  1URQ B;  3CWB G;  3VMY A;  2WMM A;  1FJK A;  3VYW A;  2ZYG A;  3VMA A;  3H1K D;  1WN0 A;  2J0W A;  3HNJ A;  2HUJ A;  1MZ9 A;  2YLD A;  3CL3 D;  1ZR2 A;  1WT6 A;  1OR2 A;  3EFO B;  1JPJ A;  1IFI A;  2IZ0 A;  4RDA A;  2QRX A;  5DS6 A;  1NTK D;  2DB4 A;  3HLZ A;  4G0H A;  4Y99 C;  4IL6 E;  3K6B A;  1KYO E;  1X0T A;  3KMI A;  2QLA A;  1SP4 A;  2K9J B;  5E3A A;  2NG1 A;  1QEX A;  4ULW A;  3LNM B;  1N7S B;  3UMH A;  1EDJ A;  1OCR C;  2P1A A;  3V2Q A;  1NTK J;  1FJP A;  2FFD C;  4ASW A;  1BBH A;  2BL2 A;  5GPG B;  4CX9 A;  2CPS A;  4QMA A;  1DH3 A;  2R25 A;  3M06 A;  1G4U S;  1FDI A;  2XM4 A;  1T6U A;  5JP7 A;  1NTZ K;  3U59 A;  3RQG A;  3H1K E;  1X79 B;  1S1C X;  2N9Y B;  2E5T A;  1KQF B;  2E74 B;  4OD4 A;  3RH3 A;  4I1M A;  4NCQ A;  1TWC A;  3HE5 B;  3EQL F;  3H1J D;  4NPF X;  2JX0 A;  4WGY A;  2KLU A;  3JCU Q;  2G62 A;  1D1B A;  1C03 A;  4GDO A;  3W68 A;  1VYK A;  3JYH A;  1SQX K;  2R7S A;  1JEK A;  2XU6 A;  1TKN A;  2WQY C;  3CCM P;  5B1B C;  3H1J J;  1FAP B;  2AEF A;  2LK4 A;  4LLE A;  3AED C;  1PP9 G;  3HUS A;  1T2K C;  1EZV G;  2I1K A;  2WZG A;  4OD5 A;  3USS A;  3SP1 A;  3V2P A;  1A7E A;  1AUE A;  3KYJ A;  1ZOY C;  3TUL A;  1JMB A;  5AVW B;  1IZM A;  3AG1 C;  4IAQ A;  4OIO F;  1GU4 A;  2Q4F A;  1V55 C;  4CDV A;  3GM1 A;  4U3F G;  4AL0 A;  4BEM J;  2YWA A;  3HE4 A;  3Q1M A;  3MP7 B;  2J9U A;  2G3A A;  2Q00 A;  3GEE A;  5GTH H;  1KZU B;  3JCU H;  1VQM P;  5JSL A;  4JCZ A;  3L75 D;  2WVQ A;  5CCG C;  3S0X A;  1OKK A;  1QLE C;  3SWY A;  4CBE A;  1NU7 D;  3H1I D;  3RBZ A;  2HPC B;  3H1L G;  3HNL A;  2QJY C;  1HTL C;  2IBZ I;  4Q7C A;  5DS5 A;  4I3M A;  2HLO A;  2JWD A;  3SEO A;  3L8I A;  4KBL A;  4I1O B;  1M90 Q;  1OR3 A;  4LDR A;  3RL0 B;  1OMI A;  1BE3 G;  2PX3 A;  1JY3 O;  1KOR A;  1H8A A;  5KAF H;  1VTM P;  3L75 J;  2OYH B;  2EIL C;  3AE1 C;  4IAO A;  1K73 Q;  2WSE H;  3W67 A;  2K37 A;  2P61 A;  4E0I A;  3H1I J;  1JNM A;  1NVO A;  1N73 B;  5E79 H;  3V5Y A;  3DJN B;  3TF5 A;  2GWW A;  1I4Y A;  4JJG A;  2XLD A;  1EQ7 A;  5KLV E;  2FFH A;  3T97 B;  4BG0 A;  4JBZ A;  1RMV A;  1OW6 A;  3RQF A;  2KUB A;  1M56 C;  1WWP A;  4H13 B;  3EGX A;  2M5A B;  3S9O A;  5A6A A;  2JR8 A;  1T01 A;  1D0X A;  2D5R B;  2YL3 A;  1LM3 B;  4BJ6 A;  2FXM A;  3H1I E;  1A02 J;  2YKO A;  4GEH A;  4MND A;  3VP9 A;  3MHV A;  1ZW0 A;  3H32 B;  1VOM A;  4YK5 A;  1EDL A;  1CW5 A;  1Y4C A;  4H13 D;  3ATP A;  2FYN C;  2DI3 A;  1NTK K;  2M0B A;  3I5P A;  1G2C A;  1DEB A;  2KGO A;  1K8A Q;  3T9O A;  1G5Z A;  3GEH A;  4IGG A;  4OIP F;  1NJI Q;  3GHG B;  4BPM A;  1IFJ A;  1E79 H;  1AJY A;  2Y3G A;  1XTG B;  3B0P A;  1T3U A;  1LTA C;  3VTP C;  2XL4 A;  4KNV A;  3ZVR A;  2NZ2 A;  1V4A A;  2MKV A;  2M3E A;  2Y3B A;  4MW3 A;  4YN0 B;  3F5H A;  4G78 A;  2L6F A;  1JMW A;  3LEV A;  3JYY A;  2VCB A;  1JPN A;  1TWH A;  4XFJ A;  3DJU B;  1Y9B A;  1HMD A;  3LW5 J;  2Y69 C;  1YA9 A;  3QW0 A;  2AXT H;  3NYM A;  2KYV A;  2N1T A;  1VDF A;  4NPE A;  3D70 A;  2G8Y A;  3FWN A;  4Q5S F;  1FDM A;  2J9B A;  3RK3 B;  1RJ9 B;  4O6Y A;  3I5Q A;  1SQP D;  2WVR A;  1YYX A;  3CAX A;  3V4W A;  4EIJ A;  1NU1 G;  4BJ5 C;  1Q0D A;  3M0A A;  2P0N A;  1FBM A;  3C1L A;  2OQM A;  1PV3 A;  1VF5 C;  3MBG A;  1T6A A;  3L70 G;  5H2F E;  2AVK A;  2H43 A;  5DJU B;  2L6G A;  2HS5 A;  3RK3 D;  1SQP J;  3M9Q A;  2R7X A;  1VL2 A;  2KIK A;  1GL2 A;  4MTG A;  1VB5 A;  3KYQ A;  3B5N B;  5CI9 A;  1EC5 A;  1G1J A;  2A45 H;  4O7G A;  1A7V A;  2YO3 A;  1QVF O;  4AE4 B;  5KYX A;  2M64 A;  2Q3E A;  3NMJ A;  1FZB A;  1YDI A;  5E3C A;  1W2B O;  3CD6 P;  2HFI A;  3DKA A;  4DOZ A;  1OKK D;  3RYL A;  3GEI A;  2KNC A;  1K40 A;  2ZYD A;  3TYY A;  3JRM O;  2ZXP A;  1BSN A;  4YT2 A;  3A3Y B;  2UUI A;  2GA1 A;  4JRZ A;  1MND A;  3U1A A;  1BR2 A;  1RXQ A;  1YI2 P;  5APS A;  3SZR A;  3PLN A;  3SWK A;  1LI5 A;  2UUH A;  1OCC C;  1ZHX A;  3CPW O;  1IO4 A;  3G3Z A;  1WGW A;  3B9Q A;  1RCP A;  1XWJ A;  1LKX A;  2KZJ A;  2EPM X;  3G9R A;  2FYU D;  3FAJ A;  1ZXG A;  2EIM C;  1H0T B;  3B29 A;  5KKZ B;  4PD4 E;  1NFO A;  4EBJ A;  2XLM A;  1VQ9 P;  3W8I A;  2AXC A;  4PJJ A;  1AVO B;  1JY3 P;  3WUV A;  4AYC A;  4IL6 H;  1KYO H;  4YT5 A;  4L76 A;  3WOD F;  1G4W R;  3BRV B;  3TOM A;  1EDI A;  3BCC J;  2FYU J;  1O3U A;  2AP3 A;  4JTA B;  4LDQ A;  1SQV G;  2R7T A;  4CS8 A;  1OXK A;  1QZX A;  4MVU A;  1KD1 Q;  2LCH A;  3TQO A;  1XZQ A;  1ZVZ A;  2EIJ C;  2KJG A;  1AQT A;  5T1D B;  2CCY A;  2JD3 A;  5AW5 B;  2H8A A;  1BR1 A;  4ONS A;  2QIW A;  1YIT P;  3Q5R A;  1Q81 Q;  1FAV A;  4WY4 A;  1M8O B;  5KYY A;  1LJ2 A;  3CXH I;  4H44 C;  3RKO F;  1LVK A;  2OTK E;  1VQ5 P;  2GDC A;  4CDA A;  2XLV A;  4O6N A;  4EBB A;  1M1J A;  2IBZ G;  1LNQ A;  2H7B A;  1ZZP A;  1DX7 A;  1BCC D;  2Q6Q A;  4YL3 A;  3H1H J;  1Z3I X;  4NQF A;  3HKK A;  3U3B A;  1R5S A;  4IFF A;  2IZ1 A;  2N1T D;  1KQS O;  3I55 P;  5KAI E;  2X0C A;  1RE4 C;  3EQ2 A;  2LQG A;  2OYI A;  3D71 A;  5DQZ A;  1BDJ B;  3L72 G;  1BCC J;  1GZL A;  3LAY A;  1J8M F;  3V5B A;  3HUS C;  3MLG A;  4TLF A;  1CGN A;  5L0F A;  3SXZ A;  3L37 A;  3BCC G;  3O10 A;  4GOE A;  4OVN F;  4DJG A;  1CPQ A;  1QSP A;  1NHL A;  3GG2 A;  3DAG A;  1N8R Q;  2WL8 A;  4N4W A;  1EXJ A;  2B88 A;  4LGD E;  1SQP K;  2R3S A;  1VPC A;  2V7Q J;  1BCC E;  3L36 A;  1JTH B;  1GTW A;  1GL2 D;  1KU2 A;  1HE1 A;  3MZW B;  3AOU A;  3AEF C;  1OW8 A;  3FGA D;  3QZC A;  3CCE P;  5KYN A;  1NZE A;  3L34 A;  5AVR B;  1YZC A;  1IK9 A;  1VQ4 P;  1TU3 F;  1X9V A;  3VMX A;  4J7T A;  3OW2 O;  1ZRT D;  5BQG A;  3K7D A;  4JYB A;  3H1H G;  5A69 A;  4ANJ A;  1USE A;  1GK6 A;  2NUT B;  4HH2 A;  4EHP A;  3MIW A;  2YVK A;  4PK4 A;  2A1D D;  1M2V A;  3K66 A;  3N2Z B;  2KZI A;  2WIT A;  3HD7 A;  2JO1 A;  1H88 A;  2A0B A;  2Q3T A;  4E0H A;  4Y28 J;  4FAP B;  3MD0 A;  4R4M A;  1RKE B;  2NSF A;  1S9K E;  4JZA A;  3AEG C;  2B87 B;  1FFH A;  2ZPA A;  2GAQ A;  2LFF A;  3V5Z A;  1X22 A;  4A2N B;  3PHL A;  1LWU B;  2YRF A;  4EYY Q;  3S28 A;  3A7O A;  3K1I A;  3ZIB A;  2ZJS E;  4YWQ A;  3V7O A;  4BJ6 C;  4IRU A;  2KSF A;  2E75 B;  1YBK A;  1URQ A;  3H2V A;  1N1C A;  2N9B A;  3E7K A;  2OTJ P;  3NXS A;  3UIA A;  2XLO A;  3WMM 0;  3IEE A;  2ZXX A;  1ZRT E;  1K05 A;  5APX A;  1E2X A;  5DLJ A;  2KOG A;  1KFN A;  1RF0 A;  1ZN5 A;  2FYU K;  1JB0 J;  3EFO A;  4C7R A;  1SMY F;  2JPU A;  3VF0 A;  2QE7 H;  4OIR F;  2I15 A;  3CXH D;  3F46 A;  2QG4 A;  1NU9 C;  2K9J A;  2LIG A;  4JF7 A;  1CZQ A;  5APY A;  1N7S A;  3CSK A;  2WSF J;  3S1K A;  1SQX D;  2HJ3 A;  2BCC G;  2FY8 A;  2NPU A;  3O39 A;  3CWB D;  3G4S P;  3C8G B;  1J1E B;  3QVY A;  4LER A;  1LTG C;  1Q86 Q;  4IL6 X;  2HOD B;  1ORY A;  2E42 A;  2WSS H;  2FBW C;  5EHH A;  5K5G B;  1OX3 A;  1LPE A;  3W8H A;  2H89 C;  2YHS A;  2L5G B;  2P67 A;  2D4U A;  2V4H A;  1ZHT A;  3DWW A;  2XM0 A;  3AQB A;  3C8G D;  3DE8 A;  5TJ5 E;  1W5C E;  3JT1 A;  3U8V A;  3HE5 A;  1YLM A;  1AEP A;  4JQ0 D;  3LS0 A;  1X8Y A;  1L0L G;  3SSU A;  3DD7 A;  4KNW A;  1GL2 C;  2SPZ A;  2W6B A;  4H4K C;  1GGQ A;  2LP4 A;  1SQX E;  4L6R A;  5H2F H;  1FNT c;  3WUU A;  1S5L E;  1FMW A;  3CWB E;  1Q0K A;  1A41 A;  1D7M A;  2ZT9 B;  5APQ A;  3AE8 C;  3LLK A;  4CIH A;  3ECS A;  1P84 E;  1LE2 A;  5KTB A;  4PV1 B;  2AU5 A;  2NUP B;  1JCD A;  2GFH A;  4XLN F;  4IAR A;  4NTB A;  5B66 E;  1FZE A;  2ZT9 D;  2L7A A;  2HJM A;  5CJ0 A;  2HMQ A;  3G4Z A;  2QJY B;  3CX5 I;  1NYH A;  4RBN A;  1FOS F;  1UII A;  4PV1 D;  3CCS P;  4U5G A;  3KDP B;  3MYF A;  3HRN A;  2HPC A;  3OWT A;  1PGO A;  1BR4 A;  3DZA A;  2IX7 C;  3EH2 A;  2OG2 A;  3NYJ A;  4LC1 A;  5L8R J;  2M4E A;  1PP9 D;  2D2C B;  3FDQ A;  1EZV D;  5L3V A;  3E1I A;  3T6G B;  4ZLD A;  1B68 A;  2B0H A;  3CCR P;  4U5B E;  1Q7Y Q;  3AE4 C;  3MYI A;  2OYH A;  1O87 A;  4JC7 A;  4U9E A;  2IXO A;  4PD4 H;  3ITF A;  5BVZ A;  1N73 A;  3CMA P;  5CMZ A;  1URQ D;  3Q3D A;  3EG9 B;  4U3F D;  1LTT C;  2R7R A;  4CS8 C;  3S4R A;  3U8P A;  3CQZ A;  2OU6 A;  2Y0D A;  2HKV A;  1KQL A;  3T97 A;  2IXP A;  1PP9 J;  1YYJ A;  4G7O F;  2QNL A;  3U1C A;  2D2C D;  2M5A A;  2W4M A;  2CW0 F;  3UR3 C;  1VQN P;  4YL1 A;  4WY4 C;  3H1L D;  1SFC B;  2QJK C;  3JRT A;  4U3F J;  2WB7 A;  2VRS A;  1BE3 D;  1N7S D;  4YTP C;  3U9J A;  1BGY G;  3H32 A;  3V4Q A;  2OEX A;  5AVS B;  2KS1 B;  2XND H;  1EZV E;  3MGN A;  1DD4 A;  2A06 G;  2A0U A;  3QW1 A;  3H1L J;  1YTZ I;  1NTK E;  4W8K A;  5JS5 A;  3H6P A;  3TK1 A;  3A0H E;  1MKM A;  3GHG A;  3R7C A;  2QVA A;  2YKQ A;  4JE9 A;  2Z5I A;  4Z9J A;  1O5H A;  1QVG O;  1BE3 J;  2VAS A;  1L7C A;  1DOV A;  2E74 D;  2KK1 A;  5KAI H;  2IOQ A;  3PDM P;  4L74 A;  3FOO A;  4JKV A;  5EFW B;  2O9X A;  1AQ5 A;  5AVX B;  1SR2 A;  4U7J A;  4AQR D;  1MNE A;  1XZP A;  4P9F A;  3SFD C;  3BAT A;  2WTY A;  3FX0 A;  2R02 A;  1RJ9 A;  2J8W A;  1E84 A;  1VF5 B;  4GQH A;  2H7O A;  1T3J A;  4CJG A;  3X2Q C;  5CCH D;  1TQG A;  3KPH A;  3NTN A;  1GW3 A;  3WG7 C;  3E1R A;  4C7O B;  4C7N B;  2WSC H;  5BU8 B;  3O6Q B;  3H1J E;  4OWF A;  1IFM A;  1UFB A;  4BRY B;  2B0J A;  2J7P A;  3POV A;  4EI2 A;  1TWA A;  3L74 J;  4OH8 B;  1D0Z A;  1KB9 D;  3KL4 A;  1OQC A;  4XEF A;  1JRA A;  1YAR O;  3HD7 C;  3B5N A;  3TGU G;  2LSE A;  2P58 A;  1M6T A;  2KQ9 A;  1PGP A;  4JUR I;  3W4Y A;  2IFM A;  4OGQ B;  4N6C A;  5E33 A;  2OAR A;  3IR9 A;  2OJQ A;  2R03 A;  4I6M C;  4AE4 A;  3LJB A;  3BEH A;  4BXL A;  3ASO C;  2ASR A;  3NKE A;  2YNY A;  2PFX A;  3L4F A;  3AG2 C;  1AV1 A;  2ZXR A;  3U0C A;  3CZ6 A;  1NU1 D;  2J46 A;  3K1I C;  3H65 A;  2XLH A;  2RH0 A;  3A9C A;  2Q9C A;  4HB1 A;  1SQB G;  3L70 D;  3VM6 A;  2QJP B;  3CEX A;  3U9M A;  1URQ C;  4DBR A;  1ORS C;  3ABM C;  3LUT B;  4QI2 A;  1E85 A;  1FZA A;  3D6Z A;  1PL5 A;  4MW8 A;  3SXY A;  3RL0 D;  1FZG A;  2Y9Y A;  3NG1 A;  3KHU A;  1JY2 O;  3L75 E;  3CC4 P;  2YQY A;  4YT8 A;  1RF0 C;  2IFN A;  1NU1 J;  2Y9Z A;  4BJ1 A;  1KB9 E;  5K0I A;  2DGJ A;  1OXZ A;  1GW4 A;  3BRT B;  4BEJ A;  1OW7 A;  1QKR A;  3L70 J;  1H0T A;  1NG1 A;  2DW3 A;  5TJH A;  1CGO A;  3L74 G;  2K1A A;  3M0D A;  1ORJ A;  4PFP A;  1AVO A;  4UB8 E;  4R4L A;  4W7Y A;  2CK3 H;  2ZXW C;  3PP5 A;  4JVS A;  2RMZ A;  3F47 A;  1YJN P;  2C9L Y;  3VAY A;  1PD1 A;  1NU1 E;  1L2P A;  1TFO B;  4U5F E;  2L81 A;  1M2O A;  3AE7 C;  1DEE G;  3TDK A;  3L70 E;  2P6V A;  1EA8 A;  3JZ0 A;  2QM8 A;  4JEA A;  2FXP A;  3PMR A;  3SFE C;  4H44 B;  3DE9 A;  3AJM A;  1FE6 A;  5F5F A;  1LTJ C;  3GF7 A;  2CPB A;  3SXK A;  1V74 B;  1YQ4 C;  1Y8A A;  5KLV G;  2XV5 A;  2E74 C;  2YMK A;  1F1M A;  2R7W A;  2YL7 A;  1K9M Q;  1L0N J;  2IPP A;  1DD3 A;  2WZL A;  3EHM A;  256B A;  1YVI A;  4U9D A;  3I5C A;  3NMI A;  1JO5 A;  5KYW B;  2OQQ A;  2XLE A;  3I4U A;  1RF1 B;  2WSF H;  4HYT B;  2RN0 A;  1YHQ P;  5AW3 B;  4R32 A;  3ZG1 A;  3LS1 A;  1OIP A;  2BE5 F;  5B3S C;  1SQV D;  4UB6 E;  3R4Y A;  4MVQ A;  4UDV A;  3CME P;  5T3W A;  5AVU B;  2OYO A;  2XS8 A;  2IDB A;  4MTF A;  3L73 J;  4WVZ A;  1LE4 A;  2YLI A;  2ZAE B;  2E43 A;  5COF A;  4GT1 A;  4M3L A;  4CS7 A;  1DIP A;  3MX3 A;  1U57 A;  1S5L H;  2H7H A;  1Y6D A;  1Z56 A;  1R4T A;  1JY3 N;  2R9R B;  1SQQ J;  3M9H A;  3DM5 A;  1SQV J;  3DMD A;  4K0D A;  3SXM A;  1E83 A;  2IBZ D;  4EDF A;  1C02 A;  4MVM A;  2J7P D;  1P84 H;  3AE3 C;  4MTO A;  2YXQ B;  5KJ7 D;  4N78 D;  1KNY A;  3QVZ A;  4NY3 A;  5T3T A;  5COM A;  3ZWI A;  2O1J A;  1ZME C;  4D6T G;  1U7M A;  1SQP E;  1JTH A;  5AW8 B;  2EIN C;  3B5N D;  1IZN B;  2L91 A;  2YIU B;  1L0N G;  1J1D B;  4W80 A;  3WU2 E;  5B66 H;  2C0W A;  1NGM B;  4J32 B;  1MMD A;  1AA0 A;  3IPM O;  2C9N Y;  4I7Z B;  3L72 D;  3OA1 A;  5APV A;  2XLW A;  1NH4 A;  2IYL D;  4J30 B;  5APU A;  4H0L B;  2XRH A;  4N3Y B;  5BUO A;  2I8D A;  3RK3 E;  1NLX A;  1MMN A;  3BCC D;  2OYH C;  1QL2 A;  4P9T A;  2NUT A;  5AW0 B;  3M4B A;  5L0G A;  5AW2 B;  2HV6 A;  1N73 C;  1QVX A;  1ZHY A;  3WUT A;  1BZ4 A;  2IBZ E;  3L72 J;  3L73 G;  2OKU A;  1YJ9 P;  1RKE A;  4E18 A;  2NPS B;  1JM0 A;  4EUK B;  2B87 A;  1NU1 K;  4H13 C;  2R3C A;  4H0L D;  4N78 E;  1NO4 A;  2IXN A;  5APW A;  3V2N A;  1SQQ G;  3PHF 2;  1LWU A;  3B0V C;  4NTF A;  3HTK B;  4OIQ F;  1EQ1 A;  1L4A B;  3H1H D;  1FZC B;  1HUC A;  4GOD A;  3L72 E;  3S84 A;  4U5E E;  3LIE A;  4YT4 A;  1KIL B;  1JY2 P;  4BJT A;  1OWA A;  4IJJ A;  3ZSU A;  3BCC E;  2FYU E;  1SZI A;  1PGQ A;  2E5Y A;  2JKV A;  3M9B A;  1HWT C;  3GHG C;  3OA7 A;  2OEV A;  3FHD A;  5GTI E;  3CI9 A;  2VCA A;  2MYS A;  1L4A D;  2OTL P;  1N86 A;  2ZXE B;  2XL8 A;  3A0H H;  2ZVN B;  1LI7 A;  3U2M A;  1KIL D;  2FGY A;  1TR2 A;  2G3V A;  2HR3 A;  1CI6 B;  4MQ9 F;  4PAC A;  2A69 F;  2W45 A;  3EGD B;  1MV8 A;  2B89 A;  1LT9 B;  5A6K A;  2PFD A;  3C8G A;  4DXW A;  3DI5 A;  1FFT C;  1U7J A;  3RK2 B;  4RD9 A;  5AVZ B;  1ZYR F;  3PRJ A;  2HOD A;  4CIP A;  3H1H E;  2JDI H;  1GU5 A;  3RK3 C;  5L0D A;  2A45 I;  3TK0 A;  1FU1 A;  5A6J A;  1RQU A;  4YXD C;  2YO2 A;  1CSB A;  1BDD A;  2PGD A;  3MTU E;  1A02 F;  3TNU B;  3NYL A;  2KYH A;  3RK2 D;  1C17 M;  1FR0 A;  1JR8 A;  1LS4 A;  4GOF A;  3C7J A;  1Z5Z A;  5AVQ B;  1KFM A;  3L71 J;  2BCC D;  1PFI A;  1SQV K;  3Q7L A;  3P8M C;  1H6G A;  2W8Z A;  2ZYA A;  3BAS A;  3U2L A;  5KYU B;  2OGU A;  5L0I A;  5BQI A;  1ZHW A;  1FTS A;  2EPK X;  1U6H A;  1WRG A;  3FAP B;  2E76 B;  2XS1 A;  2BCC J;  3ABK C;  4XA4 A;  1YIJ P;  3QWO C;  3CC7 P;  3GLM A;  1S72 P;  1KV4 A;  4XEV A;  2NUP A;  2YLG A;  3Q7G A;  1NAY A;  3O55 A;  2XXA B;  2W9Y A;  4YXW H;  1S5L X;  5AW1 B;  2C0X A;  4G7H F;  1HH0 A;  5HSW A;  1KYO I;  1L0L D;  3EPV A;  3PTZ A;  2J58 A;  4DRJ B;  1SYQ A;  4J7Y A;  2WT7 B;  2H8P D;  2W27 A;  2LKM A;  2XZR A;  1HF9 A;  3FOP A;  5KLI C;  1FS0 E;  2E76 D;  4CDY A;  2ZFC A;  5L0H A;  2BCC E;  3AE9 C;  2G3K A;  4DJ9 A;  1OXB A;  1YYC A;  2R7U A;  2PP4 A;  4YPC A;  3EFF K;  1MMA A;  4QI0 A;  1OVV A;  2Q7C A;  1HJB A;  5KKZ C;  1E86 A;  5B1A C;  4HE8 D;  2ZVO B;  2PBE A;  1L0L J;  2IYO A;  4Y99 B;  1KB9 H;  3M0D C;  2K3R A;  3GOD A;  3L71 G;  3SNH A;  1VLT A;  3BVH A;  1OCO C;  4CSA A;  3JSZ A;  1NKN A;  1SLQ A;  2KK7 A;  1ZU4 A;  1NBB A;  3Q5S A;  4WB4 A;  2E75 D;  2P1J A;  1J8Y F;  1NFN A;  1KMI Z;  4C46 A;  3EG9 A;  1OFC X;  2FFD B;  4UB8 H;  1H89 A;  2W90 A;  1ZW2 A;  3NRH A;  3LNR A;  2E87 A;  1A7D A;  3N4X A;  2J5U A;  4N6J A;  5AW4 B;  4DRH B;  2N1T C;  2Z15 A;  2BEZ F;  1SFC A;  5DQT A;  3QH9 A;  1Z63 A;  2HSQ A;  4H54 A;  1NTM D;  3UNG C;  4PJM A;  2IYP A;  2WPV B;  2ICW G;  1MQV A;  4HKZ H;  2EPO A;  2LD6 A;  3P7K A;  3U5S A;  2CNW A;  2PNO A;  2KS1 A;  5B5E E;  3ZQY A;  4XPY A;  3IQ5 A;  3WHN A;  4JIO A;  3SYN A;  2WPR A;  3TD7 A;  2KB7 P;  1NTM J;  3CXH E;  4MVR A;  3OAK A;  1U89 A;  1H9T A;  4P6I C;  1MFZ A;  2PF4 E;  2XNX A;  2CYD A;  1WAT A;  2XL6 A;  2OCC C;  3EH1 A;  2L6H A;  3LW5 H;  4UB6 H;  3ABL C;  2WVN A;  1Q0M A;  5CCH A;  5TIS E;  1T9K A;  3II6 A;  1PPJ G;  2R44 A;  1VQ8 P;  1EI7 A;  1BGY D;  3FXH A;  4K35 A;  1WTY A;  3H25 A;  2BEQ D;  3TJ5 A;  1M57 D;  1K04 A;  2A06 D;  3T6J A;  4JYC A;  4I1L A;  2R5B A;  1LTB C;  3IF4 A;  3ZDM A;  1I5N A;  4YL0 A;  1HBW A;  4C7O A;  1PIX A;  1T2K D;  3US6 A;  3N0T A;  4A4A A;  4ZLC A;  1NTZ G;  1Q82 Q;  1WMK A;  3O6Q A;  1BGY J;  4DOJ A;  1VQL P;  2Y3D A;  4IB4 A;  1PD0 A;  3LID A;  2KSJ A;  4BWN A;  4EOT A;  3WU2 H;  3N24 A;  1VQK P;  4O79 A;  4MVS A;  3KH2 A;  4CS9 A;  1NTM G;  4PJL A;  1S05 A;  2WPQ A;  3D6Y A;  3DXJ F;  2VCC A;  2WZF A;  4I2L C;  2PRR A;  2GUS A;  4N06 A;  3M4C A;  3I56 P;  4ER9 A;  1BGY E;  1T6I A;  3EFG A;  3CCV P;  4Q4Z F;  3UMI A;  3P32 A;  3GM3 A;  2W83 C;  2A45 G;  1LWU C;  3HNI A;  3OJA B;  4Z9H A;  3S27 A;  5D92 A;  4LLH A;  1L0L K;  2E75 C;  2J59 M;  5D91 A;  2QUP A;  4F4B A;  2FYZ A;  3UMK A;  2V26 A;  1RE3 A;  3C18 A;  3C8Z A;  2KP8 A;  1S7Z A;  1W2E A;  1OCZ C;  3TGU D;  1M56 D;  1M1J C;  1MUU A;  2FYN B;  3H1K J;  1HVV A;  3RGU A;  3H2U A;  2W4B A;  3C62 A;  4LAC B;  3AG4 C;  1PP9 E;  1BDC A;  2HMZ A;  5CI8 A;  4X0R A;  1SFC D;  1IK7 A;  2BAS A;  3TGU J;  5GTI H;  1SQB D;  1USD A;  2OYI C;  3IQT A;  3A11 A;  4U3F E;  3OEO A;  4IFM A;  1J1E C;  3JSV C;  2Q5U A;  3A0B E;  1NOH A;  1LTJ B;  2CNW D;  4U5C E;  2OJE D;  3AEC C;  1CPR A;  4NTA A;  3H1L E;  2WPS A;  1NTM K;  4FWV A;  1SQB J;  1A0B A;  4DRI B;  3M91 A;  1S3J A;  3TGU E;  1VQ7 P;  4HFF B;  1GS9 A;  3IQ6 A;  2A6H F;  1LGH B;  2R7V A;  3L74 D;  3AGU A;  5KYW A;  1BE3 E;  2R05 A;  3EZI A;  1GD2 E;  1RF1 A;  4KC9 A;  1ZP0 C;  1GMJ A;  1PCX A;  4GYT A;  3RF3 A;  3GF3 A;  1M57 C;  2YKZ A;  2PAJ A;  3NKD A;  3T4R A;  1RE4 A;  1S4X A;  1PZQ A;  2J45 A;  3H1K G;  3B71 A;  3Q2Y A;  1KQG B;  2YXR B;  3AEB C;  2HSB A;  1SQB E;  3VMZ A;  5AVV B;  2K9Y A;  4KHX A;  3U3F A;  2ETS A;  2TMV P;  3IQC A;  2ZT9 C;  5KJ7 A;  2RSE B;  1NTK G;  1UG7 A;  3AG3 C;  5AC4 A;  4PJ0 E;  1LP1 B;  4L73 A;  1IC2 A;  2J0X A;  4IWB A;  3CX5 D;  3W2V A;  1VF5 D;  5KLV D;  3O6X A;  2KNH A;  4PV1 C;  1VYI A;  1ZV8 A;  3GWL A;  4FX5 A;  4RJT A;  4ULV A;  2FKW B;  3GWN A;  2V7Q H;  4DT0 A;  1JOC A;  2KW3 C;  2KC3 A;  5CBN A;  4K3A A;  3L8J A;  1VLS A;  3GOR A;  1HW2 A;  3L74 E;  4PD4 I;  3KZI E;  1Q90 D;  5KLV J;  3EWK A;  3KXD A;  3QMK A;  4HJG H;  1FC2 C;  2XKM A;  1NKZ B;  4OGQ D;  4XPX A;  2LXB A;  4KT0 J;  3RVZ A;  4KI2 A;  1ZLL A;  1KC8 Q;  1YJG A;  4E7S A;  2FAP B;  1VK5 A;  4JJF A;  5BQH A;  2D2C C;  2QA4 P;  1R5I D;  4K7B A;  4AK9 A;  4CSA C;  2P10 A;  2PP6 A;  3CX5 E;  3H1J G;  4K1O A;  3CCL P;  2QY9 A;  4NPD A;  3M1C B;  4WAB A;  5FCL A;  3RFY A;  1N7S C;  4D6T D;  3UGP A;  2NPS A;  1LTI C;  4YJW A;  2A6E F;  2K88 A;  3IN6 A;  2POH A;  1L0N D;  1QL1 A;  1VMA A;  2P2U A;  1SFC C;  4RKU J;  1W2W A;  3CLQ A;  1EXI A;  1RH5 B;  2JWA A;  2YEV A;  3HTK A;  4CPG A;  2AEJ A;  5AW9 B;  1L4A A;  1EKY A;  3MUD A;  1FZC A;  4D6T J;  3C8V A;  1H7I A;  1N2D C;  1D1A A;  1NAF A;  1HGZ A;  4L75 A;  2I1J A;  2AEM A;  1KIL A;  4HFK B;  2O3J A;  5A6B A;  5COG A;  4D4X A;  2L9J A;  5AVY B;  4C3D A;  4TT3 H;  2Z4E A;  2P7V A;  1T5O A;  4XEK A;  3L73 D;  3B0U X;  3L75 G;  5B5E H;  4DVY P;  2VB6 A;  2YKP A;  2RD9 A;  5JRA A;  2O01 J;  2ITA A;  3H1I G;  4H44 D;  2IXM A;  2B9B A;  5AC5 A;  4D6T E;  1M7L A;  1SS1 A;  2R7O A;  1SQQ D;  1SQB K;  2M3B A;  3CXH H;  3ITK A;  4DVZ A;  5CCH C;  1L0N E;  3HUS B;  4B6I A;  1CI6 A;  1LIH A;  3EGD A;  3LEO A;  3X1O A;  2KLV A;  1LT9 A;  2CDQ A;  2MHR A;  2KI7 B;  4NC3 A;  1N7L A;  3FXD A;  4GKG A;  1YTZ T;  2M8R A;  1IW7 F;  1S2E A;  2LXC B;  2X51 A;  1YAU O;  5TIS H;  3ZDL A;  4AL1 A;  3G6E P;  3HE4 B;  1OVU A;  3ABV C;  4DCK A;  1IFP A;  1T8Z A;  4XPW A;  2R7Q A;  3E9V A;  3WAQ A;  2JP3 A;  3TNU A;  3L73 E;  4JEB A;  1JAF A;  1EDK A;  2NRG A;  1VQ6 P;  4M63 A;  3ASN C;  3EHN A;  5JLI A;  1U0B B;  3ZTZ A;  1AFO A;  2YL0 A;  4MS2 A;  4PD4 D;  1IFD A;  1T6Q A;  3GM2 A;  1HGV A;  1SQQ E;  3O8Z A;  1JY2 N;  1SQV E;  4CS9 C;  2WVO A;  1HJ0 A;  4DBQ A;  3V5X A;  5KYU A;  1R5L A;  1D0Y A;  4OGQ C;  5C39 A;  3Q5P A;  1IJD B;  3GMA A;  3L35 A;  3RL0 C;  3M79 A;  3AE6 C;  4CJO A;  3IAO A;  5KLV K;  5CIV A;  1GQA A;  1Q0G A;  2AWY A;  5JVE A;  2Q7R A;  4MVZ A;  4W8P A;  1RY3 A;  2IBF A;  3EGX B;  3K33 A;  2V3C C;  4Z9I A;  1KN7 A;  4JPZ B;  5AGF A;  5CJ4 A;  2QJP C;  5KLI B;  2XXA A;  3RW0 A;  2NSG A;  3RBX A;  5JT4 A;  3DM9 B;  1RE3 C;  2WT7 A;  4IFD K;  2Q9I A;  3CCU P;  5E2Q A;  4RES B;  4EBK A;  3G4X A;  1G2C B;  3A2A A;  2NPS D;  3PJS K;  1SQP G;  3RL0 g;  1G1I A;  2DYS C;  3S90 A;  5FZT A;  1WAS A;  1Q0F A;  1SVF A;  2R5D A;  1HY5 A;  3AQC A;  2Y39 A;  5EK0 A;  2HFE D;  2IM8 A;  2P7J A;  2QTV A;  3LES A;  4LLC A;  4JTC B;  1RQV A;  1YA7 O;  5F28 E;  3W2W A;  4ZKU A;  4QDL A;  2A68 F;  3ZQV A;  1H9G A;  2DYR C;  2FFD A;  1IFN A;  1I4Z A;  2HG5 D;  2N1T B;  1JOG A;  5B3I A;  1L0N K;  3CCJ P;  3KQG A;  4W7Z A;  1KTM A;  5A6B D;  2I8B A;  3AEA C;  3VP8 A;  1Z23 A;  3JC2 2;  3Q6N A;  1OZH A;  5CBO A;  4XE5 B;  3A0B H;  3KKB A;  2W6A A;  4EIY A;  3TSI A;  4EWC A;  2O1K A;  1V54 C;  3NFQ A;  4O6M A;  1RF1 C;  3L71 D;  3VRC A;  1NWQ A;  1GK4 A;  3J06 A;  4GIF A;  4JCH A;  2WSC J;  1P84 I;  2Q1K A;  1GM5 A;  2MWQ A;  1E5W A;  2PX0 A;  1WOL A;  3UGO A;  2WWW A;  5L0C A;  3RVY A;  1GL2 B;  1FOS E;  5JUA A;  4N6H A;  2AWC A;  5KJ7 C;  1SQQ K;  2FXO A;  2FYU G;  2GUV A;  3GW6 A;  3RQE A;  5KYX B;  4XQ1 A;  1KIL E;  1YQ3 C;  3B5N C;  1YJW P;  1MMG A;  3G50 A;  2KSE A;  1S9K D;  3CC2 P;  4RO0 A;  3EJN A;  2KNC B;  1JUN A;  4D4N A;  1RHZ B;  4PJN A;  3F89 A;  4PJ0 H;  3JSE O;  2Q9A A;  1PGJ A;  2J9W A;  5GTH E;  3JCU E;  2WSE J;  3L0I A;  2WZ7 A;  4XLP F;  1GDT A;  3CCQ P;  4ASV A;  3L71 E;  2H7V C;  1XTC C;  4A7P A;  4XWJ A;  1NSG B;  2ZD9 A;  2YIU C;  5CHX A;  1J1D C;  3K1H A;  5BU5 A;  2KXP B;  3AE5 C;  3ZTM A;  3AEE C;  3V2R A;  5CCG A;  5APT A;  4I7Z C;  1Z6A A;  4DZO A;  3KZI H;  2RKL A;  5KAF E;  4U5D E;  2Q3I A;  1CGM E;  5DJT B;  4H0L C;  1JCC A;  1BSH A;  2QM7 A;  5E79 E;  2EPN A;  4IOI H;  1QQ3 A;  2HYN A;  1ZU5 A;  1HE9 A;  3PCV A;  1PPJ D;  2R32 A;  4JW1 A;  4EKW A;  5AVT B;  1BCC G;  2Z5H A;  3NMK A;  2LR2 A;  4E7Z A;  5IY5 C;  3B8E B;  3HJC A;  1FDO A;  2F22 A;  3A5T A;  2OOC A;  3G71 P;  1QX8 A;  1TWG A;  4PFO A;  3CX5 H;  2NPS C;  3L1M A;  2HV7 A;  1HMO A;  3P8C D;  2C03 A;  2EIK C;  3C9I A;  3IHU A;  5EGY A;  3FVY A;  3PH0 A;  4JTD B;  1RKC A;  3VN0 A;  3FMS A;  1QGK B;  4O9B A;  3N7N A;  1EZV I;  1NTZ D;  3HTK C;  1J2J B;  3B4S A;  4WY4 B;  3FXE A;  5KYY B;  4KJM A;  2QJK B;  3QTH A;  3TJ6 A;  3AGT A;  2QE9 A;  2O01 N;  1L4A C;  1L0L E;  3MUD C;  1FZC C;  2YL1 A;  3BRJ A;  3IFM A;  3MFN A;  1M1J B;  2BC5 A;  1Z7Q c;  3NMD A;  3R2P A;  1KIL C;  4HEA J;  1FZF A;  1YZA A;  4ZNC A;  2W6J H;  3GAN A;  1M1K Q;  4B86 A;  4Z1M H;  4ZMD A;  1ZW3 A;  1PPJ E;  1NTZ J;  1Y47 A;  3DAF A;  3C63 A;  1LTS C;  4ZKP A;  2HZ8 A;  1ZR4 A;  4WY4 D;  2VH3 A;  4C3E A;  1LT1 A;  4WWI A;  2Q9B A;  4C3B A;  4MN4 C;  3KPE A;  4XTK A;  4OIN F;  3VYI A;  2OYI B;  3TOL A;  3E70 C;  1APC A;  3P8C E;  1VQP P;  2UWJ E;  2GA0 A;  2AXT E;  4WJ0 A;  1OVR A;  1P84 D;  1ST6 A;  1LT9 C;  2EPL X;  2CGE A;  4WGZ A;  1Q2N A;  1NTZ E;  3RK2 C;  5DVW A;  1DOW A;  2C04 A;  3VOP A;  1G8X A;  3Q6M A;  2YMY A;  1SQX J;  1LTJ A;  3LLI A;  3V6I A;  2XSE A;  3S29 A;  5DS4 A;  1QPU A;  3CWB J;  2GM4 A;  4E17 A;  2XDJ A;  1LS1 A;  5AW7 B;  2LFD A;  3HNK A;  3T6B A;  3FWL A;  1NTM E;  1L3P A;  3NDB B;  4MVO A;  2O01 H;  4FES A;  2VC9 A;  1TFK B;  4BJ5 A;  1MFT A;  3SWF A;  2QEX P;  4WBA A;  1ZHZ A;  3AE2 C;  3K5B A;  1JMM A;  5HV9 A;  4C7N A;  2J9V A;  2H88 C;  1VQO P;  4BRY A;  1M2V B;  5L0J A;  4G7Z F;  1R8E A;  1SF8 A;  4AX2 A;  3HD7 B;  1KYO D;  5AW6 B;  4AUW A;  1FMV A;  1AVY A;  2Y3H A;  4PR9 A;  1D1C A;  3JTL O;  1LP1 A;  2E76 C;  3RIP A;  2JJL A;  5L3Q A;  4U5H A; 
#chains in the Genus database with same CATH homology
 3MIW A;  2C9N Y;  5CCG D;  2WIT A;  5APV A;  3HD7 A;  1H88 A;  1NH4 A;  2XKM A;  5APU A;  4N3Y B;  3MD0 A;  1NKZ B;  2MJZ A;  3HD7 D;  1S9K E;  1QL2 A;  2OYH C;  2JEE A;  5AW0 B;  1URQ B;  1ZLL A;  3VMY A;  5AW2 B;  1N73 C;  1FJK A;  1LWU B;  1BZ4 A;  3A7O A;  1MZ9 A;  3CL3 D;  1ZR2 A;  1WT6 A;  2NPS B;  2PP6 A;  1OR2 A;  1IFI A;  1NU1 K;  1URQ A;  2R3C A;  4N78 E;  2N9B A;  1NO4 A;  3NXS A;  5APW A;  4Y99 C;  3UIA A;  3V2N A;  3WMM 0;  1LWU A;  1SP4 A;  5APX A;  1N7S C;  2KOG A;  3HTK B;  1KFN A;  1RF0 A;  1ZN5 A;  2FYU K;  2NPS A;  1LTI C;  4C7R A;  1EQ1 A;  1N7S B;  1L4A B;  2POH A;  1FZC B;  1HUC A;  3S84 A;  1QL1 A;  2P2U A;  1SFC C;  3V2Q A;  3LIE A;  1FJP A;  1KIL B;  3CLQ A;  2FFD C;  1JY2 P;  1OWA A;  3HTK A;  4JF7 A;  1CZQ A;  5APY A;  2CPS A;  5AW9 B;  1N7S A;  1DH3 A;  1L4A A;  3M06 A;  3M9B A;  3MUD A;  1FZC A;  3GHG C;  1HWT C;  3OA7 A;  1NTZ K;  1H7I A;  1N2D C;  3U59 A;  1NAF A;  1HGZ A;  1X79 B;  2I1J A;  3CI9 A;  1KIL A;  1L4A D;  1J1E B;  5AVY B;  1N86 A;  2ZXE B;  2Z4E A;  1LTG C;  2HOD B;  1KIL D;  2E42 A;  1LPE A;  1CI6 B;  3HE5 B;  1MV8 A;  1LT9 B;  2YKP A;  2L5G B;  2P67 A;  3RK2 B;  1M7L A;  5AVZ B;  1SQB K;  2HOD A;  2M3B A;  1SQX K;  5CCH C;  2XU6 A;  1GU5 A;  3HUS B;  3RK3 C;  1CI6 A;  3HE5 A;  1AEP A;  2A45 I;  2KLV A;  1LT9 A;  1FU1 A;  1X8Y A;  1N7L A;  4GKG A;  1YTZ T;  2M8R A;  2YO2 A;  1CSB A;  3MTU E;  1A02 F;  1GL2 C;  3TNU B;  2W6B A;  3HUS A;  3RK2 D;  1T2K C;  2I1K A;  3HE4 B;  1LS4 A;  5AVQ B;  1KFM A;  3V2P A;  1T8Z A;  1PFI A;  5AVW B;  1SQV K;  5APQ A;  3P8M C;  1GU4 A;  3TNU A;  1LE2 A;  5KTB A;  3BAS A;  3HE4 A;  1JCD A;  1AFO A;  1KZU B;  1IFD A;  5CCG C;  1HGV A;  3O8Z A;  1JY2 N;  3SWY A;  1WRG A;  2HPC B;  1FZE A;  4XA4 A;  1HTL C;  5CJ0 A;  2HLO A;  1IJD B;  3RL0 C;  3L35 A;  5KLV K;  1FOS F;  1OR3 A;  3RL0 B;  5AW1 B;  3KDP B;  1JY3 O;  3HRN A;  2C0X A;  1H8A A;  2HPC A;  1HH0 A;  2OYH B;  1RY3 A;  2J58 A;  2IX7 C;  2WSE H;  2WT7 B;  2H8P D;  2W27 A;  2LKM A;  2XZR A;  1JNM A;  1N73 B;  5CJ4 A;  4LC1 A;  2ZFC A;  3E1I A;  1EQ7 A;  1B68 A;  1YYC A;  2OYH A;  2Q7C A;  1HJB A;  1RE3 C;  5BVZ A;  2WT7 A;  1N73 A;  4IFD K;  5CMZ A;  2Q9I A;  1URQ D;  4Y99 B;  1LTT C;  3M0D C;  4RES B;  1KQL A;  2FXM A;  3T97 A;  3BVH A;  1G2C B;  1A02 J;  1NKN A;  1SLQ A;  2YKO A;  3U1C A;  3A2A A;  2NPS D;  3VP9 A;  4WB4 A;  1G1I A;  2P1J A;  1NFN A;  4WY4 C;  4C46 A;  3H32 B;  1SFC B;  1SVF A;  1CW5 A;  2R5D A;  2FFD B;  1H89 A;  1NTK K;  2HFE D;  1G2C A;  1DEB A;  2P7J A;  3N4X A;  2VRS A;  4N6J A;  3GHG B;  1N7S D;  4ZKU A;  5AW4 B;  1IFJ A;  3H32 A;  2N1T C;  3V4Q A;  5AVS B;  1SFC A;  1XTG B;  1LTA C;  1T3U A;  3VTP C;  2FFD A;  1IFN A;  3MGN A;  2HG5 D;  2N1T B;  1L0N K;  1YTZ I;  3KQG A;  4W7Z A;  3H6P A;  3TK1 A;  3VP8 A;  3P7K A;  3GHG A;  4XE5 B;  2W6A A;  2YKQ A;  3TSI A;  2Z5I A;  1YA9 A;  2KYV A;  2N1T A;  2O1K A;  1VDF A;  2WPR A;  2KB7 P;  3NFQ A;  1RF1 C;  3OAK A;  1NWQ A;  1FDM A;  1GK4 A;  4GIF A;  3RK3 B;  1AQ5 A;  1MFZ A;  2XNX A;  5AVX B;  4AQR D;  3V4W A;  4EIJ A;  3LW5 H;  1E5W A;  3BAT A;  3M0A A;  2WTY A;  2WWW A;  1FBM A;  1GL2 B;  5CCH A;  1FOS E;  3II6 A;  5KJ7 C;  1SQQ K;  2H43 A;  1T3J A;  2GUV A;  5CCH D;  3NTN A;  1GW3 A;  3RK3 D;  3B5N C;  2WSC H;  4C7N B;  5BU8 B;  3M9Q A;  1S9K D;  1GL2 A;  3KYQ A;  3B5N B;  4JYC A;  1IFM A;  4I1L A;  1JUN A;  2R5B A;  1G1J A;  2A45 H;  1LTB C;  4OH8 B;  2YO3 A;  1HBW A;  1T2K D;  1FZB A;  2WZ7 A;  1GDT A;  4DOJ A;  3HD7 C;  3B5N A;  1XTC C;  3LID A;  2KSJ A;  3TYY A;  4EOT A;  5CHX A;  2IFM A;  1J1D C;  2OAR A;  3IR9 A;  5BU5 A;  4I6M C;  3A3Y B;  2YNY A;  3V2R A;  5CCG A;  5APT A;  4DZO A;  3L4F A;  2WPQ A;  3U1A A;  2Q3I A;  5APS A;  1JCC A;  4I2L C;  2QM7 A;  2GUS A;  1IO4 A;  3G3Z A;  2HYN A;  2R32 A;  1URQ C;  5AVT B;  2Z5H A;  1FZA A;  3EFG A;  3P32 A;  3B8E B;  3RL0 D;  1FZG A;  2A45 G;  1LWU C;  3A5T A;  3OJA B;  1NFO A;  1JY2 O;  1RF0 C;  2NPS C;  2IFN A;  4LLH A;  3P8C D;  1L0L K;  3C9I A;  1OXZ A;  2J59 M;  1GW4 A;  3BRT B;  2FYZ A;  1JY3 P;  3VN0 A;  4AYC A;  4O9B A;  3N7N A;  1RE3 A;  3BRV B;  2KP8 A;  1W2E A;  1J2J B;  4WY4 B;  3M0D A;  1M1J C;  1L4A C;  1MUU A;  4W7Y A;  1FZC C;  3PP5 A;  1HVV A;  3IFM A;  1M1J B;  2C9L Y;  5AW5 B;  3NMD A;  3R2P A;  1KIL C;  1FZF A;  1FAV A;  4WY4 A;  4B86 A;  1SFC D;  1EA8 A;  2QM8 A;  1LTS C;  4ZKP A;  1ZR4 A;  2BAS A;  4WY4 D;  1M1J A;  2OYI C;  1DX7 A;  1LTJ C;  4IFM A;  2CPB A;  1J1E C;  3KPE A;  2Q5U A;  2XV5 A;  3VYI A;  2OYI B;  1NOH A;  1LTJ B;  2IPP A;  3P8C E;  4IFF A;  3I5C A;  1JO5 A;  2N1T D;  1LT9 C;  1RF1 B;  2WSF H;  2WPS A;  1NTM K;  1RE4 C;  3EQ2 A;  4HYT B;  3RK2 C;  3M91 A;  5AW3 B;  3VOP A;  2OYI A;  2YMY A;  1LTJ A;  1GZL A;  1GS9 A;  3V5B A;  3HUS C;  1LGH B;  2GM4 A;  2XDJ A;  1GD2 E;  5AW7 B;  1RF1 A;  5AVU B;  3L37 A;  2PAJ A;  1LE4 A;  1RE4 A;  2E43 A;  1NHL A;  4GT1 A;  4M3L A;  2O01 H;  2H7H A;  1Z56 A;  3VMZ A;  3SWF A;  5AVV B;  1JY3 N;  4LGD E;  1SQP K;  3M9H A;  4KHX A;  1VPC A;  3L36 A;  1JTH B;  1GTW A;  1GL2 D;  5KJ7 A;  4WBA A;  1JMM A;  4C7N A;  1IC2 A;  5AVR B;  4N78 D;  1IK9 A;  5KJ7 D;  1ZV8 A;  2O1J A;  1X9V A;  3HD7 B;  5AW6 B;  3VMX A;  4AUW A;  1JTH A;  5AW8 B;  2FKW B;  4JYB A;  3B5N D;  1JOC A;  2KC3 A;  1J1D B;  4W80 A;  2JJL A;  2C0W A;  1GK6 A;  4HH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...