3R2PA

2.2 angstrom crystal structure of c terminal truncated human apolipoprotein a-i reveals the assembly of hdl by dimerization.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
180
structure length
180
Chain Sequence
PPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of C-terminal Truncated Apolipoprotein A-I Reveals the Assembly of High Density Lipoprotein (HDL) by Dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords Apolipoprotein A-I
total genus 68
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.20 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3r2pA02
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 3r2pA01
1LE2A 1H7IA 1AEPA 1BZ4A 1NFOA 1GW3A 1OR3A 1B68A 1EQ1A 1YA9A 1LE4A 1EA8A 1NFNA 3R2PA 1GW4A 1LS4A 2KC3A 1GS9A 1OR2A 1LPEA 3S84A
chains in the Genus database with same CATH superfamily
1AA0A 2A68F 2B89A 3SNHA 4WY4D 1N7SB 4DBRA 1NYHA 2HR3A 2R7XA 3ITFA 3LS0A 2IBZD 2XNDH 1KFMA 4OGQD 2HMZA 2J58A 1ST6A 4J7TA 4D4XA 3L73J 5KJ7A 4DVZA 1NAFA 3QVZA 5A69A 1XWJA 2HJ3A 1OXZA 3CCRP 1AEPA 2UWJE 1TFKB 1ZW3A 1FDMA 4GOEA 3U2LA 2NRGA 1YYXA 1TWCA 1PPJG 4NTFA 4JKVA 3AEFC 4BJTA 4MTFA 1APCA 2IPPA 1KZUB 3PLNA 2XXAB 4BJ5C 3EHNA 1ZHXA 1CW5A 2OU6A 2E75D 2W9YA 1Z5ZA 5KKZC 2QJKB 2HODB 1YDIA 3S9OA 2P1AA 5HV9A 3E7KA 3RH3A 4XA4A 1Z6AA 2G3AA 3AECC 4HJGH 2L81A 1ZU4A 5AVQB 2HV6A 1LWUB 1D1AA 1BBHA 4GKGA 1PP9J 2HV7A 3TGUG 3M9BA 1MMGA 1SYQA 1F1MA 5CBOA 3VTPC 2CNWD 4ULVA 2OTKE 1NU1J 1EDIA 2IYPA 1W2BO 3E1IA 2PFDA 3V2QA 3EHMA 1NO4A 3BCCJ 2JP3A 3G6EP 1ZP0C 1FBMA 3EGDA 3FXEA 4TT3H 1JY2P 3PCVA 2E74C 4IL6E 1Q0DA 5L0IA 1VMAA 3L70E 2D2CC 2R44A 1LTTC 4KC9A 5KAIE 1R4TA 1ZZPA 3FOOA 1H89A 1IFDA 4IFDK 3H1JD 5DJUB 1LTBC 3M0AA 4ULWA 2J5UA 3HNLA 4MVRA 2E75C 1OIPA 1VQ7P 5GTIH 3PDMP 2Q3TA 3Q5SA 3AE3C 1KB9E 1AVOA 3O6XA 1FJPA 1S5LX 1NU1D 1BDCA 1V55C 4YWQA 2J0XA 4XLPF 2E5YA 2KS1A 5KLIC 3AJMA 2E5TA 5BU8B 2FYNC 2J7PA 3IAOA 4OWFA 2IM8A 4PK4A 3V2NA 2NSFA 1USEA 2IBFA 1RHZB 5JS5A 5AW6B 3L34A 4QI2A 3EFOB 2G8YA 3CWBG 1J1DC 3ZWIA 3TJ5A 5KLVD 2ZXRA 1CSBA 2I1KA 3QMKA 4DOJA 2IX7C 3SWKA 3U9MA 3Q7LA 1YYCA 1KQLA 1QX8A 1BE3D 3VYWA 1NZEA 1FZFA 1WGWA 3N24A 4CDAA 5CCGD 4YT8A 2I1JA 4Q4ZF 3K33A 3L72E 2DYRC 4PFPA 1N86A 4G78A 1QEXA 1HY5A 1JTHB 3RW0A 2HSBA 4JCZA 3ABVC 4MVOA 4IGGA 1Y47A 1PPJD 1LTJA 3H1HG 1L4AC 2PAJA 4CX9A 2HG5D 3NFQA 1PZQA 2FKWB 2Y3DA 1KORA 2YMYA 3VYIA 2R03A 2ZVOB 1G4WR 1NHLA 3L74E 1OCZC 4I7ZC 1T01A 3H2UA 5L0HA 4OIRF 1CI6B 3M4CA 2LIGA 5AVXB 1XZQA 4FESA 4JVSA 2KLVA 1BCCE 4N78D 3JZ0A 1FZGA 3Q2YA 1T3UA 4I6MC 4H0LC 3NRHA 2W83C 5DQTA 5AVVB 2KK7A 2OG2A 1G5ZA 4IFMA 4G0HA 3ECSA 1JRAA 1RF1C 1FMVA 1QGKB 4JTDB 2R05A 1S9KD 3KKBA 1NTKD 2DI3A 3TOLA 2HKVA 2KSEA 5KYWA 3F89A 3GORA 1HBWA 1AVOB 2WZLA 1SLQA 5T1DB 1KILC 4U5BE 3QH9A 3JSZA 4XPYA 3CCEP 1YBKA 3H1JG 1SQBG 4EI2A 3EFOA 1HTLC 2EIKC 4U5CE 4YL0A 3KPHA 1ZVZA 3AEGC 3MYFA 4WY4B 4I1LA 3LJBA 3VN0A 5CJ0A 2NPSA 4N6JA 1QZXA 2A69F 2XLHA 1LI7A 4LERA 3FHDA 3G4SP 2N9BA 4XPWA 2GM4A 1YTZI 2IBZI 1G2CB 1GL2B 1L0LJ 4DOZA 2MWQA 5AVTB 5CCGC 4K7BA 2QSIA 3HE5A 3M15A 1HVVA 2V7QH 4Y28J 2VASA 2LCHA 1GQAA 3B5ND 3L73D 4YT4A 4YT2A 1P84E 2OYIC 2QJPC 4X0RA 2KIKA 4U7JA 5AW3B 4GDOA 5JRAA 1BE3G 1VF5D 1D0YA 1P84D 3K1HA 1GU5A 1K8AQ 3TULA 4MVQA 4XEFA 4G7HF 2HLOA 1BE3J 4L76A 3CX5I 3MUDC 1CI6A 1VF5B 2W45A 4YT5A 2LKMA 2JEEA 1L4AA 1J1EB 3JSVC 3WUVA 3C8GB 3N0TA 1NJIQ 1ZW2A 4HE8D 3DZAA 1N1CA 1DEBA 2C9NY 1LGHB 4EDFA 2YQYA 1FZCC 4B86A 3LAYA 3L70J 2WTYA 3B0UX 2MJZA 3EWKA 3TQOA 3G9RA 4W7ZA 3BCCE 4F4BA 1LE2A 2C9LY 2O1JA 1NTMJ 3BEHA 4CIHA 2EPLX 5IY5C 2BEZF 1Q2NA 5GTHE 3H25A 3AQCA 1A7VA 1OWAA 1QQ3A 1NTKG 1LJ2A 3CMAP 2E75B 2KLUA 4WY4A 4FAPB 1Z63A 3OEOA 1M7LA 5F5HA 3ABKC 2FYUG 4AL0A 2KUBA 1S72P 1U6HA 5L3VA 2GUSA 1EKYA 2PFXA 2I8BA 2PP4A 2NUPB 1KV4A 2YHSA 2K9JB 4RJTA 3H1ID 1H7IA 5DS4A 5JT4A 5KJ7D 1NTKK 5KYUB 1NTZJ 2IXOA 4AX2A 4NTBA 1AQTA 1MUUA 4RESB 2AU5A 3I5CA 4CS8C 4DBQA 3GMAA 2XDJA 1NWQA 5L0FA 4EHPA 1Z56A 1V4AA 4YK5A 2L9JA 3Q1MA 5K5GB 1XTGB 3KYIA 1LP1B 1SQQE 3A2AA 1QLEC 3DM9B 1OFCX 1SQBE 3C8ZA 4XEKA 3RBZA 2KZJA 1OX3A 1TWGA 1NTMK 3GM3A 2YO2A 3D6ZA 1BSNA 3C63A 2B88A 4GT1A 2HFED 1KN7A 1YIJP 3HLZA 1L4AB 5KKZB 1I4ZA 2P10A 2ZPAA 3C8GA 4MQ9F 4PJMA 3ZQVA 3FAJA 3BRJA 5F28E 1PIXA 1OXKA 2M64A 2VB6A 4PV1D 1NU7D 3B5NB 4BEMJ 3L72G 4OD5A 1NU9C 2H7BA 4PACA 3L75E 4PD4E 3W68A 4ZMDA 3QZCA 4ANJA 1YA7O 2J7PD 2XLWA 1ZR4A 1DEEG 1YQ4C 4NC3A 4H0LB 5COGA 4KHXA 1C17M 3R7CA 2KNCB 2IYOA 2GWWA 1QVGO 2PGDA 2K9YA 2YNYA 1ORSC 2Q00A 1JCDA 2ASRA 1TKNA 2XLEA 2W6AA 1CGME 3VP9A 1ZV8A 3KL4A 2X0CA 1FMWA 2B9BA 2NPUA 3UIAA 1KYOI 1SS1A 2N1TC 2WPSA 2NUPA 3NKDA 4FWVA 4J30B 3DD7A 4DVYP 3CMEP 2FYZA 4JE9A 1D1CA 2FAPB 2KSJA 3U8VA 1I4YA 4JYBA 1N73B 5D92A 4DXWA 1DOWA 5GTIE 1DH3A 1M2VA 1QKRA 4MW3A 3SP1A 3LEVA 2JX0A 3CLQA 1LTSC 2WSSH 5JVEA 2EIMC 3UMHA 3II6A 1T2KC 3CCQP 1PGOA 1GL2C 4L75A 1ZHTA 3HE4A 1EZVG 1L0NJ 2WPVB 2Q9IA 4J32B 4GEHA 2YKQA 2XRHA 4N4WA 4L6RA 5AW8B 1A41A 4BG0A 1BDDA 1VYIA 4KT0J 1LT9C 2IXPA 3FXDA 3F47A 2IYLD 1PFIA 2FFDA 2A6EF 1OR3A 2YIUC 3W2VA 3HE5B 4JW1A 4NY3A 1LNQA 1KYOD 1IFMA 2YL1A 2R7WA 2IZ1A 4C3EA 4PJ0H 1IK9A 1Q0FA 2EILC 4U5GA 3BASA 4TLFA 4JBZA 3L75J 3JRTA 3S90A 1WN0A 5KYXB 4JIOA 1J1EC 4H4KC 3RBXA 4CBEA 3ABMC 3FAPB 4PJNA 1TU3F 4IRUA 2C0WA 1E79H 4I7ZB 1OW6A 4XFJA 4W8KA 4Z9HA 2C04A 3JSEO 1X79B 1NTMD 2AEJA 3SZRA 1JY3O 3MP7B 3CX5E 1OXBA 4AUWA 2QUPA 1P84H 3F5HA 3AEAC 4EBKA 4IARA 4CIPA 1RXQA 3L70D 3DWWA 2Q5UA 5JLIA 4JRZA 1JR8A 3TF5A 3S27A 2ZXOA 1N8RQ 1H6GA 2JR8A 2YLGA 2ZJSE 1JMMA 2DW3A 3B29A 3E1RA 4U3FJ 2HS5A 1GD2E 3EH1A 3L73E 1NLXA 4C7OB 3H1KG 2Y3HA 1M1JC 1T3JA 1JMWA 2W27A 3S0XA 1L7CA 1SMYF 4U3FE 4EYYQ 4OVNF 4CPGA 3G3ZA 3GEIA 2P7VA 2NPSD 5CCHD 2HFIA 3P8CD 2JDIH 4U3FD 3NG1A 1TWHA 1LVKA 1LPEA 1C03A 1YJNP 3P8CE 3B71A 3H1IJ 2FXMA 2J9BA 1FTSA 1NG1A 5CHXA 4C7NA 1SFCA 4ZLDA 4K3AA 3JTLO 3CWBE 1GDTA 1V54C 4ONSA 3T4RA 5TISE 1QL1A 1JNMA 3ZC4A 4KI2A 1Q0GA 2RD9A 2J59M 4EBJA 3EGXA 5T3TA 2Q7RA 4MN4C 2K37A 3AGUA 3MUDA 4JEAA 3K6BA 1N7LA 2PX0A 2E76D 3PTZA 1T9KA 1KU2A 2QJPB 3VM6A 1NTKE 5APXA 4QI0A 2P2UA 1RQUA 2J9VA 2P1JA 2POHA 2KI7B 2AXCA 3M0DA 4LC1A 3BRTB 1M1KQ 1FAPB 1EXIA 1SQPG 2E76C 2ZT9D 1NOHA 2R7QA 1YARO 3WU2E 1M90Q 3AE9C 2SPZA 3EFFK 5EFWB 1U89A 3Q3DA 2M0BA 3A5TA 3S4RA 1I5NA 4MVZA 3M1CB 2E74D 1J8YF 1FZAA 3H1HJ 2XXAA 1NTKJ 2A1DD 2AVKA 3LLKA 4JPZB 4O6NA 3HTKB 4K1OA 1BGYD 4EIJA 1L0ND 4XEVA 5APYA 1E86A 4LDKA 3WUUA 3UMIA 1NTMG 1RKCA 4DT0A 1NH4A 3NKEA 5KAIH 2L6GA 3B0VC 1BDJB 4YN0B 4C7OA 3AE5C 2WB7A 3H1LG 1LWUA 4DRJB 4AQRD 3TK1A 3RL0g 4K0DA 4WJ0A 1OW7A 3MYIA 1G8XA 3JRMO 3HUSB 2Y69C 4E17A 3GHGC 2P7JA 4KJMA 4JEBA 2IBZG 3OA1A 1GW3A 1UFBA 3L73G 3AE7C 2N1TB 2M3EA 1ZYRF 3EG9B 1SFCD 3L71G 4C46A 2YWAA 3PP5A 2JD3A 1AUEA 3VMZA 2CGEA 4B6IA 5AC4A 5APQA 2JKVA 1ORYA 3GHGA 2Y0EA 3QW0A 2QY9A 3GM1A 3IEEA 2J46A 5TJ5E 1TWAA 4N6CA 1HE1A 1SQVD 4A2NB 1CPQA 5DS5A 2LD6A 2NZ2A 4PJJA 4O7GA 1WATA 3U3FA 1S7ZA 5COFA 5E79H 4I3MA 3IPMO 3TSIA 3L36A 4OD4A 1ZLLA 2VH3A 5AVRB 4ASWA 3CSKA 1YQ3C 1CGOA 2IDBA 2W90A 2H7HA 1LTIC 3I5PA 3O6QA 4N3YB 1PPJE 3M79A 1RKEA 4OINF 4O9BA 1K04A 1KMIZ 1HGVA 3USSA 3DMDA 3JYHA 2ZYDA 3VRCA 2RN0A 2R3CA 1G1IA 3KXDA 3T6GB 1SQBJ 3L1MA 2ZAEB 4H44C 3RL0B 4JYCA 1FZEA 5AW7B 2FYUD 1BR4A 4HYTB 3B9QA 2LXBA 1EDJA 2FGYA 2QE9A 4H13B 3GG2A 2OTLP 3AE8C 2OYHB 2XM0A 1RE3A 4EWCA 2O01N 3OJAB 3CCVP 3M9HA 3BVHA 4JC7A 3CC2P 2KSFA 5B66E 3V4QA 2O3JA 2K3RA 2O01J 3A9CA 3EH2A 1WTYA 1NTZD 4Z1MH 3MGNA 5AVZB 1YJWP 1DIPA 1BR2A 2N1TD 1J2JB 3K7DA 1U57A 3JCUH 4RBNA 2ICWG 2RMZA 4MNDA 2YKOA 4YTPC 3GHGB 3SXZA 3RQFA 1L0NK 5E79E 2R7RA 1QVXA 2E42A 1X0TA 1KILE 2WVRA 1OKKA 4E18A 2ZFCA 4IL6H 3A0BE 4D6TG 1T6QA 2WPQA 1FU1A 2XKMA 1U0BB 4ZNCA 4U5HA 1AFOA 1JY3P 1A7EA 4RD9A 4CJOA 3KMIA 3MTUE 1J1DB 2YLIA 3VMXA 3U9JA 3T97B 2HUJA 3DI5A 4MVUA 1H9TA 4IFFA 3C7JA 2OGUA 1O5HA 4RDAA 3NMIA 2WSFH 2KK1A 4XWJA 2FBWC 3G50A 1X22A 1KQGB 3Q6MA 256BA 1VQ4P 3C62A 2OQQA 2P58A 1K73Q 2EINC 1EC5A 3C8GD 3GWLA 1HF9A 4WBAA 4O6YA 1JAFA 1U7MA 2YRFA 3QW1A 2J9UA 3FOPA 3H1LJ 1MMAA 2J8WA 2YL3A 2OCCC 1RMVA 2PRRA 2AWYA 3T6BA 5B1BC 2QTVA 5B3IA 2CDQA 1MFZA 1PP9D 5AVYB 2XSEA 4PFOA 5M1BA 1K05A 5H2FH 4D6TE 1S5LE 2C03A 4BJ6C 2BCCE 1PP9E 4BJ6A 1JY2O 1PGQA 4OIPF 4JJGA 3SXYA 3HTKC 2D2CD 3T6JA 2H8AA 3IHUA 1SF8A 3X2QC 1HJBA 3H1JJ 2WZFA 2FYUJ 3L4FA 2ZD9A 5A6AA 2OYHC 1JEKA 3K5BA 4XLNF 1PD0A 2OJQA 3U59A 1VQ9P 4MS2A 2I15A 1ZN5A 1G4US 2M3BA 3Q7GA 1HH0A 1CZQA 3HTKA 3RF3A 2FYUK 3BCCD 1OR2A 3TGUJ 3AE4C 2W6JH 1W5CE 1GMJA 1M1JB 3KHUA 2FXPA 2GFHA 4CS8A 3C18A 5B66H 1VQ5P 3G4XA 1ZRTD 4KNWA 3GW6A 1KILA 2XL8A 1NTZK 4R32A 4M3LA 1M57C 3LNMB 3ZG1A 1XTCC 2R5DA 1ORJA 1SQXD 5CI8A 2R5BA 4CS7A 2H88C 1FE6A 1SQQD 3O8ZA 1IO4A 2LFDA 3CX5D 1EZVI 3LNRA 2OEVA 2A06G 1Q86Q 3CXHI 2KB7P 3VMYA 3M4BA 3AG4C 2NUTA 3V5XA 2C0XA 5H2FE 2IXMA 1DD3A 3M06A 2R32A 1SQPE 1SP4A 1Q81Q 1NFOA 3B4SA 1YAUO 3V2RA 4CDVA 4BEJA 1J8MF 3L8IA 4JURI 4OIOF 2PNOA 3RL0C 3K66A 5KYYB 3JC22 4JZAA 3Q6NA 3NYLA 4ASVA 3DAFA 2ZYAA 5AW0B 3VOPA 2B0JA 1URQB 1GGQA 1QLED 5APSA 3CC7P 2E87A 1SQQJ 1FDOA 3ZQYA 1VQ8P 3AEEC 1IFPA 5AGFA 2LR2A 5BQHA 1YYJA 1IK7A 1HE9A 1WOLA 1OW8A 4OGQC 3CD6P 3HJCA 2XZRA 1GK6A 1M6TA 4DZOA 1M1JA 3HD7C 4YXDC 3LIEA 5KAFE 1FJKA 5BQGA 3M91A 2KC3A 1EI7A 3RGUA 3ZTZA 1TFOB 1VQMP 3BATA 2ZXPA 3TK0A 1IZNB 1SQVK 2R7SA 2O01H 1KILB 1X9VA 3H1KE 5CIVA 1OVUA 1RH5B 3AOUA 5AW9B 3T9OA 1JMBA 1IW7F 2BEQD 2FYUE 3L74G 3DM5A 1DOVA 3EGDB 1MNDA 5KLIB 1LTGC 2KS1B 4H0LD 2L5GB 3SXKA 1BCCG 5FCLA 4IAQA 1Z3IX 2QEXP 1LT9A 1M56D 3CWBD 2WT7B 1AJYA 4EOTA 4WB4A 2WMMA 1USDA 1MFTA 1VQPP 2HSQA 3US6A 5EHHA 5E33A 4PV1B 1SQXG 2R02A 3E70C 1JCCA 3CXHH 1T5OA 2OQMA 3FXHA 1SFCC 1WT6A 1SZIA 3W2WA 2YZSA 4GIFA 1GM5A 3AE1C 2RH0A 5L3QA 4BJ5A 4IB4A 4ER9A 4YL1A 3R2PA 2XM4A 2OYIB 2A6HF 4CSAA 1FOSE 1N7SC 1LS4A 1JUNA 4LACB 5D91A 2FFDC 4Q7CA 1D0XA 3WHNA 3H1LD 2QJYB 1VQNP 1SQXK 3S84A 2Q9BA 1L0NE 1WASA 3T97A 1VOMA 3H1HD 4KNVA 3TYYA 1D0ZA 4DJ9A 4A4AA 4Z9JA 3RIPA 4YJWA 3M0DC 4Y99C 2HZ8A 2R7UA 3KZIH 3FDQA 3RK2D 1S1CX 3H1JE 4NCQA 3NMJA 2JJLA 2K1AA 1JTHA 3EZHA 2BCCJ 2R25A 5L0JA 1NTME 3ZVRA 5AC5A 5KLVE 1SQVG 3D70A 1URQD 5DS6A 5K0IA 1Y9BA 3EFGA 2MHRA 3S29A 3GM2A 1A0BA 1IZMA 3TGUE 2M5AA 1Q7YQ 4GQHA 4OIQF 5FZTA 1MZ9A 3QVYA 3U1AA 3EJNA 2Q9AA 2P61A 2Z5IA 3ITKA 1YITP 2GAQA 4PJLA 2H7VC 2IBZE 3CCSP 1LS1A 1OKKD 2PP6A 3L0IA 4CS9C 2Y39A 4UB8H 1FDIA 3U1CA 4CS9A 1FAVA 1EZVD 5AVSB 3SWYA 1H88A 3CX5H 3O10A 3CAXA 2A0BA 1LIHA 2Y3GA 2WT7A 4ZKPA 1JM0A 3IF4A 1E5WA 1QSPA 4YPCA 1YHQP 1NFNA 5APVA 3ZTMA 3LEOA 2IXNA 3QWOC 3V2PA 1JPNA 4U9EA 4XPXA 2H43A 4DJGA 1IJDB 1H9GA 3D6YA 4ZKUA 3DJNB 3AG1C 3RK3E 3JT1A 3U5SA 1BCCD 4N78E 4D4NA 4QMAA 1R5LA 2W8ZA 1N7SD 2A0UA 2X51A 4IWBA 4AK9A 3L8JA 2WVNA 4PD4I 1E84A 1S4XA 4XQ1A 3C8VA 5T3WA 1DX7A 2ZT9C 3KPEA 2A06E 4I1MA 3SYNA 3A7OA 4WY4C 2JPUA 1VYKA 1RE4C 5CCHC 3L74J 2DYSC 1FFTC 4IJJA 4NPEA 1NTZG 2IFNA 2GA0A 3W67A 1ZHZA 3WU2H 5A6KA 1T8ZA 3V6IA 1YI2P 4O79A 1Q0KA 3M9QA 3UNGC 1D7MA 1ZHYA 3EGXB 3NTNA 2XLOA 1EXJA 2NUTB 3A11A 3HNIA 3C1LA 1E2XA 5C39A 1MQVA 2O9XA 4E0IA 2ITAA 2YEVA 4MTGA 4E0HA 4P9FA 1A7DA 1VLTA 2OJED 1URQC 1Y4CA 2ZXWC 1P84I 1KYOE 1VPCA 3U8PA 2QJKC 2D5RB 5KLVJ 2MYSA 2IOQA 3FWNA 3BRVB 1NAYA 2QM7A 1FZBA 5AW2B 1VB5A 2KYHA 3X1OA 3I5QA 4BXLA 3RVYA 1OZHA 3CPWO 4LLHA 2R3SA 1URQA 1LWUC 4QDLA 2VC9A 4U9DA 2P0NA 2P67A 2Q1KA 3H1KJ 1Q82Q 3J06A 2WVOA 2KP8A 2XLMA 1R8EA 3CWBJ 3V5BA 3WODF 2XS8A 2NPSC 3SFEC 1SQQK 3OAKA 2R7TA 3P7KA 1N73C 2HJMA 1EZVE 1M56C 3CEXA 1D1BA 3H1IG 3H32B 2K9JA 4BJ1A 3O55A 3RK3B 5TJHA 1YTZT 3KDPB 1Q0MA 1RJ9A 5EK0A 3LS1A 2AWCA 5JP7A 4BRYA 1O3UA 5B5EH 1IFJA 2VCCA 4E7SA 4C3DA 3L75G 1KB9D 3WMM0 3GEHA 1LT9B 4OH8B 3DE8A 2CPBA 1JY3N 3HRNA 1FFHA 2YL0A 2WSFJ 5APUA 4W80A 2B0HA 1KB9I 1T6IA 3MX3A 3HD7D 3L37A 2Y3BA 2ZT9B 3HKKA 2YLDA 1L0LD 3AEDC 1SQPJ 1KYOH 4HFKB 5DLJA 3SEOA 3N4XA 1O87A 2WSCJ 1L0NG 4PJ0E 4J7YA 1H8AA 2YKZA 2J9WA 3RQGA 1NU1G 2E76B 2HODA 4Y99B 2F22A 1KC8Q 1LP1A 4UB6H 3FWLA 4Q5SF 1AVYA 3IN6A 3CCMP 1QVFO 2QNLA 3UGPA 1LE4A 3L72D 3KYQA 2AXTE 5B5EE 2L7AA 2M4EA 3FX0A 1SQXE 1RF0A 1CGNA 2G3VA 2UUHA 5DQZA 1BGYE 3Q5RA 3UR3C 4H13D 4P9TA 3ZSUA 3KZIE 1PD1A 4H44B 3KQGA 5DJTB 1JOCA 3QTHA 2XS1A 5GTHH 1VF5C 1LKXA 2Q3EA 3RL0D 2DB4A 3NXSA 1SQBK 1IFIA 2KJGA 1WMKA 1SQXJ 2G3KA 5L0DA 1ZW0A 3H32A 1FZCB 4NPDA 3EZIA 2HMQA 3AEBC 4I2LC 3H1HE 1SR2A 2KGOA 3HNKA 1RJ9B 4RKUJ 2G62A 1PV3A 2EPOA 5COMA 4UB6E 4DRIB 4BWNA 1ZMEC 4O6MA 4BRYB 2FYNB 2Q9CA 2YVKA 3RK2C 2CCYA 4UB8E 1FNTc 1G1JA 2ZXEB 2H89C 4KBLA 3CXHD 3L72J 2MKVA 1GL2D 1VDFA 4EUKB 4JF7A 1OCCC 3VMAA 2L6FA 2V4HA 1VK5A 4PV1C 1UIIA 1W2EA 3I55P 4EKWA 1HW1A 3S1KA 3JCUQ 1KILD 1H0TB 4I1OB 1LT1A 2R9RB 2E43A 2WL8A 3LIDA 2QE7H 3TNUB 1N73A 3L75D 4PD4D 4JQ0D 2FFHA 2VRSA 3KH2A 2FFDB 4U5DE 3TD7A 2YIUB 3SFDC 1ZU5A 1MMNA 2WSEH 1FS0E 3W4YA 5JSLA 3RYLA 3HE4B 1TR2A 3W8HA 1L0LG 1L2PA 4EIYA 3H65A 5HSWA 1KNYA 5CI9A 1LTJC 3MHVA 3K1IC 3SSUA 3NYJA 3L74D 2WZGA 3U0CA 3PHLA 1UG7A 3IQTA 1BE3E 2VCBA 3I56P 4BPMA 1M57D 4MVSA 3ASNC 3DXJF 3O39A 1L0LK 4OGQB 2V7QJ 3FGAD 2Y0DA 3SWFA 3ASOC 1EDKA 4MVMA 1M2OA 5EGYA 1KD1Q 4MW8A 1BZ4A 1BCCJ 2JWAA 1Q90D 1VQKP 3L71E 3SXMA 5KYXA 4D6TJ 2LSEA 2LK4A 5L0GA 3RKOF 5E3AA 4LDRA 1IC2A 3V5ZA 4DRHB 1FZCA 2Q3IA 4I44A 3G4ZA 2JWDA 2V26A 1RF1A 3I4UA 3H1KD 3VF0A 1AV1A 3LW5H 5AVWB 1YLMA 3H1LE 3L35A 1Y8AA 1BSHA 2J45A 5APWA 3CL3D 2V3CC 1X8YA 3NMDA 2UUIA 3U3BA 2CNWA 1NTZE 2XU6A 2CPSA 1KTMA 4LLCA 1RCPA 3L70G 1Z23A 2IFMA 1A02F 4PD4H 3LUTB 2WWWA 4R4LA 3AQBA 2YXRB 3H1IE 3VAYA 1GW4A 2H7OA 5L0CA 1JOGA 2JO1A 4HEAJ 1YZCA 4R4MA 3EPVA 1GS9A 1OMIA 3TNUA 2W4BA 4U5EE 2WQYC 1G2CA 2N9YB 2AXTH 5F5FA 1GL2A 5AW4B 4FX5A 5CMZA 4WABA 1QPUA 3JYYA 2RSEB 1EDLA 2CW0F 1YZAA 3TGUD 2P6VA 1S2EA 2QJYC 4U3FG 3LW5J 3OA7A 2AEMA 2BE5F 2KW3C 2PX3A 3B0PA 2BASA 1YVIA 2QM8A 1RY3A 3WAQA 3WG7C 1SQPD 5A6BD 5CJ4A 2XL4A 4AL1A 3TJ6A 1FOSF 3CQZA 5GPGB 4JJFA 2Q7CA 1HMDA 4LGDE 1T2KD 4AYCA 3AG3C 3GWNA 3CXHE 4H13C 2OKUA 3F46A 2BC5A 5CCGA 1SQVE 1QL2A 1C02A 2B87B 4L74A 4NTAA 3MD0A 1HUCA 3PRJA 2W4MA 4HH2A 4PR9A 4JCHA 5KYYA 2WSCH 2YKPA 4GYTA 2QG4A 1NU1E 1PCXA 4W8PA 1PGPA 2HYNA 5DVWA 4AE4B 3UMKA 4EBBA 5CBNA 3CC4P 1EQ1A 2KXPB 4IL6X 5KLVG 4MTOA 3FMSA 3HUSA 3PMRA 1RE3C 1Z7Qc 2O1KA 2Q4FA 1T6AA 3L71J 1EQ7A 2N1TA 1K40A 5AVUB 3EG9A 2Y9YA 4GOFA 1SQVJ 3DJUB 3WUTA 1BGYG 5BUOA 2ETSA 1UIXA 1JB0J 3HD7A 3H6PA 2NG1A 4IAOA 3H2VA 3P32A 2A06D 1Y6DA 2E74B 2EIJC 2BCCD 3V5YA 4XTKA 4G7OF 3CCLP 4HFFB 4XE5B 3NYMA 1S3JA 2KQ9A 3RK2B 3ABLC 2ZXXA 1S9KE 5B1AC 3GODA 3RK3D 3CCJP 1N7SA 5KYUA 1OCOC 2Y0CA 1KB9H 2H8PD 4WVZA 5BU5A 2WITA 4LLEA 3MFNA 2XV5A 3AE6C 5A6BA 3L71D 5AW5B 2CK3H 2XNXA 4UDVA 4CJGA 4CDYA 1HJ0A 1JY2N 5E3CA 1VTMP 2QIWA 4E7ZA 1YJ9P 3EQ2A 2HPCA 4P6IC 3POVA 3GEEA 4M63A 3ZDMA 4CSAC 1YA9A 2EPNA 1S05A 3TOMA 1BGYJ 2XL6A 1RKEB 1E83A 1AQ5A 4GODA 2WZ7A 3PJSK 1H0TA 3JCUE 1WWPA 1PGJA 5BQIA 3V7OA 1ZRTE 2DGJA 1NBBA 1JPJA 5KAFH 4WGZA 2XLDA 1XZPA 4WGYA 1KFNA 2OYIA 4NPFX 3ZDLA 2W6BA 1NKNA 2OARA 2WSEJ 1NVOA 2YO3A 3NDBB 3O6QB 2YMKA 3B5NC 1OQCA 3DE9A 3B5NA 1KQFB 2KZIA 5KLVK 3CZ6A 2LFFA 1SQBD 1ZXGA 2ZVNB 1SQPK 2BL2A 2LXCB 1DD4A 5APTA 1R5SA 1NSGB 1OVRA 5E2QA 2FY8A 4HKZH 3K1IA 2KNCA 4H44D 1R5ID 1YJGA 1A02J 2A45G 1L3PA 1HW2A 3GF3A 2OYOA 1JO5A 1HMOA 2Y9ZA 3G71P 3HD7B 3KYJA 2QVAA 3PH0A 1ZHWA 3IQCA 5A6JA 2GUVA 4RO0A 1BR1A 2Z4EA 1V74B 4JTAB 3RQEA 3NMKA 1GK4A 2OYHA 2Z5HA 2QLAA 1HWTC 3IR9A 3DKAA 2M5AB 3EQLF 2L6HA 4C7RA 3ZIBA 2KOGA 3LESA 2OOCA 3RK3C 1RF1B 1U7JA 5KYNA 2OTJP 3GLMA 1TQGA 2Z15A 1FC2C 3RVZA 3V4WA 1MV8A 3IQ5A 2QA4P 2AP3A 1SVFA 2FXOA 2IZ0A 1K9MQ 1GU4A 1L0LE 1RQVA 1VLSA 1M2VB 3R4YA 3W8IA 2BCCG 5KJ7C 2I8DA 2PBEA 2HPCB 2J0WA 1S5LH 4U5FE 4JTCB 1EA8A 3A0HE 1GTWA 2TMVP 1N2DC 1VQLP 2YL7A 1WRGA 2D4UA 4N06A 3MIWA 4D6TD 1M8OB 1B68A 5B3SC 3E9VA 4DCKA 1LI5A 1LM3B 3Q5PA 3RFYA 3AE2C 3DAGA 2R7VA 4L73A 2A45I 3N2ZB 2KNHA 1LTAC 3N7NA 3VP8A 1T6UA 3C9IA 4WWIA 3A0BH 1RE4A 5CCHA 5JUAA 1PP9G 3B8EB 5L8RJ 3HNJA 1LTJB 1RF0C 4N6HA 1VQOP 4ZLCA 1KQSO 1E85A 2Q6QA 1OVVA 1VQ6P 2WVQA 3D71A 2EPKX 2RKLA 2YXQB 2NSGA 5AW1B 3OW2O 3UGOA 2KYVA 2CYDA 1MNEA 4C3BA 5KTBA 2EPMX 2OEXA 1W2WA 1MKMA 3A3YB 1HGZA 3TDKA 2GDCA 2R7OA 3LLIA 3MLGA 2WPRA 3U2MA 4LDQA 4NQFA 4G7ZF 1CPRA 2M8RA 2B87A 2GA1A 2K88A 4A7PA 3GF7A 3MBGA 1FR0A 1ZOYC 4K35A 1GZLA 4YXWH 2VCAA 1IFNA 4Z9IA 4AE4A 4IOIH 2LP4A 3AGTA 1OCRC 5KYWB 2ZYGA 2D2CB 3GANA 1NKZB 1NU1K 3AG2C 4YL3A 1NGMB 4H54A 3IQ6A 2QRXA 4HB1A 3HUSC 3CCUP 3OWTA 5TISH 2A45H 2LQGA 4W7YA 3BCCG 3CI9A 2L91A 3IFMA 1VL2A 3S28A 5BVZA 2NPSB 1SQQG 2XLVA 3PHF2 3A0HH 4C7NB 1L4AD 1MMDA 1SFCB 3MZWB 1PL5A 2AEFA 3FVYA 2PF4E 3P8MC 3ATPA 1ZR2A
chains in the Genus database with same CATH topology
1W2EA 2R5BA 1DH3A 3CLQA 4WY4D 1LTSC 1N7SB 1KILD 3II6A 1T2KC 3O8ZA 1IO4A 2E43A 3LIDA 1GL2C 1KFMA 3TNUB 1N73A 2J58A 3HE4A 2Q9IA 2VRSA 2KB7P 3VMYA 2FFDB 2YKQA 5KJ7A 5AW8B 1NAFA 2C0XA 2WSEH 3M06A 1LT9C 2R32A 1OXZA 3HE4B 1SP4A 1PFIA 1AEPA 1NFOA 2FFDA 1OR3A 3V2RA 1FDMA 3HE5B 1LTJC 1IFMA 2IPPA 3RL0C 1KZUB 1IK9A 1CW5A 3BASA 2HODB 5AW0B 3VOPA 1L0LK 1J1EC 1URQB 3SWFA 5APSA 4XA4A 2C0WA 1BZ4A 1X79B 5AVQB 1LWUB 1JY3O 4GKGA 4AUWA 2XZRA 3M9BA 1GK6A 3VTPC 1IC2A 1FZCA 2Q3IA 4DZOA 1M1JA 3HD7C 1RF1A 3LIEA 1FJKA 2Q5UA 3M91A 3LW5H 5AVWB 3E1IA 3V2QA 2KC3A 3L35A 1NO4A 5APWA 3CL3D 1FBMA 1JMMA 1X8YA 3BATA 3NMDA 1SQVK 1JY2P 2O01H 1KILB 1X9VA 2XU6A 2CPSA 1GD2E 1LTTC 5AW9B 1M1JC 1T3JA 1H89A 2W27A 1IFDA 2IFMA 1A02F 4IFDK 2WWWA 1LTGC 1LTBC 3G3ZA 3M0AA 2NPSD 1GW4A 5CCHD 2L5GB 3P8CD 1LT9A 1GS9A 3TNUA 2WT7B 1LPEA 4EOTA 4WB4A 3P8CE 1G2CA 1FJPA 1GL2A 2FXMA 5AW4B 5CMZA 5BU8B 5CHXA 4C7NA 1JCCA 1SFCA 3V2NA 1SFCC 1WT6A 5AW6B 1GDTA 4GIFA 3OA7A 1JNMA 1QL1A 1J1DC 2BASA 2QM8A 1RY3A 3R2PA 2J59M 2OYIB 1CSBA 2I1KA 1FOSE 1N7SC 1LS4A 1JUNA 3MUDA 2FFDC 1N7LA 4DOJA 2IX7C 5CJ4A 1SQXK 3S84A 1YYCA 3T97A 1KQLA 1FOSF 1FZFA 3TYYA 5APXA 5CCGD 2I1JA 2Q7CA 2P2UA 4LGDE 1T2KD 4AYCA 2P1JA 1N86A 2POHA 3M0DA 4LC1A 3BRTB 3M0DC 1JTHB 4Y99C 1NOHA 3RK2D 1LTJA 1L4AC 2PAJA 5CCGA 1QL2A 2HG5D 3NFQA 3MD0A 1HUCA 2JJLA 3A5TA 2FKWB 1JTHA 4HH2A 2YMYA 3VYIA 2WSCH 2YKPA 1FZAA 1NHLA 1URQD 2HYNA 3EFGA 3HTKB 4EIJA 1CI6B 5APYA 1EQ1A 5AVXB 3HUSA 2KLVA 1NH4A 1RE3C 4N78D 1MZ9A 1FZGA 2O1KA 1T3UA 4I6MC 3U1AA 1EQ7A 2N1TA 5AVUB 1LWUA 5AVVB 2Z5IA 4AQRD 4IFMA 3TK1A 3HD7A 1RF1C 3H6PA 3HUSB 2PP6A 3GHGC 2P7JA 1S9KD 1GW3A 3P32A 3U1CA 1FAVA 2N1TB 5AVSB 3SWYA 1SFCD 1H88A 4C46A 2WT7A 3PP5A 4XE5B 4ZKPA 1HBWA 3RK2B 1E5WA 3VMZA 1S9KE 1SLQA 3RK3D 1NFNA 1N7SA 1KILC 5APVA 5APQA 3GHGA 2H8PD 3V2PA 5BU5A 2H43A 2WITA 2XV5A 1HTLC 1IJDB 4ZKUA 5AW5B 2XNXA 4WY4B 4I1LA 1JY2N 4N78E 3VN0A 5CJ0A 2NPSA 4N6JA 1N7SD 3EQ2A 2HPCA 2N9BA 2GM4A 1YTZI 1DX7A 3KPEA 1G2CB 1YA9A 1GL2B 3TSIA 3L36A 3A7OA 4WY4C 1AQ5A 5AVTB 5CCGC 2WZ7A 1ZLLA 1RE4C 5AVRB 5CCHC 3HE5A 1HVVA 2IFNA 2H7HA 1LTIC 1T8ZA 3B5ND 4N3YB 3M9QA 1KFNA 2OYIA 4O9BA 3NTNA 2OYIC 1HGVA 5AW3B 2W6BA 1NKNA 2OARA 2R3CA 1G1IA 2YO3A 3B5NC 3B5NA 5KLVK 1GU5A 3RL0B 4JYCA 2HLOA 1FZEA 1URQC 5AW7B 1CI6A 1SQPK 4HYTB 1VPCA 5APTA 2LKMA 2JEEA 1L4AA 1J1EB 3BRVB 2QM7A 1FZBA 5AW2B 1A02J 2OYHB 2A45G 1RE3A 3OJAB 1JO5A 1DEBA 3M9HA 4LLHA 3BVHA 3HD7B 1LGHB 1URQA 2C9NY 1LWUC 3V4QA 1FZCC 2GUVA 2Z4EA 4B86A 2P67A 2WTYA 3MGNA 1GK4A 2OYHA 2Z5HA 2KP8A 2MJZA 5AVZB 1HWTC 4W7ZA 3IR9A 2N1TD 1J2JB 4C7RA 3V5BA 2KOGA 1LE2A 2NPSC 2C9LY 3RK3C 1RF1B 2O1JA 2YKOA 3GHGB 1SQQK 3OAKA 3V4WA 1MV8A 1L0NK 1SVFA 3P7KA 1N73C 1GU4A 1OWAA 3H32B 2E42A 4WY4A 2ZFCA 1M7LA 5KJ7C 3RK3B 1YTZT 3KDPB 2WPQA 1FU1A 2HPCB 2XKMA 2GUSA 1EA8A 1AFOA 1GTWA 1N2DC 1H7IA 1IFJA 1WRGA 5KJ7D 1NTKK 1JY3P 3MIWA 1MUUA 4RESB 3WMM0 3I5CA 3MTUE 1J1DB 2XDJA 1LT9B 1NWQA 1B68A 4OH8B 2CPBA 1JY3N 3HRNA 3VMXA 5APUA 4W80A 1Z56A 4IFFA 3HD7D 3L37A 2WSFH 1XTGB 2A45I 3A2AA 1LTAC 3N7NA 3VP8A 3C9IA 1RE4A 5CCHA 3N4XA 4WBAA 3B8EB 1H8AA 1NTMK 1LTJB 1RF0C 2YO2A 2HODA 4Y99B 4GT1A 2HFED 1L4AB 1LE4A 3KYQA 1MFZA 5AW1B 5AVYB 2KYVA 5KTBA 1RF0A 3A3YB 1HGZA 1JY2O 3B5NB 2WPRA 3KQGA 1HJBA 1JOCA 3L4FA 2M8RA 2OYHC 1ZR4A 3RL0D 1GZLA 3U59A 4KHXA 1ZN5A 3NXSA 1IFNA 1SQBK 2M3BA 2YNYA 1HH0A 1CZQA 1IFIA 3HTKA 1JCDA 2FYUK 2W6AA 1OR2A 3H32A 1NKZB 3VP9A 1NU1K 1ZV8A 1FZCB 1M1JB 4I2LC 3HUSC 3UIAA 2A45H 4W7YA 2N1TC 2WPSA 3CI9A 3IFMA 1KILA 5BVZA 2FYZA 1NTZK 3RK2C 2NPSB 1G1JA 2ZXEB 4M3LA 4C7NB 1L4AD 1SFCB 1XTCC 2KSJA 2R5DA 1GL2D 1VDFA 4JF7A 4JYBA 3P8MC 1N73B 1ZR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE2 A;  1H7I A;  1AEP A;  1BZ4 A;  1NFO A;  1GW3 A;  1OR3 A;  1B68 A;  1EQ1 A;  1YA9 A;  1LE4 A;  1EA8 A;  1NFN A;  3R2P A;  1GW4 A;  1LS4 A;  2KC3 A;  1GS9 A;  1OR2 A;  1LPE A;  3S84 A; 
#chains in the Genus database with same CATH topology
 1AA0 A;  2A68 F;  2B89 A;  3SNH A;  4WY4 D;  1N7S B;  4DBR A;  1NYH A;  2HR3 A;  2R7X A;  3ITF A;  3LS0 A;  2IBZ D;  2XND H;  1KFM A;  4OGQ D;  2HMZ A;  2J58 A;  1ST6 A;  4J7T A;  4D4X A;  3L73 J;  5KJ7 A;  4DVZ A;  1NAF A;  3QVZ A;  5A69 A;  1XWJ A;  2HJ3 A;  1OXZ A;  3CCR P;  1AEP A;  2UWJ E;  1TFK B;  1ZW3 A;  1FDM A;  4GOE A;  3U2L A;  2NRG A;  1YYX A;  1TWC A;  1PPJ G;  4NTF A;  4JKV A;  3AEF C;  4BJT A;  4MTF A;  1APC A;  2IPP A;  1KZU B;  3PLN A;  2XXA B;  4BJ5 C;  3EHN A;  1ZHX A;  1CW5 A;  2OU6 A;  2E75 D;  2W9Y A;  1Z5Z A;  5KKZ C;  2QJK B;  2HOD B;  1YDI A;  3S9O A;  2P1A A;  5HV9 A;  3E7K A;  3RH3 A;  4XA4 A;  1Z6A A;  2G3A A;  3AEC C;  4HJG H;  2L81 A;  1ZU4 A;  5AVQ B;  2HV6 A;  1LWU B;  1D1A A;  1BBH A;  4GKG A;  1PP9 J;  2HV7 A;  3TGU G;  3M9B A;  1MMG A;  1SYQ A;  1F1M A;  5CBO A;  3VTP C;  2CNW D;  4ULV A;  2OTK E;  1NU1 J;  1EDI A;  2IYP A;  1W2B O;  3E1I A;  2PFD A;  3V2Q A;  3EHM A;  1NO4 A;  3BCC J;  2JP3 A;  3G6E P;  1ZP0 C;  1FBM A;  3EGD A;  3FXE A;  4TT3 H;  1JY2 P;  3PCV A;  2E74 C;  4IL6 E;  1Q0D A;  5L0I A;  1VMA A;  3L70 E;  2D2C C;  2R44 A;  1LTT C;  4KC9 A;  5KAI E;  1R4T A;  1ZZP A;  3FOO A;  1H89 A;  1IFD A;  4IFD K;  3H1J D;  5DJU B;  1LTB C;  3M0A A;  4ULW A;  2J5U A;  3HNL A;  4MVR A;  2E75 C;  1OIP A;  1VQ7 P;  5GTI H;  3PDM P;  2Q3T A;  3Q5S A;  3AE3 C;  1KB9 E;  1AVO A;  3O6X A;  1FJP A;  1S5L X;  1NU1 D;  1BDC A;  1V55 C;  4YWQ A;  2J0X A;  4XLP F;  2E5Y A;  2KS1 A;  5KLI C;  3AJM A;  2E5T A;  5BU8 B;  2FYN C;  2J7P A;  3IAO A;  4OWF A;  2IM8 A;  4PK4 A;  3V2N A;  2NSF A;  1USE A;  2IBF A;  1RHZ B;  5JS5 A;  5AW6 B;  3L34 A;  4QI2 A;  3EFO B;  2G8Y A;  3CWB G;  1J1D C;  3ZWI A;  3TJ5 A;  5KLV D;  2ZXR A;  1CSB A;  2I1K A;  3QMK A;  4DOJ A;  2IX7 C;  3SWK A;  3U9M A;  3Q7L A;  1YYC A;  1KQL A;  1QX8 A;  1BE3 D;  3VYW A;  1NZE A;  1FZF A;  1WGW A;  3N24 A;  4CDA A;  5CCG D;  4YT8 A;  2I1J A;  4Q4Z F;  3K33 A;  3L72 E;  2DYR C;  4PFP A;  1N86 A;  4G78 A;  1QEX A;  1HY5 A;  1JTH B;  3RW0 A;  2HSB A;  4JCZ A;  3ABV C;  4MVO A;  4IGG A;  1Y47 A;  1PPJ D;  1LTJ A;  3H1H G;  1L4A C;  2PAJ A;  4CX9 A;  2HG5 D;  3NFQ A;  1PZQ A;  2FKW B;  2Y3D A;  1KOR A;  2YMY A;  3VYI A;  2R03 A;  2ZVO B;  1G4W R;  1NHL A;  3L74 E;  1OCZ C;  4I7Z C;  1T01 A;  3H2U A;  5L0H A;  4OIR F;  1CI6 B;  3M4C A;  2LIG A;  5AVX B;  1XZQ A;  4FES A;  4JVS A;  2KLV A;  1BCC E;  4N78 D;  3JZ0 A;  1FZG A;  3Q2Y A;  1T3U A;  4I6M C;  4H0L C;  3NRH A;  2W83 C;  5DQT A;  5AVV B;  2KK7 A;  2OG2 A;  1G5Z A;  4IFM A;  4G0H A;  3ECS A;  1JRA A;  1RF1 C;  1FMV A;  1QGK B;  4JTD B;  2R05 A;  1S9K D;  3KKB A;  1NTK D;  2DI3 A;  3TOL A;  2HKV A;  2KSE A;  5KYW A;  3F89 A;  3GOR A;  1HBW A;  1AVO B;  2WZL A;  1SLQ A;  5T1D B;  1KIL C;  4U5B E;  3QH9 A;  3JSZ A;  4XPY A;  3CCE P;  1YBK A;  3H1J G;  1SQB G;  4EI2 A;  3EFO A;  1HTL C;  2EIK C;  4U5C E;  4YL0 A;  3KPH A;  1ZVZ A;  3AEG C;  3MYF A;  4WY4 B;  4I1L A;  3LJB A;  3VN0 A;  5CJ0 A;  2NPS A;  4N6J A;  1QZX A;  2A69 F;  2XLH A;  1LI7 A;  4LER A;  3FHD A;  3G4S P;  2N9B A;  4XPW A;  2GM4 A;  1YTZ I;  2IBZ I;  1G2C B;  1GL2 B;  1L0L J;  4DOZ A;  2MWQ A;  5AVT B;  5CCG C;  4K7B A;  2QSI A;  3HE5 A;  3M15 A;  1HVV A;  2V7Q H;  4Y28 J;  2VAS A;  2LCH A;  1GQA A;  3B5N D;  3L73 D;  4YT4 A;  4YT2 A;  1P84 E;  2OYI C;  2QJP C;  4X0R A;  2KIK A;  4U7J A;  5AW3 B;  4GDO A;  5JRA A;  1BE3 G;  1VF5 D;  1D0Y A;  1P84 D;  3K1H A;  1GU5 A;  1K8A Q;  3TUL A;  4MVQ A;  4XEF A;  4G7H F;  2HLO A;  1BE3 J;  4L76 A;  3CX5 I;  3MUD C;  1CI6 A;  1VF5 B;  2W45 A;  4YT5 A;  2LKM A;  2JEE A;  1L4A A;  1J1E B;  3JSV C;  3WUV A;  3C8G B;  3N0T A;  1NJI Q;  1ZW2 A;  4HE8 D;  3DZA A;  1N1C A;  1DEB A;  2C9N Y;  1LGH B;  4EDF A;  2YQY A;  1FZC C;  4B86 A;  3LAY A;  3L70 J;  2WTY A;  3B0U X;  2MJZ A;  3EWK A;  3TQO A;  3G9R A;  4W7Z A;  3BCC E;  4F4B A;  1LE2 A;  2C9L Y;  2O1J A;  1NTM J;  3BEH A;  4CIH A;  2EPL X;  5IY5 C;  2BEZ F;  1Q2N A;  5GTH E;  3H25 A;  3AQC A;  1A7V A;  1OWA A;  1QQ3 A;  1NTK G;  1LJ2 A;  3CMA P;  2E75 B;  2KLU A;  4WY4 A;  4FAP B;  1Z63 A;  3OEO A;  1M7L A;  5F5H A;  3ABK C;  2FYU G;  4AL0 A;  2KUB A;  1S72 P;  1U6H A;  5L3V A;  2GUS A;  1EKY A;  2PFX A;  2I8B A;  2PP4 A;  2NUP B;  1KV4 A;  2YHS A;  2K9J B;  4RJT A;  3H1I D;  1H7I A;  5DS4 A;  5JT4 A;  5KJ7 D;  1NTK K;  5KYU B;  1NTZ J;  2IXO A;  4AX2 A;  4NTB A;  1AQT A;  1MUU A;  4RES B;  2AU5 A;  3I5C A;  4CS8 C;  4DBQ A;  3GMA A;  2XDJ A;  1NWQ A;  5L0F A;  4EHP A;  1Z56 A;  1V4A A;  4YK5 A;  2L9J A;  3Q1M A;  5K5G B;  1XTG B;  3KYI A;  1LP1 B;  1SQQ E;  3A2A A;  1QLE C;  3DM9 B;  1OFC X;  1SQB E;  3C8Z A;  4XEK A;  3RBZ A;  2KZJ A;  1OX3 A;  1TWG A;  1NTM K;  3GM3 A;  2YO2 A;  3D6Z A;  1BSN A;  3C63 A;  2B88 A;  4GT1 A;  2HFE D;  1KN7 A;  1YIJ P;  3HLZ A;  1L4A B;  5KKZ B;  1I4Z A;  2P10 A;  2ZPA A;  3C8G A;  4MQ9 F;  4PJM A;  3ZQV A;  3FAJ A;  3BRJ A;  5F28 E;  1PIX A;  1OXK A;  2M64 A;  2VB6 A;  4PV1 D;  1NU7 D;  3B5N B;  4BEM J;  3L72 G;  4OD5 A;  1NU9 C;  2H7B A;  4PAC A;  3L75 E;  4PD4 E;  3W68 A;  4ZMD A;  3QZC A;  4ANJ A;  1YA7 O;  2J7P D;  2XLW A;  1ZR4 A;  1DEE G;  1YQ4 C;  4NC3 A;  4H0L B;  5COG A;  4KHX A;  1C17 M;  3R7C A;  2KNC B;  2IYO A;  2GWW A;  1QVG O;  2PGD A;  2K9Y A;  2YNY A;  1ORS C;  2Q00 A;  1JCD A;  2ASR A;  1TKN A;  2XLE A;  2W6A A;  1CGM E;  3VP9 A;  1ZV8 A;  3KL4 A;  2X0C A;  1FMW A;  2B9B A;  2NPU A;  3UIA A;  1KYO I;  1SS1 A;  2N1T C;  2WPS A;  2NUP A;  3NKD A;  4FWV A;  4J30 B;  3DD7 A;  4DVY P;  3CME P;  2FYZ A;  4JE9 A;  1D1C A;  2FAP B;  2KSJ A;  3U8V A;  1I4Y A;  4JYB A;  1N73 B;  5D92 A;  4DXW A;  1DOW A;  5GTI E;  1DH3 A;  1M2V A;  1QKR A;  4MW3 A;  3SP1 A;  3LEV A;  2JX0 A;  3CLQ A;  1LTS C;  2WSS H;  5JVE A;  2EIM C;  3UMH A;  3II6 A;  1T2K C;  3CCQ P;  1PGO A;  1GL2 C;  4L75 A;  1ZHT A;  3HE4 A;  1EZV G;  1L0N J;  2WPV B;  2Q9I A;  4J32 B;  4GEH A;  2YKQ A;  2XRH A;  4N4W A;  4L6R A;  5AW8 B;  1A41 A;  4BG0 A;  1BDD A;  1VYI A;  4KT0 J;  1LT9 C;  2IXP A;  3FXD A;  3F47 A;  2IYL D;  1PFI A;  2FFD A;  2A6E F;  1OR3 A;  2YIU C;  3W2V A;  3HE5 B;  4JW1 A;  4NY3 A;  1LNQ A;  1KYO D;  1IFM A;  2YL1 A;  2R7W A;  2IZ1 A;  4C3E A;  4PJ0 H;  1IK9 A;  1Q0F A;  2EIL C;  4U5G A;  3BAS A;  4TLF A;  4JBZ A;  3L75 J;  3JRT A;  3S90 A;  1WN0 A;  5KYX B;  4JIO A;  1J1E C;  4H4K C;  3RBX A;  4CBE A;  3ABM C;  3FAP B;  4PJN A;  1TU3 F;  4IRU A;  2C0W A;  1E79 H;  4I7Z B;  1OW6 A;  4XFJ A;  4W8K A;  4Z9H A;  2C04 A;  3JSE O;  1X79 B;  1NTM D;  2AEJ A;  3SZR A;  1JY3 O;  3MP7 B;  3CX5 E;  1OXB A;  4AUW A;  2QUP A;  1P84 H;  3F5H A;  3AEA C;  4EBK A;  4IAR A;  4CIP A;  1RXQ A;  3L70 D;  3DWW A;  2Q5U A;  5JLI A;  4JRZ A;  1JR8 A;  3TF5 A;  3S27 A;  2ZXO A;  1N8R Q;  1H6G A;  2JR8 A;  2YLG A;  2ZJS E;  1JMM A;  2DW3 A;  3B29 A;  3E1R A;  4U3F J;  2HS5 A;  1GD2 E;  3EH1 A;  3L73 E;  1NLX A;  4C7O B;  3H1K G;  2Y3H A;  1M1J C;  1T3J A;  1JMW A;  2W27 A;  3S0X A;  1L7C A;  1SMY F;  4U3F E;  4EYY Q;  4OVN F;  4CPG A;  3G3Z A;  3GEI A;  2P7V A;  2NPS D;  5CCH D;  2HFI A;  3P8C D;  2JDI H;  4U3F D;  3NG1 A;  1TWH A;  1LVK A;  1LPE A;  1C03 A;  1YJN P;  3P8C E;  3B71 A;  3H1I J;  2FXM A;  2J9B A;  1FTS A;  1NG1 A;  5CHX A;  4C7N A;  1SFC A;  4ZLD A;  4K3A A;  3JTL O;  3CWB E;  1GDT A;  1V54 C;  4ONS A;  3T4R A;  5TIS E;  1QL1 A;  1JNM A;  3ZC4 A;  4KI2 A;  1Q0G A;  2RD9 A;  2J59 M;  4EBJ A;  3EGX A;  5T3T A;  2Q7R A;  4MN4 C;  2K37 A;  3AGU A;  3MUD A;  4JEA A;  3K6B A;  1N7L A;  2PX0 A;  2E76 D;  3PTZ A;  1T9K A;  1KU2 A;  2QJP B;  3VM6 A;  1NTK E;  5APX A;  4QI0 A;  2P2U A;  1RQU A;  2J9V A;  2P1J A;  2POH A;  2KI7 B;  2AXC A;  3M0D A;  4LC1 A;  3BRT B;  1M1K Q;  1FAP B;  1EXI A;  1SQP G;  2E76 C;  2ZT9 D;  1NOH A;  2R7Q A;  1YAR O;  3WU2 E;  1M90 Q;  3AE9 C;  2SPZ A;  3EFF K;  5EFW B;  1U89 A;  3Q3D A;  2M0B A;  3A5T A;  3S4R A;  1I5N A;  4MVZ A;  3M1C B;  2E74 D;  1J8Y F;  1FZA A;  3H1H J;  2XXA A;  1NTK J;  2A1D D;  2AVK A;  3LLK A;  4JPZ B;  4O6N A;  3HTK B;  4K1O A;  1BGY D;  4EIJ A;  1L0N D;  4XEV A;  5APY A;  1E86 A;  4LDK A;  3WUU A;  3UMI A;  1NTM G;  1RKC A;  4DT0 A;  1NH4 A;  3NKE A;  5KAI H;  2L6G A;  3B0V C;  1BDJ B;  4YN0 B;  4C7O A;  3AE5 C;  2WB7 A;  3H1L G;  1LWU A;  4DRJ B;  4AQR D;  3TK1 A;  3RL0 g;  4K0D A;  4WJ0 A;  1OW7 A;  3MYI A;  1G8X A;  3JRM O;  3HUS B;  2Y69 C;  4E17 A;  3GHG C;  2P7J A;  4KJM A;  4JEB A;  2IBZ G;  3OA1 A;  1GW3 A;  1UFB A;  3L73 G;  3AE7 C;  2N1T B;  2M3E A;  1ZYR F;  3EG9 B;  1SFC D;  3L71 G;  4C46 A;  2YWA A;  3PP5 A;  2JD3 A;  1AUE A;  3VMZ A;  2CGE A;  4B6I A;  5AC4 A;  5APQ A;  2JKV A;  1ORY A;  3GHG A;  2Y0E A;  3QW0 A;  2QY9 A;  3GM1 A;  3IEE A;  2J46 A;  5TJ5 E;  1TWA A;  4N6C A;  1HE1 A;  1SQV D;  4A2N B;  1CPQ A;  5DS5 A;  2LD6 A;  2NZ2 A;  4PJJ A;  4O7G A;  1WAT A;  3U3F A;  1S7Z A;  5COF A;  5E79 H;  4I3M A;  3IPM O;  3TSI A;  3L36 A;  4OD4 A;  1ZLL A;  2VH3 A;  5AVR B;  4ASW A;  3CSK A;  1YQ3 C;  1CGO A;  2IDB A;  2W90 A;  2H7H A;  1LTI C;  3I5P A;  3O6Q A;  4N3Y B;  1PPJ E;  3M79 A;  1RKE A;  4OIN F;  4O9B A;  1K04 A;  1KMI Z;  1HGV A;  3USS A;  3DMD A;  3JYH A;  2ZYD A;  3VRC A;  2RN0 A;  2R3C A;  1G1I A;  3KXD A;  3T6G B;  1SQB J;  3L1M A;  2ZAE B;  4H44 C;  3RL0 B;  4JYC A;  1FZE A;  5AW7 B;  2FYU D;  1BR4 A;  4HYT B;  3B9Q A;  2LXB A;  1EDJ A;  2FGY A;  2QE9 A;  4H13 B;  3GG2 A;  2OTL P;  3AE8 C;  2OYH B;  2XM0 A;  1RE3 A;  4EWC A;  2O01 N;  3OJA B;  3CCV P;  3M9H A;  3BVH A;  4JC7 A;  3CC2 P;  2KSF A;  5B66 E;  3V4Q A;  2O3J A;  2K3R A;  2O01 J;  3A9C A;  3EH2 A;  1WTY A;  1NTZ D;  4Z1M H;  3MGN A;  5AVZ B;  1YJW P;  1DIP A;  1BR2 A;  2N1T D;  1J2J B;  3K7D A;  1U57 A;  3JCU H;  4RBN A;  2ICW G;  2RMZ A;  4MND A;  2YKO A;  4YTP C;  3GHG B;  3SXZ A;  3RQF A;  1L0N K;  5E79 E;  2R7R A;  1QVX A;  2E42 A;  1X0T A;  1KIL E;  2WVR A;  1OKK A;  4E18 A;  2ZFC A;  4IL6 H;  3A0B E;  4D6T G;  1T6Q A;  2WPQ A;  1FU1 A;  2XKM A;  1U0B B;  4ZNC A;  4U5H A;  1AFO A;  1JY3 P;  1A7E A;  4RD9 A;  4CJO A;  3KMI A;  3MTU E;  1J1D B;  2YLI A;  3VMX A;  3U9J A;  3T97 B;  2HUJ A;  3DI5 A;  4MVU A;  1H9T A;  4IFF A;  3C7J A;  2OGU A;  1O5H A;  4RDA A;  3NMI A;  2WSF H;  2KK1 A;  4XWJ A;  2FBW C;  3G50 A;  1X22 A;  1KQG B;  3Q6M A;  256B A;  1VQ4 P;  3C62 A;  2OQQ A;  2P58 A;  1K73 Q;  2EIN C;  1EC5 A;  3C8G D;  3GWL A;  1HF9 A;  4WBA A;  4O6Y A;  1JAF A;  1U7M A;  2YRF A;  3QW1 A;  2J9U A;  3FOP A;  3H1L J;  1MMA A;  2J8W A;  2YL3 A;  2OCC C;  1RMV A;  2PRR A;  2AWY A;  3T6B A;  5B1B C;  2QTV A;  5B3I A;  2CDQ A;  1MFZ A;  1PP9 D;  5AVY B;  2XSE A;  4PFO A;  5M1B A;  1K05 A;  5H2F H;  4D6T E;  1S5L E;  2C03 A;  4BJ6 C;  2BCC E;  1PP9 E;  4BJ6 A;  1JY2 O;  1PGQ A;  4OIP F;  4JJG A;  3SXY A;  3HTK C;  2D2C D;  3T6J A;  2H8A A;  3IHU A;  1SF8 A;  3X2Q C;  1HJB A;  3H1J J;  2WZF A;  2FYU J;  3L4F A;  2ZD9 A;  5A6A A;  2OYH C;  1JEK A;  3K5B A;  4XLN F;  1PD0 A;  2OJQ A;  3U59 A;  1VQ9 P;  4MS2 A;  2I15 A;  1ZN5 A;  1G4U S;  2M3B A;  3Q7G A;  1HH0 A;  1CZQ A;  3HTK A;  3RF3 A;  2FYU K;  3BCC D;  1OR2 A;  3TGU J;  3AE4 C;  2W6J H;  1W5C E;  1GMJ A;  1M1J B;  3KHU A;  2FXP A;  2GFH A;  4CS8 A;  3C18 A;  5B66 H;  1VQ5 P;  3G4X A;  1ZRT D;  4KNW A;  3GW6 A;  1KIL A;  2XL8 A;  1NTZ K;  4R32 A;  4M3L A;  1M57 C;  3LNM B;  3ZG1 A;  1XTC C;  2R5D A;  1ORJ A;  1SQX D;  5CI8 A;  2R5B A;  4CS7 A;  2H88 C;  1FE6 A;  1SQQ D;  3O8Z A;  1IO4 A;  2LFD A;  3CX5 D;  1EZV I;  3LNR A;  2OEV A;  2A06 G;  1Q86 Q;  3CXH I;  2KB7 P;  3VMY A;  3M4B A;  3AG4 C;  2NUT A;  3V5X A;  2C0X A;  5H2F E;  2IXM A;  1DD3 A;  3M06 A;  2R32 A;  1SQP E;  1SP4 A;  1Q81 Q;  1NFO A;  3B4S A;  1YAU O;  3V2R A;  4CDV A;  4BEJ A;  1J8M F;  3L8I A;  4JUR I;  4OIO F;  2PNO A;  3RL0 C;  3K66 A;  5KYY B;  3JC2 2;  4JZA A;  3Q6N A;  3NYL A;  4ASV A;  3DAF A;  2ZYA A;  5AW0 B;  3VOP A;  2B0J A;  1URQ B;  1GGQ A;  1QLE D;  5APS A;  3CC7 P;  2E87 A;  1SQQ J;  1FDO A;  3ZQY A;  1VQ8 P;  3AEE C;  1IFP A;  5AGF A;  2LR2 A;  5BQH A;  1YYJ A;  1IK7 A;  1HE9 A;  1WOL A;  1OW8 A;  4OGQ C;  3CD6 P;  3HJC A;  2XZR A;  1GK6 A;  1M6T A;  4DZO A;  1M1J A;  3HD7 C;  4YXD C;  3LIE A;  5KAF E;  1FJK A;  5BQG A;  3M91 A;  2KC3 A;  1EI7 A;  3RGU A;  3ZTZ A;  1TFO B;  1VQM P;  3BAT A;  2ZXP A;  3TK0 A;  1IZN B;  1SQV K;  2R7S A;  2O01 H;  1KIL B;  1X9V A;  3H1K E;  5CIV A;  1OVU A;  1RH5 B;  3AOU A;  5AW9 B;  3T9O A;  1JMB A;  1IW7 F;  2BEQ D;  2FYU E;  3L74 G;  3DM5 A;  1DOV A;  3EGD B;  1MND A;  5KLI B;  1LTG C;  2KS1 B;  4H0L D;  2L5G B;  3SXK A;  1BCC G;  5FCL A;  4IAQ A;  1Z3I X;  2QEX P;  1LT9 A;  1M56 D;  3CWB D;  2WT7 B;  1AJY A;  4EOT A;  4WB4 A;  2WMM A;  1USD A;  1MFT A;  1VQP P;  2HSQ A;  3US6 A;  5EHH A;  5E33 A;  4PV1 B;  1SQX G;  2R02 A;  3E70 C;  1JCC A;  3CXH H;  1T5O A;  2OQM A;  3FXH A;  1SFC C;  1WT6 A;  1SZI A;  3W2W A;  2YZS A;  4GIF A;  1GM5 A;  3AE1 C;  2RH0 A;  5L3Q A;  4BJ5 A;  4IB4 A;  4ER9 A;  4YL1 A;  3R2P A;  2XM4 A;  2OYI B;  2A6H F;  4CSA A;  1FOS E;  1N7S C;  1LS4 A;  1JUN A;  4LAC B;  5D91 A;  2FFD C;  4Q7C A;  1D0X A;  3WHN A;  3H1L D;  2QJY B;  1VQN P;  1SQX K;  3S84 A;  2Q9B A;  1L0N E;  1WAS A;  3T97 A;  1VOM A;  3H1H D;  4KNV A;  3TYY A;  1D0Z A;  4DJ9 A;  4A4A A;  4Z9J A;  3RIP A;  4YJW A;  3M0D C;  4Y99 C;  2HZ8 A;  2R7U A;  3KZI H;  3FDQ A;  3RK2 D;  1S1C X;  3H1J E;  4NCQ A;  3NMJ A;  2JJL A;  2K1A A;  1JTH A;  3EZH A;  2BCC J;  2R25 A;  5L0J A;  1NTM E;  3ZVR A;  5AC5 A;  5KLV E;  1SQV G;  3D70 A;  1URQ D;  5DS6 A;  5K0I A;  1Y9B A;  3EFG A;  2MHR A;  3S29 A;  3GM2 A;  1A0B A;  1IZM A;  3TGU E;  2M5A A;  1Q7Y Q;  4GQH A;  4OIQ F;  5FZT A;  1MZ9 A;  3QVY A;  3U1A A;  3EJN A;  2Q9A A;  2P61 A;  2Z5I A;  3ITK A;  1YIT P;  2GAQ A;  4PJL A;  2H7V C;  2IBZ E;  3CCS P;  1LS1 A;  1OKK D;  2PP6 A;  3L0I A;  4CS9 C;  2Y39 A;  4UB8 H;  1FDI A;  3U1C A;  4CS9 A;  1FAV A;  1EZV D;  5AVS B;  3SWY A;  1H88 A;  3CX5 H;  3O10 A;  3CAX A;  2A0B A;  1LIH A;  2Y3G A;  2WT7 A;  4ZKP A;  1JM0 A;  3IF4 A;  1E5W A;  1QSP A;  4YPC A;  1YHQ P;  1NFN A;  5APV A;  3ZTM A;  3LEO A;  2IXN A;  3QWO C;  3V2P A;  1JPN A;  4U9E A;  4XPX A;  2H43 A;  4DJG A;  1IJD B;  1H9G A;  3D6Y A;  4ZKU A;  3DJN B;  3AG1 C;  3RK3 E;  3JT1 A;  3U5S A;  1BCC D;  4N78 E;  4D4N A;  4QMA A;  1R5L A;  2W8Z A;  1N7S D;  2A0U A;  2X51 A;  4IWB A;  4AK9 A;  3L8J A;  2WVN A;  4PD4 I;  1E84 A;  1S4X A;  4XQ1 A;  3C8V A;  5T3W A;  1DX7 A;  2ZT9 C;  3KPE A;  2A06 E;  4I1M A;  3SYN A;  3A7O A;  4WY4 C;  2JPU A;  1VYK A;  1RE4 C;  5CCH C;  3L74 J;  2DYS C;  1FFT C;  4IJJ A;  4NPE A;  1NTZ G;  2IFN A;  2GA0 A;  3W67 A;  1ZHZ A;  3WU2 H;  5A6K A;  1T8Z A;  3V6I A;  1YI2 P;  4O79 A;  1Q0K A;  3M9Q A;  3UNG C;  1D7M A;  1ZHY A;  3EGX B;  3NTN A;  2XLO A;  1EXJ A;  2NUT B;  3A11 A;  3HNI A;  3C1L A;  1E2X A;  5C39 A;  1MQV A;  2O9X A;  4E0I A;  2ITA A;  2YEV A;  4MTG A;  4E0H A;  4P9F A;  1A7D A;  1VLT A;  2OJE D;  1URQ C;  1Y4C A;  2ZXW C;  1P84 I;  1KYO E;  1VPC A;  3U8P A;  2QJK C;  2D5R B;  5KLV J;  2MYS A;  2IOQ A;  3FWN A;  3BRV B;  1NAY A;  2QM7 A;  1FZB A;  5AW2 B;  1VB5 A;  2KYH A;  3X1O A;  3I5Q A;  4BXL A;  3RVY A;  1OZH A;  3CPW O;  4LLH A;  2R3S A;  1URQ A;  1LWU C;  4QDL A;  2VC9 A;  4U9D A;  2P0N A;  2P67 A;  2Q1K A;  3H1K J;  1Q82 Q;  3J06 A;  2WVO A;  2KP8 A;  2XLM A;  1R8E A;  3CWB J;  3V5B A;  3WOD F;  2XS8 A;  2NPS C;  3SFE C;  1SQQ K;  3OAK A;  2R7T A;  3P7K A;  1N73 C;  2HJM A;  1EZV E;  1M56 C;  3CEX A;  1D1B A;  3H1I G;  3H32 B;  2K9J A;  4BJ1 A;  3O55 A;  3RK3 B;  5TJH A;  1YTZ T;  3KDP B;  1Q0M A;  1RJ9 A;  5EK0 A;  3LS1 A;  2AWC A;  5JP7 A;  4BRY A;  1O3U A;  5B5E H;  1IFJ A;  2VCC A;  4E7S A;  4C3D A;  3L75 G;  1KB9 D;  3WMM 0;  3GEH A;  1LT9 B;  4OH8 B;  3DE8 A;  2CPB A;  1JY3 N;  3HRN A;  1FFH A;  2YL0 A;  2WSF J;  5APU A;  4W80 A;  2B0H A;  1KB9 I;  1T6I A;  3MX3 A;  3HD7 D;  3L37 A;  2Y3B A;  2ZT9 B;  3HKK A;  2YLD A;  1L0L D;  3AED C;  1SQP J;  1KYO H;  4HFK B;  5DLJ A;  3SEO A;  3N4X A;  1O87 A;  2WSC J;  1L0N G;  4PJ0 E;  4J7Y A;  1H8A A;  2YKZ A;  2J9W A;  3RQG A;  1NU1 G;  2E76 B;  2HOD A;  4Y99 B;  2F22 A;  1KC8 Q;  1LP1 A;  4UB6 H;  3FWL A;  4Q5S F;  1AVY A;  3IN6 A;  3CCM P;  1QVF O;  2QNL A;  3UGP A;  1LE4 A;  3L72 D;  3KYQ A;  2AXT E;  5B5E E;  2L7A A;  2M4E A;  3FX0 A;  1SQX E;  1RF0 A;  1CGN A;  2G3V A;  2UUH A;  5DQZ A;  1BGY E;  3Q5R A;  3UR3 C;  4H13 D;  4P9T A;  3ZSU A;  3KZI E;  1PD1 A;  4H44 B;  3KQG A;  5DJT B;  1JOC A;  3QTH A;  2XS1 A;  5GTH H;  1VF5 C;  1LKX A;  2Q3E A;  3RL0 D;  2DB4 A;  3NXS A;  1SQB K;  1IFI A;  2KJG A;  1WMK A;  1SQX J;  2G3K A;  5L0D A;  1ZW0 A;  3H32 A;  1FZC B;  4NPD A;  3EZI A;  2HMQ A;  3AEB C;  4I2L C;  3H1H E;  1SR2 A;  2KGO A;  3HNK A;  1RJ9 B;  4RKU J;  2G62 A;  1PV3 A;  2EPO A;  5COM A;  4UB6 E;  4DRI B;  4BWN A;  1ZME C;  4O6M A;  4BRY B;  2FYN B;  2Q9C A;  2YVK A;  3RK2 C;  2CCY A;  4UB8 E;  1FNT c;  1G1J A;  2ZXE B;  2H89 C;  4KBL A;  3CXH D;  3L72 J;  2MKV A;  1GL2 D;  1VDF A;  4EUK B;  4JF7 A;  1OCC C;  3VMA A;  2L6F A;  2V4H A;  1VK5 A;  4PV1 C;  1UII A;  1W2E A;  3I55 P;  4EKW A;  1HW1 A;  3S1K A;  3JCU Q;  1KIL D;  1H0T B;  4I1O B;  1LT1 A;  2R9R B;  2E43 A;  2WL8 A;  3LID A;  2QE7 H;  3TNU B;  1N73 A;  3L75 D;  4PD4 D;  4JQ0 D;  2FFH A;  2VRS A;  3KH2 A;  2FFD B;  4U5D E;  3TD7 A;  2YIU B;  3SFD C;  1ZU5 A;  1MMN A;  2WSE H;  1FS0 E;  3W4Y A;  5JSL A;  3RYL A;  3HE4 B;  1TR2 A;  3W8H A;  1L0L G;  1L2P A;  4EIY A;  3H65 A;  5HSW A;  1KNY A;  5CI9 A;  1LTJ C;  3MHV A;  3K1I C;  3SSU A;  3NYJ A;  3L74 D;  2WZG A;  3U0C A;  3PHL A;  1UG7 A;  3IQT A;  1BE3 E;  2VCB A;  3I56 P;  4BPM A;  1M57 D;  4MVS A;  3ASN C;  3DXJ F;  3O39 A;  1L0L K;  4OGQ B;  2V7Q J;  3FGA D;  2Y0D A;  3SWF A;  3ASO C;  1EDK A;  4MVM A;  1M2O A;  5EGY A;  1KD1 Q;  4MW8 A;  1BZ4 A;  1BCC J;  2JWA A;  1Q90 D;  1VQK P;  3L71 E;  3SXM A;  5KYX A;  4D6T J;  2LSE A;  2LK4 A;  5L0G A;  3RKO F;  5E3A A;  4LDR A;  1IC2 A;  3V5Z A;  4DRH B;  1FZC A;  2Q3I A;  4I44 A;  3G4Z A;  2JWD A;  2V26 A;  1RF1 A;  3I4U A;  3H1K D;  3VF0 A;  1AV1 A;  3LW5 H;  5AVW B;  1YLM A;  3H1L E;  3L35 A;  1Y8A A;  1BSH A;  2J45 A;  5APW A;  3CL3 D;  2V3C C;  1X8Y A;  3NMD A;  2UUI A;  3U3B A;  2CNW A;  1NTZ E;  2XU6 A;  2CPS A;  1KTM A;  4LLC A;  1RCP A;  3L70 G;  1Z23 A;  2IFM A;  1A02 F;  4PD4 H;  3LUT B;  2WWW A;  4R4L A;  3AQB A;  2YXR B;  3H1I E;  3VAY A;  1GW4 A;  2H7O A;  5L0C A;  1JOG A;  2JO1 A;  4HEA J;  1YZC A;  4R4M A;  3EPV A;  1GS9 A;  1OMI A;  3TNU A;  2W4B A;  4U5E E;  2WQY C;  1G2C A;  2N9Y B;  2AXT H;  5F5F A;  1GL2 A;  5AW4 B;  4FX5 A;  5CMZ A;  4WAB A;  1QPU A;  3JYY A;  2RSE B;  1EDL A;  2CW0 F;  1YZA A;  3TGU D;  2P6V A;  1S2E A;  2QJY C;  4U3F G;  3LW5 J;  3OA7 A;  2AEM A;  2BE5 F;  2KW3 C;  2PX3 A;  3B0P A;  2BAS A;  1YVI A;  2QM8 A;  1RY3 A;  3WAQ A;  3WG7 C;  1SQP D;  5A6B D;  5CJ4 A;  2XL4 A;  4AL1 A;  3TJ6 A;  1FOS F;  3CQZ A;  5GPG B;  4JJF A;  2Q7C A;  1HMD A;  4LGD E;  1T2K D;  4AYC A;  3AG3 C;  3GWN A;  3CXH E;  4H13 C;  2OKU A;  3F46 A;  2BC5 A;  5CCG A;  1SQV E;  1QL2 A;  1C02 A;  2B87 B;  4L74 A;  4NTA A;  3MD0 A;  1HUC A;  3PRJ A;  2W4M A;  4HH2 A;  4PR9 A;  4JCH A;  5KYY A;  2WSC H;  2YKP A;  4GYT A;  2QG4 A;  1NU1 E;  1PCX A;  4W8P A;  1PGP A;  2HYN A;  5DVW A;  4AE4 B;  3UMK A;  4EBB A;  5CBN A;  3CC4 P;  1EQ1 A;  2KXP B;  4IL6 X;  5KLV G;  4MTO A;  3FMS A;  3HUS A;  3PMR A;  1RE3 C;  1Z7Q c;  2O1K A;  2Q4F A;  1T6A A;  3L71 J;  1EQ7 A;  2N1T A;  1K40 A;  5AVU B;  3EG9 A;  2Y9Y A;  4GOF A;  1SQV J;  3DJU B;  3WUT A;  1BGY G;  5BUO A;  2ETS A;  1UIX A;  1JB0 J;  3HD7 A;  3H6P A;  2NG1 A;  4IAO A;  3H2V A;  3P32 A;  2A06 D;  1Y6D A;  2E74 B;  2EIJ C;  2BCC D;  3V5Y A;  4XTK A;  4G7O F;  3CCL P;  4HFF B;  4XE5 B;  3NYM A;  1S3J A;  2KQ9 A;  3RK2 B;  3ABL C;  2ZXX A;  1S9K E;  5B1A C;  3GOD A;  3RK3 D;  3CCJ P;  1N7S A;  5KYU A;  1OCO C;  2Y0C A;  1KB9 H;  2H8P D;  4WVZ A;  5BU5 A;  2WIT A;  4LLE A;  3MFN A;  2XV5 A;  3AE6 C;  5A6B A;  3L71 D;  5AW5 B;  2CK3 H;  2XNX A;  4UDV A;  4CJG A;  4CDY A;  1HJ0 A;  1JY2 N;  5E3C A;  1VTM P;  2QIW A;  4E7Z A;  1YJ9 P;  3EQ2 A;  2HPC A;  4P6I C;  3POV A;  3GEE A;  4M63 A;  3ZDM A;  4CSA C;  1YA9 A;  2EPN A;  1S05 A;  3TOM A;  1BGY J;  2XL6 A;  1RKE B;  1E83 A;  1AQ5 A;  4GOD A;  2WZ7 A;  3PJS K;  1H0T A;  3JCU E;  1WWP A;  1PGJ A;  5BQI A;  3V7O A;  1ZRT E;  2DGJ A;  1NBB A;  1JPJ A;  5KAF H;  4WGZ A;  2XLD A;  1XZP A;  4WGY A;  1KFN A;  2OYI A;  4NPF X;  3ZDL A;  2W6B A;  1NKN A;  2OAR A;  2WSE J;  1NVO A;  2YO3 A;  3NDB B;  3O6Q B;  2YMK A;  3B5N C;  1OQC A;  3DE9 A;  3B5N A;  1KQF B;  2KZI A;  5KLV K;  3CZ6 A;  2LFF A;  1SQB D;  1ZXG A;  2ZVN B;  1SQP K;  2BL2 A;  2LXC B;  1DD4 A;  5APT A;  1R5S A;  1NSG B;  1OVR A;  5E2Q A;  2FY8 A;  4HKZ H;  3K1I A;  2KNC A;  4H44 D;  1R5I D;  1YJG A;  1A02 J;  2A45 G;  1L3P A;  1HW2 A;  3GF3 A;  2OYO A;  1JO5 A;  1HMO A;  2Y9Z A;  3G71 P;  3HD7 B;  3KYJ A;  2QVA A;  3PH0 A;  1ZHW A;  3IQC A;  5A6J A;  2GUV A;  4RO0 A;  1BR1 A;  2Z4E A;  1V74 B;  4JTA B;  3RQE A;  3NMK A;  1GK4 A;  2OYH A;  2Z5H A;  2QLA A;  1HWT C;  3IR9 A;  3DKA A;  2M5A B;  3EQL F;  2L6H A;  4C7R A;  3ZIB A;  2KOG A;  3LES A;  2OOC A;  3RK3 C;  1RF1 B;  1U7J A;  5KYN A;  2OTJ P;  3GLM A;  1TQG A;  2Z15 A;  1FC2 C;  3RVZ A;  3V4W A;  1MV8 A;  3IQ5 A;  2QA4 P;  2AP3 A;  1SVF A;  2FXO A;  2IZ0 A;  1K9M Q;  1GU4 A;  1L0L E;  1RQV A;  1VLS A;  1M2V B;  3R4Y A;  3W8I A;  2BCC G;  5KJ7 C;  2I8D A;  2PBE A;  2HPC B;  2J0W A;  1S5L H;  4U5F E;  4JTC B;  1EA8 A;  3A0H E;  1GTW A;  2TMV P;  1N2D C;  1VQL P;  2YL7 A;  1WRG A;  2D4U A;  4N06 A;  3MIW A;  4D6T D;  1M8O B;  1B68 A;  5B3S C;  3E9V A;  4DCK A;  1LI5 A;  1LM3 B;  3Q5P A;  3RFY A;  3AE2 C;  3DAG A;  2R7V A;  4L73 A;  2A45 I;  3N2Z B;  2KNH A;  1LTA C;  3N7N A;  3VP8 A;  1T6U A;  3C9I A;  4WWI A;  3A0B H;  1RE4 A;  5CCH A;  5JUA A;  1PP9 G;  3B8E B;  5L8R J;  3HNJ A;  1LTJ B;  1RF0 C;  4N6H A;  1VQO P;  4ZLC A;  1KQS O;  1E85 A;  2Q6Q A;  1OVV A;  1VQ6 P;  2WVQ A;  3D71 A;  2EPK X;  2RKL A;  2YXQ B;  2NSG A;  5AW1 B;  3OW2 O;  3UGO A;  2KYV A;  2CYD A;  1MNE A;  4C3B A;  5KTB A;  2EPM X;  2OEX A;  1W2W A;  1MKM A;  3A3Y B;  1HGZ A;  3TDK A;  2GDC A;  2R7O A;  3LLI A;  3MLG A;  2WPR A;  3U2M A;  4LDQ A;  4NQF A;  4G7Z F;  1CPR A;  2M8R A;  2B87 A;  2GA1 A;  2K88 A;  4A7P A;  3GF7 A;  3MBG A;  1FR0 A;  1ZOY C;  4K35 A;  1GZL A;  4YXW H;  2VCA A;  1IFN A;  4Z9I A;  4AE4 A;  4IOI H;  2LP4 A;  3AGT A;  1OCR C;  5KYW B;  2ZYG A;  2D2C B;  3GAN A;  1NKZ B;  1NU1 K;  3AG2 C;  4YL3 A;  1NGM B;  4H54 A;  3IQ6 A;  2QRX A;  4HB1 A;  3HUS C;  3CCU P;  3OWT A;  5TIS H;  2A45 H;  2LQG A;  4W7Y A;  3BCC G;  3CI9 A;  2L91 A;  3IFM A;  1VL2 A;  3S28 A;  5BVZ A;  2NPS B;  1SQQ G;  2XLV A;  3PHF 2;  3A0H H;  4C7N B;  1L4A D;  1MMD A;  1SFC B;  3MZW B;  1PL5 A;  2AEF A;  3FVY A;  2PF4 E;  3P8M C;  3ATP A;  1ZR2 A; 
#chains in the Genus database with same CATH homology
 1W2E A;  2R5B A;  1DH3 A;  3CLQ A;  4WY4 D;  1LTS C;  1N7S B;  1KIL D;  3II6 A;  1T2K C;  3O8Z A;  1IO4 A;  2E43 A;  3LID A;  1GL2 C;  1KFM A;  3TNU B;  1N73 A;  2J58 A;  3HE4 A;  2Q9I A;  2VRS A;  2KB7 P;  3VMY A;  2FFD B;  2YKQ A;  5KJ7 A;  5AW8 B;  1NAF A;  2C0X A;  2WSE H;  3M06 A;  1LT9 C;  2R32 A;  1OXZ A;  3HE4 B;  1SP4 A;  1PFI A;  1AEP A;  1NFO A;  2FFD A;  1OR3 A;  3V2R A;  1FDM A;  3HE5 B;  1LTJ C;  1IFM A;  2IPP A;  3RL0 C;  1KZU B;  1IK9 A;  1CW5 A;  3BAS A;  2HOD B;  5AW0 B;  3VOP A;  1L0L K;  1J1E C;  1URQ B;  3SWF A;  5APS A;  4XA4 A;  2C0W A;  1BZ4 A;  1X79 B;  5AVQ B;  1LWU B;  1JY3 O;  4GKG A;  4AUW A;  2XZR A;  3M9B A;  1GK6 A;  3VTP C;  1IC2 A;  1FZC A;  2Q3I A;  4DZO A;  1M1J A;  3HD7 C;  1RF1 A;  3LIE A;  1FJK A;  2Q5U A;  3M91 A;  3LW5 H;  5AVW B;  3E1I A;  3V2Q A;  2KC3 A;  3L35 A;  1NO4 A;  5APW A;  3CL3 D;  1FBM A;  1JMM A;  1X8Y A;  3BAT A;  3NMD A;  1SQV K;  1JY2 P;  2O01 H;  1KIL B;  1X9V A;  2XU6 A;  2CPS A;  1GD2 E;  1LTT C;  5AW9 B;  1M1J C;  1T3J A;  1H89 A;  2W27 A;  1IFD A;  2IFM A;  1A02 F;  4IFD K;  2WWW A;  1LTG C;  1LTB C;  3G3Z A;  3M0A A;  2NPS D;  1GW4 A;  5CCH D;  2L5G B;  3P8C D;  1LT9 A;  1GS9 A;  3TNU A;  2WT7 B;  1LPE A;  4EOT A;  4WB4 A;  3P8C E;  1G2C A;  1FJP A;  1GL2 A;  2FXM A;  5AW4 B;  5CMZ A;  5BU8 B;  5CHX A;  4C7N A;  1JCC A;  1SFC A;  3V2N A;  1SFC C;  1WT6 A;  5AW6 B;  1GDT A;  4GIF A;  3OA7 A;  1JNM A;  1QL1 A;  1J1D C;  2BAS A;  2QM8 A;  1RY3 A;  3R2P A;  2J59 M;  2OYI B;  1CSB A;  2I1K A;  1FOS E;  1N7S C;  1LS4 A;  1JUN A;  3MUD A;  2FFD C;  1N7L A;  4DOJ A;  2IX7 C;  5CJ4 A;  1SQX K;  3S84 A;  1YYC A;  3T97 A;  1KQL A;  1FOS F;  1FZF A;  3TYY A;  5APX A;  5CCG D;  2I1J A;  2Q7C A;  2P2U A;  4LGD E;  1T2K D;  4AYC A;  2P1J A;  1N86 A;  2POH A;  3M0D A;  4LC1 A;  3BRT B;  3M0D C;  1JTH B;  4Y99 C;  1NOH A;  3RK2 D;  1LTJ A;  1L4A C;  2PAJ A;  5CCG A;  1QL2 A;  2HG5 D;  3NFQ A;  3MD0 A;  1HUC A;  2JJL A;  3A5T A;  2FKW B;  1JTH A;  4HH2 A;  2YMY A;  3VYI A;  2WSC H;  2YKP A;  1FZA A;  1NHL A;  1URQ D;  2HYN A;  3EFG A;  3HTK B;  4EIJ A;  1CI6 B;  5APY A;  1EQ1 A;  5AVX B;  3HUS A;  2KLV A;  1NH4 A;  1RE3 C;  4N78 D;  1MZ9 A;  1FZG A;  2O1K A;  1T3U A;  4I6M C;  3U1A A;  1EQ7 A;  2N1T A;  5AVU B;  1LWU A;  5AVV B;  2Z5I A;  4AQR D;  4IFM A;  3TK1 A;  3HD7 A;  1RF1 C;  3H6P A;  3HUS B;  2PP6 A;  3GHG C;  2P7J A;  1S9K D;  1GW3 A;  3P32 A;  3U1C A;  1FAV A;  2N1T B;  5AVS B;  3SWY A;  1SFC D;  1H88 A;  4C46 A;  2WT7 A;  3PP5 A;  4XE5 B;  4ZKP A;  1HBW A;  3RK2 B;  1E5W A;  3VMZ A;  1S9K E;  1SLQ A;  3RK3 D;  1NFN A;  1N7S A;  1KIL C;  5APV A;  5APQ A;  3GHG A;  2H8P D;  3V2P A;  5BU5 A;  2H43 A;  2WIT A;  2XV5 A;  1HTL C;  1IJD B;  4ZKU A;  5AW5 B;  2XNX A;  4WY4 B;  4I1L A;  1JY2 N;  4N78 E;  3VN0 A;  5CJ0 A;  2NPS A;  4N6J A;  1N7S D;  3EQ2 A;  2HPC A;  2N9B A;  2GM4 A;  1YTZ I;  1DX7 A;  3KPE A;  1G2C B;  1YA9 A;  1GL2 B;  3TSI A;  3L36 A;  3A7O A;  4WY4 C;  1AQ5 A;  5AVT B;  5CCG C;  2WZ7 A;  1ZLL A;  1RE4 C;  5AVR B;  5CCH C;  3HE5 A;  1HVV A;  2IFN A;  2H7H A;  1LTI C;  1T8Z A;  3B5N D;  4N3Y B;  3M9Q A;  1KFN A;  2OYI A;  4O9B A;  3NTN A;  2OYI C;  1HGV A;  5AW3 B;  2W6B A;  1NKN A;  2OAR A;  2R3C A;  1G1I A;  2YO3 A;  3B5N C;  3B5N A;  5KLV K;  1GU5 A;  3RL0 B;  4JYC A;  2HLO A;  1FZE A;  1URQ C;  5AW7 B;  1CI6 A;  1SQP K;  4HYT B;  1VPC A;  5APT A;  2LKM A;  2JEE A;  1L4A A;  1J1E B;  3BRV B;  2QM7 A;  1FZB A;  5AW2 B;  1A02 J;  2OYH B;  2A45 G;  1RE3 A;  3OJA B;  1JO5 A;  1DEB A;  3M9H A;  4LLH A;  3BVH A;  3HD7 B;  1LGH B;  1URQ A;  2C9N Y;  1LWU C;  3V4Q A;  1FZC C;  2GUV A;  2Z4E A;  4B86 A;  2P67 A;  2WTY A;  3MGN A;  1GK4 A;  2OYH A;  2Z5H A;  2KP8 A;  2MJZ A;  5AVZ B;  1HWT C;  4W7Z A;  3IR9 A;  2N1T D;  1J2J B;  4C7R A;  3V5B A;  2KOG A;  1LE2 A;  2NPS C;  2C9L Y;  3RK3 C;  1RF1 B;  2O1J A;  2YKO A;  3GHG B;  1SQQ K;  3OAK A;  3V4W A;  1MV8 A;  1L0N K;  1SVF A;  3P7K A;  1N73 C;  1GU4 A;  1OWA A;  3H32 B;  2E42 A;  4WY4 A;  2ZFC A;  1M7L A;  5KJ7 C;  3RK3 B;  1YTZ T;  3KDP B;  2WPQ A;  1FU1 A;  2HPC B;  2XKM A;  2GUS A;  1EA8 A;  1AFO A;  1GTW A;  1N2D C;  1H7I A;  1IFJ A;  1WRG A;  5KJ7 D;  1NTK K;  1JY3 P;  3MIW A;  1MUU A;  4RES B;  3WMM 0;  3I5C A;  3MTU E;  1J1D B;  2XDJ A;  1LT9 B;  1NWQ A;  1B68 A;  4OH8 B;  2CPB A;  1JY3 N;  3HRN A;  3VMX A;  5APU A;  4W80 A;  1Z56 A;  4IFF A;  3HD7 D;  3L37 A;  2WSF H;  1XTG B;  2A45 I;  3A2A A;  1LTA C;  3N7N A;  3VP8 A;  3C9I A;  1RE4 A;  5CCH A;  3N4X A;  4WBA A;  3B8E B;  1H8A A;  1NTM K;  1LTJ B;  1RF0 C;  2YO2 A;  2HOD A;  4Y99 B;  4GT1 A;  2HFE D;  1L4A B;  1LE4 A;  3KYQ A;  1MFZ A;  5AW1 B;  5AVY B;  2KYV A;  5KTB A;  1RF0 A;  3A3Y B;  1HGZ A;  1JY2 O;  3B5N B;  2WPR A;  3KQG A;  1HJB A;  1JOC A;  3L4F A;  2M8R A;  2OYH C;  1ZR4 A;  3RL0 D;  1GZL A;  3U59 A;  4KHX A;  1ZN5 A;  3NXS A;  1IFN A;  1SQB K;  2M3B A;  2YNY A;  1HH0 A;  1CZQ A;  1IFI A;  3HTK A;  1JCD A;  2FYU K;  2W6A A;  1OR2 A;  3H32 A;  1NKZ B;  3VP9 A;  1NU1 K;  1ZV8 A;  1FZC B;  1M1J B;  4I2L C;  3HUS C;  3UIA A;  2A45 H;  4W7Y A;  2N1T C;  2WPS A;  3CI9 A;  3IFM A;  1KIL A;  5BVZ A;  2FYZ A;  1NTZ K;  3RK2 C;  2NPS B;  1G1J A;  2ZXE B;  4M3L A;  4C7N B;  1L4A D;  1SFC B;  1XTC C;  2KSJ A;  2R5D A;  1GL2 D;  1VDF A;  4JF7 A;  4JYB A;  3P8M C;  1N73 B;  1ZR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...