3SXKA

Zn2+-bound fcd domain of tm0439, a putative transcriptional regulator
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
140
structure length
140
Chain Sequence
GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVAASAAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Zn2+-bound FCD domain of TM0439, a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 55
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxkA00
3IHUA 3FMSA 3SXMA 3SXYA 2DI3A 4P9FA 3SXKA 1HW2A 1H9TA 1HW1A 2HS5A 3SXZA 1E2XA 1H9GA 3C7JA
chains in the Genus database with same CATH superfamily
3NYMA 3MYIA 2KGOA 1VK5A 2OJQA 3GANA 4U5FE 3SNHA 2EIJC 3UMIA 3RQFA 2LCHA 1JAFA 3FXHA 1T9KA 2KJGA 3B0PA 3NRHA 3AQCA 3Q7LA 3X1OA 1OXBA 1Y4CA 3DI5A 2YLGA 3ZWIA 4DBQA 4DRIB 1O5HA 1DOVA 1TWAA 5CI8A 1ZHWA 4XPWA 4GQHA 2GDCA 2YZSA 1XZPA 2R03A 3LNRA 4BEJA 3HLZA 4D4NA 4JJGA 1OW6A 3JYYA 3DD7A 4JRZA 3QZCA 1CPQA 2YL0A 5DS5A 1WWPA 1OCZC 3ATPA 4FAPB 5KYWB 4DRJB 4U5GA 5KYXB 1ZW3A 3ZVRA 4E7SA 3JRMO 1Q0MA 1I5NA 2RD9A 3UGOA 1NSGB 4OIPF 2P6VA 4B6IA 4YT2A 4WABA 3ASNC 3LS0A 3G4ZA 2W9YA 2WVQA 1RCPA 4A4AA 3S0XA 3B0UX 1KTMA 4ZLCA 1T6QA 1HMDA 2YLIA 4JE9A 4X0RA 2G3VA 2GWWA 3SXYA 4CJOA 2PF4E 1SZIA 2H7VC 3AG4C 3E9VA 3C8ZA 3EPVA 3K7DA 3LEVA 2A0UA 2CNWD 2AP3A 3EHMA 4JKVA 4CSAC 4G7OF 1AEPA 4CDYA 2PX3A 1VLSA 5D91A 3CZ6A 5KYWA 1ORJA 1OCCC 1MMAA 5KYXA 4FWVA 3LESA 2H8AA 3HNLA 2EIKC 2UUIA 1APCA 3RQGA 2MYSA 3L8JA 3T4RA 4YL1A 5EGYA 2E87A 3EH1A 1GM5A 3K1HA 3EZIA 3ECSA 2KSFA 4PJLA 1MMNA 4OD5A 1ZU4A 2R02A 1A41A 2ICWG 1ZHYA 4AE4B 3F47A 5K0IA 4IRUA 4CIPA 3SP1A 1B68A 3LUTB 3M4BA 1D0ZA 3N24A 2IXMA 1AVOB 4O6NA 4YT5A 2A0BA 3I5QA 2B0JA 3ZSUA 2OOCA 1YA7O 1LE2A 3A11A 5BQHA 3N0TA 1YJGA 4EBKA 2WZFA 1OKKA 1HE1A 1TR2A 3M79A 3W2VA 4MVQA 1GQAA 1GGQA 1ZVZA 1H7IA 2R7VA 3Q6MA 2L6GA 2A6EF 1ZW2A 3TD7A 2PFDA 1WTYA 3LLIA 2J7PA 1LIHA 2DYRC 4HFKB 3BRJA 4AE4A 1DOWA 2J9UA 1M57C 4C3DA 5E3CA 2R7RA 1BBHA 2P1AA 4P9FA 4PJMA 4PFPA 1JMWA 3EJNA 1VOMA 2IXPA 3AGUA 3GWLA 3NKEA 2XLWA 3TQOA 3DJNB 3LLKA 4KC9A 3PHF2 1Q0FA 4CS7A 1NU9C 1D1BA 2NUPB 3U9JA 2FGYA 1V74B 2DI3A 5E33A 4CX9A 1K40A 1G4US 4JTCB 4JIOA 2A69F 3QVZA 4LDKA 2NSFA 3CQZA 5FCLA 4Q4ZF 1FMWA 1QZXA 2HMQA 3F46A 1NG1A 4AL1A 1Z6AA 2GFHA 2YL3A 3HJCA 2HSBA 2Y3BA 3DE9A 4DVYP 2IOQA 3QVYA 2Q9CA 2LK4A 4EBBA 2EILC 5L0DA 5JS5A 3I5PA 2B0HA 1KU2A 2FFHA 3O39A 4U9EA 1J8YF 2RSEB 2ZXRA 5COFA 3V5YA 2AVKA 2NUPA 1OCRC 1T6UA 1BR4A 2EINC 2ZXWC 4AX2A 3LNMB 2P0NA 5A69A 3U2MA 1TQGA 1Y6DA 3QW1A 1MMDA 2HKVA 2HS5A 3JSEO 3LJBA 4N06A 3L34A 4JJFA 2CCYA 4N4WA 3SXZA 3W2WA 3RKOF 4PACA 4N6HA 3UNGC 3W8HA 4CDAA 3T6JA 1MMGA 4L6RA 4DRHB 2OJED 4CJGA 1ZHZA 2I15A 4Z9JA 3DM9B 3G4XA 1E84A 5B1BC 5DQTA 1L7CA 1ZHXA 4PJJA 1E86A 5CIVA 4PK4A 3EG9B 4GYTA 1YZAA 2UUHA 3C62A 3K1IC 4YL3A 4U5CE 4CIHA 5KYYB 2VCAA 1TWCA 2HV6A 4IAQA 4MVSA 5CI9A 3AGTA 1OQCA 1S05A 3BEHA 4U5EE 4FX5A 4MVRA 3CEXA 4YN0B 3G50A 5L0CA 4OIOF 2AWYA 3U8PA 3LAYA 2QY9A 4U9DA 3OWTA 1LI5A 2XRHA 1BZ4A 1BR2A 3DJUB 5BQIA 3EQLF 3JRTA 4LDQA 2JPUA 2BL2A 1AUEA 4ONSA 2YVKA 3EG9A 3ZQVA 4WGZA 3T6GB 2Q4FA 2EPMX 3EZHA 1J8MF 3TULA 3KKBA 1CGOA 1YZCA 3JT1A 1FNTc 4CS9A 3SYNA 1YYXA 1VYIA 3SZRA 2HZ8A 5EK0A 2GA0A 4MVOA 3WAQA 4XLNF 3GEIA 2G3KA 4AK9A 3NDBB 1NFOA 4O79A 4MQ9F 3NYLA 4I1OB 4BJTA 4YL0A 3PDMP 3KMIA 5A6KA 5L0FA 3AJMA 3M4CA 3HNKA 3PMRA 1YARO 3KYJA 4MTOA 1A7VA 5TJ5E 2XLOA 4CS8A 1EI7A 1I4ZA 4R32A 4NCQA 1NBBA 3S90A 3IQ5A 2XLMA 3NMJA 4E0IA 5A6JA 1IZMA 3ABLC 3KPHA 4HEAJ 1EKYA 3TJ5A 4M63A 4PR9A 4JTAB 3US6A 4N6CA 2V3CC 4A2NB 1KNYA 5BQGA 1SF8A 3EGXB 5DS4A 3S9OA 2J46A 1CGME 3O6XA 2X0CA 1C02A 1ORYA 3FAPB 3JSZA 1MNDA 2YEVA 3K66A 4AL0A 4DVZA 4JCHA 3DWWA 4EBJA 4EWCA 2LP4A 5D92A 4H4KC 4IARA 4J7TA 2V26A 2EPOA 5DS6A 3EGDB 1UFBA 1LVKA 1QQ3A 2J0WA 4Q7CA 4YT8A 5L0JA 4NTFA 4WGYA 4J30B 4KI2A 3IHUA 3FMSA 3UR3C 4C7OB 1M2VB 3EGXA 4JC7A 1ORSC 4HE8D 1YYJA 2JD3A 3JYHA 3HKKA 4E0HA 4U5BE 2QTVA 2HMZA 4XEKA 5L3VA 2NSGA 4I44A 1TKNA 5DVWA 1WN0A 3ZTZA 4MTFA 3T6BA 4J32B 3VF0A 2ETSA 2W4MA 3MLGA 4YK5A 4G7ZF 1U89A 2D5RB 4K1OA 5KYUB 2VASA 4JCZA 3NG1A 5FZTA 2WZGA 3GM1A 4MVMA 4BJ6C 1F1MA 1WGWA 2NUTB 2O9XA 1V54C 4JVSA 3EGDA 1QKRA 2Q9AA 3DE8A 2CDQA 4JEBA 4UDVA 3U9MA 3N2ZB 4PFOA 2ASRA 1SYQA 1OXKA 4XLPF 2QNLA 1M2VA 2L6HA 3SEOA 3U8VA 5F5FA 1PCXA 2LD6A 1SR2A 1ZYRF 2R7TA 4G0HA 3VAYA 5T3WA 2J9WA 4JZAA 2VC9A 1OCOC 2XL6A 2VCBA 3DAGA 4KNVA 4XEFA 4ER9A 4O6MA 3QTHA 3T9OA 2Y69C 4K0DA 1RKEB 2F22A 2J8WA 4O6YA 1OR2A 5AGFA 4P9TA 5E2QA 1JPJA 1M6TA 2CNWA 3ZDLA 5AC5A 1QVXA 3S84A 3NYJA 3ZG1A 3QMKA 1O87A 3M15A 1FMVA 2R7XA 2YL7A 2HJMA 1BR1A 256BA 2JX0A 3EH2A 2WVOA 3FAJA 1GS9A 5COGA 1HW2A 3L1MA 2Q9BA 2IBFA 3DZAA 1C17M 3JTLO 2D4UA 3ABMC 2YHSA 3RH3A 1YA9A 4I3MA 5B3SC 1K05A 1QSPA 4BEMJ 3GM2A 1RJ9B 2KW3C 2DB4A 4BJ1A 1H9TA 2XL8A 1RKEA 3FOPA 4HFFB 1H9GA 1C03A 1V55C 4JTDB 4NQFA 1Q0DA 4DOZA 4KBLA 1VYKA 2GAQA 2J9VA 4IGGA 1ZHTA 1V4AA 1D1AA 3WG7C 2XLHA 3AOUA 5L3QA 4ZLDA 3J06A 3DXJF 2OKUA 2QLAA 5HV9A 4XTKA 1A7EA 2C03A 3Q7GA 1ZU5A 1WATA 1QPUA 2HSQA 2LSEA 2XLEA 4EIYA 1U6HA 1W2WA 2KNHA 5DQZA 3UMKA 4CS9C 1S7ZA 1RJ9A 2M4EA 4MW3A 1NZEA 1T6IA 1Q0KA 2P7VA 4FESA 5A6BD 1ST6A 4EUKB 1JOGA 4LLCA 2L7AA 2R7OA 2OG2A 3S28A 5DLJA 1RMVA 3OEOA 4Q5SF 2IYLD 1FFTC 2YLDA 2A6HF 3WODF 2HFIA 1OW8A 1QLEC 4K7BA 3H65A 3RVYA 4WJ0A 3S27A 3C7JA 5F28E 3V5XA 3ABKC 1HE9A 1N1CA 5GPGB 3RW0A 2IXOA 2Y3GA 2H7BA 2XLVA 3JCUQ 1LS4A 3ZIBA 1TFKB 4W8KA 2AU5A 2FAPB 2VB6A 2H7OA 3C8GD 3DM5A 4G78A 1HY5A 4ANJA 3O10A 5KYYA 2BE5F 4YT4A 3HNJA 4BJ5A 5L0IA 2Y3DA 2PNOA 2Y3HA 3C18A 1XWJA 3GODA 1LKXA 3U3FA 4Z9IA 2YL1A 3M1CB 4RD9A 5B3IA 2EPLX 2G62A 3HNIA 1ZZPA 2MHRA 4JURI 4YJWA 4BG0A 1VB5A 4IB4A 1FTSA 4QI0A 4IAOA 5BUOA 3GWNA 5L0GA 2R7SA 1RXQA 4F4BA 2M64A 2X51A 3LS1A 2R05A 4I1MA 4E7ZA 1YAUO 1Z23A 5KYUA 3ITFA 2LFFA 2HV7A 3LEOA 2YRFA 3U5SA 4LLEA 2VCCA 2OEVA 2YWAA 2W45A 1EA8A 2XL4A 5A6BA 1T5OA 5JLIA 3MFNA 1A7DA 1Q0GA 2J45A 2KQ9A 3FOOA 2PBEA 3C8GB 4MS2A 3X2QC 5JVEA 1YLMA 4NY3A 3JZ0A 1OKKD 1YVIA 2EPKX 2XS1A 3KYIA 2R7UA 3H2UA 3QW0A 3I4UA 1LE4A 3UGPA 3HTKC 2Q7RA 3EFOB 2QUPA 1PD1A 1RKCA 2HJ3A 4MW8A 1XZQA 2J7PD 1MQVA 2R7QA 2Q00A 3K6BA 3C63A 3SXMA 2P61A 3L8IA 2LFDA 4RBNA 3SXKA 4EHPA 4DBRA 2WVNA 3K1IA 3S29A 3UMHA 2IM8A 1LPEA 2KC3A 3RVZA 4ULWA 4CDVA 3B0VC 1TWHA 3C8GA 3B29A 2NPUA 1VTMP 1WASA 2HUJA 4JW1A 4NTBA 2Y39A 2WZLA 3WHNA 2LIGA 2ZD9A 3IQ6A 2TMVP 4H54A 4XQ1A 4CBEA 3IQTA 2L81A 1EQ1A 3EFOA 3POVA 1D0YA 2KK1A 5JRAA 4LACB 3VYWA 3R2PA 2CW0F 2OEXA 1D1CA 2CYDA 2XXAB 5IY5C 4C7OA 1PV3A 2IXNA 1JRAA 2R9RB 3DKAA 3RIPA 1IW7F 1E2XA 1UG7A 3ZTMA 2Q3TA 1K04A 3MBGA 1E85A 1CGNA 3AG1C 1WOLA 2CGEA 4NTAA 4W8PA 5A6AA 2A1DD 3Q6NA 4QDLA 2PX0A 1YDIA 2Z15A 3U3BA 2WL8A 5JP7A 4OD4A 2ZPAA 5T1DB 4OINF 4J7YA 2NUTA 2ZXPA 4MTGA 1PD0A 4D4XA 3DAFA 3L0IA 1FFHA 2QE9A 4ULVA 2XXAA 2XM0A 1T01A 3H2VA 3IQCA 4XPXA 2VH3A 4EKWA 5EHHA 2A68F 4XWJA 1E83A 3NKDA 4U5HA 4QI2A 1VMAA 3PCVA 4KNWA 2J0XA 1CPRA 2XSEA 4E17A 4E18A 1G4WR 2R25A 1H6GA 3R7CA 2XM4A 1BDJB 3V5ZA 2OU6A 3GEEA 1NFNA 2DYSC 1LS1A 1OR3A 1M2OA 1OW7A 1R4TA 2I8BA 2PP4A 3AQBA 1MNEA 3EHNA 3GEHA 3FVYA 3KH2A 4PJNA 3MX3A 3E70C 5COMA 4BJ5C 4Z9HA 1G8XA 1L3PA 3A9CA 3W4YA 3B71A 5KYNA 1FR0A 1A0BA 1FAPB 1O3UA 3OA1A 5B1AC 4BPMA 5JUAA 2R7WA 1G5ZA 3K33A 4C3BA 1M56C 4P6IC 4NC3A 4MVUA 1NU7D 4IWBA 4MVZA 5T3TA 1U0BB 2W4BA 4LDRA 2L6FA 2MWQA 1TFOB 4CSAA 4CS8C 3DMDA 3TOMA 2DGJA 1SMYF 4U5DE 3W8IA 3NMIA 2BC5A 2WB7A 2YKZA 3AG3C 4RDAA 5AC4A 3TK0A 3AG2C 1Z63A 2EIMC 2J9BA 1NLXA 2OQMA 3CSKA 3ASOC 2EPNA 4IJJA 2AWCA 4MNDA 1JR8A 3NMKA 2ZXOA 3RYLA 3GM3A 4OIRF 3RF3A 3KL4A 3ZC4A 4DJ9A 3U2LA 1R5ID 3TOLA 3FHDA 3GORA 4O7GA 4XPYA 3U0CA 5HSWA 4G7HF 1LI7A 3VM6A 3MYFA 1JPNA 4OIQF 1TWGA 3RQEA 3V7OA 2KYHA 3B9QA 3CAXA 4LERA 4DXWA 5L0HA 2OCCC 2XLDA 1Z5ZA 4XEVA 5JSLA 3VRCA 2C04A 2XS8A 3O55A 3RFYA 4YWQA 1VLTA 3IPMO 2NG1A 3IEEA 1Z3IX 4C3EA 5E3AA 2YQYA 2L9JA 2LQGA 4JEAA 3TJ6A 1D0XA 1HMOA 1HW1A 4GEHA 5F5HA 5JT4A 3FDQA 1Z7Qc 3ZQYA 1I4YA 4BJ6A 1LM3B
chains in the Genus database with same CATH topology
3IHUA 3FMSA 3SXMA 3SXYA 2DI3A 4P9FA 3SXKA 1HW2A 1H9TA 1HW1A 2HS5A 3SXZA 1E2XA 1H9GA 3C7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHU A;  3FMS A;  3SXM A;  3SXY A;  2DI3 A;  4P9F A;  3SXK A;  1HW2 A;  1H9T A;  1HW1 A;  2HS5 A;  3SXZ A;  1E2X A;  1H9G A;  3C7J A; 
#chains in the Genus database with same CATH topology
 3NYM A;  3MYI A;  2KGO A;  1VK5 A;  2OJQ A;  3GAN A;  4U5F E;  3SNH A;  2EIJ C;  3UMI A;  3RQF A;  2LCH A;  1JAF A;  3FXH A;  1T9K A;  2KJG A;  3B0P A;  3NRH A;  3AQC A;  3Q7L A;  3X1O A;  1OXB A;  1Y4C A;  3DI5 A;  2YLG A;  3ZWI A;  4DBQ A;  4DRI B;  1O5H A;  1DOV A;  1TWA A;  5CI8 A;  1ZHW A;  4XPW A;  4GQH A;  2GDC A;  2YZS A;  1XZP A;  2R03 A;  3LNR A;  4BEJ A;  3HLZ A;  4D4N A;  4JJG A;  1OW6 A;  3JYY A;  3DD7 A;  4JRZ A;  3QZC A;  1CPQ A;  2YL0 A;  5DS5 A;  1WWP A;  1OCZ C;  3ATP A;  4FAP B;  5KYW B;  4DRJ B;  4U5G A;  5KYX B;  1ZW3 A;  3ZVR A;  4E7S A;  3JRM O;  1Q0M A;  1I5N A;  2RD9 A;  3UGO A;  1NSG B;  4OIP F;  2P6V A;  4B6I A;  4YT2 A;  4WAB A;  3ASN C;  3LS0 A;  3G4Z A;  2W9Y A;  2WVQ A;  1RCP A;  4A4A A;  3S0X A;  3B0U X;  1KTM A;  4ZLC A;  1T6Q A;  1HMD A;  2YLI A;  4JE9 A;  4X0R A;  2G3V A;  2GWW A;  3SXY A;  4CJO A;  2PF4 E;  1SZI A;  2H7V C;  3AG4 C;  3E9V A;  3C8Z A;  3EPV A;  3K7D A;  3LEV A;  2A0U A;  2CNW D;  2AP3 A;  3EHM A;  4JKV A;  4CSA C;  4G7O F;  1AEP A;  4CDY A;  2PX3 A;  1VLS A;  5D91 A;  3CZ6 A;  5KYW A;  1ORJ A;  1OCC C;  1MMA A;  5KYX A;  4FWV A;  3LES A;  2H8A A;  3HNL A;  2EIK C;  2UUI A;  1APC A;  3RQG A;  2MYS A;  3L8J A;  3T4R A;  4YL1 A;  5EGY A;  2E87 A;  3EH1 A;  1GM5 A;  3K1H A;  3EZI A;  3ECS A;  2KSF A;  4PJL A;  1MMN A;  4OD5 A;  1ZU4 A;  2R02 A;  1A41 A;  2ICW G;  1ZHY A;  4AE4 B;  3F47 A;  5K0I A;  4IRU A;  4CIP A;  3SP1 A;  1B68 A;  3LUT B;  3M4B A;  1D0Z A;  3N24 A;  2IXM A;  1AVO B;  4O6N A;  4YT5 A;  2A0B A;  3I5Q A;  2B0J A;  3ZSU A;  2OOC A;  1YA7 O;  1LE2 A;  3A11 A;  5BQH A;  3N0T A;  1YJG A;  4EBK A;  2WZF A;  1OKK A;  1HE1 A;  1TR2 A;  3M79 A;  3W2V A;  4MVQ A;  1GQA A;  1GGQ A;  1ZVZ A;  1H7I A;  2R7V A;  3Q6M A;  2L6G A;  2A6E F;  1ZW2 A;  3TD7 A;  2PFD A;  1WTY A;  3LLI A;  2J7P A;  1LIH A;  2DYR C;  4HFK B;  3BRJ A;  4AE4 A;  1DOW A;  2J9U A;  1M57 C;  4C3D A;  5E3C A;  2R7R A;  1BBH A;  2P1A A;  4P9F A;  4PJM A;  4PFP A;  1JMW A;  3EJN A;  1VOM A;  2IXP A;  3AGU A;  3GWL A;  3NKE A;  2XLW A;  3TQO A;  3DJN B;  3LLK A;  4KC9 A;  3PHF 2;  1Q0F A;  4CS7 A;  1NU9 C;  1D1B A;  2NUP B;  3U9J A;  2FGY A;  1V74 B;  2DI3 A;  5E33 A;  4CX9 A;  1K40 A;  1G4U S;  4JTC B;  4JIO A;  2A69 F;  3QVZ A;  4LDK A;  2NSF A;  3CQZ A;  5FCL A;  4Q4Z F;  1FMW A;  1QZX A;  2HMQ A;  3F46 A;  1NG1 A;  4AL1 A;  1Z6A A;  2GFH A;  2YL3 A;  3HJC A;  2HSB A;  2Y3B A;  3DE9 A;  4DVY P;  2IOQ A;  3QVY A;  2Q9C A;  2LK4 A;  4EBB A;  2EIL C;  5L0D A;  5JS5 A;  3I5P A;  2B0H A;  1KU2 A;  2FFH A;  3O39 A;  4U9E A;  1J8Y F;  2RSE B;  2ZXR A;  5COF A;  3V5Y A;  2AVK A;  2NUP A;  1OCR C;  1T6U A;  1BR4 A;  2EIN C;  2ZXW C;  4AX2 A;  3LNM B;  2P0N A;  5A69 A;  3U2M A;  1TQG A;  1Y6D A;  3QW1 A;  1MMD A;  2HKV A;  2HS5 A;  3JSE O;  3LJB A;  4N06 A;  3L34 A;  4JJF A;  2CCY A;  4N4W A;  3SXZ A;  3W2W A;  3RKO F;  4PAC A;  4N6H A;  3UNG C;  3W8H A;  4CDA A;  3T6J A;  1MMG A;  4L6R A;  4DRH B;  2OJE D;  4CJG A;  1ZHZ A;  2I15 A;  4Z9J A;  3DM9 B;  3G4X A;  1E84 A;  5B1B C;  5DQT A;  1L7C A;  1ZHX A;  4PJJ A;  1E86 A;  5CIV A;  4PK4 A;  3EG9 B;  4GYT A;  1YZA A;  2UUH A;  3C62 A;  3K1I C;  4YL3 A;  4U5C E;  4CIH A;  5KYY B;  2VCA A;  1TWC A;  2HV6 A;  4IAQ A;  4MVS A;  5CI9 A;  3AGT A;  1OQC A;  1S05 A;  3BEH A;  4U5E E;  4FX5 A;  4MVR A;  3CEX A;  4YN0 B;  3G50 A;  5L0C A;  4OIO F;  2AWY A;  3U8P A;  3LAY A;  2QY9 A;  4U9D A;  3OWT A;  1LI5 A;  2XRH A;  1BZ4 A;  1BR2 A;  3DJU B;  5BQI A;  3EQL F;  3JRT A;  4LDQ A;  2JPU A;  2BL2 A;  1AUE A;  4ONS A;  2YVK A;  3EG9 A;  3ZQV A;  4WGZ A;  3T6G B;  2Q4F A;  2EPM X;  3EZH A;  1J8M F;  3TUL A;  3KKB A;  1CGO A;  1YZC A;  3JT1 A;  1FNT c;  4CS9 A;  3SYN A;  1YYX A;  1VYI A;  3SZR A;  2HZ8 A;  5EK0 A;  2GA0 A;  4MVO A;  3WAQ A;  4XLN F;  3GEI A;  2G3K A;  4AK9 A;  3NDB B;  1NFO A;  4O79 A;  4MQ9 F;  3NYL A;  4I1O B;  4BJT A;  4YL0 A;  3PDM P;  3KMI A;  5A6K A;  5L0F A;  3AJM A;  3M4C A;  3HNK A;  3PMR A;  1YAR O;  3KYJ A;  4MTO A;  1A7V A;  5TJ5 E;  2XLO A;  4CS8 A;  1EI7 A;  1I4Z A;  4R32 A;  4NCQ A;  1NBB A;  3S90 A;  3IQ5 A;  2XLM A;  3NMJ A;  4E0I A;  5A6J A;  1IZM A;  3ABL C;  3KPH A;  4HEA J;  1EKY A;  3TJ5 A;  4M63 A;  4PR9 A;  4JTA B;  3US6 A;  4N6C A;  2V3C C;  4A2N B;  1KNY A;  5BQG A;  1SF8 A;  3EGX B;  5DS4 A;  3S9O A;  2J46 A;  1CGM E;  3O6X A;  2X0C A;  1C02 A;  1ORY A;  3FAP B;  3JSZ A;  1MND A;  2YEV A;  3K66 A;  4AL0 A;  4DVZ A;  4JCH A;  3DWW A;  4EBJ A;  4EWC A;  2LP4 A;  5D92 A;  4H4K C;  4IAR A;  4J7T A;  2V26 A;  2EPO A;  5DS6 A;  3EGD B;  1UFB A;  1LVK A;  1QQ3 A;  2J0W A;  4Q7C A;  4YT8 A;  5L0J A;  4NTF A;  4WGY A;  4J30 B;  4KI2 A;  3IHU A;  3FMS A;  3UR3 C;  4C7O B;  1M2V B;  3EGX A;  4JC7 A;  1ORS C;  4HE8 D;  1YYJ A;  2JD3 A;  3JYH A;  3HKK A;  4E0H A;  4U5B E;  2QTV A;  2HMZ A;  4XEK A;  5L3V A;  2NSG A;  4I44 A;  1TKN A;  5DVW A;  1WN0 A;  3ZTZ A;  4MTF A;  3T6B A;  4J32 B;  3VF0 A;  2ETS A;  2W4M A;  3MLG A;  4YK5 A;  4G7Z F;  1U89 A;  2D5R B;  4K1O A;  5KYU B;  2VAS A;  4JCZ A;  3NG1 A;  5FZT A;  2WZG A;  3GM1 A;  4MVM A;  4BJ6 C;  1F1M A;  1WGW A;  2NUT B;  2O9X A;  1V54 C;  4JVS A;  3EGD A;  1QKR A;  2Q9A A;  3DE8 A;  2CDQ A;  4JEB A;  4UDV A;  3U9M A;  3N2Z B;  4PFO A;  2ASR A;  1SYQ A;  1OXK A;  4XLP F;  2QNL A;  1M2V A;  2L6H A;  3SEO A;  3U8V A;  5F5F A;  1PCX A;  2LD6 A;  1SR2 A;  1ZYR F;  2R7T A;  4G0H A;  3VAY A;  5T3W A;  2J9W A;  4JZA A;  2VC9 A;  1OCO C;  2XL6 A;  2VCB A;  3DAG A;  4KNV A;  4XEF A;  4ER9 A;  4O6M A;  3QTH A;  3T9O A;  2Y69 C;  4K0D A;  1RKE B;  2F22 A;  2J8W A;  4O6Y A;  1OR2 A;  5AGF A;  4P9T A;  5E2Q A;  1JPJ A;  1M6T A;  2CNW A;  3ZDL A;  5AC5 A;  1QVX A;  3S84 A;  3NYJ A;  3ZG1 A;  3QMK A;  1O87 A;  3M15 A;  1FMV A;  2R7X A;  2YL7 A;  2HJM A;  1BR1 A;  256B A;  2JX0 A;  3EH2 A;  2WVO A;  3FAJ A;  1GS9 A;  5COG A;  1HW2 A;  3L1M A;  2Q9B A;  2IBF A;  3DZA A;  1C17 M;  3JTL O;  2D4U A;  3ABM C;  2YHS A;  3RH3 A;  1YA9 A;  4I3M A;  5B3S C;  1K05 A;  1QSP A;  4BEM J;  3GM2 A;  1RJ9 B;  2KW3 C;  2DB4 A;  4BJ1 A;  1H9T A;  2XL8 A;  1RKE A;  3FOP A;  4HFF B;  1H9G A;  1C03 A;  1V55 C;  4JTD B;  4NQF A;  1Q0D A;  4DOZ A;  4KBL A;  1VYK A;  2GAQ A;  2J9V A;  4IGG A;  1ZHT A;  1V4A A;  1D1A A;  3WG7 C;  2XLH A;  3AOU A;  5L3Q A;  4ZLD A;  3J06 A;  3DXJ F;  2OKU A;  2QLA A;  5HV9 A;  4XTK A;  1A7E A;  2C03 A;  3Q7G A;  1ZU5 A;  1WAT A;  1QPU A;  2HSQ A;  2LSE A;  2XLE A;  4EIY A;  1U6H A;  1W2W A;  2KNH A;  5DQZ A;  3UMK A;  4CS9 C;  1S7Z A;  1RJ9 A;  2M4E A;  4MW3 A;  1NZE A;  1T6I A;  1Q0K A;  2P7V A;  4FES A;  5A6B D;  1ST6 A;  4EUK B;  1JOG A;  4LLC A;  2L7A A;  2R7O A;  2OG2 A;  3S28 A;  5DLJ A;  1RMV A;  3OEO A;  4Q5S F;  2IYL D;  1FFT C;  2YLD A;  2A6H F;  3WOD F;  2HFI A;  1OW8 A;  1QLE C;  4K7B A;  3H65 A;  3RVY A;  4WJ0 A;  3S27 A;  3C7J A;  5F28 E;  3V5X A;  3ABK C;  1HE9 A;  1N1C A;  5GPG B;  3RW0 A;  2IXO A;  2Y3G A;  2H7B A;  2XLV A;  3JCU Q;  1LS4 A;  3ZIB A;  1TFK B;  4W8K A;  2AU5 A;  2FAP B;  2VB6 A;  2H7O A;  3C8G D;  3DM5 A;  4G78 A;  1HY5 A;  4ANJ A;  3O10 A;  5KYY A;  2BE5 F;  4YT4 A;  3HNJ A;  4BJ5 A;  5L0I A;  2Y3D A;  2PNO A;  2Y3H A;  3C18 A;  1XWJ A;  3GOD A;  1LKX A;  3U3F A;  4Z9I A;  2YL1 A;  3M1C B;  4RD9 A;  5B3I A;  2EPL X;  2G62 A;  3HNI A;  1ZZP A;  2MHR A;  4JUR I;  4YJW A;  4BG0 A;  1VB5 A;  4IB4 A;  1FTS A;  4QI0 A;  4IAO A;  5BUO A;  3GWN A;  5L0G A;  2R7S A;  1RXQ A;  4F4B A;  2M64 A;  2X51 A;  3LS1 A;  2R05 A;  4I1M A;  4E7Z A;  1YAU O;  1Z23 A;  5KYU A;  3ITF A;  2LFF A;  2HV7 A;  3LEO A;  2YRF A;  3U5S A;  4LLE A;  2VCC A;  2OEV A;  2YWA A;  2W45 A;  1EA8 A;  2XL4 A;  5A6B A;  1T5O A;  5JLI A;  3MFN A;  1A7D A;  1Q0G A;  2J45 A;  2KQ9 A;  3FOO A;  2PBE A;  3C8G B;  4MS2 A;  3X2Q C;  5JVE A;  1YLM A;  4NY3 A;  3JZ0 A;  1OKK D;  1YVI A;  2EPK X;  2XS1 A;  3KYI A;  2R7U A;  3H2U A;  3QW0 A;  3I4U A;  1LE4 A;  3UGP A;  3HTK C;  2Q7R A;  3EFO B;  2QUP A;  1PD1 A;  1RKC A;  2HJ3 A;  4MW8 A;  1XZQ A;  2J7P D;  1MQV A;  2R7Q A;  2Q00 A;  3K6B A;  3C63 A;  3SXM A;  2P61 A;  3L8I A;  2LFD A;  4RBN A;  3SXK A;  4EHP A;  4DBR A;  2WVN A;  3K1I A;  3S29 A;  3UMH A;  2IM8 A;  1LPE A;  2KC3 A;  3RVZ A;  4ULW A;  4CDV A;  3B0V C;  1TWH A;  3C8G A;  3B29 A;  2NPU A;  1VTM P;  1WAS A;  2HUJ A;  4JW1 A;  4NTB A;  2Y39 A;  2WZL A;  3WHN A;  2LIG A;  2ZD9 A;  3IQ6 A;  2TMV P;  4H54 A;  4XQ1 A;  4CBE A;  3IQT A;  2L81 A;  1EQ1 A;  3EFO A;  3POV A;  1D0Y A;  2KK1 A;  5JRA A;  4LAC B;  3VYW A;  3R2P A;  2CW0 F;  2OEX A;  1D1C A;  2CYD A;  2XXA B;  5IY5 C;  4C7O A;  1PV3 A;  2IXN A;  1JRA A;  2R9R B;  3DKA A;  3RIP A;  1IW7 F;  1E2X A;  1UG7 A;  3ZTM A;  2Q3T A;  1K04 A;  3MBG A;  1E85 A;  1CGN A;  3AG1 C;  1WOL A;  2CGE A;  4NTA A;  4W8P A;  5A6A A;  2A1D D;  3Q6N A;  4QDL A;  2PX0 A;  1YDI A;  2Z15 A;  3U3B A;  2WL8 A;  5JP7 A;  4OD4 A;  2ZPA A;  5T1D B;  4OIN F;  4J7Y A;  2NUT A;  2ZXP A;  4MTG A;  1PD0 A;  4D4X A;  3DAF A;  3L0I A;  1FFH A;  2QE9 A;  4ULV A;  2XXA A;  2XM0 A;  1T01 A;  3H2V A;  3IQC A;  4XPX A;  2VH3 A;  4EKW A;  5EHH A;  2A68 F;  4XWJ A;  1E83 A;  3NKD A;  4U5H A;  4QI2 A;  1VMA A;  3PCV A;  4KNW A;  2J0X A;  1CPR A;  2XSE A;  4E17 A;  4E18 A;  1G4W R;  2R25 A;  1H6G A;  3R7C A;  2XM4 A;  1BDJ B;  3V5Z A;  2OU6 A;  3GEE A;  1NFN A;  2DYS C;  1LS1 A;  1OR3 A;  1M2O A;  1OW7 A;  1R4T A;  2I8B A;  2PP4 A;  3AQB A;  1MNE A;  3EHN A;  3GEH A;  3FVY A;  3KH2 A;  4PJN A;  3MX3 A;  3E70 C;  5COM A;  4BJ5 C;  4Z9H A;  1G8X A;  1L3P A;  3A9C A;  3W4Y A;  3B71 A;  5KYN A;  1FR0 A;  1A0B A;  1FAP B;  1O3U A;  3OA1 A;  5B1A C;  4BPM A;  5JUA A;  2R7W A;  1G5Z A;  3K33 A;  4C3B A;  1M56 C;  4P6I C;  4NC3 A;  4MVU A;  1NU7 D;  4IWB A;  4MVZ A;  5T3T A;  1U0B B;  2W4B A;  4LDR A;  2L6F A;  2MWQ A;  1TFO B;  4CSA A;  4CS8 C;  3DMD A;  3TOM A;  2DGJ A;  1SMY F;  4U5D E;  3W8I A;  3NMI A;  2BC5 A;  2WB7 A;  2YKZ A;  3AG3 C;  4RDA A;  5AC4 A;  3TK0 A;  3AG2 C;  1Z63 A;  2EIM C;  2J9B A;  1NLX A;  2OQM A;  3CSK A;  3ASO C;  2EPN A;  4IJJ A;  2AWC A;  4MND A;  1JR8 A;  3NMK A;  2ZXO A;  3RYL A;  3GM3 A;  4OIR F;  3RF3 A;  3KL4 A;  3ZC4 A;  4DJ9 A;  3U2L A;  1R5I D;  3TOL A;  3FHD A;  3GOR A;  4O7G A;  4XPY A;  3U0C A;  5HSW A;  4G7H F;  1LI7 A;  3VM6 A;  3MYF A;  1JPN A;  4OIQ F;  1TWG A;  3RQE A;  3V7O A;  2KYH A;  3B9Q A;  3CAX A;  4LER A;  4DXW A;  5L0H A;  2OCC C;  2XLD A;  1Z5Z A;  4XEV A;  5JSL A;  3VRC A;  2C04 A;  2XS8 A;  3O55 A;  3RFY A;  4YWQ A;  1VLT A;  3IPM O;  2NG1 A;  3IEE A;  1Z3I X;  4C3E A;  5E3A A;  2YQY A;  2L9J A;  2LQG A;  4JEA A;  3TJ6 A;  1D0X A;  1HMO A;  1HW1 A;  4GEH A;  5F5H A;  5JT4 A;  3FDQ A;  1Z7Q c;  3ZQY A;  1I4Y A;  4BJ6 A;  1LM3 B; 
#chains in the Genus database with same CATH homology
 3IHU A;  3FMS A;  3SXM A;  3SXY A;  2DI3 A;  4P9F A;  3SXK A;  1HW2 A;  1H9T A;  1HW1 A;  2HS5 A;  3SXZ A;  1E2X A;  1H9G A;  3C7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...