3SXKA

Zn2+-bound fcd domain of tm0439, a putative transcriptional regulator
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
140
structure length
140
Chain Sequence
GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVAASAAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Zn2+-bound FCD domain of TM0439, a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 55
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxkA00
3SXYA 1HW2A 1H9TA 3C7JA 2DI3A 3IHUA 2HS5A 1H9GA 3FMSA 3SXKA 3SXMA 1E2XA 3SXZA 1HW1A 4P9FA
chains in the Genus database with same CATH superfamily
3DKAA 1LIHA 1A0BA 2A6EF 3ITFA 4X0RA 3WHNA 1MMGA 3SXMA 1IW7F 3AQCA 5DLJA 2UUIA 2P6VA 5T3TA 3ZIBA 3K1IC 1V54C 2O9XA 2YLIA 3VF0A 1Q0GA 2GWWA 4U9DA 2EPKX 1NBBA 3X1OA 2PX0A 2XM4A 4KNWA 3B0VC 3EG9A 4PJJA 2FFHA 2NUPB 2H8AA 3GWNA 1OCZC 1JPNA 5B3IA 3LLIA 1ZHTA 3PCVA 1RJ9B 1WOLA 4DVZA 4NY3A 1ORJA 2YVKA 1J8YF 4JEBA 2L6FA 4Q7CA 1ST6A 2KK1A 1WATA 1H6GA 4EKWA 1A7EA 4P9TA 2LK4A 3O39A 4LLCA 4HFKB 4ULVA 3KMIA 4RBNA 3V5XA 3DE9A 4HFFB 1VTMP 2XLVA 4D4NA 1Z23A 4O7GA 3ZG1A 3O10A 2YEVA 5DQZA 2Y3BA 2MWQA 4BG0A 3SYNA 3S90A 2OG2A 2MHRA 4LDRA 2R7SA 1M2VA 3EZHA 4JTAB 1PCXA 3JRTA 4U5BE 3A11A 1A7VA 3ZTMA 3HLZA 1O3UA 5COFA 2YLDA 3B0UX 4MVQA 1YZAA 1KU2A 2XXAA 1Q0FA 3DM5A 1RCPA 2M64A 4BJ5C 4M63A 3UMHA 1AUEA 2KSFA 2PF4E 3IQ5A 3LNRA 4XPXA 4ZLDA 4XEKA 2XL8A 3AJMA 4N4WA 4BJ1A 3F46A 4JTDB 3CSKA 4PFPA 5JP7A 2L6GA 5D92A 4ZLCA 3AG3C 1FNTc 4YWQA 3R2PA 3BEHA 5L0JA 3BRJA 3U9MA 1T6UA 2AWCA 3M4BA 2CDQA 3C62A 5TJ5E 4E7ZA 2PBEA 2EPMX 3JZ0A 1RXQA 1DOVA 4CBEA 1ZHXA 4ANJA 1V74B 1QVXA 4W8PA 3QMKA 3U8PA 1L7CA 5BUOA 4JKVA 3M4CA 1NU7D 5L0DA 3W8HA 4IAOA 2VB6A 3U3BA 2XM0A 4DVYP 4CIPA 4DJ9A 3US6A 1Q0MA 3E9VA 3T9OA 5JSLA 1E85A 2CNWD 2W4MA 4YL0A 3DJNB 3L8IA 3GODA 3LNMB 4BEMJ 4EBKA 1NFOA 3NDBB 1JAFA 2ZXWC 1Y6DA 2KNHA 2XLMA 1IZMA 1T6QA 3ECSA 3KH2A 1OCCC 2R03A 4MNDA 2HSQA 4JCHA 3RQEA 2PP4A 1YDIA 3ASNC 1ZW3A 5D91A 3B29A 5F5HA 2JD3A 4IGGA 3RH3A 3MYIA 2PFDA 5DS6A 5K0IA 2EILC 2XLHA 1HMOA 3DXJF 4IAQA 3UMIA 1R4TA 4EBJA 2OCCC 4YJWA 1BBHA 1SF8A 2AP3A 2A0BA 3E70C 3U9JA 2E87A 1RKEB 3S27A 1D0XA 3TOLA 4YT8A 5AC4A 2PNOA 1WWPA 2JPUA 2J0WA 2L81A 2NSFA 4O79A 4WABA 2BL2A 2J7PD 4BJ6C 5KYWB 3JCUQ 2J0XA 3C63A 3IPMO 3MX3A 4G7HF 2KQ9A 1VB5A 4WGYA 2R7XA 1WN0A 3C8GD 1F1MA 2B0HA 1D1BA 3EQLF 5L0HA 1VYIA 4K7BA 2YL0A 3GORA 3OWTA 3KKBA 1H7IA 2IM8A 1MMDA 4YN0B 3FDQA 1LS4A 3EGDA 2Y39A 3NYJA 2GAQA 2R05A 2A6HF 1SMYF 5DS4A 1DOWA 2LCHA 3K66A 3JTLO 5T3WA 4C3DA 2Q7RA 2HMQA 2YLGA 3UR3C 1HMDA 2R7TA 1BDJB 2YZSA 4NTBA 4BEJA 2HS5A 2YWAA 2J9WA 1BR1A 1SR2A 4KNVA 4AE4B 1OCRC 4OD4A 3V5YA 3PMRA 4ONSA 3EPVA 4HEAJ 4MVSA 5KYYB 2TMVP 4JZAA 5COGA 1T5OA 3UGPA 2WZLA 3DZAA 3UMKA 1NG1A 1TWCA 1YYJA 2HZ8A 2WVNA 5DQTA 4A4AA 1YA7O 4CJGA 4CJOA 1VYKA 5IY5C 2GDCA 4Z9HA 1E84A 1HW2A 4JEAA 2QLAA 3GEIA 2CW0F 3JSEO 1Q0DA 2A68F 2GA0A 2ETSA 2H7VC 2YKZA 3LS1A 3TJ6A 1N1CA 3W8IA 1I4YA 2FAPB 3G4XA 4E17A 2VCBA 4C7OB 4JURI 3JT1A 4KBLA 3VRCA 3QTHA 3Q7GA 2R7VA 4YL1A 1NSGB 1Z5ZA 2OJQA 3DWWA 2CYDA 3LESA 4I1MA 4YT4A 5BQHA 3DD7A 2DYSC 3WODF 4FX5A 2HJ3A 2YL1A 1VK5A 4O6MA 2LD6A 3W2VA 2LFFA 2Y3DA 4U5HA 4XEFA 5JVEA 1G5ZA 3NKDA 4FESA 2R7RA 2JX0A 2XLEA 2RSEB 3V7OA 3EFOB 3G50A 2ZPAA 3S0XA 1MMNA 2AVKA 1HY5A 2QNLA 2VC9A 4CS9C 4JJGA 1JPJA 4JTCB 3S28A 2PX3A 1M6TA 1OXBA 3AG2C 4B6IA 3M1CB 2HMZA 4I1OB 3PHF2 3J06A 5B3SC 5L3QA 1PD0A 1LKXA 4Z9JA 2I15A 1V55C 1Z6AA 2L9JA 5KYXA 4U5CE 5DS5A 1A41A 4O6NA 4XPWA 2J9VA 1Q0KA 3U5SA 1FAPB 2ZXPA 3ATPA 4XPYA 2NUTA 4BJTA 4EWCA 3DJUB 3L0IA 3FAJA 1WTYA 4MVOA 1EA8A 3T6BA 1T9KA 4OD5A 1OQCA 1TFKB 3RF3A 1JOGA 3EGXB 2XLWA 2Q3TA 3HTKC 1HW1A 4E0HA 4JJFA 2CNWA 4NC3A 1QLEC 1ZU5A 1MMAA 3CAXA 3JYYA 3NKEA 1ZZPA 1AVOB 1NZEA 2ICWG 2Q4FA 1K04A 3KYIA 1J8MF 3SP1A 3W2WA 2L6HA 2EIJC 2Q9AA 4W8KA 5E3CA 3T6JA 4IARA 3TQOA 4CS8A 3GWLA 1YVIA 2QY9A 4U5EE 4U5GA 2EPLX 4YL3A 2KJGA 5HV9A 1G8XA 2WB7A 3EJNA 5F5FA 2HUJA 3FOPA 4LLEA 1YLMA 3NYMA 5JS5A 2GFHA 3SZRA 3QVYA 3QVZA 1MNDA 1TWAA 2XLOA 1E86A 1W2WA 2J46A 3ZWIA 4FAPB 3VM6A 4I44A 3N2ZB 4RD9A 1OW6A 1YZCA 2XRHA 2IXNA 2J7PA 2A1DD 4J7YA 1NFNA 1Z3IX 4CS8C 1CGNA 3F47A 1VLTA 4WJ0A 3GM1A 1VMAA 2P7VA 2EPNA 2YRFA 5B1AC 2IXOA 3EG9B 3C8GA 3EH2A 3KYJA 4MW8A 3IQTA 3M15A 5L0GA 1E83A 2WVQA 3FHDA 3QW1A 4K0DA 4U5FE 1TFOB 2W9YA 3K7DA 5E2QA 2MYSA 4GQHA 5A6KA 5A69A 1TR2A 2XSEA 3G4ZA 3WAQA 3C18A 3HNIA 4EHPA 1LE2A 2AU5A 4EUKB 2J9UA 3V5ZA 3U2MA 3A9CA 3SNHA 1H9GA 2Y3HA 4QI0A 4O6YA 2R7WA 3LS0A 4OIOF 3DE8A 2G62A 1H9TA 2ASRA 4DBRA 2QE9A 3NMJA 5L3VA 1U0BB 1TQGA 5COMA 2VCAA 3RKOF 3ABKC 1QQ3A 1G4US 4C3EA 1M2VB 4HE8D 3M79A 2L7AA 5KYUA 3OA1A 3OEOA 4AK9A 3O6XA 4J30B 5AGFA 3DMDA 4CSAA 3KPHA 4D4XA 2G3VA 2XXAB 1LE4A 3PDMP 4JE9A 2Z15A 4MVRA 1KNYA 1QZXA 1E2XA 1XZPA 4QI2A 1KTMA 1JR8A 2ZXOA 5HSWA 1ZHYA 4LDKA 1GM5A 3NRHA 4MW3A 1MNEA 1ORYA 2OOCA 4MTOA 3U3FA 2F22A 3RVYA 2XL6A 2OU6A 1SZIA 2RD9A 1YARO 2R9RB 4NTFA 3W4YA 4EIYA 2A69F 2DGJA 3O55A 3LEVA 1Z63A 2YHSA 2IBFA 2C04A 2NUPA 2FGYA 3IEEA 2VCCA 1Z7Qc 4NQFA 1ZHZA 3MFNA 1BR4A 4DOZA 4G7OF 4JW1A 1RJ9A 4KC9A 3ZC4A 4JCZA 1O87A 1APCA 1GGQA 2R25A 2EPOA 2YL3A 3CZ6A 4G0HA 3H2UA 1C17M 3HJCA 4QDLA 2EIKC 4N6CA 1FTSA 3HNKA 2XS8A 3TULA 3LUTB 2NPUA 3CEXA 4IWBA 1OR2A 2DI3A 2WZFA 4ULWA 2KYHA 3QZCA 4I3MA 5FZTA 5A6BD 4MVMA 4CDAA 4PK4A 1LPEA 5T1DB 4DRJB 3B71A 2LFDA 3FOOA 4J32B 2B0JA 3IQ6A 3RQFA 2V26A 3HKKA 4MTFA 5E3AA 3SEOA 5BQIA 2KGOA 3AOUA 4P9FA 3K33A 4LACB 2QTVA 5CI8A 3U8VA 3X2QC 1YYXA 1I4ZA 1ZHWA 3DI5A 4PJNA 3NYLA 1HE9A 1EQ1A 3FVYA 3T6GB 4DRHB 3H2VA 4CX9A 1WGWA 3SXKA 4MS2A 3EH1A 3JYHA 1YJGA 5DVWA 3TK0A 3S84A 1C02A 4JC7A 2P61A 1FMVA 2OEVA 4L6RA 1PV3A 1G4WR 1R5ID 2LIGA 4GYTA 2IXPA 3S29A 3ZTZA 1TWHA 3C8ZA 1C03A 1K05A 2AWYA 3RW0A 5EGYA 5CI9A 2NG1A 1RMVA 1O5HA 3EGDB 1A7DA 2R02A 1FR0A 3POVA 4KI2A 2NSGA 4BPMA 3WG7C 2Q9CA 4EBBA 3LJBA 4U9EA 5L0FA 2IOQA 4ER9A 3GANA 2R7QA 4K1OA 4NTAA 4C3BA 2CGEA 2R7UA 1QKRA 1ORSC 2WVOA 2OQMA 4GEHA 3MLGA 4H4KC 4XEVA 3RYLA 4A2NB 3N0TA 4XWJA 1AEPA 1OKKD 3S9OA 4OIPF 1BZ4A 2ZD9A 3JRMO 2KC3A 4AX2A 2OEXA 5KYNA 3RQGA 5JLIA 1UFBA 4XLNF 4Q5SF 4AL1A 2Y69C 1EI7A 4BJ5A 3QW0A 1V4AA 1SYQA 4G78A 2HV7A 1D0ZA 4JVSA 1YAUO 2H7OA 3ZQYA 2P1AA 2P0NA 1ZW2A 2VH3A 3FMSA 1S05A 3FXHA 3GM3A 4MVZA 4XQ1A 2V3CC 2HFIA 1M56C 2OKUA 4U5DE 1LM3B 2M4EA 5GPGB 4OIRF 1RKEA 4PR9A 2D4UA 4NCQA 2KW3C 4P6IC 1CGOA 2ZXRA 1LI5A 1B68A 3AG4C 2IYLD 3ASOC 2HJMA 5KYWA 3TOMA 1MQVA 4JIOA 4LERA 3SXYA 4XLPF 1NLXA 3MBGA 1UG7A 2OJED 3ZDLA 1LI7A 5B1BC 1T6IA 3EHMA 2X0CA 5A6AA 2WZGA 2LP4A 2EIMC 4JRZA 3TJ5A 5E33A 3IQCA 5F28E 3B0PA 2H7BA 3JSZA 5BQGA 1U89A 4MQ9F 3ZQVA 5KYXB 2C03A 2G3KA 1XZQA 3GEEA 3K6BA 2IXMA 1I5NA 2LQGA 2BE5F 2NUTB 2W45A 3H65A 3L34A 1OCOC 4OINF 4OIQF 2XLDA 3GM2A 3IHUA 4AE4A 4F4BA 1QPUA 3HNJA 3UNGC 1ZVZA 3HNLA 3VAYA 4CS7A 3I4UA 1WASA 5KYYA 5L0IA 2X51A 1TWGA 1ZU4A 3C7JA 1ZYRF 4IRUA 1VOMA 4BJ6A 4IB4A 5L0CA 5A6BA 4DXWA 3FAPB 2J9BA 3U0CA 3NMKA 3RIPA 3N24A 4CDVA 1QSPA 4C7OA 3L8JA 4PJMA 3T4RA 1HE1A 2LSEA 3GEHA 3UGOA 4G7ZF 4UDVA 3NG1A 2DB4A 2HV6A 3LEOA 3R7CA 4H54A 2XL4A 1CPRA 1LVKA 3ABMC 1Y4CA 4YT5A 3I5PA 2J8WA 3DAGA 1M2OA 4CIHA 1OXKA 3RVZA 3ZVRA 1CPQA 2YQYA 3KL4A 4CSAC 2HKVA 3K1HA 4YT2A 5EHHA 3EFOA 1OW7A 1VLSA 3AGTA 3C8GB 1TKNA 1D1CA 1T01A 3AG1C 5JT4A 1GS9A 2DYRC 1XWJA 2BC5A 3VYWA 2D5RB 4PFOA 1K40A 2YL7A 1GQAA 1BR2A 3DM9B 5JUAA 2WL8A 3EZIA 5CIVA 3TD7A 3B9QA 4MVUA 4MTGA 3AGUA 4E18A 4XTKA 2QUPA 4PACA 3I5QA 3AQBA 1FFTC 1L3PA 2XS1A 3EHNA 4E0IA 5AC5A 1M57C 1OR3A 1PD1A 2EINC 3Q7LA 3CQZA 4DBQA 2Q9BA 1EKYA 4Z9IA 1NU9C 3ZSUA 2Q00A 3U2LA 2HSBA 1RKCA 2UUHA 3Q6NA 4IJJA 4DRIB 4R32A 3EGXA 2Y3GA 1D1AA 1FFHA 4N6HA 3LLKA 1OW8A 1U6HA 5JRAA 2CCYA 2I8BA 3LAYA 3Q6MA 4PJLA 1FMWA 1OKKA 4N06A 3K1IA 4WGZA 3MYFA 4CDYA 3RFYA 4Q4ZF 5FCLA 5KYUB 2VASA 5A6JA 3ABLC 2A0UA 256BA 2W4BA 2R7OA 1S7ZA 3L1MA 2J45A 4RDAA 4YK5A 3DAFA 5EK0A 3NMIA 4CS9A 1D0YA 1YA9A 1JRAA 4LDQA 4E7SA 3SXZA 1LS1A 4J7TA 4FWVA 4AL0A 1CGME 1JMWA
chains in the Genus database with same CATH topology
3SXYA 1HW2A 1H9TA 3C7JA 2DI3A 3IHUA 2HS5A 1H9GA 3FMSA 3SXKA 3SXMA 1E2XA 3SXZA 1HW1A 4P9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXY A;  1HW2 A;  1H9T A;  3C7J A;  2DI3 A;  3IHU A;  2HS5 A;  1H9G A;  3FMS A;  3SXK A;  3SXM A;  1E2X A;  3SXZ A;  1HW1 A;  4P9F A; 
#chains in the Genus database with same CATH topology
 3DKA A;  1LIH A;  1A0B A;  2A6E F;  3ITF A;  4X0R A;  3WHN A;  1MMG A;  3SXM A;  1IW7 F;  3AQC A;  5DLJ A;  2UUI A;  2P6V A;  5T3T A;  3ZIB A;  3K1I C;  1V54 C;  2O9X A;  2YLI A;  3VF0 A;  1Q0G A;  2GWW A;  4U9D A;  2EPK X;  1NBB A;  3X1O A;  2PX0 A;  2XM4 A;  4KNW A;  3B0V C;  3EG9 A;  4PJJ A;  2FFH A;  2NUP B;  2H8A A;  3GWN A;  1OCZ C;  1JPN A;  5B3I A;  3LLI A;  1ZHT A;  3PCV A;  1RJ9 B;  1WOL A;  4DVZ A;  4NY3 A;  1ORJ A;  2YVK A;  1J8Y F;  4JEB A;  2L6F A;  4Q7C A;  1ST6 A;  2KK1 A;  1WAT A;  1H6G A;  4EKW A;  1A7E A;  4P9T A;  2LK4 A;  3O39 A;  4LLC A;  4HFK B;  4ULV A;  3KMI A;  4RBN A;  3V5X A;  3DE9 A;  4HFF B;  1VTM P;  2XLV A;  4D4N A;  1Z23 A;  4O7G A;  3ZG1 A;  3O10 A;  2YEV A;  5DQZ A;  2Y3B A;  2MWQ A;  4BG0 A;  3SYN A;  3S90 A;  2OG2 A;  2MHR A;  4LDR A;  2R7S A;  1M2V A;  3EZH A;  4JTA B;  1PCX A;  3JRT A;  4U5B E;  3A11 A;  1A7V A;  3ZTM A;  3HLZ A;  1O3U A;  5COF A;  2YLD A;  3B0U X;  4MVQ A;  1YZA A;  1KU2 A;  2XXA A;  1Q0F A;  3DM5 A;  1RCP A;  2M64 A;  4BJ5 C;  4M63 A;  3UMH A;  1AUE A;  2KSF A;  2PF4 E;  3IQ5 A;  3LNR A;  4XPX A;  4ZLD A;  4XEK A;  2XL8 A;  3AJM A;  4N4W A;  4BJ1 A;  3F46 A;  4JTD B;  3CSK A;  4PFP A;  5JP7 A;  2L6G A;  5D92 A;  4ZLC A;  3AG3 C;  1FNT c;  4YWQ A;  3R2P A;  3BEH A;  5L0J A;  3BRJ A;  3U9M A;  1T6U A;  2AWC A;  3M4B A;  2CDQ A;  3C62 A;  5TJ5 E;  4E7Z A;  2PBE A;  2EPM X;  3JZ0 A;  1RXQ A;  1DOV A;  4CBE A;  1ZHX A;  4ANJ A;  1V74 B;  1QVX A;  4W8P A;  3QMK A;  3U8P A;  1L7C A;  5BUO A;  4JKV A;  3M4C A;  1NU7 D;  5L0D A;  3W8H A;  4IAO A;  2VB6 A;  3U3B A;  2XM0 A;  4DVY P;  4CIP A;  4DJ9 A;  3US6 A;  1Q0M A;  3E9V A;  3T9O A;  5JSL A;  1E85 A;  2CNW D;  2W4M A;  4YL0 A;  3DJN B;  3L8I A;  3GOD A;  3LNM B;  4BEM J;  4EBK A;  1NFO A;  3NDB B;  1JAF A;  2ZXW C;  1Y6D A;  2KNH A;  2XLM A;  1IZM A;  1T6Q A;  3ECS A;  3KH2 A;  1OCC C;  2R03 A;  4MND A;  2HSQ A;  4JCH A;  3RQE A;  2PP4 A;  1YDI A;  3ASN C;  1ZW3 A;  5D91 A;  3B29 A;  5F5H A;  2JD3 A;  4IGG A;  3RH3 A;  3MYI A;  2PFD A;  5DS6 A;  5K0I A;  2EIL C;  2XLH A;  1HMO A;  3DXJ F;  4IAQ A;  3UMI A;  1R4T A;  4EBJ A;  2OCC C;  4YJW A;  1BBH A;  1SF8 A;  2AP3 A;  2A0B A;  3E70 C;  3U9J A;  2E87 A;  1RKE B;  3S27 A;  1D0X A;  3TOL A;  4YT8 A;  5AC4 A;  2PNO A;  1WWP A;  2JPU A;  2J0W A;  2L81 A;  2NSF A;  4O79 A;  4WAB A;  2BL2 A;  2J7P D;  4BJ6 C;  5KYW B;  3JCU Q;  2J0X A;  3C63 A;  3IPM O;  3MX3 A;  4G7H F;  2KQ9 A;  1VB5 A;  4WGY A;  2R7X A;  1WN0 A;  3C8G D;  1F1M A;  2B0H A;  1D1B A;  3EQL F;  5L0H A;  1VYI A;  4K7B A;  2YL0 A;  3GOR A;  3OWT A;  3KKB A;  1H7I A;  2IM8 A;  1MMD A;  4YN0 B;  3FDQ A;  1LS4 A;  3EGD A;  2Y39 A;  3NYJ A;  2GAQ A;  2R05 A;  2A6H F;  1SMY F;  5DS4 A;  1DOW A;  2LCH A;  3K66 A;  3JTL O;  5T3W A;  4C3D A;  2Q7R A;  2HMQ A;  2YLG A;  3UR3 C;  1HMD A;  2R7T A;  1BDJ B;  2YZS A;  4NTB A;  4BEJ A;  2HS5 A;  2YWA A;  2J9W A;  1BR1 A;  1SR2 A;  4KNV A;  4AE4 B;  1OCR C;  4OD4 A;  3V5Y A;  3PMR A;  4ONS A;  3EPV A;  4HEA J;  4MVS A;  5KYY B;  2TMV P;  4JZA A;  5COG A;  1T5O A;  3UGP A;  2WZL A;  3DZA A;  3UMK A;  1NG1 A;  1TWC A;  1YYJ A;  2HZ8 A;  2WVN A;  5DQT A;  4A4A A;  1YA7 O;  4CJG A;  4CJO A;  1VYK A;  5IY5 C;  2GDC A;  4Z9H A;  1E84 A;  1HW2 A;  4JEA A;  2QLA A;  3GEI A;  2CW0 F;  3JSE O;  1Q0D A;  2A68 F;  2GA0 A;  2ETS A;  2H7V C;  2YKZ A;  3LS1 A;  3TJ6 A;  1N1C A;  3W8I A;  1I4Y A;  2FAP B;  3G4X A;  4E17 A;  2VCB A;  4C7O B;  4JUR I;  3JT1 A;  4KBL A;  3VRC A;  3QTH A;  3Q7G A;  2R7V A;  4YL1 A;  1NSG B;  1Z5Z A;  2OJQ A;  3DWW A;  2CYD A;  3LES A;  4I1M A;  4YT4 A;  5BQH A;  3DD7 A;  2DYS C;  3WOD F;  4FX5 A;  2HJ3 A;  2YL1 A;  1VK5 A;  4O6M A;  2LD6 A;  3W2V A;  2LFF A;  2Y3D A;  4U5H A;  4XEF A;  5JVE A;  1G5Z A;  3NKD A;  4FES A;  2R7R A;  2JX0 A;  2XLE A;  2RSE B;  3V7O A;  3EFO B;  3G50 A;  2ZPA A;  3S0X A;  1MMN A;  2AVK A;  1HY5 A;  2QNL A;  2VC9 A;  4CS9 C;  4JJG A;  1JPJ A;  4JTC B;  3S28 A;  2PX3 A;  1M6T A;  1OXB A;  3AG2 C;  4B6I A;  3M1C B;  2HMZ A;  4I1O B;  3PHF 2;  3J06 A;  5B3S C;  5L3Q A;  1PD0 A;  1LKX A;  4Z9J A;  2I15 A;  1V55 C;  1Z6A A;  2L9J A;  5KYX A;  4U5C E;  5DS5 A;  1A41 A;  4O6N A;  4XPW A;  2J9V A;  1Q0K A;  3U5S A;  1FAP B;  2ZXP A;  3ATP A;  4XPY A;  2NUT A;  4BJT A;  4EWC A;  3DJU B;  3L0I A;  3FAJ A;  1WTY A;  4MVO A;  1EA8 A;  3T6B A;  1T9K A;  4OD5 A;  1OQC A;  1TFK B;  3RF3 A;  1JOG A;  3EGX B;  2XLW A;  2Q3T A;  3HTK C;  1HW1 A;  4E0H A;  4JJF A;  2CNW A;  4NC3 A;  1QLE C;  1ZU5 A;  1MMA A;  3CAX A;  3JYY A;  3NKE A;  1ZZP A;  1AVO B;  1NZE A;  2ICW G;  2Q4F A;  1K04 A;  3KYI A;  1J8M F;  3SP1 A;  3W2W A;  2L6H A;  2EIJ C;  2Q9A A;  4W8K A;  5E3C A;  3T6J A;  4IAR A;  3TQO A;  4CS8 A;  3GWL A;  1YVI A;  2QY9 A;  4U5E E;  4U5G A;  2EPL X;  4YL3 A;  2KJG A;  5HV9 A;  1G8X A;  2WB7 A;  3EJN A;  5F5F A;  2HUJ A;  3FOP A;  4LLE A;  1YLM A;  3NYM A;  5JS5 A;  2GFH A;  3SZR A;  3QVY A;  3QVZ A;  1MND A;  1TWA A;  2XLO A;  1E86 A;  1W2W A;  2J46 A;  3ZWI A;  4FAP B;  3VM6 A;  4I44 A;  3N2Z B;  4RD9 A;  1OW6 A;  1YZC A;  2XRH A;  2IXN A;  2J7P A;  2A1D D;  4J7Y A;  1NFN A;  1Z3I X;  4CS8 C;  1CGN A;  3F47 A;  1VLT A;  4WJ0 A;  3GM1 A;  1VMA A;  2P7V A;  2EPN A;  2YRF A;  5B1A C;  2IXO A;  3EG9 B;  3C8G A;  3EH2 A;  3KYJ A;  4MW8 A;  3IQT A;  3M15 A;  5L0G A;  1E83 A;  2WVQ A;  3FHD A;  3QW1 A;  4K0D A;  4U5F E;  1TFO B;  2W9Y A;  3K7D A;  5E2Q A;  2MYS A;  4GQH A;  5A6K A;  5A69 A;  1TR2 A;  2XSE A;  3G4Z A;  3WAQ A;  3C18 A;  3HNI A;  4EHP A;  1LE2 A;  2AU5 A;  4EUK B;  2J9U A;  3V5Z A;  3U2M A;  3A9C A;  3SNH A;  1H9G A;  2Y3H A;  4QI0 A;  4O6Y A;  2R7W A;  3LS0 A;  4OIO F;  3DE8 A;  2G62 A;  1H9T A;  2ASR A;  4DBR A;  2QE9 A;  3NMJ A;  5L3V A;  1U0B B;  1TQG A;  5COM A;  2VCA A;  3RKO F;  3ABK C;  1QQ3 A;  1G4U S;  4C3E A;  1M2V B;  4HE8 D;  3M79 A;  2L7A A;  5KYU A;  3OA1 A;  3OEO A;  4AK9 A;  3O6X A;  4J30 B;  5AGF A;  3DMD A;  4CSA A;  3KPH A;  4D4X A;  2G3V A;  2XXA B;  1LE4 A;  3PDM P;  4JE9 A;  2Z15 A;  4MVR A;  1KNY A;  1QZX A;  1E2X A;  1XZP A;  4QI2 A;  1KTM A;  1JR8 A;  2ZXO A;  5HSW A;  1ZHY A;  4LDK A;  1GM5 A;  3NRH A;  4MW3 A;  1MNE A;  1ORY A;  2OOC A;  4MTO A;  3U3F A;  2F22 A;  3RVY A;  2XL6 A;  2OU6 A;  1SZI A;  2RD9 A;  1YAR O;  2R9R B;  4NTF A;  3W4Y A;  4EIY A;  2A69 F;  2DGJ A;  3O55 A;  3LEV A;  1Z63 A;  2YHS A;  2IBF A;  2C04 A;  2NUP A;  2FGY A;  3IEE A;  2VCC A;  1Z7Q c;  4NQF A;  1ZHZ A;  3MFN A;  1BR4 A;  4DOZ A;  4G7O F;  4JW1 A;  1RJ9 A;  4KC9 A;  3ZC4 A;  4JCZ A;  1O87 A;  1APC A;  1GGQ A;  2R25 A;  2EPO A;  2YL3 A;  3CZ6 A;  4G0H A;  3H2U A;  1C17 M;  3HJC A;  4QDL A;  2EIK C;  4N6C A;  1FTS A;  3HNK A;  2XS8 A;  3TUL A;  3LUT B;  2NPU A;  3CEX A;  4IWB A;  1OR2 A;  2DI3 A;  2WZF A;  4ULW A;  2KYH A;  3QZC A;  4I3M A;  5FZT A;  5A6B D;  4MVM A;  4CDA A;  4PK4 A;  1LPE A;  5T1D B;  4DRJ B;  3B71 A;  2LFD A;  3FOO A;  4J32 B;  2B0J A;  3IQ6 A;  3RQF A;  2V26 A;  3HKK A;  4MTF A;  5E3A A;  3SEO A;  5BQI A;  2KGO A;  3AOU A;  4P9F A;  3K33 A;  4LAC B;  2QTV A;  5CI8 A;  3U8V A;  3X2Q C;  1YYX A;  1I4Z A;  1ZHW A;  3DI5 A;  4PJN A;  3NYL A;  1HE9 A;  1EQ1 A;  3FVY A;  3T6G B;  4DRH B;  3H2V A;  4CX9 A;  1WGW A;  3SXK A;  4MS2 A;  3EH1 A;  3JYH A;  1YJG A;  5DVW A;  3TK0 A;  3S84 A;  1C02 A;  4JC7 A;  2P61 A;  1FMV A;  2OEV A;  4L6R A;  1PV3 A;  1G4W R;  1R5I D;  2LIG A;  4GYT A;  2IXP A;  3S29 A;  3ZTZ A;  1TWH A;  3C8Z A;  1C03 A;  1K05 A;  2AWY A;  3RW0 A;  5EGY A;  5CI9 A;  2NG1 A;  1RMV A;  1O5H A;  3EGD B;  1A7D A;  2R02 A;  1FR0 A;  3POV A;  4KI2 A;  2NSG A;  4BPM A;  3WG7 C;  2Q9C A;  4EBB A;  3LJB A;  4U9E A;  5L0F A;  2IOQ A;  4ER9 A;  3GAN A;  2R7Q A;  4K1O A;  4NTA A;  4C3B A;  2CGE A;  2R7U A;  1QKR A;  1ORS C;  2WVO A;  2OQM A;  4GEH A;  3MLG A;  4H4K C;  4XEV A;  3RYL A;  4A2N B;  3N0T A;  4XWJ A;  1AEP A;  1OKK D;  3S9O A;  4OIP F;  1BZ4 A;  2ZD9 A;  3JRM O;  2KC3 A;  4AX2 A;  2OEX A;  5KYN A;  3RQG A;  5JLI A;  1UFB A;  4XLN F;  4Q5S F;  4AL1 A;  2Y69 C;  1EI7 A;  4BJ5 A;  3QW0 A;  1V4A A;  1SYQ A;  4G78 A;  2HV7 A;  1D0Z A;  4JVS A;  1YAU O;  2H7O A;  3ZQY A;  2P1A A;  2P0N A;  1ZW2 A;  2VH3 A;  3FMS A;  1S05 A;  3FXH A;  3GM3 A;  4MVZ A;  4XQ1 A;  2V3C C;  2HFI A;  1M56 C;  2OKU A;  4U5D E;  1LM3 B;  2M4E A;  5GPG B;  4OIR F;  1RKE A;  4PR9 A;  2D4U A;  4NCQ A;  2KW3 C;  4P6I C;  1CGO A;  2ZXR A;  1LI5 A;  1B68 A;  3AG4 C;  2IYL D;  3ASO C;  2HJM A;  5KYW A;  3TOM A;  1MQV A;  4JIO A;  4LER A;  3SXY A;  4XLP F;  1NLX A;  3MBG A;  1UG7 A;  2OJE D;  3ZDL A;  1LI7 A;  5B1B C;  1T6I A;  3EHM A;  2X0C A;  5A6A A;  2WZG A;  2LP4 A;  2EIM C;  4JRZ A;  3TJ5 A;  5E33 A;  3IQC A;  5F28 E;  3B0P A;  2H7B A;  3JSZ A;  5BQG A;  1U89 A;  4MQ9 F;  3ZQV A;  5KYX B;  2C03 A;  2G3K A;  1XZQ A;  3GEE A;  3K6B A;  2IXM A;  1I5N A;  2LQG A;  2BE5 F;  2NUT B;  2W45 A;  3H65 A;  3L34 A;  1OCO C;  4OIN F;  4OIQ F;  2XLD A;  3GM2 A;  3IHU A;  4AE4 A;  4F4B A;  1QPU A;  3HNJ A;  3UNG C;  1ZVZ A;  3HNL A;  3VAY A;  4CS7 A;  3I4U A;  1WAS A;  5KYY A;  5L0I A;  2X51 A;  1TWG A;  1ZU4 A;  3C7J A;  1ZYR F;  4IRU A;  1VOM A;  4BJ6 A;  4IB4 A;  5L0C A;  5A6B A;  4DXW A;  3FAP B;  2J9B A;  3U0C A;  3NMK A;  3RIP A;  3N24 A;  4CDV A;  1QSP A;  4C7O A;  3L8J A;  4PJM A;  3T4R A;  1HE1 A;  2LSE A;  3GEH A;  3UGO A;  4G7Z F;  4UDV A;  3NG1 A;  2DB4 A;  2HV6 A;  3LEO A;  3R7C A;  4H54 A;  2XL4 A;  1CPR A;  1LVK A;  3ABM C;  1Y4C A;  4YT5 A;  3I5P A;  2J8W A;  3DAG A;  1M2O A;  4CIH A;  1OXK A;  3RVZ A;  3ZVR A;  1CPQ A;  2YQY A;  3KL4 A;  4CSA C;  2HKV A;  3K1H A;  4YT2 A;  5EHH A;  3EFO A;  1OW7 A;  1VLS A;  3AGT A;  3C8G B;  1TKN A;  1D1C A;  1T01 A;  3AG1 C;  5JT4 A;  1GS9 A;  2DYR C;  1XWJ A;  2BC5 A;  3VYW A;  2D5R B;  4PFO A;  1K40 A;  2YL7 A;  1GQA A;  1BR2 A;  3DM9 B;  5JUA A;  2WL8 A;  3EZI A;  5CIV A;  3TD7 A;  3B9Q A;  4MVU A;  4MTG A;  3AGU A;  4E18 A;  4XTK A;  2QUP A;  4PAC A;  3I5Q A;  3AQB A;  1FFT C;  1L3P A;  2XS1 A;  3EHN A;  4E0I A;  5AC5 A;  1M57 C;  1OR3 A;  1PD1 A;  2EIN C;  3Q7L A;  3CQZ A;  4DBQ A;  2Q9B A;  1EKY A;  4Z9I A;  1NU9 C;  3ZSU A;  2Q00 A;  3U2L A;  2HSB A;  1RKC A;  2UUH A;  3Q6N A;  4IJJ A;  4DRI B;  4R32 A;  3EGX A;  2Y3G A;  1D1A A;  1FFH A;  4N6H A;  3LLK A;  1OW8 A;  1U6H A;  5JRA A;  2CCY A;  2I8B A;  3LAY A;  3Q6M A;  4PJL A;  1FMW A;  1OKK A;  4N06 A;  3K1I A;  4WGZ A;  3MYF A;  4CDY A;  3RFY A;  4Q4Z F;  5FCL A;  5KYU B;  2VAS A;  5A6J A;  3ABL C;  2A0U A;  256B A;  2W4B A;  2R7O A;  1S7Z A;  3L1M A;  2J45 A;  4RDA A;  4YK5 A;  3DAF A;  5EK0 A;  3NMI A;  4CS9 A;  1D0Y A;  1YA9 A;  1JRA A;  4LDQ A;  4E7S A;  3SXZ A;  1LS1 A;  4J7T A;  4FWV A;  4AL0 A;  1CGM E;  1JMW A; 
#chains in the Genus database with same CATH homology
 3SXY A;  1HW2 A;  1H9T A;  3C7J A;  2DI3 A;  3IHU A;  2HS5 A;  1H9G A;  3FMS A;  3SXK A;  3SXM A;  1E2X A;  3SXZ A;  1HW1 A;  4P9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...