3SXKA

Zn2+-bound fcd domain of tm0439, a putative transcriptional regulator
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
140
structure length
140
Chain Sequence
GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVAASAAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, GntR family
publication title Zn2+-bound FCD domain of TM0439, a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
total genus 55
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxkA00
3IHUA 3SXYA 1HW2A 2HS5A 1E2XA 3SXMA 3SXKA 3C7JA 3FMSA 1H9TA 3SXZA 1H9GA 2DI3A 4P9FA 1HW1A
chains in the Genus database with same CATH superfamily
3QVYA 2VC9A 3E9VA 3SZRA 4XQ1A 3KMIA 2WZLA 2KYHA 1SYQA 2YL0A 1D0XA 2H7OA 1I4YA 1HMOA 2CCYA 3B0PA 2XL6A 2YQYA 4CIPA 4XEVA 1WASA 4JJFA 2A6HF 4PJJA 3HKKA 1YDIA 3Q6NA 3T6GB 1NZEA 4PACA 1M2VB 1T6IA 3VRCA 4BJ5A 4E18A 5A6JA 4CIHA 3DAFA 3RQEA 3G4ZA 2KJGA 1T6QA 5E2QA 3ZSUA 2XM4A 5JUAA 3LAYA 4O6YA 4YJWA 5EK0A 3T4RA 3L0IA 3U2MA 2HSBA 3PDMP 4P9TA 4JTDB 3LS0A 1LE2A 1TFOB 3QTHA 4N4WA 4O7GA 4H4KC 1OKKA 2P6VA 1WOLA 5D92A 2MWQA 3AJMA 4Q5SF 1Q0KA 2OCCC 3UGPA 2G62A 2AU5A 2Q9BA 3EQLF 3RYLA 1FNTc 1YYJA 4LERA 3E70C 4DRHB 2EIMC 1RJ9B 3I5PA 4EIYA 2M4EA 2VB6A 3JZ0A 4L6RA 2XM0A 4OD4A 1EQ1A 2J45A 2XS1A 1FMVA 3QW1A 2X0CA 1A7EA 1ORJA 3HNKA 3QW0A 1V54C 3NYLA 1EI7A 1LIHA 4H54A 4JURI 1JRAA 4MVQA 3L1MA 3AG1C 3B9QA 1MMAA 1G4US 2GA0A 3N24A 4IARA 3TOMA 3K1IC 1HW2A 2B0HA 4PR9A 3ZQVA 4RBNA 1OCZC 1Z6AA 1QZXA 1BR1A 2OU6A 1I4ZA 1OW6A 3C7JA 3ZTZA 1Y4CA 1H9TA 3R7CA 4Z9HA 5L0DA 3ZDLA 5L3VA 2GAQA 3C62A 1D0ZA 5EHHA 1WWPA 1YA9A 1VB5A 2YLDA 3DM5A 3LNMB 2PFDA 3AQBA 1S7ZA 3IEEA 4NC3A 3M1CB 3U8VA 4DJ9A 2AWCA 2G3KA 1NSGB 4E7ZA 1J8YF 2HMQA 1H7IA 3NMIA 3GEIA 3WODF 1NBBA 1QPUA 1G5ZA 2FGYA 1LVKA 3EGDA 4U5DE 1Z63A 2OEXA 3AGTA 1C03A 2IXNA 3RKOF 1WATA 2XL8A 1A0BA 3GM1A 3UMKA 3AG2C 4M63A 2NUTA 1M56C 1KU2A 4JZAA 5BUOA 4QI0A 2C04A 3W8IA 3EG9B 4CS7A 4ER9A 1M6TA 2JPUA 2A6EF 3W2WA 2ZXWC 4YWQA 1QKRA 4EHPA 2HJ3A 4DRIB 3EZHA 4PJLA 1V55C 4MVRA 1MNEA 5AC5A 3AOUA 2R02A 3R2PA 2XL4A 4AX2A 1UFBA 2HKVA 4XPXA 4DBQA 2F22A 2UUHA 3AGUA 3L8JA 3O39A 4K7BA 3FHDA 1E86A 4PJMA 2BC5A 1FFHA 1TR2A 1O5HA 2FFHA 2WVQA 2XS8A 1FAPB 3FVYA 1ZHXA 3Q6MA 4KBLA 1JAFA 3T6JA 2A68F 3J06A 4MVUA 4BJ6C 4QI2A 3NMJA 3KYJA 3S28A 3W4YA 1E2XA 3M4CA 4XWJA 1B68A 1VYIA 1ORYA 1YARO 3IQTA 3Q7LA 4IRUA 4JE9A 1CGME 4NTFA 4U5EE 2WZGA 4KI2A 1NFOA 1MQVA 3AG4C 1TWHA 4F4BA 1VYKA 3DWWA 2Z15A 1QLEC 3FOPA 4XTKA 5B3IA 1HE1A 2VCBA 5L0GA 1DOWA 3FDQA 2R7XA 4A4AA 1QSPA 2QUPA 3GODA 1TFKB 4AK9A 4ULVA 4WABA 4ULWA 1FFTC 2B0JA 3MX3A 4HEAJ 3CSKA 3NYMA 5AC4A 2IYLD 3KKBA 1KTMA 2X51A 1RCPA 2YZSA 5T3TA 3VF0A 2YHSA 5KYUA 2L6FA 5B1AC 2LK4A 4NTAA 2PBEA 1ZW2A 5AGFA 3UMIA 1U0BB 1TWAA 3VAYA 4DOZA 3O10A 5E33A 1T6UA 5IY5C 1BR2A 3EGXA 2AVKA 3OEOA 1NG1A 1OKKD 4IJJA 3NDBB 2YVKA 1F1MA 3UR3C 5FCLA 4OD5A 4KNVA 2A0UA 2PX0A 4XEKA 2E87A 2NUPB 2TMVP 1A41A 4C3DA 3KPHA 2YL1A 4FX5A 4IGGA 5T1DB 1TWGA 1AVOB 2Q9CA 4FAPB 5F5FA 1PV3A 1RKCA 2OG2A 3DM9B 5A69A 2QE9A 3CAXA 4A2NB 4BJ6A 2WVNA 2W4MA 3EFOB 4LACB 3SP1A 5DQTA 3K1HA 1GS9A 2WZFA 3ZG1A 4RD9A 4YT4A 3C63A 2LIGA 5BQHA 1HY5A 2R7QA 2R9RB 4C7OB 2XLDA 5KYXB 3MYIA 2D5RB 1T5OA 5DVWA 3EHMA 4MTGA 3C8ZA 2VCCA 4U5GA 5KYYB 1MMGA 3SXYA 4DBRA 1U6HA 1LI5A 2KGOA 4N06A 5DS4A 1V4AA 4YT8A 4CSAA 2L6GA 3N2ZB 3MFNA 3U3BA 2I8BA 2D4UA 3IQ6A 2ZD9A 4C7OA 3DJUB 3DZAA 5L0HA 2EINC 1C17M 3BRJA 3DI5A 2G3VA 3LLIA 4O79A 2IXPA 4U5HA 5DS5A 2XXAA 2FAPB 4D4NA 4YT2A 3RF3A 1K40A 256BA 2L81A 4E0IA 1ZW3A 2YL3A 5B3SC 4AE4B 2LD6A 3V5ZA 1VMAA 5A6KA 2KNHA 2XLMA 4IAQA 2EPOA 2CDQA 1OQCA 1YVIA 4JJGA 3SEOA 4CS8A 1ZHYA 4O6MA 1TQGA 2Y39A 3ZQYA 4ZLDA 4YN0B 3S90A 2H7VC 4MVSA 3FMSA 4JIOA 3SYNA 3W2VA 2HV6A 4LDKA 1LE4A 1T01A 5A6BA 1T9KA 3ZIBA 4WGZA 3RVYA 2IXMA 3EZIA 4MQ9F 5COMA 3L34A 4U5CE 3PHF2 1YZAA 4BG0A 1C02A 1WN0A 2XLOA 1H9GA 2CYDA 5KYWA 1Q0FA 3ASOC 4FWVA 3VYWA 3V7OA 4CDYA 4BPMA 3QMKA 1BZ4A 2CW0F 4EKWA 4OIPF 2HJMA 3HTKC 4IB4A 3WG7C 4J7YA 1ST6A 3GANA 2Q4FA 3I5QA 4NY3A 2HSQA 2JD3A 2MHRA 3KL4A 1ORSC 4NQFA 5E3AA 4BJTA 4MVMA 5JRAA 4E7SA 3F46A 2O9XA 3KYIA 2KK1A 3QZCA 4P9FA 2J9WA 3LEVA 1VLSA 3PMRA 2J8WA 2ZXOA 3K33A 4CX9A 4O6NA 2XSEA 4PFOA 4NCQA 4JEAA 3TQOA 2A69F 4G0HA 3GWNA 3TD7A 2R7VA 2L9JA 2NG1A 2J9BA 1YA7O 2EILC 2A1DD 4YL0A 3B29A 1CGNA 2JX0A 1G4WR 3ASNC 3ATPA 3FAPB 3NMKA 2HFIA 3C8GA 1QVXA 1XZQA 5BQGA 1E84A 4I1MA 1LS4A 2J0XA 1I5NA 4U9DA 1U89A 2LCHA 1R5ID 2PP4A 2Q3TA 1ZYRF 3LESA 4OIQF 2YEVA 2Y69C 4CS9C 4CJOA 1LM3B 2CGEA 2CNWA 2R7OA 4J32B 2R05A 4W8PA 1ZVZA 4ANJA 1A7VA 4I1OB 4XLNF 5BQIA 3POVA 1TWCA 3UNGC 2W9YA 2Y3BA 3T9OA 3M4BA 2OKUA 3U2LA 1ZHWA 4LDRA 1OCCC 2DYSC 3ZTMA 1ZU5A 2Y3GA 3W8HA 3NYJA 5DQZA 5JLIA 2Y3DA 1A7DA 2WB7A 4MW3A 1CGOA 2Q7RA 2VH3A 3EGDB 3UMHA 3U9JA 4XLPF 4UDVA 2R03A 1D1AA 2KC3A 3K66A 2IXOA 4CSAC 5T3WA 5L0CA 2GDCA 3U9MA 1OR3A 4JEBA 1PCXA 1Y6DA 1BBHA 2VCAA 3X1OA 5JP7A 3TJ5A 2H8AA 5L0JA 1OW7A 1D1BA 2NUTB 3DXJF 1RXQA 5GPGB 1O87A 2V3CC 3JSZA 1K04A 4YK5A 3MYFA 1OXKA 4J30B 2AP3A 2XLEA 1JPNA 1W2WA 1SZIA 2EPMX 2BL2A 1N1CA 2IOQA 2XLWA 3JRTA 1NFNA 3RIPA 2LQGA 3U3FA 1VK5A 3ECSA 3NG1A 2HS5A 2DYRC 1NU7D 3HNIA 1YJGA 2WVOA 4X0RA 4HE8D 3S29A 4BJ1A 4CS8C 1Q0GA 1M2VA 4EBJA 2DB4A 2ZXRA 3H2UA 3U5SA 1SMYF 1YLMA 4Q7CA 2H7BA 4HFFB 3NRHA 3FXHA 4Z9JA 2IM8A 2OJQA 3RQFA 4YL3A 3ABKC 2HMZA 2J46A 2P7VA 4P6IC 2IBFA 3IHUA 1NU9C 3QVZA 4CS9A 3S27A 1ZZPA 2OOCA 3F47A 4J7TA 2J7PA 5CI9A 3GM2A 3JTLO 3ZVRA 3ZC4A 3B71A 3GEHA 3ITFA 3NKEA 4XEFA 2XXAB 3K6BA 2P1AA 3U0CA 3RH3A 4E17A 3LNRA 1L3PA 1RJ9A 1OW8A 3KH2A 2RD9A 5A6BD 1EA8A 1J8MF 1PD0A 5HSWA 1Q0MA 1WGWA 4JW1A 2I15A 2R7UA 3GM3A 3K7DA 1LPEA 4G7OF 2LP4A 3LUTB 2LFDA 3H2VA 1FTSA 1Z7Qc 1IZMA 4C3EA 1PD1A 3JSEO 4WJ0A 5CIVA 1JOGA 5KYUB 4MVOA 4DVZA 1BDJB 4DRJB 2WL8A 2LFFA 2Y3HA 4U9EA 1Q0DA 3EGXB 4N6CA 2XLHA 1R4TA 4W8KA 2OEVA 1OXBA 3SXKA 3TK0A 3EH2A 2YLIA 3CZ6A 4MS2A 1L7CA 4KNWA 2L6HA 4XPYA 4MW8A 1BR4A 4CDVA 2RSEB 2YRFA 1E83A 3IPMO 1D1CA 4D4XA 5L0IA 3JRMO 1YAUO 1ZHZA 1OR2A 2HZ8A 3OA1A 4GEHA 4YL1A 1MMNA 4GQHA 1O3UA 4G78A 1XWJA 4YT5A 2QTVA 3EH1A 3WHNA 5K0IA 2V26A 1GGQA 3RW0A 2QNLA 5E3CA 2UUIA 4BEJA 2ETSA 2LSEA 1YYXA 4JRZA 1HE9A 1VTMP 4Q4ZF 3C8GD 1HMDA 2XRHA 3I4UA 4PK4A 3JYHA 2HV7A 4IAOA 3V5XA 3DE8A 4HFKB 2PNOA 4U5BE 5EGYA 3DAGA 3JCUQ 1DOVA 2R25A 3CQZA 2QLAA 3EG9A 4NTBA 3SXMA 3CEXA 2CNWD 1ZU4A 2MYSA 4WGYA 5COGA 3O55A 1LS1A 2R7TA 1JMWA 3EJNA 1Z3IX 1D0YA 2HUJA 5FZTA 1JPJA 1WTYA 2NSFA 3MLGA 1KNYA 4RDAA 1VOMA 3ZWIA 4I3MA 5D91A 4MNDA 2J0WA 1Z5ZA 3H65A 3L8IA 5JSLA 4C3BA 4DVYP 2GFHA 3HNLA 2PF4E 3BEHA 4AL1A 2KW3C 5JT4A 4R32A 2P61A 2J9VA 3HLZA 5CI8A 4Z9IA 4FESA 4LLEA 3WAQA 1UG7A 3M15A 5TJ5E 5KYNA 5F28E 2OQMA 3US6A 2ZPAA 1HW1A 1YZCA 1CPQA 2OJED 4JCZA 2PX3A 4GYTA 3AG3C 3RQGA 3HJCA 4XPWA 1RMVA 3A9CA 4IWBA 2YWAA 3SNHA 1NLXA 3HNJA 1EKYA 3V5YA 1CPRA 1RKEA 1E85A 1AEPA 1FMWA 4ONSA 3LLKA 3RVZA 3SXZA 5DS6A 2AWYA 2EPNA 4OINF 2M64A 3NKDA 1OCRC 4B6IA 5JVEA 1GM5A 1LI7A 2W4BA 4MVZA 5KYWB 3T6BA 4OIRF 2XLVA 3GORA 2DGJA 4JVSA 2KSFA 2C03A 3TOLA 3JT1A 3O6XA 1ZHTA 1MMDA 3LEOA 2ICWG 4MTOA 3Q7GA 1K05A 4U5FE 2J7PD 4EUKB 1M2OA 2KQ9A 4I44A 2R7SA 2Q9AA 4KC9A 3B0VC 3DE9A 3EPVA 1G8XA 3S9OA 2NUPA 3DD7A 1VLTA 3ABLC 1IW7F 2ZXPA 2EPLX 2EPKX 3IQ5A 3K1IA 2YLGA 4JCHA 1M57C 2EIKC 2YL7A 3N0TA 4MTFA 2ASRA 5A6AA 3ABMC 4K0DA 5COFA 5B1BC 2DI3A 1Z23A 1TKNA 5JS5A 2W45A 3LS1A 3EFOA 3MBGA 4BJ5C 5L3QA 3S0XA 3C8GB 3GEEA 4LLCA 4OIOF 2R7WA 3G4XA 2YKZA 3X2QC 3DMDA 3LJBA 5F5HA 4JTAB 1APCA 4BEMJ 4CJGA 4DXWA 1LKXA 5KYXA 3FOOA 4G7ZF 2L7AA 1OCOC 1RKEB 1H6GA 2VASA 4AL0A 3IQCA 3DJNB 4EWCA 4PFPA 4ZLCA 5KYYA 2QY9A 3U8PA 3TULA 1SF8A 4LDQA 2EIJC 1V74B 2BE5F 4JKVA 1XZPA 4N6HA 2P0NA 3VM6A 1QQ3A 2NSGA 5L0FA 1FR0A 4PJNA 3DKAA 4QDLA 3B0UX 2Q00A 5DLJA 2J9UA 2A0BA 4JTCB 4EBKA 5HV9A 1SR2A 3C18A 2R7RA 2GWWA 1MNDA 2NPUA 3EHNA 1AUEA 3PCVA 3UGOA 3G50A 1GQAA 4K1OA 4JC7A 3RFYA 1JR8A 4G7HF 3GWLA 3TJ6A 4CBEA 3A11A 3FAJA 3M79A 4CDAA 4EBBA 4AE4A 1S05A 3JYYA 3AQCA 3OWTA 4E0HA 3S84A
chains in the Genus database with same CATH topology
3IHUA 3SXYA 1HW2A 2HS5A 1E2XA 3SXMA 3SXKA 3C7JA 3FMSA 1H9TA 3SXZA 1H9GA 2DI3A 4P9FA 1HW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHU A;  3SXY A;  1HW2 A;  2HS5 A;  1E2X A;  3SXM A;  3SXK A;  3C7J A;  3FMS A;  1H9T A;  3SXZ A;  1H9G A;  2DI3 A;  4P9F A;  1HW1 A; 
#chains in the Genus database with same CATH topology
 3QVY A;  2VC9 A;  3E9V A;  3SZR A;  4XQ1 A;  3KMI A;  2WZL A;  2KYH A;  1SYQ A;  2YL0 A;  1D0X A;  2H7O A;  1I4Y A;  1HMO A;  2CCY A;  3B0P A;  2XL6 A;  2YQY A;  4CIP A;  4XEV A;  1WAS A;  4JJF A;  2A6H F;  4PJJ A;  3HKK A;  1YDI A;  3Q6N A;  3T6G B;  1NZE A;  4PAC A;  1M2V B;  1T6I A;  3VRC A;  4BJ5 A;  4E18 A;  5A6J A;  4CIH A;  3DAF A;  3RQE A;  3G4Z A;  2KJG A;  1T6Q A;  5E2Q A;  3ZSU A;  2XM4 A;  5JUA A;  3LAY A;  4O6Y A;  4YJW A;  5EK0 A;  3T4R A;  3L0I A;  3U2M A;  2HSB A;  3PDM P;  4P9T A;  4JTD B;  3LS0 A;  1LE2 A;  1TFO B;  3QTH A;  4N4W A;  4O7G A;  4H4K C;  1OKK A;  2P6V A;  1WOL A;  5D92 A;  2MWQ A;  3AJM A;  4Q5S F;  1Q0K A;  2OCC C;  3UGP A;  2G62 A;  2AU5 A;  2Q9B A;  3EQL F;  3RYL A;  1FNT c;  1YYJ A;  4LER A;  3E70 C;  4DRH B;  2EIM C;  1RJ9 B;  3I5P A;  4EIY A;  2M4E A;  2VB6 A;  3JZ0 A;  4L6R A;  2XM0 A;  4OD4 A;  1EQ1 A;  2J45 A;  2XS1 A;  1FMV A;  3QW1 A;  2X0C A;  1A7E A;  1ORJ A;  3HNK A;  3QW0 A;  1V54 C;  3NYL A;  1EI7 A;  1LIH A;  4H54 A;  4JUR I;  1JRA A;  4MVQ A;  3L1M A;  3AG1 C;  3B9Q A;  1MMA A;  1G4U S;  2GA0 A;  3N24 A;  4IAR A;  3TOM A;  3K1I C;  1HW2 A;  2B0H A;  4PR9 A;  3ZQV A;  4RBN A;  1OCZ C;  1Z6A A;  1QZX A;  1BR1 A;  2OU6 A;  1I4Z A;  1OW6 A;  3C7J A;  3ZTZ A;  1Y4C A;  1H9T A;  3R7C A;  4Z9H A;  5L0D A;  3ZDL A;  5L3V A;  2GAQ A;  3C62 A;  1D0Z A;  5EHH A;  1WWP A;  1YA9 A;  1VB5 A;  2YLD A;  3DM5 A;  3LNM B;  2PFD A;  3AQB A;  1S7Z A;  3IEE A;  4NC3 A;  3M1C B;  3U8V A;  4DJ9 A;  2AWC A;  2G3K A;  1NSG B;  4E7Z A;  1J8Y F;  2HMQ A;  1H7I A;  3NMI A;  3GEI A;  3WOD F;  1NBB A;  1QPU A;  1G5Z A;  2FGY A;  1LVK A;  3EGD A;  4U5D E;  1Z63 A;  2OEX A;  3AGT A;  1C03 A;  2IXN A;  3RKO F;  1WAT A;  2XL8 A;  1A0B A;  3GM1 A;  3UMK A;  3AG2 C;  4M63 A;  2NUT A;  1M56 C;  1KU2 A;  4JZA A;  5BUO A;  4QI0 A;  2C04 A;  3W8I A;  3EG9 B;  4CS7 A;  4ER9 A;  1M6T A;  2JPU A;  2A6E F;  3W2W A;  2ZXW C;  4YWQ A;  1QKR A;  4EHP A;  2HJ3 A;  4DRI B;  3EZH A;  4PJL A;  1V55 C;  4MVR A;  1MNE A;  5AC5 A;  3AOU A;  2R02 A;  3R2P A;  2XL4 A;  4AX2 A;  1UFB A;  2HKV A;  4XPX A;  4DBQ A;  2F22 A;  2UUH A;  3AGU A;  3L8J A;  3O39 A;  4K7B A;  3FHD A;  1E86 A;  4PJM A;  2BC5 A;  1FFH A;  1TR2 A;  1O5H A;  2FFH A;  2WVQ A;  2XS8 A;  1FAP B;  3FVY A;  1ZHX A;  3Q6M A;  4KBL A;  1JAF A;  3T6J A;  2A68 F;  3J06 A;  4MVU A;  4BJ6 C;  4QI2 A;  3NMJ A;  3KYJ A;  3S28 A;  3W4Y A;  1E2X A;  3M4C A;  4XWJ A;  1B68 A;  1VYI A;  1ORY A;  1YAR O;  3IQT A;  3Q7L A;  4IRU A;  4JE9 A;  1CGM E;  4NTF A;  4U5E E;  2WZG A;  4KI2 A;  1NFO A;  1MQV A;  3AG4 C;  1TWH A;  4F4B A;  1VYK A;  3DWW A;  2Z15 A;  1QLE C;  3FOP A;  4XTK A;  5B3I A;  1HE1 A;  2VCB A;  5L0G A;  1DOW A;  3FDQ A;  2R7X A;  4A4A A;  1QSP A;  2QUP A;  3GOD A;  1TFK B;  4AK9 A;  4ULV A;  4WAB A;  4ULW A;  1FFT C;  2B0J A;  3MX3 A;  4HEA J;  3CSK A;  3NYM A;  5AC4 A;  2IYL D;  3KKB A;  1KTM A;  2X51 A;  1RCP A;  2YZS A;  5T3T A;  3VF0 A;  2YHS A;  5KYU A;  2L6F A;  5B1A C;  2LK4 A;  4NTA A;  2PBE A;  1ZW2 A;  5AGF A;  3UMI A;  1U0B B;  1TWA A;  3VAY A;  4DOZ A;  3O10 A;  5E33 A;  1T6U A;  5IY5 C;  1BR2 A;  3EGX A;  2AVK A;  3OEO A;  1NG1 A;  1OKK D;  4IJJ A;  3NDB B;  2YVK A;  1F1M A;  3UR3 C;  5FCL A;  4OD5 A;  4KNV A;  2A0U A;  2PX0 A;  4XEK A;  2E87 A;  2NUP B;  2TMV P;  1A41 A;  4C3D A;  3KPH A;  2YL1 A;  4FX5 A;  4IGG A;  5T1D B;  1TWG A;  1AVO B;  2Q9C A;  4FAP B;  5F5F A;  1PV3 A;  1RKC A;  2OG2 A;  3DM9 B;  5A69 A;  2QE9 A;  3CAX A;  4A2N B;  4BJ6 A;  2WVN A;  2W4M A;  3EFO B;  4LAC B;  3SP1 A;  5DQT A;  3K1H A;  1GS9 A;  2WZF A;  3ZG1 A;  4RD9 A;  4YT4 A;  3C63 A;  2LIG A;  5BQH A;  1HY5 A;  2R7Q A;  2R9R B;  4C7O B;  2XLD A;  5KYX B;  3MYI A;  2D5R B;  1T5O A;  5DVW A;  3EHM A;  4MTG A;  3C8Z A;  2VCC A;  4U5G A;  5KYY B;  1MMG A;  3SXY A;  4DBR A;  1U6H A;  1LI5 A;  2KGO A;  4N06 A;  5DS4 A;  1V4A A;  4YT8 A;  4CSA A;  2L6G A;  3N2Z B;  3MFN A;  3U3B A;  2I8B A;  2D4U A;  3IQ6 A;  2ZD9 A;  4C7O A;  3DJU B;  3DZA A;  5L0H A;  2EIN C;  1C17 M;  3BRJ A;  3DI5 A;  2G3V A;  3LLI A;  4O79 A;  2IXP A;  4U5H A;  5DS5 A;  2XXA A;  2FAP B;  4D4N A;  4YT2 A;  3RF3 A;  1K40 A;  256B A;  2L81 A;  4E0I A;  1ZW3 A;  2YL3 A;  5B3S C;  4AE4 B;  2LD6 A;  3V5Z A;  1VMA A;  5A6K A;  2KNH A;  2XLM A;  4IAQ A;  2EPO A;  2CDQ A;  1OQC A;  1YVI A;  4JJG A;  3SEO A;  4CS8 A;  1ZHY A;  4O6M A;  1TQG A;  2Y39 A;  3ZQY A;  4ZLD A;  4YN0 B;  3S90 A;  2H7V C;  4MVS A;  3FMS A;  4JIO A;  3SYN A;  3W2V A;  2HV6 A;  4LDK A;  1LE4 A;  1T01 A;  5A6B A;  1T9K A;  3ZIB A;  4WGZ A;  3RVY A;  2IXM A;  3EZI A;  4MQ9 F;  5COM A;  3L34 A;  4U5C E;  3PHF 2;  1YZA A;  4BG0 A;  1C02 A;  1WN0 A;  2XLO A;  1H9G A;  2CYD A;  5KYW A;  1Q0F A;  3ASO C;  4FWV A;  3VYW A;  3V7O A;  4CDY A;  4BPM A;  3QMK A;  1BZ4 A;  2CW0 F;  4EKW A;  4OIP F;  2HJM A;  3HTK C;  4IB4 A;  3WG7 C;  4J7Y A;  1ST6 A;  3GAN A;  2Q4F A;  3I5Q A;  4NY3 A;  2HSQ A;  2JD3 A;  2MHR A;  3KL4 A;  1ORS C;  4NQF A;  5E3A A;  4BJT A;  4MVM A;  5JRA A;  4E7S A;  3F46 A;  2O9X A;  3KYI A;  2KK1 A;  3QZC A;  4P9F A;  2J9W A;  3LEV A;  1VLS A;  3PMR A;  2J8W A;  2ZXO A;  3K33 A;  4CX9 A;  4O6N A;  2XSE A;  4PFO A;  4NCQ A;  4JEA A;  3TQO A;  2A69 F;  4G0H A;  3GWN A;  3TD7 A;  2R7V A;  2L9J A;  2NG1 A;  2J9B A;  1YA7 O;  2EIL C;  2A1D D;  4YL0 A;  3B29 A;  1CGN A;  2JX0 A;  1G4W R;  3ASN C;  3ATP A;  3FAP B;  3NMK A;  2HFI A;  3C8G A;  1QVX A;  1XZQ A;  5BQG A;  1E84 A;  4I1M A;  1LS4 A;  2J0X A;  1I5N A;  4U9D A;  1U89 A;  2LCH A;  1R5I D;  2PP4 A;  2Q3T A;  1ZYR F;  3LES A;  4OIQ F;  2YEV A;  2Y69 C;  4CS9 C;  4CJO A;  1LM3 B;  2CGE A;  2CNW A;  2R7O A;  4J32 B;  2R05 A;  4W8P A;  1ZVZ A;  4ANJ A;  1A7V A;  4I1O B;  4XLN F;  5BQI A;  3POV A;  1TWC A;  3UNG C;  2W9Y A;  2Y3B A;  3T9O A;  3M4B A;  2OKU A;  3U2L A;  1ZHW A;  4LDR A;  1OCC C;  2DYS C;  3ZTM A;  1ZU5 A;  2Y3G A;  3W8H A;  3NYJ A;  5DQZ A;  5JLI A;  2Y3D A;  1A7D A;  2WB7 A;  4MW3 A;  1CGO A;  2Q7R A;  2VH3 A;  3EGD B;  3UMH A;  3U9J A;  4XLP F;  4UDV A;  2R03 A;  1D1A A;  2KC3 A;  3K66 A;  2IXO A;  4CSA C;  5T3W A;  5L0C A;  2GDC A;  3U9M A;  1OR3 A;  4JEB A;  1PCX A;  1Y6D A;  1BBH A;  2VCA A;  3X1O A;  5JP7 A;  3TJ5 A;  2H8A A;  5L0J A;  1OW7 A;  1D1B A;  2NUT B;  3DXJ F;  1RXQ A;  5GPG B;  1O87 A;  2V3C C;  3JSZ A;  1K04 A;  4YK5 A;  3MYF A;  1OXK A;  4J30 B;  2AP3 A;  2XLE A;  1JPN A;  1W2W A;  1SZI A;  2EPM X;  2BL2 A;  1N1C A;  2IOQ A;  2XLW A;  3JRT A;  1NFN A;  3RIP A;  2LQG A;  3U3F A;  1VK5 A;  3ECS A;  3NG1 A;  2HS5 A;  2DYR C;  1NU7 D;  3HNI A;  1YJG A;  2WVO A;  4X0R A;  4HE8 D;  3S29 A;  4BJ1 A;  4CS8 C;  1Q0G A;  1M2V A;  4EBJ A;  2DB4 A;  2ZXR A;  3H2U A;  3U5S A;  1SMY F;  1YLM A;  4Q7C A;  2H7B A;  4HFF B;  3NRH A;  3FXH A;  4Z9J A;  2IM8 A;  2OJQ A;  3RQF A;  4YL3 A;  3ABK C;  2HMZ A;  2J46 A;  2P7V A;  4P6I C;  2IBF A;  3IHU A;  1NU9 C;  3QVZ A;  4CS9 A;  3S27 A;  1ZZP A;  2OOC A;  3F47 A;  4J7T A;  2J7P A;  5CI9 A;  3GM2 A;  3JTL O;  3ZVR A;  3ZC4 A;  3B71 A;  3GEH A;  3ITF A;  3NKE A;  4XEF A;  2XXA B;  3K6B A;  2P1A A;  3U0C A;  3RH3 A;  4E17 A;  3LNR A;  1L3P A;  1RJ9 A;  1OW8 A;  3KH2 A;  2RD9 A;  5A6B D;  1EA8 A;  1J8M F;  1PD0 A;  5HSW A;  1Q0M A;  1WGW A;  4JW1 A;  2I15 A;  2R7U A;  3GM3 A;  3K7D A;  1LPE A;  4G7O F;  2LP4 A;  3LUT B;  2LFD A;  3H2V A;  1FTS A;  1Z7Q c;  1IZM A;  4C3E A;  1PD1 A;  3JSE O;  4WJ0 A;  5CIV A;  1JOG A;  5KYU B;  4MVO A;  4DVZ A;  1BDJ B;  4DRJ B;  2WL8 A;  2LFF A;  2Y3H A;  4U9E A;  1Q0D A;  3EGX B;  4N6C A;  2XLH A;  1R4T A;  4W8K A;  2OEV A;  1OXB A;  3SXK A;  3TK0 A;  3EH2 A;  2YLI A;  3CZ6 A;  4MS2 A;  1L7C A;  4KNW A;  2L6H A;  4XPY A;  4MW8 A;  1BR4 A;  4CDV A;  2RSE B;  2YRF A;  1E83 A;  3IPM O;  1D1C A;  4D4X A;  5L0I A;  3JRM O;  1YAU O;  1ZHZ A;  1OR2 A;  2HZ8 A;  3OA1 A;  4GEH A;  4YL1 A;  1MMN A;  4GQH A;  1O3U A;  4G78 A;  1XWJ A;  4YT5 A;  2QTV A;  3EH1 A;  3WHN A;  5K0I A;  2V26 A;  1GGQ A;  3RW0 A;  2QNL A;  5E3C A;  2UUI A;  4BEJ A;  2ETS A;  2LSE A;  1YYX A;  4JRZ A;  1HE9 A;  1VTM P;  4Q4Z F;  3C8G D;  1HMD A;  2XRH A;  3I4U A;  4PK4 A;  3JYH A;  2HV7 A;  4IAO A;  3V5X A;  3DE8 A;  4HFK B;  2PNO A;  4U5B E;  5EGY A;  3DAG A;  3JCU Q;  1DOV A;  2R25 A;  3CQZ A;  2QLA A;  3EG9 A;  4NTB A;  3SXM A;  3CEX A;  2CNW D;  1ZU4 A;  2MYS A;  4WGY A;  5COG A;  3O55 A;  1LS1 A;  2R7T A;  1JMW A;  3EJN A;  1Z3I X;  1D0Y A;  2HUJ A;  5FZT A;  1JPJ A;  1WTY A;  2NSF A;  3MLG A;  1KNY A;  4RDA A;  1VOM A;  3ZWI A;  4I3M A;  5D91 A;  4MND A;  2J0W A;  1Z5Z A;  3H65 A;  3L8I A;  5JSL A;  4C3B A;  4DVY P;  2GFH A;  3HNL A;  2PF4 E;  3BEH A;  4AL1 A;  2KW3 C;  5JT4 A;  4R32 A;  2P61 A;  2J9V A;  3HLZ A;  5CI8 A;  4Z9I A;  4FES A;  4LLE A;  3WAQ A;  1UG7 A;  3M15 A;  5TJ5 E;  5KYN A;  5F28 E;  2OQM A;  3US6 A;  2ZPA A;  1HW1 A;  1YZC A;  1CPQ A;  2OJE D;  4JCZ A;  2PX3 A;  4GYT A;  3AG3 C;  3RQG A;  3HJC A;  4XPW A;  1RMV A;  3A9C A;  4IWB A;  2YWA A;  3SNH A;  1NLX A;  3HNJ A;  1EKY A;  3V5Y A;  1CPR A;  1RKE A;  1E85 A;  1AEP A;  1FMW A;  4ONS A;  3LLK A;  3RVZ A;  3SXZ A;  5DS6 A;  2AWY A;  2EPN A;  4OIN F;  2M64 A;  3NKD A;  1OCR C;  4B6I A;  5JVE A;  1GM5 A;  1LI7 A;  2W4B A;  4MVZ A;  5KYW B;  3T6B A;  4OIR F;  2XLV A;  3GOR A;  2DGJ A;  4JVS A;  2KSF A;  2C03 A;  3TOL A;  3JT1 A;  3O6X A;  1ZHT A;  1MMD A;  3LEO A;  2ICW G;  4MTO A;  3Q7G A;  1K05 A;  4U5F E;  2J7P D;  4EUK B;  1M2O A;  2KQ9 A;  4I44 A;  2R7S A;  2Q9A A;  4KC9 A;  3B0V C;  3DE9 A;  3EPV A;  1G8X A;  3S9O A;  2NUP A;  3DD7 A;  1VLT A;  3ABL C;  1IW7 F;  2ZXP A;  2EPL X;  2EPK X;  3IQ5 A;  3K1I A;  2YLG A;  4JCH A;  1M57 C;  2EIK C;  2YL7 A;  3N0T A;  4MTF A;  2ASR A;  5A6A A;  3ABM C;  4K0D A;  5COF A;  5B1B C;  2DI3 A;  1Z23 A;  1TKN A;  5JS5 A;  2W45 A;  3LS1 A;  3EFO A;  3MBG A;  4BJ5 C;  5L3Q A;  3S0X A;  3C8G B;  3GEE A;  4LLC A;  4OIO F;  2R7W A;  3G4X A;  2YKZ A;  3X2Q C;  3DMD A;  3LJB A;  5F5H A;  4JTA B;  1APC A;  4BEM J;  4CJG A;  4DXW A;  1LKX A;  5KYX A;  3FOO A;  4G7Z F;  2L7A A;  1OCO C;  1RKE B;  1H6G A;  2VAS A;  4AL0 A;  3IQC A;  3DJN B;  4EWC A;  4PFP A;  4ZLC A;  5KYY A;  2QY9 A;  3U8P A;  3TUL A;  1SF8 A;  4LDQ A;  2EIJ C;  1V74 B;  2BE5 F;  4JKV A;  1XZP A;  4N6H A;  2P0N A;  3VM6 A;  1QQ3 A;  2NSG A;  5L0F A;  1FR0 A;  4PJN A;  3DKA A;  4QDL A;  3B0U X;  2Q00 A;  5DLJ A;  2J9U A;  2A0B A;  4JTC B;  4EBK A;  5HV9 A;  1SR2 A;  3C18 A;  2R7R A;  2GWW A;  1MND A;  2NPU A;  3EHN A;  1AUE A;  3PCV A;  3UGO A;  3G50 A;  1GQA A;  4K1O A;  4JC7 A;  3RFY A;  1JR8 A;  4G7H F;  3GWL A;  3TJ6 A;  4CBE A;  3A11 A;  3FAJ A;  3M79 A;  4CDA A;  4EBB A;  4AE4 A;  1S05 A;  3JYY A;  3AQC A;  3OWT A;  4E0H A;  3S84 A; 
#chains in the Genus database with same CATH homology
 3IHU A;  3SXY A;  1HW2 A;  2HS5 A;  1E2X A;  3SXM A;  3SXK A;  3C7J A;  3FMS A;  1H9T A;  3SXZ A;  1H9G A;  2DI3 A;  4P9F A;  1HW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...