3SXKA

Zn2+-bound fcd domain of tm0439, a putative transcriptional regulator
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
140
structure length
140
Chain Sequence
b'GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVAASAAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Zn2+-bound FCD domain of TM0439, a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 55
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxkA00
2DI3A 1HW2A 1E2XA 3SXYA 3SXZA 3C7JA 4P9FA 3SXMA 3FMSA 3IHUA 2HS5A 3SXKA 1H9GA 1HW1A 1H9TA
chains in the Genus database with same CATH superfamily
3M1CB 1MNEA 4MNDA 5B3IA 4KBLA 2IXNA 2PP4A 3VRCA 1F1MA 1Q0KA 1K04A 3U2MA 1JAFA 3F47A 4CDVA 4AL0A 1LS1A 1AUEA 1NLXA 2R02A 3ECSA 1D0XA 1LE2A 3GM2A 1E85A 2H7BA 4PR9A 3SZRA 5AGFA 5L0IA 4GEHA 4AL1A 1Y4CA 3SEOA 4X0RA 3PHF2 1H6GA 1H9TA 5COFA 1OR2A 1A41A 2QE9A 1Z3IX 2C04A 4U5EE 3U9MA 4JRZA 4JIOA 1VLTA 1CPRA 3T6BA 2I8BA 2L81A 1RCPA 4OIPF 1RJ9B 2Y39A 2EIMC 2H7OA 3WODF 1M2OA 1LI7A 3OEOA 5D91A 2EPLX 3U3FA 1HY5A 1T5OA 1NSGB 1TFOB 4IAQA 4JJFA 2KK1A 2YLGA 5F5FA 3O55A 4XPWA 4GQHA 3U0CA 3EGXA 4J7YA 2HUJA 5CI8A 4YK5A 3R2PA 1TFKB 5KYYB 1Z63A 3GEHA 4BJ5C 2EPNA 1ZYRF 3V5ZA 4DVYP 3ASOC 5KYYA 1D0YA 4J32B 3IEEA 4YT8A 1G8XA 2B0JA 4O6MA 2Z15A 1V4AA 3LEOA 3AG1C 4XPXA 4BEMJ 3N0TA 4IRUA 2XL4A 4WGYA 4K0DA 1MNDA 2AU5A 4DBQA 3K1HA 2CCYA 3U8PA 2JPUA 3FVYA 2E87A 2R7UA 2L6HA 4YT2A 4LDKA 1YVIA 3FXHA 4MTGA 1YDIA 1T6QA 3FMSA 3LLKA 1VYKA 4C3BA 3I4UA 2M64A 1XWJA 2W9YA 3C8GD 2J9BA 3DWWA 4P9TA 4CS9A 2CYDA 4MS2A 2Q00A 1SF8A 3E70C 2MHRA 2KYHA 3RQGA 1MMGA 1HE1A 1OCCC 2FAPB 1JMWA 3B71A 4Q7CA 3EJNA 3B0UX 2JX0A 3RQFA 2X51A 2A68F 3AGUA 3IQCA 3TOMA 4U5CE 2HSBA 4EWCA 4UDVA 1Q0FA 2OEVA 1WATA 3O10A 4IARA 5BQIA 3KYIA 2XLWA 5K0IA 2P0NA 3I5PA 3EGDB 2Q7RA 3NDBB 2YL0A 2FFHA 1ZHZA 3H2VA 1PD0A 2XM0A 4U9EA 2ZXRA 1TWCA 4KNVA 1R4TA 2JD3A 5KYUA 3ZVRA 1ZW2A 2LK4A 3AGTA 2XS8A 3U5SA 1HW1A 1ZVZA 2YL3A 4ER9A 4NY3A 3ZTMA 4U5FE 2XXAA 4P6IC 3HNKA 3L8JA 2J0WA 3B0PA 2LP4A 1RMVA 1C03A 5L0GA 2HV6A 1VLSA 3A9CA 3UMIA 3N2ZB 5CIVA 3LLIA 1RKEA 3J06A 4IGGA 2PBEA 4YL1A 2VCCA 2PFDA 3KL4A 4U5GA 4U9DA 4CSAA 4CJOA 5JP7A 3HNLA 3O39A 1OCOC 2L6FA 4JURI 2G3KA 1C02A 1NU9C 1T01A 4WABA 4ZLCA 3WAQA 3K1IA 3MX3A 2ASRA 3AG3C 2ICWG 3JSEO 2W45A 3NYLA 2RSEB 4JCHA 4U5DE 4OIRF 3RVZA 1YA7O 4LLCA 4BEJA 5COGA 4CJGA 5JLIA 2NPUA 4E0IA 3GORA 1IW7F 4JEBA 4DXWA 4W8PA 3DE9A 1QLEC 3C18A 4JTAB 3RW0A 4C7OB 3TJ6A 3ZDLA 4D4NA 3EHNA 2QNLA 1LKXA 3U8VA 1T6UA 1Q0DA 2HSQA 1E86A 2XLVA 4YL0A 4XWJA 4RBNA 3AQBA 4Z9JA 3SXYA 1V74B 2GA0A 4PJMA 2XLDA 1Q0MA 2GDCA 4JJGA 4P9FA 4MVOA 4PJJA 3F46A 3DJNB 4E18A 1EKYA 1N1CA 4JC7A 3KH2A 3OA1A 4CS9C 2A6HF 1K40A 5A6BA 3WHNA 1SZIA 1K05A 4XEKA 2H7VC 5B1BC 4C3DA 1QVXA 3HTKC 1B68A 2X0CA 4G7OF 2KSFA 2NUPA 1YJGA 3DJUB 3W8IA 4DVZA 1WASA 2HFIA 3QMKA 1EQ1A 3V7OA 3AG2C 1VTMP 3PCVA 3JRMO 2R7VA 3BEHA 2EPOA 4K7BA 2B0HA 2OJQA 2XLMA 3EGXB 4JTDB 5DVWA 5FZTA 2YZSA 3S90A 1R5ID 1Z6AA 2PX0A 4XTKA 1V54C 4L6RA 2YWAA 1HE9A 4N4WA 2IBFA 3SXKA 4A2NB 4G0HA 3C8GB 3H65A 1AVOB 4KI2A 2VB6A 5A6BD 3QVYA 1NZEA 2R7TA 4YT5A 4ULWA 4EHPA 4CDAA 3C8ZA 2OJED 5TJ5E 4HE8D 4MTOA 2HJ3A 1NG1A 2DGJA 2W4MA 2LCHA 4AK9A 3C7JA 2VCAA 1PCXA 3EG9B 1S7ZA 3K66A 2IYLD 4WGZA 2MWQA 3TK0A 3ZC4A 2AP3A 4OIQF 2WVOA 4H54A 4XPYA 5E33A 1YA9A 4AE4B 5DS4A 4R32A 3NKDA 2XLEA 3FDQA 3NRHA 3S84A 1XZQA 2MYSA 4CS8C 3HJCA 2W4BA 2GAQA 2LD6A 3RIPA 4N6HA 4LLEA 1E84A 1OW7A 3EH1A 4CIPA 1ORJA 3K33A 2V3CC 2R7SA 3EZHA 3H2UA 2Q9BA 3O6XA 3CAXA 3DD7A 2WZFA 2VH3A 4IB4A 2NUTB 3TJ5A 2A0BA 3Q6MA 1ST6A 2FGYA 4WJ0A 3LNRA 3T6GB 4FWVA 1MMNA 2YVKA 1I4YA 1L7CA 2DYRC 3L1MA 4O7GA 3NYMA 1BR4A 3VM6A 3L34A 2IOQA 2OKUA 1C17M 3E9VA 2D5RB 1JR8A 2HZ8A 3W8HA 1YYJA 2Q9CA 5KYUB 2YL1A 2EILC 1DOVA 2L6GA 3DAGA 1OCRC 3QTHA 3W2WA 2KJGA 3DM5A 1H9GA 5A6AA 3M79A 1KU2A 2DI3A 1E2XA 3TD7A 4I3MA 3EPVA 2YEVA 5JT4A 1SMYF 3GEIA 3DM9B 3UGOA 1G5ZA 1OXBA 4O79A 1TWHA 3S28A 5A6JA 2J7PA 3S0XA 3EFOA 3GM1A 4E7SA 1RKEB 2ETSA 1TWAA 2KQ9A 3ASNC 1CGNA 3RQEA 1D1AA 1D1BA 4BJ6C 4GYTA 4W8KA 3S9OA 3X2QC 1A7VA 3FAPB 4JW1A 3UGPA 5L0CA 4HFFB 3NYJA 1OQCA 1WTYA 2YHSA 2OG2A 4JTCB 1OKKA 2LFDA 4BG0A 3W2VA 4LERA 1WWPA 2EIKC 3HLZA 4RDAA 5E3CA 5BQHA 1RJ9A 4EBBA 3RFYA 2R05A 2P61A 1SYQA 2VASA 4LDRA 5CI9A 1JPJA 3KPHA 2J7PD 4OD5A 1TQGA 2CNWA 1M2VA 1VYIA 1VOMA 3GM3A 3IQ5A 3LS0A 3UMHA 4IJJA 5E3AA 5HV9A 2XRHA 5EK0A 3C63A 4OIOF 1JOGA 4LDQA 3MLGA 2VC9A 3QW1A 4MVQA 4EUKB 4MQ9F 2CDQA 1FFHA 1PD1A 1U6HA 1Z23A 2EIJC 2NSGA 1FTSA 4PACA 1KTMA 3DKAA 5F5HA 1OKKD 4KNWA 1CPQA 5FCLA 4I1MA 5L3QA 4FX5A 1LI5A 4O6YA 2J46A 4Q4ZF 5B3SC 3SXZA 1FNTc 3HKKA 2A69F 2Y3BA 1YAUO 2WZGA 2ZD9A 3LESA 2EPMX 2CNWD 3T6JA 4XEVA 3X1OA 4OINF 3VYWA 4ANJA 2PF4E 4G7ZF 1A0BA 4MVSA 5BQGA 2ZXWC 4CS7A 4PK4A 2H8AA 4DBRA 5JUAA 2XSEA 4ULVA 3ABMC 2CW0F 1G4US 4D4XA 3IQ6A 1SR2A 5E2QA 5T3WA 4ONSA 2Q3TA 2I15A 4H4KC 4FAPB 1Z5ZA 2A1DD 2ZPAA 1IZMA 1G4WR 2HJMA 1UFBA 3ZQYA 5JRAA 4N6CA 2Y3HA 3NMKA 2WB7A 4F4BA 5KYXA 2P6VA 4EKWA 1NBBA 2AWYA 3B29A 1EA8A 2GFHA 2WVQA 5DS6A 2OQMA 4NCQA 5GPGB 3QVZA 3POVA 1ZW3A 2DB4A 4XQ1A 4BJ5A 2R7WA 2OOCA 3UR3C 3ZIBA 3ABKC 2P1AA 2HMZA 3DZAA 1GQAA 1T9KA 4XEFA 3ZTZA 4DRIB 1YZCA 5JS5A 5L0DA 2Q9AA 3M4CA 2LIGA 3DAFA 2XM4A 2EPKX 2XL8A 2OU6A 1O3UA 1FAPB 2QLAA 2UUHA 3FOPA 1TR2A 3RVYA 3WG7C 1V55C 4MVRA 4EBKA 2L7AA 2YLDA 4O6NA 1NFNA 5DLJA 2QY9A 4EIYA 1M56C 1D1CA 5L0FA 4G78A 1LIHA 1UG7A 3QW0A 1VB5A 2AWCA 3MBGA 4MVMA 1BR1A 1MMAA 2HKVA 2P7VA 3Q6NA 2PNOA 3V5XA 4LACB 2YKZA 3CEXA 3TULA 4C7OA 5D92A 1E83A 5AC5A 3GWLA 3R7CA 2ZXOA 4Z9IA 3S29A 1M6TA 4MW3A 3ZQVA 4JVSA 2R9RB 4N06A 1FMWA 1RXQA 3LNMB 3DI5A 4QI2A 4I44A 2R03A 2J9VA 1VK5A 2WZLA 3DE8A 3L8IA 4CSAC 5AC4A 3JSZA 4DRHB 1A7EA 3G4XA 2UUIA 2XS1A 5L0HA 1QSPA 3MYFA 2EINC 3SNHA 2J9WA 5EGYA 4YWQA 1RKCA 3JYYA 3NMJA 3EFOB 2HV7A 3K1IC 2XLHA 1WOLA 4J30B 4KC9A 4MVUA 2RD9A 1W2WA 1YLMA 1HMOA 3ITFA 1ZHWA 3U2LA 2PX3A 1LVKA 3KMIA 3NG1A 4BPMA 5A6KA 1I4ZA 1J8MF 3ATPA 5KYWA 1YARO 3US6A 256BA 2XL6A 1GGQA 3DXJF 1BBHA 1FMVA 2Y3DA 1FR0A 2HMQA 1LPEA 2BE5F 2G62A 2KGOA 4PFPA 5JVEA 1ZHTA 1HW2A 3EQLF 3MFNA 4DJ9A 4MVZA 3W4YA 2J9UA 2CGEA 3G4ZA 5IY5C 1BZ4A 2R7XA 3RF3A 2M4EA 1M2VB 1ORYA 1TWGA 2DYSC 3IHUA 3KYJA 4NTAA 3V5YA 3IPMO 1EI7A 3FAJA 3K7DA 5DQZA 2AVKA 4K1OA 4RD9A 4IAOA 5JSLA 4CX9A 5BUOA 3KKBA 4NTFA 3PDMP 3DMDA 1XZPA 4YN0B 2HS5A 3IQTA 1MMDA 5HSWA 3M15A 1VMAA 3C8GA 4FESA 4JKVA 2IXMA 4YJWA 4NC3A 2TMVP 3B0VC 1CGME 1DOWA 3GODA 4BJ1A 4U5HA 2O9XA 4E0HA 2A0UA 2LQGA 3M4BA 2NSFA 5COMA 1OCZC 2Y3GA 2R7QA 2KNHA 3EG9A 3N24A 4AE4A 3AG4C 1YZAA 1WN0A 3Q7GA 4OD4A 3LAYA 1D0ZA 1O5HA 4QDLA 3LS1A 1OR3A 1CGOA 1ZZPA 4YL3A 1QKRA 1ZU5A 3CSKA 4QI0A 4CDYA 1HMDA 3EHMA 3MYIA 3SXMA 3BRJA 4DRJB 2IXOA 3LJBA 4A4AA 1QQ3A 4HFKB 1QZXA 4NTBA 2XXAB 1S05A 1LE4A 2YLIA 2LFFA 2BC5A 2KC3A 4U5BE 5L0JA 1U0BB 3A11A 2IXPA 4IWBA 2NUTA 5KYXB 1Q0GA 1OW8A 1M57C 2R25A 3ZSUA 5KYNA 1ZU4A 2QTVA 3ABLC 3CZ6A 3HNIA 3EH2A 2L9JA 3EZIA 5A69A 1ZHXA 3VAYA 2Y69C 4XLNF 2NUPB 3AQCA 1AEPA 2YL7A 2WVNA 3B9QA 3JTLO 2J45A 3T4RA 4B6IA 4G7HF 1ZHYA 3JYHA 3ZG1A 2A6EF 1APCA 2J0XA 5EHHA 3RKOF 4E17A 4M63A 3TQOA 2G3VA 2QUPA 1Y6DA 1JPNA 4I1OB 4ZLDA 1LS4A 2ZXPA 3NMIA 3JT1A 1H7IA 3S27A 4J7TA 3I5QA 5T1DB 3RYLA 3AOUA 4CS8A 3G50A 2C03A 1JRAA 2KW3C 2LSEA 1T6IA 2F22A 3OWTA 1YYXA 1NU7D 3Q7LA 3TOLA 3EGDA 4CIHA 1J8YF 1FFTC 4JCZA 4MW8A 1BR2A 4JE9A 4C3EA 2R7OA 3JCUQ 3L0IA 1WGWA 4DOZA 1L3PA 3C62A 2Q4FA 3GANA 1KNYA 4EBJA 3UMKA 3K6BA 3RH3A 4AX2A 5DQTA 3T9OA 3ZWIA 4CBEA 2WL8A 3AJMA 4YT4A 2YRFA 3LEVA 4Q5SF 1TKNA 2J8WA 1I5NA 4XLPF 2R7RA 1QPUA 3GWNA 5T3TA 1GM5A 1OW6A 4HEAJ 3U3BA 3JRTA 5F28E 1ORSC 1O87A 4NQFA 5DS5A 4JEAA 4E7ZA 3SYNA 3U9JA 2XLOA 4PJLA 5KYWB 5B1AC 3VF0A 4BJTA 1MQVA 3HNJA 2VCBA 2IM8A 1BDJB 2OEXA 3PMRA 4PJNA 3UNGC 1U89A 1OXKA 1A7DA 3JZ0A 3LUTB 5L3VA 2D4UA 4MTFA 1PV3A 2V26A 1GS9A 3CQZA 2BL2A 3NKEA 3QZCA 4JZAA 4PFOA 4Z9HA 3FHDA 3GEEA 2YQYA 2NG1A 1Z7Qc 3FOOA 1NFOA 1LM3B 4BJ6A 2OCCC 3SP1A 2GWWA
chains in the Genus database with same CATH topology
2DI3A 1HW2A 1E2XA 3SXYA 3SXZA 3C7JA 4P9FA 3SXMA 3FMSA 3IHUA 2HS5A 3SXKA 1H9GA 1HW1A 1H9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DI3 A;  1HW2 A;  1E2X A;  3SXY A;  3SXZ A;  3C7J A;  4P9F A;  3SXM A;  3FMS A;  3IHU A;  2HS5 A;  3SXK A;  1H9G A;  1HW1 A;  1H9T A; 
#chains in the Genus database with same CATH topology
 3M1C B;  1MNE A;  4MND A;  5B3I A;  4KBL A;  2IXN A;  2PP4 A;  3VRC A;  1F1M A;  1Q0K A;  1K04 A;  3U2M A;  1JAF A;  3F47 A;  4CDV A;  4AL0 A;  1LS1 A;  1AUE A;  1NLX A;  2R02 A;  3ECS A;  1D0X A;  1LE2 A;  3GM2 A;  1E85 A;  2H7B A;  4PR9 A;  3SZR A;  5AGF A;  5L0I A;  4GEH A;  4AL1 A;  1Y4C A;  3SEO A;  4X0R A;  3PHF 2;  1H6G A;  1H9T A;  5COF A;  1OR2 A;  1A41 A;  2QE9 A;  1Z3I X;  2C04 A;  4U5E E;  3U9M A;  4JRZ A;  4JIO A;  1VLT A;  1CPR A;  3T6B A;  2I8B A;  2L81 A;  1RCP A;  4OIP F;  1RJ9 B;  2Y39 A;  2EIM C;  2H7O A;  3WOD F;  1M2O A;  1LI7 A;  3OEO A;  5D91 A;  2EPL X;  3U3F A;  1HY5 A;  1T5O A;  1NSG B;  1TFO B;  4IAQ A;  4JJF A;  2KK1 A;  2YLG A;  5F5F A;  3O55 A;  4XPW A;  4GQH A;  3U0C A;  3EGX A;  4J7Y A;  2HUJ A;  5CI8 A;  4YK5 A;  3R2P A;  1TFK B;  5KYY B;  1Z63 A;  3GEH A;  4BJ5 C;  2EPN A;  1ZYR F;  3V5Z A;  4DVY P;  3ASO C;  5KYY A;  1D0Y A;  4J32 B;  3IEE A;  4YT8 A;  1G8X A;  2B0J A;  4O6M A;  2Z15 A;  1V4A A;  3LEO A;  3AG1 C;  4XPX A;  4BEM J;  3N0T A;  4IRU A;  2XL4 A;  4WGY A;  4K0D A;  1MND A;  2AU5 A;  4DBQ A;  3K1H A;  2CCY A;  3U8P A;  2JPU A;  3FVY A;  2E87 A;  2R7U A;  2L6H A;  4YT2 A;  4LDK A;  1YVI A;  3FXH A;  4MTG A;  1YDI A;  1T6Q A;  3FMS A;  3LLK A;  1VYK A;  4C3B A;  3I4U A;  2M64 A;  1XWJ A;  2W9Y A;  3C8G D;  2J9B A;  3DWW A;  4P9T A;  4CS9 A;  2CYD A;  4MS2 A;  2Q00 A;  1SF8 A;  3E70 C;  2MHR A;  2KYH A;  3RQG A;  1MMG A;  1HE1 A;  1OCC C;  2FAP B;  1JMW A;  3B71 A;  4Q7C A;  3EJN A;  3B0U X;  2JX0 A;  3RQF A;  2X51 A;  2A68 F;  3AGU A;  3IQC A;  3TOM A;  4U5C E;  2HSB A;  4EWC A;  4UDV A;  1Q0F A;  2OEV A;  1WAT A;  3O10 A;  4IAR A;  5BQI A;  3KYI A;  2XLW A;  5K0I A;  2P0N A;  3I5P A;  3EGD B;  2Q7R A;  3NDB B;  2YL0 A;  2FFH A;  1ZHZ A;  3H2V A;  1PD0 A;  2XM0 A;  4U9E A;  2ZXR A;  1TWC A;  4KNV A;  1R4T A;  2JD3 A;  5KYU A;  3ZVR A;  1ZW2 A;  2LK4 A;  3AGT A;  2XS8 A;  3U5S A;  1HW1 A;  1ZVZ A;  2YL3 A;  4ER9 A;  4NY3 A;  3ZTM A;  4U5F E;  2XXA A;  4P6I C;  3HNK A;  3L8J A;  2J0W A;  3B0P A;  2LP4 A;  1RMV A;  1C03 A;  5L0G A;  2HV6 A;  1VLS A;  3A9C A;  3UMI A;  3N2Z B;  5CIV A;  3LLI A;  1RKE A;  3J06 A;  4IGG A;  2PBE A;  4YL1 A;  2VCC A;  2PFD A;  3KL4 A;  4U5G A;  4U9D A;  4CSA A;  4CJO A;  5JP7 A;  3HNL A;  3O39 A;  1OCO C;  2L6F A;  4JUR I;  2G3K A;  1C02 A;  1NU9 C;  1T01 A;  4WAB A;  4ZLC A;  3WAQ A;  3K1I A;  3MX3 A;  2ASR A;  3AG3 C;  2ICW G;  3JSE O;  2W45 A;  3NYL A;  2RSE B;  4JCH A;  4U5D E;  4OIR F;  3RVZ A;  1YA7 O;  4LLC A;  4BEJ A;  5COG A;  4CJG A;  5JLI A;  2NPU A;  4E0I A;  3GOR A;  1IW7 F;  4JEB A;  4DXW A;  4W8P A;  3DE9 A;  1QLE C;  3C18 A;  4JTA B;  3RW0 A;  4C7O B;  3TJ6 A;  3ZDL A;  4D4N A;  3EHN A;  2QNL A;  1LKX A;  3U8V A;  1T6U A;  1Q0D A;  2HSQ A;  1E86 A;  2XLV A;  4YL0 A;  4XWJ A;  4RBN A;  3AQB A;  4Z9J A;  3SXY A;  1V74 B;  2GA0 A;  4PJM A;  2XLD A;  1Q0M A;  2GDC A;  4JJG A;  4P9F A;  4MVO A;  4PJJ A;  3F46 A;  3DJN B;  4E18 A;  1EKY A;  1N1C A;  4JC7 A;  3KH2 A;  3OA1 A;  4CS9 C;  2A6H F;  1K40 A;  5A6B A;  3WHN A;  1SZI A;  1K05 A;  4XEK A;  2H7V C;  5B1B C;  4C3D A;  1QVX A;  3HTK C;  1B68 A;  2X0C A;  4G7O F;  2KSF A;  2NUP A;  1YJG A;  3DJU B;  3W8I A;  4DVZ A;  1WAS A;  2HFI A;  3QMK A;  1EQ1 A;  3V7O A;  3AG2 C;  1VTM P;  3PCV A;  3JRM O;  2R7V A;  3BEH A;  2EPO A;  4K7B A;  2B0H A;  2OJQ A;  2XLM A;  3EGX B;  4JTD B;  5DVW A;  5FZT A;  2YZS A;  3S90 A;  1R5I D;  1Z6A A;  2PX0 A;  4XTK A;  1V54 C;  4L6R A;  2YWA A;  1HE9 A;  4N4W A;  2IBF A;  3SXK A;  4A2N B;  4G0H A;  3C8G B;  3H65 A;  1AVO B;  4KI2 A;  2VB6 A;  5A6B D;  3QVY A;  1NZE A;  2R7T A;  4YT5 A;  4ULW A;  4EHP A;  4CDA A;  3C8Z A;  2OJE D;  5TJ5 E;  4HE8 D;  4MTO A;  2HJ3 A;  1NG1 A;  2DGJ A;  2W4M A;  2LCH A;  4AK9 A;  3C7J A;  2VCA A;  1PCX A;  3EG9 B;  1S7Z A;  3K66 A;  2IYL D;  4WGZ A;  2MWQ A;  3TK0 A;  3ZC4 A;  2AP3 A;  4OIQ F;  2WVO A;  4H54 A;  4XPY A;  5E33 A;  1YA9 A;  4AE4 B;  5DS4 A;  4R32 A;  3NKD A;  2XLE A;  3FDQ A;  3NRH A;  3S84 A;  1XZQ A;  2MYS A;  4CS8 C;  3HJC A;  2W4B A;  2GAQ A;  2LD6 A;  3RIP A;  4N6H A;  4LLE A;  1E84 A;  1OW7 A;  3EH1 A;  4CIP A;  1ORJ A;  3K33 A;  2V3C C;  2R7S A;  3EZH A;  3H2U A;  2Q9B A;  3O6X A;  3CAX A;  3DD7 A;  2WZF A;  2VH3 A;  4IB4 A;  2NUT B;  3TJ5 A;  2A0B A;  3Q6M A;  1ST6 A;  2FGY A;  4WJ0 A;  3LNR A;  3T6G B;  4FWV A;  1MMN A;  2YVK A;  1I4Y A;  1L7C A;  2DYR C;  3L1M A;  4O7G A;  3NYM A;  1BR4 A;  3VM6 A;  3L34 A;  2IOQ A;  2OKU A;  1C17 M;  3E9V A;  2D5R B;  1JR8 A;  2HZ8 A;  3W8H A;  1YYJ A;  2Q9C A;  5KYU B;  2YL1 A;  2EIL C;  1DOV A;  2L6G A;  3DAG A;  1OCR C;  3QTH A;  3W2W A;  2KJG A;  3DM5 A;  1H9G A;  5A6A A;  3M79 A;  1KU2 A;  2DI3 A;  1E2X A;  3TD7 A;  4I3M A;  3EPV A;  2YEV A;  5JT4 A;  1SMY F;  3GEI A;  3DM9 B;  3UGO A;  1G5Z A;  1OXB A;  4O79 A;  1TWH A;  3S28 A;  5A6J A;  2J7P A;  3S0X A;  3EFO A;  3GM1 A;  4E7S A;  1RKE B;  2ETS A;  1TWA A;  2KQ9 A;  3ASN C;  1CGN A;  3RQE A;  1D1A A;  1D1B A;  4BJ6 C;  4GYT A;  4W8K A;  3S9O A;  3X2Q C;  1A7V A;  3FAP B;  4JW1 A;  3UGP A;  5L0C A;  4HFF B;  3NYJ A;  1OQC A;  1WTY A;  2YHS A;  2OG2 A;  4JTC B;  1OKK A;  2LFD A;  4BG0 A;  3W2V A;  4LER A;  1WWP A;  2EIK C;  3HLZ A;  4RDA A;  5E3C A;  5BQH A;  1RJ9 A;  4EBB A;  3RFY A;  2R05 A;  2P61 A;  1SYQ A;  2VAS A;  4LDR A;  5CI9 A;  1JPJ A;  3KPH A;  2J7P D;  4OD5 A;  1TQG A;  2CNW A;  1M2V A;  1VYI A;  1VOM A;  3GM3 A;  3IQ5 A;  3LS0 A;  3UMH A;  4IJJ A;  5E3A A;  5HV9 A;  2XRH A;  5EK0 A;  3C63 A;  4OIO F;  1JOG A;  4LDQ A;  3MLG A;  2VC9 A;  3QW1 A;  4MVQ A;  4EUK B;  4MQ9 F;  2CDQ A;  1FFH A;  1PD1 A;  1U6H A;  1Z23 A;  2EIJ C;  2NSG A;  1FTS A;  4PAC A;  1KTM A;  3DKA A;  5F5H A;  1OKK D;  4KNW A;  1CPQ A;  5FCL A;  4I1M A;  5L3Q A;  4FX5 A;  1LI5 A;  4O6Y A;  2J46 A;  4Q4Z F;  5B3S C;  3SXZ A;  1FNT c;  3HKK A;  2A69 F;  2Y3B A;  1YAU O;  2WZG A;  2ZD9 A;  3LES A;  2EPM X;  2CNW D;  3T6J A;  4XEV A;  3X1O A;  4OIN F;  3VYW A;  4ANJ A;  2PF4 E;  4G7Z F;  1A0B A;  4MVS A;  5BQG A;  2ZXW C;  4CS7 A;  4PK4 A;  2H8A A;  4DBR A;  5JUA A;  2XSE A;  4ULV A;  3ABM C;  2CW0 F;  1G4U S;  4D4X A;  3IQ6 A;  1SR2 A;  5E2Q A;  5T3W A;  4ONS A;  2Q3T A;  2I15 A;  4H4K C;  4FAP B;  1Z5Z A;  2A1D D;  2ZPA A;  1IZM A;  1G4W R;  2HJM A;  1UFB A;  3ZQY A;  5JRA A;  4N6C A;  2Y3H A;  3NMK A;  2WB7 A;  4F4B A;  5KYX A;  2P6V A;  4EKW A;  1NBB A;  2AWY A;  3B29 A;  1EA8 A;  2GFH A;  2WVQ A;  5DS6 A;  2OQM A;  4NCQ A;  5GPG B;  3QVZ A;  3POV A;  1ZW3 A;  2DB4 A;  4XQ1 A;  4BJ5 A;  2R7W A;  2OOC A;  3UR3 C;  3ZIB A;  3ABK C;  2P1A A;  2HMZ A;  3DZA A;  1GQA A;  1T9K A;  4XEF A;  3ZTZ A;  4DRI B;  1YZC A;  5JS5 A;  5L0D A;  2Q9A A;  3M4C A;  2LIG A;  3DAF A;  2XM4 A;  2EPK X;  2XL8 A;  2OU6 A;  1O3U A;  1FAP B;  2QLA A;  2UUH A;  3FOP A;  1TR2 A;  3RVY A;  3WG7 C;  1V55 C;  4MVR A;  4EBK A;  2L7A A;  2YLD A;  4O6N A;  1NFN A;  5DLJ A;  2QY9 A;  4EIY A;  1M56 C;  1D1C A;  5L0F A;  4G78 A;  1LIH A;  1UG7 A;  3QW0 A;  1VB5 A;  2AWC A;  3MBG A;  4MVM A;  1BR1 A;  1MMA A;  2HKV A;  2P7V A;  3Q6N A;  2PNO A;  3V5X A;  4LAC B;  2YKZ A;  3CEX A;  3TUL A;  4C7O A;  5D92 A;  1E83 A;  5AC5 A;  3GWL A;  3R7C A;  2ZXO A;  4Z9I A;  3S29 A;  1M6T A;  4MW3 A;  3ZQV A;  4JVS A;  2R9R B;  4N06 A;  1FMW A;  1RXQ A;  3LNM B;  3DI5 A;  4QI2 A;  4I44 A;  2R03 A;  2J9V A;  1VK5 A;  2WZL A;  3DE8 A;  3L8I A;  4CSA C;  5AC4 A;  3JSZ A;  4DRH B;  1A7E A;  3G4X A;  2UUI A;  2XS1 A;  5L0H A;  1QSP A;  3MYF A;  2EIN C;  3SNH A;  2J9W A;  5EGY A;  4YWQ A;  1RKC A;  3JYY A;  3NMJ A;  3EFO B;  2HV7 A;  3K1I C;  2XLH A;  1WOL A;  4J30 B;  4KC9 A;  4MVU A;  2RD9 A;  1W2W A;  1YLM A;  1HMO A;  3ITF A;  1ZHW A;  3U2L A;  2PX3 A;  1LVK A;  3KMI A;  3NG1 A;  4BPM A;  5A6K A;  1I4Z A;  1J8M F;  3ATP A;  5KYW A;  1YAR O;  3US6 A;  256B A;  2XL6 A;  1GGQ A;  3DXJ F;  1BBH A;  1FMV A;  2Y3D A;  1FR0 A;  2HMQ A;  1LPE A;  2BE5 F;  2G62 A;  2KGO A;  4PFP A;  5JVE A;  1ZHT A;  1HW2 A;  3EQL F;  3MFN A;  4DJ9 A;  4MVZ A;  3W4Y A;  2J9U A;  2CGE A;  3G4Z A;  5IY5 C;  1BZ4 A;  2R7X A;  3RF3 A;  2M4E A;  1M2V B;  1ORY A;  1TWG A;  2DYS C;  3IHU A;  3KYJ A;  4NTA A;  3V5Y A;  3IPM O;  1EI7 A;  3FAJ A;  3K7D A;  5DQZ A;  2AVK A;  4K1O A;  4RD9 A;  4IAO A;  5JSL A;  4CX9 A;  5BUO A;  3KKB A;  4NTF A;  3PDM P;  3DMD A;  1XZP A;  4YN0 B;  2HS5 A;  3IQT A;  1MMD A;  5HSW A;  3M15 A;  1VMA A;  3C8G A;  4FES A;  4JKV A;  2IXM A;  4YJW A;  4NC3 A;  2TMV P;  3B0V C;  1CGM E;  1DOW A;  3GOD A;  4BJ1 A;  4U5H A;  2O9X A;  4E0H A;  2A0U A;  2LQG A;  3M4B A;  2NSF A;  5COM A;  1OCZ C;  2Y3G A;  2R7Q A;  2KNH A;  3EG9 A;  3N24 A;  4AE4 A;  3AG4 C;  1YZA A;  1WN0 A;  3Q7G A;  4OD4 A;  3LAY A;  1D0Z A;  1O5H A;  4QDL A;  3LS1 A;  1OR3 A;  1CGO A;  1ZZP A;  4YL3 A;  1QKR A;  1ZU5 A;  3CSK A;  4QI0 A;  4CDY A;  1HMD A;  3EHM A;  3MYI A;  3SXM A;  3BRJ A;  4DRJ B;  2IXO A;  3LJB A;  4A4A A;  1QQ3 A;  4HFK B;  1QZX A;  4NTB A;  2XXA B;  1S05 A;  1LE4 A;  2YLI A;  2LFF A;  2BC5 A;  2KC3 A;  4U5B E;  5L0J A;  1U0B B;  3A11 A;  2IXP A;  4IWB A;  2NUT A;  5KYX B;  1Q0G A;  1OW8 A;  1M57 C;  2R25 A;  3ZSU A;  5KYN A;  1ZU4 A;  2QTV A;  3ABL C;  3CZ6 A;  3HNI A;  3EH2 A;  2L9J A;  3EZI A;  5A69 A;  1ZHX A;  3VAY A;  2Y69 C;  4XLN F;  2NUP B;  3AQC A;  1AEP A;  2YL7 A;  2WVN A;  3B9Q A;  3JTL O;  2J45 A;  3T4R A;  4B6I A;  4G7H F;  1ZHY A;  3JYH A;  3ZG1 A;  2A6E F;  1APC A;  2J0X A;  5EHH A;  3RKO F;  4E17 A;  4M63 A;  3TQO A;  2G3V A;  2QUP A;  1Y6D A;  1JPN A;  4I1O B;  4ZLD A;  1LS4 A;  2ZXP A;  3NMI A;  3JT1 A;  1H7I A;  3S27 A;  4J7T A;  3I5Q A;  5T1D B;  3RYL A;  3AOU A;  4CS8 A;  3G50 A;  2C03 A;  1JRA A;  2KW3 C;  2LSE A;  1T6I A;  2F22 A;  3OWT A;  1YYX A;  1NU7 D;  3Q7L A;  3TOL A;  3EGD A;  4CIH A;  1J8Y F;  1FFT C;  4JCZ A;  4MW8 A;  1BR2 A;  4JE9 A;  4C3E A;  2R7O A;  3JCU Q;  3L0I A;  1WGW A;  4DOZ A;  1L3P A;  3C62 A;  2Q4F A;  3GAN A;  1KNY A;  4EBJ A;  3UMK A;  3K6B A;  3RH3 A;  4AX2 A;  5DQT A;  3T9O A;  3ZWI A;  4CBE A;  2WL8 A;  3AJM A;  4YT4 A;  2YRF A;  3LEV A;  4Q5S F;  1TKN A;  2J8W A;  1I5N A;  4XLP F;  2R7R A;  1QPU A;  3GWN A;  5T3T A;  1GM5 A;  1OW6 A;  4HEA J;  3U3B A;  3JRT A;  5F28 E;  1ORS C;  1O87 A;  4NQF A;  5DS5 A;  4JEA A;  4E7Z A;  3SYN A;  3U9J A;  2XLO A;  4PJL A;  5KYW B;  5B1A C;  3VF0 A;  4BJT A;  1MQV A;  3HNJ A;  2VCB A;  2IM8 A;  1BDJ B;  2OEX A;  3PMR A;  4PJN A;  3UNG C;  1U89 A;  1OXK A;  1A7D A;  3JZ0 A;  3LUT B;  5L3V A;  2D4U A;  4MTF A;  1PV3 A;  2V26 A;  1GS9 A;  3CQZ A;  2BL2 A;  3NKE A;  3QZC A;  4JZA A;  4PFO A;  4Z9H A;  3FHD A;  3GEE A;  2YQY A;  2NG1 A;  1Z7Q c;  3FOO A;  1NFO A;  1LM3 B;  4BJ6 A;  2OCC C;  3SP1 A;  2GWW A; 
#chains in the Genus database with same CATH homology
 2DI3 A;  1HW2 A;  1E2X A;  3SXY A;  3SXZ A;  3C7J A;  4P9F A;  3SXM A;  3FMS A;  3IHU A;  2HS5 A;  3SXK A;  1H9G A;  1HW1 A;  1H9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...