2IXMA

Structure of human ptpa
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
300
structure length
300
Chain Sequence
FIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLLALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Pp2A Phosphatase Activator: Implications for its Pp2A-Specific Ppiase Activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE 2A REGULATORY SUBUNIT B
total genus 117
structure length 300
sequence length 300
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2ixmA02
2IXOA 2G62A 4LACB 2IXNA 2IXMA 2HV6A 2HV7A 4NY3A 2IXPA
chains in the Genus database with same CATH superfamily
2ETSA 4LDQA 4NCQA 3U3BA 4OD5A 4AE4B 3EGDB 2YKZA 2ICWG 3NKDA 2IXNA 2XS8A 4JCZA 4HFKB 4JEBA 4N06A 4BEMJ 2EPKX 5GPGB 1H9TA 3FXHA 2W9YA 1ORYA 2P61A 3BEHA 3DD7A 3HJCA 3S9OA 2CCYA 2GAQA 2M4EA 2YHSA 5HV9A 1RMVA 1ZHXA 1PD0A 3UMIA 4CSAA 4BJTA 4DBRA 1LIHA 5IY5C 3ZWIA 2IBFA 2H7VC 3EHMA 2KSFA 3GORA 5T1DB 2VCBA 3M15A 1JOGA 3KYIA 3US6A 3FOOA 1T6UA 3ITFA 3POVA 2LP4A 4MVSA 1SMYF 4P9TA 1C02A 2XLHA 2YVKA 3JRTA 4L6RA 3ASOC 4JE9A 5JP7A 2HKVA 3RVYA 1NLXA 2AVKA 2R25A 3PCVA 2GA0A 1T6QA 2A6HF 1VYKA 4G7OF 1U89A 4EWCA 1A41A 4UDVA 2UUIA 4JEAA 4K0DA 5E2QA 4MTGA 2IXMA 4XTKA 1OW6A 1N1CA 1V74B 3X1OA 4BPMA 5L0IA 3MLGA 4OIRF 2OCCC 2VCCA 2YLGA 2XS1A 4CS7A 5B3IA 1TWGA 4HEAJ 2L7AA 3TQOA 4DVYP 1CGOA 1H6GA 3ZVRA 2XSEA 1YZCA 1EI7A 4DRIB 4CBEA 3N24A 4WGYA 4JJGA 2IXOA 3IQCA 4G7HF 2R7WA 2EPNA 2QNLA 3GODA 2JX0A 3U5SA 1V55C 3KKBA 4CIHA 1YYJA 5B1BC 2J9BA 5CI9A 3GM2A 2WVQA 5FZTA 5BQHA 2KQ9A 3C8ZA 2PX0A 2NPUA 3OA1A 1U6HA 1H9GA 1QKRA 1G4US 2OQMA 3NMKA 4MVZA 4XLNF 2J9UA 3U2MA 4MVMA 2HS5A 3I4UA 3HLZA 2R7TA 3SXMA 5DVWA 5T3WA 5DQTA 3NDBB 2A68F 3ATPA 4RDAA 1ORSC 2R7RA 3G4ZA 2XXAB 5JS5A 3S0XA 2YWAA 1KTMA 2ZPAA 2G3KA 3AJMA 5B3SC 1Y6DA 4JTAB 2YL0A 3Q6MA 5F5FA 1YZAA 4ZLDA 2W45A 2F22A 4P9FA 4OIPF 2Q9AA 4CJOA 2OJQA 5JUAA 1VLTA 2IXPA 3MYFA 1AVOB 2NUTA 3VYWA 3V5YA 1MNDA 3Q7LA 4E0HA 5KYUB 2O9XA 1HE1A 4G0HA 5FCLA 1M2VB 4JIOA 4P6IC 1L7CA 3RQFA 4YL3A 5L0DA 5HSWA 3C8GB 2WZLA 5BQIA 1ZU5A 1XWJA 3LNRA 4PJMA 5L0FA 5KYXB 2A1DD 3DAGA 2ZXPA 1ORJA 3JSEO 4YL1A 1E2XA 3ABMC 4KBLA 3JYYA 5A6KA 3W8HA 2TMVP 3JYHA 3LLKA 4PFPA 2NUTB 2ZXRA 5EGYA 3JT1A 1RKEB 1BR2A 2IYLD 2Q3TA 3KMIA 2HSQA 4FWVA 2FAPB 3RF3A 3DJUB 4BJ5C 1LE2A 2Q9BA 3TOLA 4BEJA 2QUPA 2G62A 3S84A 4CX9A 2HMQA 4YJWA 3UR3C 2IM8A 4CDYA 5DQZA 3KYJA 1FMVA 3HTKC 3L0IA 1H7IA 4Q7CA 3IQ5A 2CGEA 1YJGA 2XL6A 5AGFA 1E84A 3ZSUA 1Q0MA 3L8IA 4NY3A 2VCAA 3DKAA 2J45A 1EQ1A 2DB4A 2QTVA 4KNVA 1NFNA 4BG0A 3CEXA 4E18A 2AWYA 2C04A 4KC9A 2HUJA 2R7QA 2Y3HA 4JCHA 5JVEA 4CS8C 4PK4A 4N6CA 3QW1A 2XRHA 3EHNA 3F46A 4MQ9F 5KYYB 3L34A 3EGXB 2LQGA 1Q0DA 2Y39A 1FAPB 4JKVA 3DM5A 2A0UA 3M4CA 4O79A 3U9MA 1YARO 1WOLA 3SP1A 2KJGA 2EPOA 3NKEA 4AK9A 2EINC 5DS5A 2H7BA 2R02A 1NG1A 5KYUA 2J0WA 2HSBA 2YL1A 3PHF2 1Z6AA 1MQVA 4LLEA 4U5HA 4M63A 1ZVZA 3K33A 1QQ3A 2VC9A 4ULVA 1VMAA 1G4WR 4U5BE 2GWWA 2OEXA 5E3CA 4BJ5A 1T5OA 1HMOA 3GANA 1VTMP 3C7JA 1G8XA 2LCHA 1YA9A 4B6IA 1OQCA 4NTBA 4G7ZF 2ASRA 2WL8A 5B1AC 4EIYA 1YLMA 2DYRC 3M79A 2H8AA 4J7YA 1PD1A 4U5DE 4LDRA 1QVXA 3PMRA 3NYJA 4O6NA 2EIJC 4I44A 3ASNC 4E7SA 2R7UA 4U5FE 3JSZA 3O55A 2PFDA 3DXJF 3MFNA 1LI7A 5KYNA 2R7OA 5JT4A 3UGOA 4DBQA 1QLEC 3GEIA 3TJ6A 4CS8A 4H54A 4ULWA 2KGOA 2HV6A 3NMIA 3AGUA 3GWLA 3O6XA 4XWJA 1RKCA 3AG1C 3DI5A 4C3EA 2I15A 3FAJA 3FAPB 4N6HA 3RQEA 1MMAA 3RVZA 1GGQA 1Q0GA 2I8BA 3K7DA 5T3TA 1S05A 3K1IA 2Q7RA 4EHPA 4Q5SF 1LKXA 1FTSA 3EZHA 2XM4A 4YT2A 1CGNA 5JLIA 1YAUO 4Q4ZF 3FOPA 3U3FA 4YT4A 3DE9A 2JD3A 4NTFA 1Z63A 5F5HA 4PJNA 3VF0A 3LEOA 3CQZA 1HW2A 1FFTC 2EPLX 3FDQA 1KU2A 3AG2C 2ZXWC 3DMDA 4HE8D 1KNYA 1O87A 4CS9C 1ZHYA 2ZXOA 1OCRC 3JCUQ 4DRHB 5AC5A 5L0GA 2HZ8A 3EFOB 4MVQA 1D0ZA 3C8GA 3OEOA 4O6MA 3LJBA 4QDLA 4BJ1A 5KYXA 2XLWA 2PP4A 3M1CB 2XLOA 1K40A 5DS4A 3TK0A 3W2VA 5KYYA 3W8IA 2KC3A 2WZFA 3EZIA 3N2ZB 2P7VA 1AUEA 2EIMC 3AG3C 1OR3A 3B0VC 3NMJA 3UNGC 2WVNA 4QI2A 1Q0KA 1ZW2A 2AU5A 2PNOA 3H2UA 5AC4A 2GFHA 4DXWA 3SXZA 2D4UA 3DM9B 3V5XA 1BBHA 1K04A 3B29A 2LSEA 2QLAA 3QVZA 2DGJA 1I5NA 2G3VA 4IRUA 4AX2A 2GDCA 4K7BA 2R7SA 2WZGA 4IAQA 3WG7C 1OCZC 1L3PA 4AE4A 2MHRA 4GQHA 3LESA 2Q00A 3AQCA 3K1IC 3ZQYA 1YYXA 3JZ0A 2Y3BA 3S27A 2A0BA 2Y3DA 2DYSC 4NTAA 3T4RA 1GS9A 3S29A 2WVOA 1LS4A 1RKEA 256BA 2NG1A 2CDQA 4I1OB 1A0BA 2AWCA 3ZC4A 3JTLO 3GM3A 3TULA 3K1HA 1FFHA 1ST6A 1HY5A 3T9OA 1S7ZA 1NZEA 3GWNA 4MVUA 4CS9A 5DS6A 3S90A 1U0BB 1NBBA 5E33A 2CNWA 1ZHZA 3L8JA 1C03A 4EBBA 4KI2A 3PDMP 1A7VA 5A6BA 4D4NA 4YT8A 3C62A 5COFA 3TD7A 4QI0A 4I3MA 2W4MA 3AQBA 1OW7A 3LS1A 4C3DA 2E87A 3RYLA 3EFOA 4YL0A 1SF8A 4E0IA 5K0IA 2PF4E 1RXQA 2XLEA 3T6GB 4I1MA 1RCPA 4LERA 5DLJA 3TOMA 1D0XA 1WTYA 5JSLA 4FAPB 1BZ4A 1MNEA 1BR4A 1V54C 1VLSA 1WGWA 4MW3A 2XLMA 2XXAA 1VOMA 2HFIA 3B9QA 3E9VA 2XL8A 4W8PA 4LDKA 1TFOB 4OD4A 1BDJB 4YN0B 1A7EA 3M4BA 4OIOF 4WGZA 4PJJA 3G4XA 1R4TA 3CSKA 1HE9A 1T6IA 4HFFB 1GQAA 4OIQF 3EGXA 4EBJA 4ANJA 1OR2A 1QSPA 1VB5A 3FMSA 1TKNA 2JPUA 2RSEB 4XEVA 2AP3A 3HNKA 5EK0A 1CGME 2R03A 2Q9CA 3LS0A 1NSGB 3R7CA 4AL0A 5L3VA 4ONSA 1CPRA 1OCOC 1E83A 4CIPA 2J9WA 2R7VA 1Z23A 2HJ3A 3ZTMA 4K1OA 1NFOA 2B0HA 2YEVA 5F28E 1ZHTA 1Y4CA 1M56C 2BE5F 5L0CA 1R5ID 2W4BA 3RH3A 4ER9A 3QZCA 2J8WA 1EKYA 2OJED 3E70C 1CPQA 1TFKB 2IOQA 3NG1A 4JURI 4XPYA 2UUHA 4JTDB 3SYNA 3ZG1A 3ZDLA 2OU6A 1YDIA 3AG4C 3MBGA 1JPJA 4FX5A 3A11A 1YA7O 2WB7A 4IAOA 4JTCB 3BRJA 4PR9A 2BC5A 3RIPA 1LVKA 4JJFA 5BQGA 1K05A 2VB6A 2HV7A 1FNTc 1D1BA 1JRAA 3ECSA 1JPNA 1MMNA 2BL2A 3KH2A 4MNDA 4DJ9A 3I5PA 1G5ZA 4X0RA 2J7PA 3ZQVA 3CZ6A 3U2LA 1O3UA 2XM0A 3WODF 3B0UX 4CDVA 3QTHA 2OKUA 2Q4FA 2FGYA 4J30B 1I4ZA 3QW0A 4LACB 1VK5A 3GM1A 3QVYA 4YWQA 1HW1A 1IW7F 4JC7A 4Z9IA 2YL3A 4RD9A 1M2VA 2YLIA 4IB4A 3H2VA 4U9DA 1BR1A 4C7OB 2B0JA 2NUPA 2Y69C 3DAFA 1F1MA 1LM3B 4EKWA 1SYQA 3CAXA 1LE4A 5TJ5E 3LNMB 3RQGA 2YQYA 2LK4A 1OW8A 3H65A 3VRCA 2P0NA 2PX3A 1B68A 2OOCA 3EH2A 3GEEA 4JW1A 3UMKA 2CW0F 2XLVA 4GYTA 5D92A 3TJ5A 4E7ZA 1OCCC 2NSGA 1SZIA 1LS1A 1ZYRF 4MS2A 1Z7Qc 3N0TA 2P6VA 4PACA 4KNWA 1WWPA 5L3QA 1OXBA 1WN0A 1J8MF 4MW8A 1A7DA 1TWCA 4CJGA 2MWQA 1Z5ZA 1MMDA 1O5HA 2NSFA 3NYLA 4DVZA 4IJJA 2MYSA 4IWBA 1SR2A 3RW0A 3SZRA 4DOZA 3F47A 3T6JA 1Q0FA 5E3AA 3ABKC 4MVOA 1J8YF 4U5CE 1OKKD 2H7OA 4CDAA 3HNLA 2M64A 1V4AA 3IEEA 3FHDA 1ZZPA 2YZSA 1JR8A 4NQFA 5A6AA 1TWHA 3RKOF 4R32A 1TR2A 1I4YA 2VASA 3T6BA 2XL4A 1UFBA 3U8PA 3WAQA 1JMWA 4MTOA 3EG9A 5KYWA 2J0XA 4IGGA 1QPUA 1TQGA 2L6GA 4AL1A 3LAYA 4XPWA 3K66A 3K6BA 1DOVA 2NUPB 2YRFA 3L1MA 3HNIA 3DE8A 4XPXA 2X0CA 2LIGA 4OINF 2Y3GA 3W2WA 2J9VA 4NC3A 1IZMA 4RBNA 2CNWD 2OG2A 1OKKA 4O6YA 1T01A 5EHHA 3V7OA 4JRZA 4EBKA 3DJNB 2HJMA 4XEFA 4A4AA 3MYIA 5L0JA 3AGTA 3U8VA 1VYIA 3SXYA 2A6EF 5KYWB 2R9RB 4JZAA 1XZPA 3NYMA 3EH1A 1MMGA 3IQTA 3B71A 1LPEA 2X51A 1D1CA 1YVIA 1ZU4A 3C8GD 4U5EE 3SNHA 1PV3A 2V3CC 2OEVA 2XLDA 2HMZA 1M2OA 2R05A 3LLIA 3KL4A 4J7TA 3UMHA 5A69A 1QZXA 2DI3A 3O39A 3ZTZA 4H4KC 2D5RB 3HNJA 4FESA 3EGDA 2LFDA 4WJ0A 1TWAA 2L6HA 4Z9JA 3ZIBA 2Z15A 1D0YA 3I5QA 4YK5A 2L81A 3ABLC 3V5ZA 5A6JA 4BJ6A 1XZQA 1OXKA 3Q7GA 3O10A 4F4BA 1D1AA 1HMDA 1PCXA 3SEOA 2VH3A 1JAFA 2LD6A 3AOUA 2PBEA 3RFYA 2KYHA 2YLDA 3NRHA 4PJLA 3C18A 4G78A 3QMKA 1C17M 2L9JA 2KK1A 1WATA 2YL7A 5L0HA 3J06A 3C63A 2LFFA 1T9KA 4D4XA 2KW3C 4WABA 4XLPF 4JVSA 2EILC 3LEVA 3G50A 3LUTB 5CI8A 4U5GA 4DRJB 2QE9A 1W2WA 4W8KA 3JRMO 1RJ9A 4Z9HA 3U0CA 3GEHA 3IHUA 1FMWA 5D91A 4EUKB 3FVYA 1UG7A 3MX3A 4J32B 1M6TA 2EIKC 2FFHA 4XQ1A 3Q6NA 1Z3IX 2J46A 1LI5A 3A9CA 1M57C 4CSAC 3R2PA 3S28A 3UGPA 2KNHA 4E17A 2A69F 4MTFA 2V26A 3EJNA 3EG9B 4MVRA 1RJ9B 1FR0A 1ZHWA 5A6BD 4PFOA 5BUOA 1AEPA 5CIVA 1E86A 1GM5A 1NU7D 3DWWA 3HKKA 4C7OA 3EQLF 3DZAA 3KPHA 4XEKA 4BJ6C 4U9EA 3VM6A 2RD9A 1E85A 1ZW3A 3OWTA 3VAYA 3IPMO 3SXKA 3W4YA 2R7XA 4C3BA 5COMA 3B0PA 2J7PD 1WASA 2P1AA 4ZLCA 1NU9C 2QY9A 5COGA 1DOWA 3IQ6A 2L6FA 4LLCA 4N4WA 3EPVA 4O7GA 2EPMX 3WHNA 3X2QC 2C03A 4A2NB 2CYDA 4IARA 4YT5A 1EA8A 3U9JA 5JRAA 2ZD9A 1APCA 4GEHA
chains in the Genus database with same CATH topology
4OD5A 4AE4B 3EGDB 3NKDA 2IXNA 2R7TA 4HFKB 4N06A 2W9YA 3DD7A 3HJCA 2M4EA 2YHSA 1ZHXA 1PD0A 3UMIA 4CSAA 4BJTA 4DBRA 5IY5C 2H7VC 3EHMA 5T1DB 3ITFA 3POVA 1SMYF 3JRTA 3ASOC 1VYKA 2A6HF 4G7OF 4EWCA 4K0DA 5E2QA 2IXMA 4XTKA 3X1OA 1N1CA 3MLGA 4OIRF 2OCCC 4CS7A 1TWGA 4HEAJ 4DVYP 3ZVRA 2XSEA 3N24A 4JJGA 2IXOA 4G7HF 2R7WA 4CIHA 3GODA 1V55C 3KKBA 5B1BC 5CI9A 2WVQA 2KQ9A 2PX0A 3OA1A 4XLNF 2J9UA 3I4UA 3HLZA 5DVWA 5T3WA 5DQTA 3NDBB 2A68F 4RDAA 2R7RA 2XXAB 3S0XA 2ZPAA 2G3KA 5B3SC 3Q6MA 5F5FA 4ZLDA 2W45A 4OIPF 2Q9AA 2IXPA 3VYWA 2NUTA 3Q7LA 1MNDA 5KYUB 2O9XA 4G0HA 5FCLA 1M2VB 4P6IC 5HSWA 5KYXB 2WZLA 1ZU5A 4PJMA 3LNRA 2A1DD 3DAGA 2ZXPA 3ABMC 4KBLA 3W8HA 3JYHA 3LLKA 4PFPA 2NUTB 2ZXRA 5EGYA 3JT1A 1BR2A 2IYLD 2Q3TA 3KMIA 4FWVA 4BJ5C 3DJUB 4BEJA 2Q9BA 2G62A 4YJWA 3UR3C 5DQZA 1FMVA 3HTKC 3L0IA 4Q7CA 2CGEA 3ZSUA 4NY3A 2J45A 2QTVA 4KNVA 4BG0A 2C04A 4KC9A 2R7QA 2Y3HA 4JCHA 4CS8C 4PK4A 2XRHA 3EHNA 3F46A 4MQ9F 5KYYB 3L34A 3EGXB 2Y39A 3DM5A 4O79A 3SP1A 2KJGA 4AK9A 3NKEA 5DS5A 2EINC 2H7BA 5KYUA 1NG1A 2J0WA 3PHF2 1Z6AA 4LLEA 4U5HA 4M63A 3K33A 1VMAA 4U5BE 5E3CA 4BJ5A 3GANA 1G8XA 4B6IA 4G7ZF 2WL8A 5B1AC 4U5DE 2DYRC 1PD1A 3PMRA 3NYJA 4O6NA 2EIJC 4I44A 3ASNC 4E7SA 2R7UA 4U5FE 3JSZA 2PFDA 3DXJF 5KYNA 2R7OA 3UGOA 4DBQA 1QLEC 4CS8A 4ULWA 2KGOA 2HV6A 3O6XA 4XWJA 3AG1C 4C3EA 3FAJA 1MMAA 3K7DA 2I8BA 5T3TA 4Q5SF 1LKXA 1FTSA 3EZHA 4YT2A 4Q4ZF 4YT4A 2JD3A 1Z63A 5F5HA 4PJNA 3CQZA 1FFTC 3FDQA 1KU2A 3AG2C 2ZXWC 3DMDA 4HE8D 4CS9C 1O87A 1ZHYA 2ZXOA 1OCRC 3JCUQ 4O6MA 3EFOB 1D0ZA 3OEOA 4QDLA 4BJ1A 3LJBA 5KYXA 2PP4A 3M1CB 5DS4A 3W2VA 5KYYA 3W8IA 2WZFA 3EZIA 3N2ZB 2P7VA 2EIMC 3AG3C 3B0VC 3UNGC 2WVNA 4QI2A 2GFHA 3DM9B 2LSEA 2DGJA 4IRUA 2G3VA 4AX2A 4K7BA 2R7SA 2WZGA 3WG7C 1OCZC 4AE4A 3LESA 3AQCA 3K1IC 3S27A 2Y3BA 3T4RA 2Y3DA 2DYSC 3S29A 2WVOA 2NG1A 2CDQA 4I1OB 3ZC4A 3K1HA 1FFHA 1ST6A 4CS9A 5DS6A 1S7ZA 1NZEA 5E33A 2CNWA 1ZHZA 4EBBA 4KI2A 4YT8A 3TD7A 4QI0A 4I3MA 2W4MA 3AQBA 3LS1A 4C3DA 2E87A 3RYLA 3EFOA 1SF8A 2PF4E 4I1MA 4LERA 5DLJA 1D0XA 1MNEA 1WGWA 1BR4A 1V54C 2XXAA 1VOMA 3B9QA 3E9VA 4OD4A 4OIOF 4YN0B 4PJJA 3CSKA 4HFFB 3EGXA 4ANJA 1TKNA 2Q9CA 3LS0A 5L3VA 1OCOC 2J9WA 2R7VA 1Z23A 2YEVA 1ZHTA 1M56C 2BE5F 2W4BA 3RH3A 3QZCA 3E70C 4JURI 2IOQA 3NG1A 3SYNA 3ZG1A 3AG4C 4FX5A 4IAOA 1JPJA 2WB7A 3RIPA 1LVKA 4JJFA 2VB6A 2HV7A 1D1BA 3ECSA 1JPNA 1MMNA 3KH2A 4MNDA 3I5PA 4X0RA 2J7PA 3CZ6A 3WODF 3B0UX 4LACB 4YWQA 2FGYA 4J30B 1VK5A 1IW7F 4RD9A 1M2VA 4C7OB 1BR1A 2B0JA 2NUPA 2Y69C 3DAFA 3H65A 2PX3A 3UMKA 3EH2A 4JW1A 2CW0F 4GYTA 5D92A 4E7ZA 1OCCC 1SZIA 1LS1A 1ZYRF 3N0TA 2P6VA 5L3QA 4KNWA 1J8MF 1TWCA 2MWQA 1Z5ZA 1MMDA 1O5HA 4DVZA 3NYLA 4IJJA 2MYSA 4IWBA 3SZRA 4DOZA 3F47A 3T6JA 5E3AA 3ABKC 1J8YF 4U5CE 1OKKD 2H7OA 3IEEA 3FHDA 2YZSA 1TWHA 3RKOF 1TR2A 2VASA 3T6BA 2XL4A 3EG9A 5KYWA 2J0XA 3LAYA 3K66A 3K6BA 4CBEA 2NUPB 3W2WA 4OINF 2Y3GA 2J9VA 4RBNA 1IZMA 2CNWD 2OG2A 1OKKA 4O6YA 5EHHA 3V7OA 3DJNB 1VYIA 2A6EF 5KYWB 4JZAA 3NYMA 3EH1A 1MMGA 2X51A 1D1CA 1ZU4A 4U5EE 3SNHA 2V3CC 1M2OA 3LLIA 3KL4A 3UMHA 1QZXA 3O39A 4H4KC 2D5RB 4FESA 3EGDA 4WJ0A 1TWAA 3ZIBA 2Z15A 1D0YA 3I5QA 2L81A 3ABLC 4BJ6A 3Q7GA 4F4BA 1D1AA 1PCXA 3SEOA 2VH3A 3RFYA 3NRHA 4PJLA 4OIQF 3QMKA 2L9JA 2KW3C 4XLPF 4JVSA 2EILC 3LEVA 5CI8A 4U5GA 1W2WA 4W8KA 1RJ9A 1FMWA 5D91A 3FVYA 3MX3A 4J32B 2EIKC 2FFHA 3Q6NA 1Z3IX 2J46A 4CSAC 1M57C 3S28A 3UGPA 2KNHA 2A69F 2V26A 3EJNA 3EG9B 1RJ9B 1ZHWA 4PFOA 5BUOA 1NU7D 4C7OA 3EQLF 3DZAA 4BJ6C 3OWTA 3VAYA 2R7XA 4C3BA 3B0PA 2J7PD 4ZLCA 1NU9C 2QY9A 4LLCA 4O7GA 3EPVA 3X2QC 4A2NB 2C03A 4YT5A 4GEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXO A;  2G62 A;  4LAC B;  2IXN A;  2IXM A;  2HV6 A;  2HV7 A;  4NY3 A;  2IXP A; 
#chains in the Genus database with same CATH topology
 2ETS A;  4LDQ A;  4NCQ A;  3U3B A;  4OD5 A;  4AE4 B;  3EGD B;  2YKZ A;  2ICW G;  3NKD A;  2IXN A;  2XS8 A;  4JCZ A;  4HFK B;  4JEB A;  4N06 A;  4BEM J;  2EPK X;  5GPG B;  1H9T A;  3FXH A;  2W9Y A;  1ORY A;  2P61 A;  3BEH A;  3DD7 A;  3HJC A;  3S9O A;  2CCY A;  2GAQ A;  2M4E A;  2YHS A;  5HV9 A;  1RMV A;  1ZHX A;  1PD0 A;  3UMI A;  4CSA A;  4BJT A;  4DBR A;  1LIH A;  5IY5 C;  3ZWI A;  2IBF A;  2H7V C;  3EHM A;  2KSF A;  3GOR A;  5T1D B;  2VCB A;  3M15 A;  1JOG A;  3KYI A;  3US6 A;  3FOO A;  1T6U A;  3ITF A;  3POV A;  2LP4 A;  4MVS A;  1SMY F;  4P9T A;  1C02 A;  2XLH A;  2YVK A;  3JRT A;  4L6R A;  3ASO C;  4JE9 A;  5JP7 A;  2HKV A;  3RVY A;  1NLX A;  2AVK A;  2R25 A;  3PCV A;  2GA0 A;  1T6Q A;  2A6H F;  1VYK A;  4G7O F;  1U89 A;  4EWC A;  1A41 A;  4UDV A;  2UUI A;  4JEA A;  4K0D A;  5E2Q A;  4MTG A;  2IXM A;  4XTK A;  1OW6 A;  1N1C A;  1V74 B;  3X1O A;  4BPM A;  5L0I A;  3MLG A;  4OIR F;  2OCC C;  2VCC A;  2YLG A;  2XS1 A;  4CS7 A;  5B3I A;  1TWG A;  4HEA J;  2L7A A;  3TQO A;  4DVY P;  1CGO A;  1H6G A;  3ZVR A;  2XSE A;  1YZC A;  1EI7 A;  4DRI B;  4CBE A;  3N24 A;  4WGY A;  4JJG A;  2IXO A;  3IQC A;  4G7H F;  2R7W A;  2EPN A;  2QNL A;  3GOD A;  2JX0 A;  3U5S A;  1V55 C;  3KKB A;  4CIH A;  1YYJ A;  5B1B C;  2J9B A;  5CI9 A;  3GM2 A;  2WVQ A;  5FZT A;  5BQH A;  2KQ9 A;  3C8Z A;  2PX0 A;  2NPU A;  3OA1 A;  1U6H A;  1H9G A;  1QKR A;  1G4U S;  2OQM A;  3NMK A;  4MVZ A;  4XLN F;  2J9U A;  3U2M A;  4MVM A;  2HS5 A;  3I4U A;  3HLZ A;  2R7T A;  3SXM A;  5DVW A;  5T3W A;  5DQT A;  3NDB B;  2A68 F;  3ATP A;  4RDA A;  1ORS C;  2R7R A;  3G4Z A;  2XXA B;  5JS5 A;  3S0X A;  2YWA A;  1KTM A;  2ZPA A;  2G3K A;  3AJM A;  5B3S C;  1Y6D A;  4JTA B;  2YL0 A;  3Q6M A;  5F5F A;  1YZA A;  4ZLD A;  2W45 A;  2F22 A;  4P9F A;  4OIP F;  2Q9A A;  4CJO A;  2OJQ A;  5JUA A;  1VLT A;  2IXP A;  3MYF A;  1AVO B;  2NUT A;  3VYW A;  3V5Y A;  1MND A;  3Q7L A;  4E0H A;  5KYU B;  2O9X A;  1HE1 A;  4G0H A;  5FCL A;  1M2V B;  4JIO A;  4P6I C;  1L7C A;  3RQF A;  4YL3 A;  5L0D A;  5HSW A;  3C8G B;  2WZL A;  5BQI A;  1ZU5 A;  1XWJ A;  3LNR A;  4PJM A;  5L0F A;  5KYX B;  2A1D D;  3DAG A;  2ZXP A;  1ORJ A;  3JSE O;  4YL1 A;  1E2X A;  3ABM C;  4KBL A;  3JYY A;  5A6K A;  3W8H A;  2TMV P;  3JYH A;  3LLK A;  4PFP A;  2NUT B;  2ZXR A;  5EGY A;  3JT1 A;  1RKE B;  1BR2 A;  2IYL D;  2Q3T A;  3KMI A;  2HSQ A;  4FWV A;  2FAP B;  3RF3 A;  3DJU B;  4BJ5 C;  1LE2 A;  2Q9B A;  3TOL A;  4BEJ A;  2QUP A;  2G62 A;  3S84 A;  4CX9 A;  2HMQ A;  4YJW A;  3UR3 C;  2IM8 A;  4CDY A;  5DQZ A;  3KYJ A;  1FMV A;  3HTK C;  3L0I A;  1H7I A;  4Q7C A;  3IQ5 A;  2CGE A;  1YJG A;  2XL6 A;  5AGF A;  1E84 A;  3ZSU A;  1Q0M A;  3L8I A;  4NY3 A;  2VCA A;  3DKA A;  2J45 A;  1EQ1 A;  2DB4 A;  2QTV A;  4KNV A;  1NFN A;  4BG0 A;  3CEX A;  4E18 A;  2AWY A;  2C04 A;  4KC9 A;  2HUJ A;  2R7Q A;  2Y3H A;  4JCH A;  5JVE A;  4CS8 C;  4PK4 A;  4N6C A;  3QW1 A;  2XRH A;  3EHN A;  3F46 A;  4MQ9 F;  5KYY B;  3L34 A;  3EGX B;  2LQG A;  1Q0D A;  2Y39 A;  1FAP B;  4JKV A;  3DM5 A;  2A0U A;  3M4C A;  4O79 A;  3U9M A;  1YAR O;  1WOL A;  3SP1 A;  2KJG A;  2EPO A;  3NKE A;  4AK9 A;  2EIN C;  5DS5 A;  2H7B A;  2R02 A;  1NG1 A;  5KYU A;  2J0W A;  2HSB A;  2YL1 A;  3PHF 2;  1Z6A A;  1MQV A;  4LLE A;  4U5H A;  4M63 A;  1ZVZ A;  3K33 A;  1QQ3 A;  2VC9 A;  4ULV A;  1VMA A;  1G4W R;  4U5B E;  2GWW A;  2OEX A;  5E3C A;  4BJ5 A;  1T5O A;  1HMO A;  3GAN A;  1VTM P;  3C7J A;  1G8X A;  2LCH A;  1YA9 A;  4B6I A;  1OQC A;  4NTB A;  4G7Z F;  2ASR A;  2WL8 A;  5B1A C;  4EIY A;  1YLM A;  2DYR C;  3M79 A;  2H8A A;  4J7Y A;  1PD1 A;  4U5D E;  4LDR A;  1QVX A;  3PMR A;  3NYJ A;  4O6N A;  2EIJ C;  4I44 A;  3ASN C;  4E7S A;  2R7U A;  4U5F E;  3JSZ A;  3O55 A;  2PFD A;  3DXJ F;  3MFN A;  1LI7 A;  5KYN A;  2R7O A;  5JT4 A;  3UGO A;  4DBQ A;  1QLE C;  3GEI A;  3TJ6 A;  4CS8 A;  4H54 A;  4ULW A;  2KGO A;  2HV6 A;  3NMI A;  3AGU A;  3GWL A;  3O6X A;  4XWJ A;  1RKC A;  3AG1 C;  3DI5 A;  4C3E A;  2I15 A;  3FAJ A;  3FAP B;  4N6H A;  3RQE A;  1MMA A;  3RVZ A;  1GGQ A;  1Q0G A;  2I8B A;  3K7D A;  5T3T A;  1S05 A;  3K1I A;  2Q7R A;  4EHP A;  4Q5S F;  1LKX A;  1FTS A;  3EZH A;  2XM4 A;  4YT2 A;  1CGN A;  5JLI A;  1YAU O;  4Q4Z F;  3FOP A;  3U3F A;  4YT4 A;  3DE9 A;  2JD3 A;  4NTF A;  1Z63 A;  5F5H A;  4PJN A;  3VF0 A;  3LEO A;  3CQZ A;  1HW2 A;  1FFT C;  2EPL X;  3FDQ A;  1KU2 A;  3AG2 C;  2ZXW C;  3DMD A;  4HE8 D;  1KNY A;  1O87 A;  4CS9 C;  1ZHY A;  2ZXO A;  1OCR C;  3JCU Q;  4DRH B;  5AC5 A;  5L0G A;  2HZ8 A;  3EFO B;  4MVQ A;  1D0Z A;  3C8G A;  3OEO A;  4O6M A;  3LJB A;  4QDL A;  4BJ1 A;  5KYX A;  2XLW A;  2PP4 A;  3M1C B;  2XLO A;  1K40 A;  5DS4 A;  3TK0 A;  3W2V A;  5KYY A;  3W8I A;  2KC3 A;  2WZF A;  3EZI A;  3N2Z B;  2P7V A;  1AUE A;  2EIM C;  3AG3 C;  1OR3 A;  3B0V C;  3NMJ A;  3UNG C;  2WVN A;  4QI2 A;  1Q0K A;  1ZW2 A;  2AU5 A;  2PNO A;  3H2U A;  5AC4 A;  2GFH A;  4DXW A;  3SXZ A;  2D4U A;  3DM9 B;  3V5X A;  1BBH A;  1K04 A;  3B29 A;  2LSE A;  2QLA A;  3QVZ A;  2DGJ A;  1I5N A;  2G3V A;  4IRU A;  4AX2 A;  2GDC A;  4K7B A;  2R7S A;  2WZG A;  4IAQ A;  3WG7 C;  1OCZ C;  1L3P A;  4AE4 A;  2MHR A;  4GQH A;  3LES A;  2Q00 A;  3AQC A;  3K1I C;  3ZQY A;  1YYX A;  3JZ0 A;  2Y3B A;  3S27 A;  2A0B A;  2Y3D A;  2DYS C;  4NTA A;  3T4R A;  1GS9 A;  3S29 A;  2WVO A;  1LS4 A;  1RKE A;  256B A;  2NG1 A;  2CDQ A;  4I1O B;  1A0B A;  2AWC A;  3ZC4 A;  3JTL O;  3GM3 A;  3TUL A;  3K1H A;  1FFH A;  1ST6 A;  1HY5 A;  3T9O A;  1S7Z A;  1NZE A;  3GWN A;  4MVU A;  4CS9 A;  5DS6 A;  3S90 A;  1U0B B;  1NBB A;  5E33 A;  2CNW A;  1ZHZ A;  3L8J A;  1C03 A;  4EBB A;  4KI2 A;  3PDM P;  1A7V A;  5A6B A;  4D4N A;  4YT8 A;  3C62 A;  5COF A;  3TD7 A;  4QI0 A;  4I3M A;  2W4M A;  3AQB A;  1OW7 A;  3LS1 A;  4C3D A;  2E87 A;  3RYL A;  3EFO A;  4YL0 A;  1SF8 A;  4E0I A;  5K0I A;  2PF4 E;  1RXQ A;  2XLE A;  3T6G B;  4I1M A;  1RCP A;  4LER A;  5DLJ A;  3TOM A;  1D0X A;  1WTY A;  5JSL A;  4FAP B;  1BZ4 A;  1MNE A;  1BR4 A;  1V54 C;  1VLS A;  1WGW A;  4MW3 A;  2XLM A;  2XXA A;  1VOM A;  2HFI A;  3B9Q A;  3E9V A;  2XL8 A;  4W8P A;  4LDK A;  1TFO B;  4OD4 A;  1BDJ B;  4YN0 B;  1A7E A;  3M4B A;  4OIO F;  4WGZ A;  4PJJ A;  3G4X A;  1R4T A;  3CSK A;  1HE9 A;  1T6I A;  4HFF B;  1GQA A;  4OIQ F;  3EGX A;  4EBJ A;  4ANJ A;  1OR2 A;  1QSP A;  1VB5 A;  3FMS A;  1TKN A;  2JPU A;  2RSE B;  4XEV A;  2AP3 A;  3HNK A;  5EK0 A;  1CGM E;  2R03 A;  2Q9C A;  3LS0 A;  1NSG B;  3R7C A;  4AL0 A;  5L3V A;  4ONS A;  1CPR A;  1OCO C;  1E83 A;  4CIP A;  2J9W A;  2R7V A;  1Z23 A;  2HJ3 A;  3ZTM A;  4K1O A;  1NFO A;  2B0H A;  2YEV A;  5F28 E;  1ZHT A;  1Y4C A;  1M56 C;  2BE5 F;  5L0C A;  1R5I D;  2W4B A;  3RH3 A;  4ER9 A;  3QZC A;  2J8W A;  1EKY A;  2OJE D;  3E70 C;  1CPQ A;  1TFK B;  2IOQ A;  3NG1 A;  4JUR I;  4XPY A;  2UUH A;  4JTD B;  3SYN A;  3ZG1 A;  3ZDL A;  2OU6 A;  1YDI A;  3AG4 C;  3MBG A;  1JPJ A;  4FX5 A;  3A11 A;  1YA7 O;  2WB7 A;  4IAO A;  4JTC B;  3BRJ A;  4PR9 A;  2BC5 A;  3RIP A;  1LVK A;  4JJF A;  5BQG A;  1K05 A;  2VB6 A;  2HV7 A;  1FNT c;  1D1B A;  1JRA A;  3ECS A;  1JPN A;  1MMN A;  2BL2 A;  3KH2 A;  4MND A;  4DJ9 A;  3I5P A;  1G5Z A;  4X0R A;  2J7P A;  3ZQV A;  3CZ6 A;  3U2L A;  1O3U A;  2XM0 A;  3WOD F;  3B0U X;  4CDV A;  3QTH A;  2OKU A;  2Q4F A;  2FGY A;  4J30 B;  1I4Z A;  3QW0 A;  4LAC B;  1VK5 A;  3GM1 A;  3QVY A;  4YWQ A;  1HW1 A;  1IW7 F;  4JC7 A;  4Z9I A;  2YL3 A;  4RD9 A;  1M2V A;  2YLI A;  4IB4 A;  3H2V A;  4U9D A;  1BR1 A;  4C7O B;  2B0J A;  2NUP A;  2Y69 C;  3DAF A;  1F1M A;  1LM3 B;  4EKW A;  1SYQ A;  3CAX A;  1LE4 A;  5TJ5 E;  3LNM B;  3RQG A;  2YQY A;  2LK4 A;  1OW8 A;  3H65 A;  3VRC A;  2P0N A;  2PX3 A;  1B68 A;  2OOC A;  3EH2 A;  3GEE A;  4JW1 A;  3UMK A;  2CW0 F;  2XLV A;  4GYT A;  5D92 A;  3TJ5 A;  4E7Z A;  1OCC C;  2NSG A;  1SZI A;  1LS1 A;  1ZYR F;  4MS2 A;  1Z7Q c;  3N0T A;  2P6V A;  4PAC A;  4KNW A;  1WWP A;  5L3Q A;  1OXB A;  1WN0 A;  1J8M F;  4MW8 A;  1A7D A;  1TWC A;  4CJG A;  2MWQ A;  1Z5Z A;  1MMD A;  1O5H A;  2NSF A;  3NYL A;  4DVZ A;  4IJJ A;  2MYS A;  4IWB A;  1SR2 A;  3RW0 A;  3SZR A;  4DOZ A;  3F47 A;  3T6J A;  1Q0F A;  5E3A A;  3ABK C;  4MVO A;  1J8Y F;  4U5C E;  1OKK D;  2H7O A;  4CDA A;  3HNL A;  2M64 A;  1V4A A;  3IEE A;  3FHD A;  1ZZP A;  2YZS A;  1JR8 A;  4NQF A;  5A6A A;  1TWH A;  3RKO F;  4R32 A;  1TR2 A;  1I4Y A;  2VAS A;  3T6B A;  2XL4 A;  1UFB A;  3U8P A;  3WAQ A;  1JMW A;  4MTO A;  3EG9 A;  5KYW A;  2J0X A;  4IGG A;  1QPU A;  1TQG A;  2L6G A;  4AL1 A;  3LAY A;  4XPW A;  3K66 A;  3K6B A;  1DOV A;  2NUP B;  2YRF A;  3L1M A;  3HNI A;  3DE8 A;  4XPX A;  2X0C A;  2LIG A;  4OIN F;  2Y3G A;  3W2W A;  2J9V A;  4NC3 A;  1IZM A;  4RBN A;  2CNW D;  2OG2 A;  1OKK A;  4O6Y A;  1T01 A;  5EHH A;  3V7O A;  4JRZ A;  4EBK A;  3DJN B;  2HJM A;  4XEF A;  4A4A A;  3MYI A;  5L0J A;  3AGT A;  3U8V A;  1VYI A;  3SXY A;  2A6E F;  5KYW B;  2R9R B;  4JZA A;  1XZP A;  3NYM A;  3EH1 A;  1MMG A;  3IQT A;  3B71 A;  1LPE A;  2X51 A;  1D1C A;  1YVI A;  1ZU4 A;  3C8G D;  4U5E E;  3SNH A;  1PV3 A;  2V3C C;  2OEV A;  2XLD A;  2HMZ A;  1M2O A;  2R05 A;  3LLI A;  3KL4 A;  4J7T A;  3UMH A;  5A69 A;  1QZX A;  2DI3 A;  3O39 A;  3ZTZ A;  4H4K C;  2D5R B;  3HNJ A;  4FES A;  3EGD A;  2LFD A;  4WJ0 A;  1TWA A;  2L6H A;  4Z9J A;  3ZIB A;  2Z15 A;  1D0Y A;  3I5Q A;  4YK5 A;  2L81 A;  3ABL C;  3V5Z A;  5A6J A;  4BJ6 A;  1XZQ A;  1OXK A;  3Q7G A;  3O10 A;  4F4B A;  1D1A A;  1HMD A;  1PCX A;  3SEO A;  2VH3 A;  1JAF A;  2LD6 A;  3AOU A;  2PBE A;  3RFY A;  2KYH A;  2YLD A;  3NRH A;  4PJL A;  3C18 A;  4G78 A;  3QMK A;  1C17 M;  2L9J A;  2KK1 A;  1WAT A;  2YL7 A;  5L0H A;  3J06 A;  3C63 A;  2LFF A;  1T9K A;  4D4X A;  2KW3 C;  4WAB A;  4XLP F;  4JVS A;  2EIL C;  3LEV A;  3G50 A;  3LUT B;  5CI8 A;  4U5G A;  4DRJ B;  2QE9 A;  1W2W A;  4W8K A;  3JRM O;  1RJ9 A;  4Z9H A;  3U0C A;  3GEH A;  3IHU A;  1FMW A;  5D91 A;  4EUK B;  3FVY A;  1UG7 A;  3MX3 A;  4J32 B;  1M6T A;  2EIK C;  2FFH A;  4XQ1 A;  3Q6N A;  1Z3I X;  2J46 A;  1LI5 A;  3A9C A;  1M57 C;  4CSA C;  3R2P A;  3S28 A;  3UGP A;  2KNH A;  4E17 A;  2A69 F;  4MTF A;  2V26 A;  3EJN A;  3EG9 B;  4MVR A;  1RJ9 B;  1FR0 A;  1ZHW A;  5A6B D;  4PFO A;  5BUO A;  1AEP A;  5CIV A;  1E86 A;  1GM5 A;  1NU7 D;  3DWW A;  3HKK A;  4C7O A;  3EQL F;  3DZA A;  3KPH A;  4XEK A;  4BJ6 C;  4U9E A;  3VM6 A;  2RD9 A;  1E85 A;  1ZW3 A;  3OWT A;  3VAY A;  3IPM O;  3SXK A;  3W4Y A;  2R7X A;  4C3B A;  5COM A;  3B0P A;  2J7P D;  1WAS A;  2P1A A;  4ZLC A;  1NU9 C;  2QY9 A;  5COG A;  1DOW A;  3IQ6 A;  2L6F A;  4LLC A;  4N4W A;  3EPV A;  4O7G A;  2EPM X;  3WHN A;  3X2Q C;  2C03 A;  4A2N B;  2CYD A;  4IAR A;  4YT5 A;  1EA8 A;  3U9J A;  5JRA A;  2ZD9 A;  1APC A;  4GEH A; 
#chains in the Genus database with same CATH homology
 4OD5 A;  4AE4 B;  3EGD B;  3NKD A;  2IXN A;  2R7T A;  4HFK B;  4N06 A;  2W9Y A;  3DD7 A;  3HJC A;  2M4E A;  2YHS A;  1ZHX A;  1PD0 A;  3UMI A;  4CSA A;  4BJT A;  4DBR A;  5IY5 C;  2H7V C;  3EHM A;  5T1D B;  3ITF A;  3POV A;  1SMY F;  3JRT A;  3ASO C;  1VYK A;  2A6H F;  4G7O F;  4EWC A;  4K0D A;  5E2Q A;  2IXM A;  4XTK A;  3X1O A;  1N1C A;  3MLG A;  4OIR F;  2OCC C;  4CS7 A;  1TWG A;  4HEA J;  4DVY P;  3ZVR A;  2XSE A;  3N24 A;  4JJG A;  2IXO A;  4G7H F;  2R7W A;  4CIH A;  3GOD A;  1V55 C;  3KKB A;  5B1B C;  5CI9 A;  2WVQ A;  2KQ9 A;  2PX0 A;  3OA1 A;  4XLN F;  2J9U A;  3I4U A;  3HLZ A;  5DVW A;  5T3W A;  5DQT A;  3NDB B;  2A68 F;  4RDA A;  2R7R A;  2XXA B;  3S0X A;  2ZPA A;  2G3K A;  5B3S C;  3Q6M A;  5F5F A;  4ZLD A;  2W45 A;  4OIP F;  2Q9A A;  2IXP A;  3VYW A;  2NUT A;  3Q7L A;  1MND A;  5KYU B;  2O9X A;  4G0H A;  5FCL A;  1M2V B;  4P6I C;  5HSW A;  5KYX B;  2WZL A;  1ZU5 A;  4PJM A;  3LNR A;  2A1D D;  3DAG A;  2ZXP A;  3ABM C;  4KBL A;  3W8H A;  3JYH A;  3LLK A;  4PFP A;  2NUT B;  2ZXR A;  5EGY A;  3JT1 A;  1BR2 A;  2IYL D;  2Q3T A;  3KMI A;  4FWV A;  4BJ5 C;  3DJU B;  4BEJ A;  2Q9B A;  2G62 A;  4YJW A;  3UR3 C;  5DQZ A;  1FMV A;  3HTK C;  3L0I A;  4Q7C A;  2CGE A;  3ZSU A;  4NY3 A;  2J45 A;  2QTV A;  4KNV A;  4BG0 A;  2C04 A;  4KC9 A;  2R7Q A;  2Y3H A;  4JCH A;  4CS8 C;  4PK4 A;  2XRH A;  3EHN A;  3F46 A;  4MQ9 F;  5KYY B;  3L34 A;  3EGX B;  2Y39 A;  3DM5 A;  4O79 A;  3SP1 A;  2KJG A;  4AK9 A;  3NKE A;  5DS5 A;  2EIN C;  2H7B A;  5KYU A;  1NG1 A;  2J0W A;  3PHF 2;  1Z6A A;  4LLE A;  4U5H A;  4M63 A;  3K33 A;  1VMA A;  4U5B E;  5E3C A;  4BJ5 A;  3GAN A;  1G8X A;  4B6I A;  4G7Z F;  2WL8 A;  5B1A C;  4U5D E;  2DYR C;  1PD1 A;  3PMR A;  3NYJ A;  4O6N A;  2EIJ C;  4I44 A;  3ASN C;  4E7S A;  2R7U A;  4U5F E;  3JSZ A;  2PFD A;  3DXJ F;  5KYN A;  2R7O A;  3UGO A;  4DBQ A;  1QLE C;  4CS8 A;  4ULW A;  2KGO A;  2HV6 A;  3O6X A;  4XWJ A;  3AG1 C;  4C3E A;  3FAJ A;  1MMA A;  3K7D A;  2I8B A;  5T3T A;  4Q5S F;  1LKX A;  1FTS A;  3EZH A;  4YT2 A;  4Q4Z F;  4YT4 A;  2JD3 A;  1Z63 A;  5F5H A;  4PJN A;  3CQZ A;  1FFT C;  3FDQ A;  1KU2 A;  3AG2 C;  2ZXW C;  3DMD A;  4HE8 D;  4CS9 C;  1O87 A;  1ZHY A;  2ZXO A;  1OCR C;  3JCU Q;  4O6M A;  3EFO B;  1D0Z A;  3OEO A;  4QDL A;  4BJ1 A;  3LJB A;  5KYX A;  2PP4 A;  3M1C B;  5DS4 A;  3W2V A;  5KYY A;  3W8I A;  2WZF A;  3EZI A;  3N2Z B;  2P7V A;  2EIM C;  3AG3 C;  3B0V C;  3UNG C;  2WVN A;  4QI2 A;  2GFH A;  3DM9 B;  2LSE A;  2DGJ A;  4IRU A;  2G3V A;  4AX2 A;  4K7B A;  2R7S A;  2WZG A;  3WG7 C;  1OCZ C;  4AE4 A;  3LES A;  3AQC A;  3K1I C;  3S27 A;  2Y3B A;  3T4R A;  2Y3D A;  2DYS C;  3S29 A;  2WVO A;  2NG1 A;  2CDQ A;  4I1O B;  3ZC4 A;  3K1H A;  1FFH A;  1ST6 A;  4CS9 A;  5DS6 A;  1S7Z A;  1NZE A;  5E33 A;  2CNW A;  1ZHZ A;  4EBB A;  4KI2 A;  4YT8 A;  3TD7 A;  4QI0 A;  4I3M A;  2W4M A;  3AQB A;  3LS1 A;  4C3D A;  2E87 A;  3RYL A;  3EFO A;  1SF8 A;  2PF4 E;  4I1M A;  4LER A;  5DLJ A;  1D0X A;  1MNE A;  1WGW A;  1BR4 A;  1V54 C;  2XXA A;  1VOM A;  3B9Q A;  3E9V A;  4OD4 A;  4OIO F;  4YN0 B;  4PJJ A;  3CSK A;  4HFF B;  3EGX A;  4ANJ A;  1TKN A;  2Q9C A;  3LS0 A;  5L3V A;  1OCO C;  2J9W A;  2R7V A;  1Z23 A;  2YEV A;  1ZHT A;  1M56 C;  2BE5 F;  2W4B A;  3RH3 A;  3QZC A;  3E70 C;  4JUR I;  2IOQ A;  3NG1 A;  3SYN A;  3ZG1 A;  3AG4 C;  4FX5 A;  4IAO A;  1JPJ A;  2WB7 A;  3RIP A;  1LVK A;  4JJF A;  2VB6 A;  2HV7 A;  1D1B A;  3ECS A;  1JPN A;  1MMN A;  3KH2 A;  4MND A;  3I5P A;  4X0R A;  2J7P A;  3CZ6 A;  3WOD F;  3B0U X;  4LAC B;  4YWQ A;  2FGY A;  4J30 B;  1VK5 A;  1IW7 F;  4RD9 A;  1M2V A;  4C7O B;  1BR1 A;  2B0J A;  2NUP A;  2Y69 C;  3DAF A;  3H65 A;  2PX3 A;  3UMK A;  3EH2 A;  4JW1 A;  2CW0 F;  4GYT A;  5D92 A;  4E7Z A;  1OCC C;  1SZI A;  1LS1 A;  1ZYR F;  3N0T A;  2P6V A;  5L3Q A;  4KNW A;  1J8M F;  1TWC A;  2MWQ A;  1Z5Z A;  1MMD A;  1O5H A;  4DVZ A;  3NYL A;  4IJJ A;  2MYS A;  4IWB A;  3SZR A;  4DOZ A;  3F47 A;  3T6J A;  5E3A A;  3ABK C;  1J8Y F;  4U5C E;  1OKK D;  2H7O A;  3IEE A;  3FHD A;  2YZS A;  1TWH A;  3RKO F;  1TR2 A;  2VAS A;  3T6B A;  2XL4 A;  3EG9 A;  5KYW A;  2J0X A;  3LAY A;  3K66 A;  3K6B A;  4CBE A;  2NUP B;  3W2W A;  4OIN F;  2Y3G A;  2J9V A;  4RBN A;  1IZM A;  2CNW D;  2OG2 A;  1OKK A;  4O6Y A;  5EHH A;  3V7O A;  3DJN B;  1VYI A;  2A6E F;  5KYW B;  4JZA A;  3NYM A;  3EH1 A;  1MMG A;  2X51 A;  1D1C A;  1ZU4 A;  4U5E E;  3SNH A;  2V3C C;  1M2O A;  3LLI A;  3KL4 A;  3UMH A;  1QZX A;  3O39 A;  4H4K C;  2D5R B;  4FES A;  3EGD A;  4WJ0 A;  1TWA A;  3ZIB A;  2Z15 A;  1D0Y A;  3I5Q A;  2L81 A;  3ABL C;  4BJ6 A;  3Q7G A;  4F4B A;  1D1A A;  1PCX A;  3SEO A;  2VH3 A;  3RFY A;  3NRH A;  4PJL A;  4OIQ F;  3QMK A;  2L9J A;  2KW3 C;  4XLP F;  4JVS A;  2EIL C;  3LEV A;  5CI8 A;  4U5G A;  1W2W A;  4W8K A;  1RJ9 A;  1FMW A;  5D91 A;  3FVY A;  3MX3 A;  4J32 B;  2EIK C;  2FFH A;  3Q6N A;  1Z3I X;  2J46 A;  4CSA C;  1M57 C;  3S28 A;  3UGP A;  2KNH A;  2A69 F;  2V26 A;  3EJN A;  3EG9 B;  1RJ9 B;  1ZHW A;  4PFO A;  5BUO A;  1NU7 D;  4C7O A;  3EQL F;  3DZA A;  4BJ6 C;  3OWT A;  3VAY A;  2R7X A;  4C3B A;  3B0P A;  2J7P D;  4ZLC A;  1NU9 C;  2QY9 A;  4LLC A;  4O7G A;  3EPV A;  3X2Q C;  4A2N B;  2C03 A;  4YT5 A;  4GEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...