2IXMA

Structure of human ptpa
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
300
structure length
300
Chain Sequence
FIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLLALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE 2A REGULATORY SUBUNIT B
publication title Crystal Structure of the Pp2A Phosphatase Activator: Implications for its Pp2A-Specific Ppiase Activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 117
structure length 300
sequence length 300
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2ixmA02
2G62A 4LACB 2IXMA 2IXPA 2IXNA 2IXOA 2HV7A 2HV6A 4NY3A
chains in the Genus database with same CATH superfamily
3EHMA 2FGYA 1ZW2A 4HFFB 2WL8A 4ULWA 1SF8A 2ETSA 2Q9BA 3GWLA 2WVOA 5IY5C 5L0IA 3GM3A 4MVUA 1E2XA 2NPUA 3UMKA 3V7OA 3ZIBA 2O9XA 4GYTA 2IYLD 1H9GA 2HUJA 1K04A 4FESA 4IRUA 1ZYRF 1KTMA 1OCZC 3CQZA 3MLGA 4LACB 3AG4C 3DZAA 3U8VA 1RKEB 5CIVA 1RKEA 3FMSA 3T4RA 1G4WR 1OW8A 1DOWA 3AOUA 5A6BA 1EA8A 3NDBB 4BJ5A 4WGZA 2YL0A 4IGGA 2XLDA 3O10A 1Z7Qc 1YZCA 3LLIA 4ANJA 4BJ6C 2LD6A 2D4UA 1M2OA 1TFKB 1YYXA 1HE1A 2QY9A 4P9FA 3RVYA 1ORYA 1BR4A 3RW0A 4UDVA 2R7WA 4YL3A 256BA 4RBNA 1D0XA 1MNEA 2R03A 3S0XA 4DRHB 1T5OA 3GEIA 3W8HA 5DQZA 2A68F 3UGOA 4XEVA 2GDCA 5EHHA 3TOMA 3ZTMA 5L0CA 2BE5F 3TJ6A 2LQGA 1TQGA 3JSEO 3VM6A 4JEBA 3PMRA 4LDQA 3GM1A 3T6BA 2MHRA 3ASOC 1NLXA 4DBRA 1O87A 3LEOA 1MNDA 1D1BA 1E84A 4NY3A 3LNRA 1V4AA 1YA7O 1XZQA 2PP4A 4GQHA 3IQ6A 4A2NB 2XM0A 1NU7D 1JRAA 3CEXA 3ZG1A 4ZLDA 2XLHA 1T6UA 2HJMA 1BR2A 2L9JA 2PBEA 3CZ6A 3H2UA 1LE4A 2ASRA 2ZD9A 2XLVA 2ZXRA 3K1IA 3LNMB 1WASA 1O5HA 3DAFA 2EPNA 5FZTA 2J0XA 1A7VA 2YZSA 3ABLC 3KYIA 3SXMA 3TJ5A 3RKOF 2J9WA 3EH2A 2W9YA 4H4KC 2F22A 2Q3TA 1ZVZA 3MYFA 5L0FA 2XM4A 3MX3A 4JVSA 1VTMP 4LERA 2A0BA 3T6GB 1A7DA 2HZ8A 1JPJA 2EILC 3QVZA 5DS4A 4JEAA 3ECSA 4LDKA 2FAPB 4YWQA 1FAPB 4CIHA 3N2ZB 2IOQA 1VLTA 2OQMA 3GANA 1D0YA 3POVA 4N6HA 4BJ5C 2V3CC 2YLGA 1D0ZA 4CDAA 4CDYA 2IM8A 3VYWA 1L7CA 1OCCC 4XQ1A 2ZXWC 1H7IA 2PFDA 1T01A 1RKCA 2AU5A 3I5PA 4XPYA 3CSKA 4MTFA 2R7RA 1F1MA 4MVSA 4XPXA 2DYSC 1BZ4A 4IAOA 3AG3C 2HV7A 2H7VC 2R02A 4BG0A 5BUOA 5AC4A 5FCLA 1OR3A 3U3FA 3EPVA 2OJQA 1HY5A 2YL3A 3EGDB 3NKDA 4F4BA 3DKAA 2L6HA 3B71A 2NSGA 4PFPA 3IHUA 5EK0A 4DBQA 1M2VA 1UG7A 1MMDA 1TWHA 2WVQA 2NUTA 2YKZA 3RQEA 2XLWA 2YRFA 4CBEA 1Z63A 2HFIA 3U3BA 3HNIA 2PX3A 3NMKA 3ZDLA 4EIYA 3G4XA 2BC5A 1SMYF 3A11A 4I1MA 2XLMA 4PR9A 4RD9A 1O3UA 3DJNB 3GWNA 4X0RA 1APCA 3GM2A 1LI5A 2R9RB 4XTKA 2PF4E 3VAYA 3PCVA 3KMIA 5KYYA 1HW2A 4PJNA 1NG1A 1M6TA 3K1IC 3LJBA 4JJFA 2GAQA 3DM9B 3EGXA 1LPEA 1T6IA 3FOPA 1WN0A 3RH3A 3U5SA 3U9JA 4XLNF 3FHDA 4LDRA 4JURI 5A6KA 3S84A 2G3VA 3EHNA 4JRZA 1Q0GA 2LFDA 2XL6A 4CDVA 2KNHA 4MTGA 1I4ZA 2IXNA 3V5XA 2IXOA 3LUTB 4KI2A 2XS8A 4MS2A 2VCCA 3WG7C 5JT4A 1ZW3A 2J9BA 1CGOA 2YLDA 3ITFA 3LS0A 2YL7A 4CS9A 4ZLCA 4DRJB 4DVZA 1JPNA 2Y69C 1FNTc 2DI3A 2L6GA 3TD7A 3EFOA 2VB6A 4N6CA 3TQOA 4XWJA 3UNGC 4EBKA 1Z6AA 5F5FA 4BJ1A 1R5ID 2DYRC 2P0NA 4ONSA 4FAPB 1NZEA 2AWCA 2I8BA 2B0JA 1OCRC 1RJ9A 2Y3HA 4BEMJ 5T1DB 3M79A 4YT2A 4ULVA 5KYXA 2YEVA 5KYXB 1S7ZA 1G8XA 4U5GA 4IARA 2GWWA 2KJGA 4MVZA 4Q5SF 3SXYA 5JRAA 4XPWA 1SR2A 3V5YA 1NSGB 1HMOA 4KNVA 3U2LA 3S29A 2OEVA 3RF3A 4CX9A 4Z9HA 1CPQA 3U2MA 2VH3A 3JRMO 3LEVA 4PFOA 2EIJC 3SP1A 1U6HA 5E33A 2CDQA 2WZLA 5F5HA 2W45A 5L0JA 4Q4ZF 4DOZA 3DXJF 2CNWA 1ZHXA 1ZHTA 3V5ZA 4BJTA 3FDQA 1VYKA 4HEAJ 3HTKC 3EH1A 1OR2A 3SEOA 1VYIA 3ZQVA 3K33A 2J8WA 3RFYA 2J7PD 3ZC4A 5JSLA 3L34A 4U9EA 3T6JA 3W4YA 2OCCC 1B68A 3Q6MA 4JJGA 1LS1A 2J0WA 1QVXA 4O79A 4DXWA 4AE4A 3C7JA 2EPKX 3IQ5A 1YZAA 2J46A 3K1HA 2AVKA 2JX0A 3C8ZA 2B0HA 1LVKA 1QPUA 2CW0F 5DQTA 2P1AA 1JAFA 2YQYA 1QZXA 3RYLA 2MYSA 2NSFA 2Y3BA 2LK4A 3AJMA 2KC3A 1WGWA 2RD9A 3DI5A 2WZFA 3O55A 4JKVA 4RDAA 2YHSA 3SNHA 1TWAA 4NTFA 3JCUQ 1Y4CA 4KNWA 2EIMC 2JD3A 3A9CA 3GEEA 3IEEA 3B0PA 3EZIA 3IQTA 1A41A 1BBHA 4IB4A 4CS9C 5JLIA 1Z23A 3IPMO 5JUAA 5L0GA 5D92A 4E0HA 2XSEA 5T3TA 5F28E 5JS5A 5KYUA 1T9KA 3L8IA 1G5ZA 1SYQA 2DB4A 3LAYA 3K6BA 4U5FE 4ER9A 5A69A 5K0IA 2DGJA 2QTVA 4KC9A 3PDMP 2XLEA 1ORJA 2G3KA 2LIGA 1G4US 1VLSA 4FX5A 1YVIA 4K1OA 3US6A 4E7SA 1I4YA 3G4ZA 2TMVP 3NYMA 1NBBA 3B29A 2W4MA 2X0CA 2R7XA 3HKKA 1IZMA 4MVRA 3K7DA 2Q7RA 2R7TA 4JTDB 1RMVA 1OCOC 4BEJA 1PCXA 4P6IC 3U8PA 2HSBA 1AVOB 3M1CB 3C8GB 3I4UA 3C8GA 3CAXA 4FWVA 4YL0A 4AK9A 4YT4A 5AC5A 4G7ZF 1CGNA 1C02A 1HMDA 2LP4A 3DE9A 3WHNA 3NG1A 3H2VA 3NRHA 3MYIA 5HV9A 2LCHA 2ICWG 4YL1A 1AEPA 1U89A 3S90A 4NQFA 2FFHA 2M64A 1GS9A 3MBGA 1MMGA 3W2VA 5B1BC 1N1CA 3ZSUA 2XL8A 5D91A 3QW1A 2OG2A 4LLCA 1PD1A 2HSQA 2YWAA 2EPMX 1HE9A 4U5EE 2PX0A 5BQHA 4JE9A 2H7OA 4JCZA 3L1MA 2A6HF 3EJNA 2XLOA 1Q0KA 3IQCA 3UR3C 4EWCA 1A0BA 1L3PA 5DS5A 1M2VB 2NUTB 5COFA 3FVYA 4E0IA 2OOCA 3QMKA 1C17M 5KYNA 3LESA 3JRTA 2I15A 3SYNA 3TK0A 3M15A 3ABKC 4YN0B 1GQAA 3QW0A 3KYJA 2CGEA 2OEXA 3EQLF 3NKEA 1ST6A 1XWJA 4O7GA 1WTYA 3B9QA 5BQGA 5KYYB 1K05A 1WOLA 5E3CA 5A6AA 2VC9A 3B0VC 3EGXB 3B0UX 4IAQA 1BDJB 4W8KA 4C7OA 2CCYA 3EZHA 3M4CA 2XXAA 1FFHA 2A69F 2QLAA 1Q0DA 1V54C 2IXMA 3RVZA 4NCQA 2AP3A 2Y3DA 2EPLX 4OIQF 4HE8D 4CS8A 3DJUB 2OU6A 4I44A 4K7BA 4YT5A 5B3IA 1W2WA 4J7TA 1QLEC 4MVOA 1Q0MA 3JYYA 3E9VA 2R7UA 3MFNA 3F47A 3NMJA 4J7YA 1FMVA 4N4WA 2VCBA 3O39A 3DE8A 3FAJA 3EFOB 3GEHA 1QKRA 4LLEA 4U5DE 1LIHA 3WAQA 3TOLA 4NTBA 2VASA 2A6EF 1C03A 3NYJA 3UMIA 4AX2A 4QDLA 4HFKB 4JTAB 1YYJA 4WGYA 2J9UA 2J7PA 4XEKA 3F46A 1SZIA 1CGME 1H6GA 1T6QA 2Q9CA 3SZRA 1RJ9B 4MVMA 5COGA 1TWCA 3AG1C 2EPOA 1R4TA 3KL4A 4A4AA 3BRJA 1AUEA 3T9OA 4G7OF 3ZWIA 4B6IA 4QI0A 2HMQA 3FXHA 5CI9A 5EGYA 3H65A 3Q6NA 4JW1A 4OIRF 5JVEA 4CJOA 2WZGA 4U9DA 1H9TA 3ASNC 1EQ1A 1CPRA 3ZQYA 2NUPB 2NUPA 2Y39A 3G50A 4AL0A 3QTHA 3EG9B 3AG2C 3EG9A 4BPMA 1A7EA 4C3DA 3KH2A 4G0HA 4Q7CA 4JCHA 1J8MF 1OXKA 2Q00A 2C03A 4MW8A 3QVYA 1Z5ZA 4PJJA 1E86A 1KNYA 1LI7A 2AWYA 3GORA 4MW3A 4MQ9F 2W4BA 1BR1A 1DOVA 5B1AC 3W2WA 4CS7A 3U0CA 3DAGA 3RQGA 2R7SA 1NFOA 3AGUA 3JZ0A 4AE4B 1Z3IX 1JOGA 2V26A 4JC7A 4MVQA 1I5NA 5KYWB 5KYWA 1ZHZA 2HMZA 3I5QA 2HV6A 3QZCA 2R7OA 4CIPA 1YAUO 1ORSC 2Y3GA 3NYLA 4K0DA 1FTSA 2CYDA 2XRHA 3DMDA 4YJWA 2A0UA 3AGTA 1GM5A 1JMWA 3X2QC 3OWTA 2L6FA 4PK4A 3C18A 1OKKD 4CS8C 3NMIA 3SXZA 1EI7A 3X1OA 2HJ3A 5AGFA 5B3SC 2H8AA 1S05A 2EINC 3AQBA 2ZXPA 2J45A 3DD7A 3JYHA 5KYUB 2X51A 1ZU4A 2XL4A 3N0TA 2GFHA 3ABMC 4U5HA 3AQCA 4GEHA 2JPUA 1FFTC 1RCPA 2GA0A 3HNKA 4NC3A 4DRIB 4G78A 4CSAA 5CI8A 1YA9A 3LS1A 2Q9AA 4I1OB 1ZU5A 4NTAA 3PHF2 5HSWA 2EIKC 3UGPA 3WODF 5A6BD 5E2QA 2IBFA 1TFOB 2BL2A 2XS1A 5L0DA 4O6NA 4C3EA 2CNWD 5E3AA 2P6VA 1EKYA 4CJGA 1QQ3A 5L3QA 3FAPB 2QE9A 4WABA 1HW1A 4OINF 2KGOA 4I3MA 3JTLO 1XZPA 3VRCA 4PJLA 2R25A 2D5RB 4P9TA 4WJ0A 4OIOF 2YL1A 3DM5A 4E17A 1VOMA 2KQ9A 1WATA 4N06A 1ZZPA 3VF0A 2A1DD 1NFNA 4IWBA 1NU9C 4D4XA 3KKBA 5L3VA 2KSFA 4IJJA 1GGQA 3HJCA 1MMNA 2KW3C 4KBLA 4EBJA 3R2PA 2R7QA 3S27A 4G7HF 4J32B 2VCAA 4E7ZA 2R7VA 1D1CA 1IW7F 3S28A 2IXPA 2ZPAA 4Z9JA 5T3WA 3JT1A 4U5BE 1K40A 2LFFA 2H7BA 3S9OA 3SXKA 3U9MA 3FOOA 4C3BA 1D1AA 1ZHYA 3C62A 5DVWA 2KK1A 5A6JA 1E85A 4XLPF 4QI2A 2M4EA 1YARO 1YLMA 4R32A 3L0IA 3L8JA 4L6RA 1V74B 3OEOA 4MNDA 2P61A 1OW7A 4YK5A 2NG1A 4O6MA 5JP7A 2QUPA 4OD4A 2WB7A 1U0BB 3ZVRA 1UFBA 2UUHA 2MWQA 4AL1A 1Y6DA 4EUKB 4U5CE 4W8PA 4Z9IA 3HLZA 4O6YA 1MQVA 1OQCA 2HKVA 1MMAA 1QSPA 3EGDA 5BQIA 3O6XA 4C7OB 4M63A 4J30B 5COMA 4DJ9A 3OA1A 1YDIA 1OW6A 4CSAC 2XXAB 2YLIA 3E70C 4MTOA 3C8GD 3C63A 1M56C 2C04A 2J9VA 1PD0A 3J06A 1KU2A 4PJMA 2R05A 1Q0FA 4BJ6A 4EBBA 1FMWA 4JTCB 1V55C 4EKWA 4H54A 1YJGA 1J8YF 1LKXA 1WWPA 2HS5A 2KYHA 2WVNA 3Q7GA 3GODA 2PNOA 3JSZA 4OIPF 4PACA 3N24A 2QNLA 1FR0A 5GPGB 5TJ5E 3RQFA 1VB5A 5DS6A 4DVYP 4D4NA 1OXBA 3M4BA 4XEFA 1E83A 5L0HA 1TR2A 1LE2A 2OKUA 2YVKA 3DWWA 3KPHA 4JIOA 1ZHWA 3ZTZA 4YT8A 3TULA 2L81A 4E18A 3K66A 1JR8A 1VK5A 2E87A 1RXQA 2ZXOA 3HNJA 1M57C 2Q4FA 2LSEA 2P7VA 3HNLA 1TWGA 3LLKA 2Z15A 1LS4A 1LM3B 3Q7LA 2UUIA 2OJED 2RSEB 2G62A 3RIPA 1VMAA 3BEHA 3UMHA 3W8IA 1TKNA 4JZAA 3R7CA 1PV3A 5DLJA 3ATPA 4OD5A 2L7AA 1OKKA 4EHPA
chains in the Genus database with same CATH topology
3EHMA 2FGYA 4HFFB 2WL8A 4ULWA 1SF8A 2Q9BA 2WVOA 5IY5C 3V7OA 3UMKA 3ZIBA 2O9XA 4GYTA 2IYLD 4IRUA 4FESA 1ZYRF 1OCZC 3CQZA 3MLGA 4LACB 3AG4C 3DZAA 3T4RA 3NDBB 4BJ5A 3LLIA 4ANJA 4BJ6C 2QY9A 1M2OA 1BR4A 2R7WA 4RBNA 1D0XA 1MNEA 3S0XA 3W8HA 5DQZA 2A68F 3UGOA 5EHHA 2BE5F 3PMRA 3T6BA 3ASOC 4DBRA 1O87A 1MNDA 1D1BA 4NY3A 3LNRA 2PP4A 4A2NB 1NU7D 3ZG1A 4ZLDA 1BR2A 2L9JA 3CZ6A 2ZXRA 1O5HA 3DAFA 2J0XA 2YZSA 3ABLC 3RKOF 2J9WA 3EH2A 2W9YA 4H4KC 2Q3TA 3MX3A 4JVSA 4LERA 1JPJA 2EILC 5DS4A 3ECSA 4YWQA 4CIHA 3N2ZB 2IOQA 3GANA 3POVA 1D0YA 4BJ5C 2V3CC 1D0ZA 3VYWA 1OCCC 2ZXWC 2PFDA 3I5PA 3CSKA 2R7RA 2DYSC 4IAOA 3AG3C 2HV7A 2H7VC 4BG0A 5BUOA 5FCLA 3EPVA 4F4BA 3NKDA 3EGDB 4PFPA 4DBQA 1M2VA 2NUTA 1MMDA 1TWHA 2WVQA 4CBEA 1Z63A 2PX3A 1SMYF 4I1MA 4RD9A 3DJNB 4X0RA 4XTKA 3VAYA 2PF4E 5KYYA 3KMIA 4PJNA 1NG1A 3K1IC 4JJFA 3LJBA 2R7UA 3DM9B 3EGXA 3RH3A 4XLNF 3FHDA 4JURI 2G3VA 3EHNA 2KNHA 2IXNA 2IXOA 4KI2A 3WG7C 3ITFA 4ZLCA 3LS0A 4CS9A 4DVZA 1JPNA 2Y69C 3TD7A 3EFOA 2VB6A 4XWJA 3UNGC 1Z6AA 5F5FA 4BJ1A 2DYRC 1NZEA 2I8BA 4YT2A 2B0JA 1OCRC 1RJ9A 2Y3HA 5T1DB 5KYXB 5KYXA 2YEVA 1S7ZA 1G8XA 4U5GA 2KJGA 4Q5SF 4KNVA 3S29A 2VH3A 3LEVA 4PFOA 2EIJC 3SP1A 5E33A 2CDQA 2WZLA 5F5HA 2W45A 4Q4ZF 4DOZA 3DXJF 2CNWA 1ZHXA 1ZHTA 4BJTA 3FDQA 1VYKA 4HEAJ 3HTKC 3EH1A 3SEOA 1VYIA 3K33A 3RFYA 2J7PD 3ZC4A 3T6JA 3L34A 2OCCC 3Q6MA 4JJGA 1LS1A 2J0WA 4O79A 4AE4A 2J46A 3K1HA 1LVKA 2CW0F 5DQTA 3RYLA 1QZXA 2MYSA 2Y3BA 3W8IA 4RDAA 1WGWA 2WZFA 2YHSA 3SNHA 1TWAA 3JCUQ 4KNWA 2EIMC 2JD3A 3IEEA 4CS9C 3B0PA 3EZIA 4G7OF 1Z23A 5D92A 2XSEA 5T3TA 5KYUA 3LAYA 3K6BA 4U5FE 2DGJA 2QTVA 4KC9A 2G3KA 4FX5A 4E7SA 3NYMA 2W4MA 2R7XA 1IZMA 2R7TA 3K7DA 1OCOC 4BEJA 1PCXA 4P6IC 3M1CB 3I4UA 4FWVA 4YT4A 4AK9A 4G7ZF 3NRHA 3NG1A 2FFHA 3W2VA 1MMGA 5B1BC 1N1CA 3ZSUA 5D91A 2OG2A 4LLCA 1PD1A 4U5EE 2PX0A 2H7OA 2A6HF 3EJNA 3UR3C 4EWCA 5DS5A 1M2VB 2NUTB 3FVYA 3QMKA 5KYNA 3LESA 3JRTA 3SYNA 3ABKC 4YN0B 2CGEA 3EQLF 3NKEA 1ST6A 4O7GA 3B9QA 5KYYB 5E3CA 3B0VC 3EGXB 3B0UX 4C7OA 4W8KA 3EZHA 2XXAA 1FFHA 2A69F 1V54C 2IXMA 2Y3DA 4OIQF 4HE8D 4CS8A 3DJUB 4K7BA 4I44A 4YT5A 1W2WA 1QLEC 3E9VA 3F47A 1FMVA 3O39A 3FAJA 4LLEA 3EFOB 2R7VA 4U5DE 2VASA 2A6EF 3NYJA 3UMIA 4AX2A 4QDLA 4HFKB 2J9UA 2J7PA 3F46A 1SZIA 2Q9CA 3SZRA 1RJ9B 1TWCA 3AG1C 3KL4A 4B6IA 4QI0A 5CI9A 5EGYA 3H65A 3Q6NA 4JW1A 4OIRF 2WZGA 3ASNC 2NUPB 2NUPA 2Y39A 3EG9B 3AG2C 3EG9A 4C3DA 3KH2A 4G0HA 4Q7CA 4JCHA 1J8MF 2C03A 4PJJA 1Z5ZA 4MQ9F 2W4BA 1BR1A 5B1AC 3W2WA 4CS7A 3DAGA 2R7SA 4AE4B 1Z3IX 2V26A 5KYWB 5KYWA 1ZHZA 3I5QA 2HV6A 3QZCA 2R7OA 2Y3GA 3NYLA 4K0DA 1FTSA 2XRHA 3DMDA 4YJWA 3X2QC 3OWTA 4PK4A 4CS8C 1OKKD 3X1OA 5B3SC 3AQBA 2EINC 2ZXPA 2J45A 3DD7A 3JYHA 5KYUB 2X51A 1ZU4A 2XL4A 3N0TA 2GFHA 3ABMC 4U5HA 3AQCA 4GEHA 1FFTC 4CSAA 5CI8A 3PHF2 3LS1A 2Q9AA 4I1OB 1ZU5A 5HSWA 2EIKC 3UGPA 3WODF 5E2QA 4O6NA 4C3EA 2CNWD 5E3AA 2P6VA 5L3QA 4OINF 2KGOA 4I3MA 4PJLA 2D5RB 4WJ0A 4OIOF 3DM5A 1VOMA 2KQ9A 4N06A 2A1DD 4IWBA 1NU9C 3KKBA 5L3VA 4IJJA 3HJCA 1MMNA 2KW3C 4KBLA 4G7HF 3S27A 2R7QA 4J32B 4E7ZA 1D1CA 1IW7F 3S28A 2IXPA 2ZPAA 5T3WA 3JT1A 4U5BE 2H7BA 4C3BA 1D1AA 1ZHYA 5DVWA 4XLPF 4QI2A 2M4EA 3L0IA 3OEOA 4MNDA 2NG1A 4O6MA 4OD4A 2WB7A 3ZVRA 2MWQA 4U5CE 3HLZA 4O6YA 1MMAA 3EGDA 3O6XA 4C7OB 4M63A 4J30B 3OA1A 4CSAC 2XXAB 3E70C 1M56C 2C04A 2J9VA 1PD0A 1KU2A 4PJMA 4BJ6A 4EBBA 1FMWA 1V55C 1J8YF 1LKXA 2WVNA 3Q7GA 3GODA 3JSZA 4OIPF 3N24A 5DS6A 4DVYP 1TR2A 4YT8A 1ZHWA 2L81A 3K66A 1VK5A 2E87A 2ZXOA 1M57C 2LSEA 2P7VA 1TWGA 3LLKA 2Z15A 3Q7LA 2G62A 3RIPA 1VMAA 3UMHA 1TKNA 4JZAA 5DLJA 4OD5A 1OKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G62 A;  4LAC B;  2IXM A;  2IXP A;  2IXN A;  2IXO A;  2HV7 A;  2HV6 A;  4NY3 A; 
#chains in the Genus database with same CATH topology
 3EHM A;  2FGY A;  1ZW2 A;  4HFF B;  2WL8 A;  4ULW A;  1SF8 A;  2ETS A;  2Q9B A;  3GWL A;  2WVO A;  5IY5 C;  5L0I A;  3GM3 A;  4MVU A;  1E2X A;  2NPU A;  3UMK A;  3V7O A;  3ZIB A;  2O9X A;  4GYT A;  2IYL D;  1H9G A;  2HUJ A;  1K04 A;  4FES A;  4IRU A;  1ZYR F;  1KTM A;  1OCZ C;  3CQZ A;  3MLG A;  4LAC B;  3AG4 C;  3DZA A;  3U8V A;  1RKE B;  5CIV A;  1RKE A;  3FMS A;  3T4R A;  1G4W R;  1OW8 A;  1DOW A;  3AOU A;  5A6B A;  1EA8 A;  3NDB B;  4BJ5 A;  4WGZ A;  2YL0 A;  4IGG A;  2XLD A;  3O10 A;  1Z7Q c;  1YZC A;  3LLI A;  4ANJ A;  4BJ6 C;  2LD6 A;  2D4U A;  1M2O A;  1TFK B;  1YYX A;  1HE1 A;  2QY9 A;  4P9F A;  3RVY A;  1ORY A;  1BR4 A;  3RW0 A;  4UDV A;  2R7W A;  4YL3 A;  256B A;  4RBN A;  1D0X A;  1MNE A;  2R03 A;  3S0X A;  4DRH B;  1T5O A;  3GEI A;  3W8H A;  5DQZ A;  2A68 F;  3UGO A;  4XEV A;  2GDC A;  5EHH A;  3TOM A;  3ZTM A;  5L0C A;  2BE5 F;  3TJ6 A;  2LQG A;  1TQG A;  3JSE O;  3VM6 A;  4JEB A;  3PMR A;  4LDQ A;  3GM1 A;  3T6B A;  2MHR A;  3ASO C;  1NLX A;  4DBR A;  1O87 A;  3LEO A;  1MND A;  1D1B A;  1E84 A;  4NY3 A;  3LNR A;  1V4A A;  1YA7 O;  1XZQ A;  2PP4 A;  4GQH A;  3IQ6 A;  4A2N B;  2XM0 A;  1NU7 D;  1JRA A;  3CEX A;  3ZG1 A;  4ZLD A;  2XLH A;  1T6U A;  2HJM A;  1BR2 A;  2L9J A;  2PBE A;  3CZ6 A;  3H2U A;  1LE4 A;  2ASR A;  2ZD9 A;  2XLV A;  2ZXR A;  3K1I A;  3LNM B;  1WAS A;  1O5H A;  3DAF A;  2EPN A;  5FZT A;  2J0X A;  1A7V A;  2YZS A;  3ABL C;  3KYI A;  3SXM A;  3TJ5 A;  3RKO F;  2J9W A;  3EH2 A;  2W9Y A;  4H4K C;  2F22 A;  2Q3T A;  1ZVZ A;  3MYF A;  5L0F A;  2XM4 A;  3MX3 A;  4JVS A;  1VTM P;  4LER A;  2A0B A;  3T6G B;  1A7D A;  2HZ8 A;  1JPJ A;  2EIL C;  3QVZ A;  5DS4 A;  4JEA A;  3ECS A;  4LDK A;  2FAP B;  4YWQ A;  1FAP B;  4CIH A;  3N2Z B;  2IOQ A;  1VLT A;  2OQM A;  3GAN A;  1D0Y A;  3POV A;  4N6H A;  4BJ5 C;  2V3C C;  2YLG A;  1D0Z A;  4CDA A;  4CDY A;  2IM8 A;  3VYW A;  1L7C A;  1OCC C;  4XQ1 A;  2ZXW C;  1H7I A;  2PFD A;  1T01 A;  1RKC A;  2AU5 A;  3I5P A;  4XPY A;  3CSK A;  4MTF A;  2R7R A;  1F1M A;  4MVS A;  4XPX A;  2DYS C;  1BZ4 A;  4IAO A;  3AG3 C;  2HV7 A;  2H7V C;  2R02 A;  4BG0 A;  5BUO A;  5AC4 A;  5FCL A;  1OR3 A;  3U3F A;  3EPV A;  2OJQ A;  1HY5 A;  2YL3 A;  3EGD B;  3NKD A;  4F4B A;  3DKA A;  2L6H A;  3B71 A;  2NSG A;  4PFP A;  3IHU A;  5EK0 A;  4DBQ A;  1M2V A;  1UG7 A;  1MMD A;  1TWH A;  2WVQ A;  2NUT A;  2YKZ A;  3RQE A;  2XLW A;  2YRF A;  4CBE A;  1Z63 A;  2HFI A;  3U3B A;  3HNI A;  2PX3 A;  3NMK A;  3ZDL A;  4EIY A;  3G4X A;  2BC5 A;  1SMY F;  3A11 A;  4I1M A;  2XLM A;  4PR9 A;  4RD9 A;  1O3U A;  3DJN B;  3GWN A;  4X0R A;  1APC A;  3GM2 A;  1LI5 A;  2R9R B;  4XTK A;  2PF4 E;  3VAY A;  3PCV A;  3KMI A;  5KYY A;  1HW2 A;  4PJN A;  1NG1 A;  1M6T A;  3K1I C;  3LJB A;  4JJF A;  2GAQ A;  3DM9 B;  3EGX A;  1LPE A;  1T6I A;  3FOP A;  1WN0 A;  3RH3 A;  3U5S A;  3U9J A;  4XLN F;  3FHD A;  4LDR A;  4JUR I;  5A6K A;  3S84 A;  2G3V A;  3EHN A;  4JRZ A;  1Q0G A;  2LFD A;  2XL6 A;  4CDV A;  2KNH A;  4MTG A;  1I4Z A;  2IXN A;  3V5X A;  2IXO A;  3LUT B;  4KI2 A;  2XS8 A;  4MS2 A;  2VCC A;  3WG7 C;  5JT4 A;  1ZW3 A;  2J9B A;  1CGO A;  2YLD A;  3ITF A;  3LS0 A;  2YL7 A;  4CS9 A;  4ZLC A;  4DRJ B;  4DVZ A;  1JPN A;  2Y69 C;  1FNT c;  2DI3 A;  2L6G A;  3TD7 A;  3EFO A;  2VB6 A;  4N6C A;  3TQO A;  4XWJ A;  3UNG C;  4EBK A;  1Z6A A;  5F5F A;  4BJ1 A;  1R5I D;  2DYR C;  2P0N A;  4ONS A;  4FAP B;  1NZE A;  2AWC A;  2I8B A;  2B0J A;  1OCR C;  1RJ9 A;  2Y3H A;  4BEM J;  5T1D B;  3M79 A;  4YT2 A;  4ULV A;  5KYX A;  2YEV A;  5KYX B;  1S7Z A;  1G8X A;  4U5G A;  4IAR A;  2GWW A;  2KJG A;  4MVZ A;  4Q5S F;  3SXY A;  5JRA A;  4XPW A;  1SR2 A;  3V5Y A;  1NSG B;  1HMO A;  4KNV A;  3U2L A;  3S29 A;  2OEV A;  3RF3 A;  4CX9 A;  4Z9H A;  1CPQ A;  3U2M A;  2VH3 A;  3JRM O;  3LEV A;  4PFO A;  2EIJ C;  3SP1 A;  1U6H A;  5E33 A;  2CDQ A;  2WZL A;  5F5H A;  2W45 A;  5L0J A;  4Q4Z F;  4DOZ A;  3DXJ F;  2CNW A;  1ZHX A;  1ZHT A;  3V5Z A;  4BJT A;  3FDQ A;  1VYK A;  4HEA J;  3HTK C;  3EH1 A;  1OR2 A;  3SEO A;  1VYI A;  3ZQV A;  3K33 A;  2J8W A;  3RFY A;  2J7P D;  3ZC4 A;  5JSL A;  3L34 A;  4U9E A;  3T6J A;  3W4Y A;  2OCC C;  1B68 A;  3Q6M A;  4JJG A;  1LS1 A;  2J0W A;  1QVX A;  4O79 A;  4DXW A;  4AE4 A;  3C7J A;  2EPK X;  3IQ5 A;  1YZA A;  2J46 A;  3K1H A;  2AVK A;  2JX0 A;  3C8Z A;  2B0H A;  1LVK A;  1QPU A;  2CW0 F;  5DQT A;  2P1A A;  1JAF A;  2YQY A;  1QZX A;  3RYL A;  2MYS A;  2NSF A;  2Y3B A;  2LK4 A;  3AJM A;  2KC3 A;  1WGW A;  2RD9 A;  3DI5 A;  2WZF A;  3O55 A;  4JKV A;  4RDA A;  2YHS A;  3SNH A;  1TWA A;  4NTF A;  3JCU Q;  1Y4C A;  4KNW A;  2EIM C;  2JD3 A;  3A9C A;  3GEE A;  3IEE A;  3B0P A;  3EZI A;  3IQT A;  1A41 A;  1BBH A;  4IB4 A;  4CS9 C;  5JLI A;  1Z23 A;  3IPM O;  5JUA A;  5L0G A;  5D92 A;  4E0H A;  2XSE A;  5T3T A;  5F28 E;  5JS5 A;  5KYU A;  1T9K A;  3L8I A;  1G5Z A;  1SYQ A;  2DB4 A;  3LAY A;  3K6B A;  4U5F E;  4ER9 A;  5A69 A;  5K0I A;  2DGJ A;  2QTV A;  4KC9 A;  3PDM P;  2XLE A;  1ORJ A;  2G3K A;  2LIG A;  1G4U S;  1VLS A;  4FX5 A;  1YVI A;  4K1O A;  3US6 A;  4E7S A;  1I4Y A;  3G4Z A;  2TMV P;  3NYM A;  1NBB A;  3B29 A;  2W4M A;  2X0C A;  2R7X A;  3HKK A;  1IZM A;  4MVR A;  3K7D A;  2Q7R A;  2R7T A;  4JTD B;  1RMV A;  1OCO C;  4BEJ A;  1PCX A;  4P6I C;  3U8P A;  2HSB A;  1AVO B;  3M1C B;  3C8G B;  3I4U A;  3C8G A;  3CAX A;  4FWV A;  4YL0 A;  4AK9 A;  4YT4 A;  5AC5 A;  4G7Z F;  1CGN A;  1C02 A;  1HMD A;  2LP4 A;  3DE9 A;  3WHN A;  3NG1 A;  3H2V A;  3NRH A;  3MYI A;  5HV9 A;  2LCH A;  2ICW G;  4YL1 A;  1AEP A;  1U89 A;  3S90 A;  4NQF A;  2FFH A;  2M64 A;  1GS9 A;  3MBG A;  1MMG A;  3W2V A;  5B1B C;  1N1C A;  3ZSU A;  2XL8 A;  5D91 A;  3QW1 A;  2OG2 A;  4LLC A;  1PD1 A;  2HSQ A;  2YWA A;  2EPM X;  1HE9 A;  4U5E E;  2PX0 A;  5BQH A;  4JE9 A;  2H7O A;  4JCZ A;  3L1M A;  2A6H F;  3EJN A;  2XLO A;  1Q0K A;  3IQC A;  3UR3 C;  4EWC A;  1A0B A;  1L3P A;  5DS5 A;  1M2V B;  2NUT B;  5COF A;  3FVY A;  4E0I A;  2OOC A;  3QMK A;  1C17 M;  5KYN A;  3LES A;  3JRT A;  2I15 A;  3SYN A;  3TK0 A;  3M15 A;  3ABK C;  4YN0 B;  1GQA A;  3QW0 A;  3KYJ A;  2CGE A;  2OEX A;  3EQL F;  3NKE A;  1ST6 A;  1XWJ A;  4O7G A;  1WTY A;  3B9Q A;  5BQG A;  5KYY B;  1K05 A;  1WOL A;  5E3C A;  5A6A A;  2VC9 A;  3B0V C;  3EGX B;  3B0U X;  4IAQ A;  1BDJ B;  4W8K A;  4C7O A;  2CCY A;  3EZH A;  3M4C A;  2XXA A;  1FFH A;  2A69 F;  2QLA A;  1Q0D A;  1V54 C;  2IXM A;  3RVZ A;  4NCQ A;  2AP3 A;  2Y3D A;  2EPL X;  4OIQ F;  4HE8 D;  4CS8 A;  3DJU B;  2OU6 A;  4I44 A;  4K7B A;  4YT5 A;  5B3I A;  1W2W A;  4J7T A;  1QLE C;  4MVO A;  1Q0M A;  3JYY A;  3E9V A;  2R7U A;  3MFN A;  3F47 A;  3NMJ A;  4J7Y A;  1FMV A;  4N4W A;  2VCB A;  3O39 A;  3DE8 A;  3FAJ A;  3EFO B;  3GEH A;  1QKR A;  4LLE A;  4U5D E;  1LIH A;  3WAQ A;  3TOL A;  4NTB A;  2VAS A;  2A6E F;  1C03 A;  3NYJ A;  3UMI A;  4AX2 A;  4QDL A;  4HFK B;  4JTA B;  1YYJ A;  4WGY A;  2J9U A;  2J7P A;  4XEK A;  3F46 A;  1SZI A;  1CGM E;  1H6G A;  1T6Q A;  2Q9C A;  3SZR A;  1RJ9 B;  4MVM A;  5COG A;  1TWC A;  3AG1 C;  2EPO A;  1R4T A;  3KL4 A;  4A4A A;  3BRJ A;  1AUE A;  3T9O A;  4G7O F;  3ZWI A;  4B6I A;  4QI0 A;  2HMQ A;  3FXH A;  5CI9 A;  5EGY A;  3H65 A;  3Q6N A;  4JW1 A;  4OIR F;  5JVE A;  4CJO A;  2WZG A;  4U9D A;  1H9T A;  3ASN C;  1EQ1 A;  1CPR A;  3ZQY A;  2NUP B;  2NUP A;  2Y39 A;  3G50 A;  4AL0 A;  3QTH A;  3EG9 B;  3AG2 C;  3EG9 A;  4BPM A;  1A7E A;  4C3D A;  3KH2 A;  4G0H A;  4Q7C A;  4JCH A;  1J8M F;  1OXK A;  2Q00 A;  2C03 A;  4MW8 A;  3QVY A;  1Z5Z A;  4PJJ A;  1E86 A;  1KNY A;  1LI7 A;  2AWY A;  3GOR A;  4MW3 A;  4MQ9 F;  2W4B A;  1BR1 A;  1DOV A;  5B1A C;  3W2W A;  4CS7 A;  3U0C A;  3DAG A;  3RQG A;  2R7S A;  1NFO A;  3AGU A;  3JZ0 A;  4AE4 B;  1Z3I X;  1JOG A;  2V26 A;  4JC7 A;  4MVQ A;  1I5N A;  5KYW B;  5KYW A;  1ZHZ A;  2HMZ A;  3I5Q A;  2HV6 A;  3QZC A;  2R7O A;  4CIP A;  1YAU O;  1ORS C;  2Y3G A;  3NYL A;  4K0D A;  1FTS A;  2CYD A;  2XRH A;  3DMD A;  4YJW A;  2A0U A;  3AGT A;  1GM5 A;  1JMW A;  3X2Q C;  3OWT A;  2L6F A;  4PK4 A;  3C18 A;  1OKK D;  4CS8 C;  3NMI A;  3SXZ A;  1EI7 A;  3X1O A;  2HJ3 A;  5AGF A;  5B3S C;  2H8A A;  1S05 A;  2EIN C;  3AQB A;  2ZXP A;  2J45 A;  3DD7 A;  3JYH A;  5KYU B;  2X51 A;  1ZU4 A;  2XL4 A;  3N0T A;  2GFH A;  3ABM C;  4U5H A;  3AQC A;  4GEH A;  2JPU A;  1FFT C;  1RCP A;  2GA0 A;  3HNK A;  4NC3 A;  4DRI B;  4G78 A;  4CSA A;  5CI8 A;  1YA9 A;  3LS1 A;  2Q9A A;  4I1O B;  1ZU5 A;  4NTA A;  3PHF 2;  5HSW A;  2EIK C;  3UGP A;  3WOD F;  5A6B D;  5E2Q A;  2IBF A;  1TFO B;  2BL2 A;  2XS1 A;  5L0D A;  4O6N A;  4C3E A;  2CNW D;  5E3A A;  2P6V A;  1EKY A;  4CJG A;  1QQ3 A;  5L3Q A;  3FAP B;  2QE9 A;  4WAB A;  1HW1 A;  4OIN F;  2KGO A;  4I3M A;  3JTL O;  1XZP A;  3VRC A;  4PJL A;  2R25 A;  2D5R B;  4P9T A;  4WJ0 A;  4OIO F;  2YL1 A;  3DM5 A;  4E17 A;  1VOM A;  2KQ9 A;  1WAT A;  4N06 A;  1ZZP A;  3VF0 A;  2A1D D;  1NFN A;  4IWB A;  1NU9 C;  4D4X A;  3KKB A;  5L3V A;  2KSF A;  4IJJ A;  1GGQ A;  3HJC A;  1MMN A;  2KW3 C;  4KBL A;  4EBJ A;  3R2P A;  2R7Q A;  3S27 A;  4G7H F;  4J32 B;  2VCA A;  4E7Z A;  2R7V A;  1D1C A;  1IW7 F;  3S28 A;  2IXP A;  2ZPA A;  4Z9J A;  5T3W A;  3JT1 A;  4U5B E;  1K40 A;  2LFF A;  2H7B A;  3S9O A;  3SXK A;  3U9M A;  3FOO A;  4C3B A;  1D1A A;  1ZHY A;  3C62 A;  5DVW A;  2KK1 A;  5A6J A;  1E85 A;  4XLP F;  4QI2 A;  2M4E A;  1YAR O;  1YLM A;  4R32 A;  3L0I A;  3L8J A;  4L6R A;  1V74 B;  3OEO A;  4MND A;  2P61 A;  1OW7 A;  4YK5 A;  2NG1 A;  4O6M A;  5JP7 A;  2QUP A;  4OD4 A;  2WB7 A;  1U0B B;  3ZVR A;  1UFB A;  2UUH A;  2MWQ A;  4AL1 A;  1Y6D A;  4EUK B;  4U5C E;  4W8P A;  4Z9I A;  3HLZ A;  4O6Y A;  1MQV A;  1OQC A;  2HKV A;  1MMA A;  1QSP A;  3EGD A;  5BQI A;  3O6X A;  4C7O B;  4M63 A;  4J30 B;  5COM A;  4DJ9 A;  3OA1 A;  1YDI A;  1OW6 A;  4CSA C;  2XXA B;  2YLI A;  3E70 C;  4MTO A;  3C8G D;  3C63 A;  1M56 C;  2C04 A;  2J9V A;  1PD0 A;  3J06 A;  1KU2 A;  4PJM A;  2R05 A;  1Q0F A;  4BJ6 A;  4EBB A;  1FMW A;  4JTC B;  1V55 C;  4EKW A;  4H54 A;  1YJG A;  1J8Y F;  1LKX A;  1WWP A;  2HS5 A;  2KYH A;  2WVN A;  3Q7G A;  3GOD A;  2PNO A;  3JSZ A;  4OIP F;  4PAC A;  3N24 A;  2QNL A;  1FR0 A;  5GPG B;  5TJ5 E;  3RQF A;  1VB5 A;  5DS6 A;  4DVY P;  4D4N A;  1OXB A;  3M4B A;  4XEF A;  1E83 A;  5L0H A;  1TR2 A;  1LE2 A;  2OKU A;  2YVK A;  3DWW A;  3KPH A;  4JIO A;  1ZHW A;  3ZTZ A;  4YT8 A;  3TUL A;  2L81 A;  4E18 A;  3K66 A;  1JR8 A;  1VK5 A;  2E87 A;  1RXQ A;  2ZXO A;  3HNJ A;  1M57 C;  2Q4F A;  2LSE A;  2P7V A;  3HNL A;  1TWG A;  3LLK A;  2Z15 A;  1LS4 A;  1LM3 B;  3Q7L A;  2UUI A;  2OJE D;  2RSE B;  2G62 A;  3RIP A;  1VMA A;  3BEH A;  3UMH A;  3W8I A;  1TKN A;  4JZA A;  3R7C A;  1PV3 A;  5DLJ A;  3ATP A;  4OD5 A;  2L7A A;  1OKK A;  4EHP A; 
#chains in the Genus database with same CATH homology
 3EHM A;  2FGY A;  4HFF B;  2WL8 A;  4ULW A;  1SF8 A;  2Q9B A;  2WVO A;  5IY5 C;  3V7O A;  3UMK A;  3ZIB A;  2O9X A;  4GYT A;  2IYL D;  4IRU A;  4FES A;  1ZYR F;  1OCZ C;  3CQZ A;  3MLG A;  4LAC B;  3AG4 C;  3DZA A;  3T4R A;  3NDB B;  4BJ5 A;  3LLI A;  4ANJ A;  4BJ6 C;  2QY9 A;  1M2O A;  1BR4 A;  2R7W A;  4RBN A;  1D0X A;  1MNE A;  3S0X A;  3W8H A;  5DQZ A;  2A68 F;  3UGO A;  5EHH A;  2BE5 F;  3PMR A;  3T6B A;  3ASO C;  4DBR A;  1O87 A;  1MND A;  1D1B A;  4NY3 A;  3LNR A;  2PP4 A;  4A2N B;  1NU7 D;  3ZG1 A;  4ZLD A;  1BR2 A;  2L9J A;  3CZ6 A;  2ZXR A;  1O5H A;  3DAF A;  2J0X A;  2YZS A;  3ABL C;  3RKO F;  2J9W A;  3EH2 A;  2W9Y A;  4H4K C;  2Q3T A;  3MX3 A;  4JVS A;  4LER A;  1JPJ A;  2EIL C;  5DS4 A;  3ECS A;  4YWQ A;  4CIH A;  3N2Z B;  2IOQ A;  3GAN A;  3POV A;  1D0Y A;  4BJ5 C;  2V3C C;  1D0Z A;  3VYW A;  1OCC C;  2ZXW C;  2PFD A;  3I5P A;  3CSK A;  2R7R A;  2DYS C;  4IAO A;  3AG3 C;  2HV7 A;  2H7V C;  4BG0 A;  5BUO A;  5FCL A;  3EPV A;  4F4B A;  3NKD A;  3EGD B;  4PFP A;  4DBQ A;  1M2V A;  2NUT A;  1MMD A;  1TWH A;  2WVQ A;  4CBE A;  1Z63 A;  2PX3 A;  1SMY F;  4I1M A;  4RD9 A;  3DJN B;  4X0R A;  4XTK A;  3VAY A;  2PF4 E;  5KYY A;  3KMI A;  4PJN A;  1NG1 A;  3K1I C;  4JJF A;  3LJB A;  2R7U A;  3DM9 B;  3EGX A;  3RH3 A;  4XLN F;  3FHD A;  4JUR I;  2G3V A;  3EHN A;  2KNH A;  2IXN A;  2IXO A;  4KI2 A;  3WG7 C;  3ITF A;  4ZLC A;  3LS0 A;  4CS9 A;  4DVZ A;  1JPN A;  2Y69 C;  3TD7 A;  3EFO A;  2VB6 A;  4XWJ A;  3UNG C;  1Z6A A;  5F5F A;  4BJ1 A;  2DYR C;  1NZE A;  2I8B A;  4YT2 A;  2B0J A;  1OCR C;  1RJ9 A;  2Y3H A;  5T1D B;  5KYX B;  5KYX A;  2YEV A;  1S7Z A;  1G8X A;  4U5G A;  2KJG A;  4Q5S F;  4KNV A;  3S29 A;  2VH3 A;  3LEV A;  4PFO A;  2EIJ C;  3SP1 A;  5E33 A;  2CDQ A;  2WZL A;  5F5H A;  2W45 A;  4Q4Z F;  4DOZ A;  3DXJ F;  2CNW A;  1ZHX A;  1ZHT A;  4BJT A;  3FDQ A;  1VYK A;  4HEA J;  3HTK C;  3EH1 A;  3SEO A;  1VYI A;  3K33 A;  3RFY A;  2J7P D;  3ZC4 A;  3T6J A;  3L34 A;  2OCC C;  3Q6M A;  4JJG A;  1LS1 A;  2J0W A;  4O79 A;  4AE4 A;  2J46 A;  3K1H A;  1LVK A;  2CW0 F;  5DQT A;  3RYL A;  1QZX A;  2MYS A;  2Y3B A;  3W8I A;  4RDA A;  1WGW A;  2WZF A;  2YHS A;  3SNH A;  1TWA A;  3JCU Q;  4KNW A;  2EIM C;  2JD3 A;  3IEE A;  4CS9 C;  3B0P A;  3EZI A;  4G7O F;  1Z23 A;  5D92 A;  2XSE A;  5T3T A;  5KYU A;  3LAY A;  3K6B A;  4U5F E;  2DGJ A;  2QTV A;  4KC9 A;  2G3K A;  4FX5 A;  4E7S A;  3NYM A;  2W4M A;  2R7X A;  1IZM A;  2R7T A;  3K7D A;  1OCO C;  4BEJ A;  1PCX A;  4P6I C;  3M1C B;  3I4U A;  4FWV A;  4YT4 A;  4AK9 A;  4G7Z F;  3NRH A;  3NG1 A;  2FFH A;  3W2V A;  1MMG A;  5B1B C;  1N1C A;  3ZSU A;  5D91 A;  2OG2 A;  4LLC A;  1PD1 A;  4U5E E;  2PX0 A;  2H7O A;  2A6H F;  3EJN A;  3UR3 C;  4EWC A;  5DS5 A;  1M2V B;  2NUT B;  3FVY A;  3QMK A;  5KYN A;  3LES A;  3JRT A;  3SYN A;  3ABK C;  4YN0 B;  2CGE A;  3EQL F;  3NKE A;  1ST6 A;  4O7G A;  3B9Q A;  5KYY B;  5E3C A;  3B0V C;  3EGX B;  3B0U X;  4C7O A;  4W8K A;  3EZH A;  2XXA A;  1FFH A;  2A69 F;  1V54 C;  2IXM A;  2Y3D A;  4OIQ F;  4HE8 D;  4CS8 A;  3DJU B;  4K7B A;  4I44 A;  4YT5 A;  1W2W A;  1QLE C;  3E9V A;  3F47 A;  1FMV A;  3O39 A;  3FAJ A;  4LLE A;  3EFO B;  2R7V A;  4U5D E;  2VAS A;  2A6E F;  3NYJ A;  3UMI A;  4AX2 A;  4QDL A;  4HFK B;  2J9U A;  2J7P A;  3F46 A;  1SZI A;  2Q9C A;  3SZR A;  1RJ9 B;  1TWC A;  3AG1 C;  3KL4 A;  4B6I A;  4QI0 A;  5CI9 A;  5EGY A;  3H65 A;  3Q6N A;  4JW1 A;  4OIR F;  2WZG A;  3ASN C;  2NUP B;  2NUP A;  2Y39 A;  3EG9 B;  3AG2 C;  3EG9 A;  4C3D A;  3KH2 A;  4G0H A;  4Q7C A;  4JCH A;  1J8M F;  2C03 A;  4PJJ A;  1Z5Z A;  4MQ9 F;  2W4B A;  1BR1 A;  5B1A C;  3W2W A;  4CS7 A;  3DAG A;  2R7S A;  4AE4 B;  1Z3I X;  2V26 A;  5KYW B;  5KYW A;  1ZHZ A;  3I5Q A;  2HV6 A;  3QZC A;  2R7O A;  2Y3G A;  3NYL A;  4K0D A;  1FTS A;  2XRH A;  3DMD A;  4YJW A;  3X2Q C;  3OWT A;  4PK4 A;  4CS8 C;  1OKK D;  3X1O A;  5B3S C;  3AQB A;  2EIN C;  2ZXP A;  2J45 A;  3DD7 A;  3JYH A;  5KYU B;  2X51 A;  1ZU4 A;  2XL4 A;  3N0T A;  2GFH A;  3ABM C;  4U5H A;  3AQC A;  4GEH A;  1FFT C;  4CSA A;  5CI8 A;  3PHF 2;  3LS1 A;  2Q9A A;  4I1O B;  1ZU5 A;  5HSW A;  2EIK C;  3UGP A;  3WOD F;  5E2Q A;  4O6N A;  4C3E A;  2CNW D;  5E3A A;  2P6V A;  5L3Q A;  4OIN F;  2KGO A;  4I3M A;  4PJL A;  2D5R B;  4WJ0 A;  4OIO F;  3DM5 A;  1VOM A;  2KQ9 A;  4N06 A;  2A1D D;  4IWB A;  1NU9 C;  3KKB A;  5L3V A;  4IJJ A;  3HJC A;  1MMN A;  2KW3 C;  4KBL A;  4G7H F;  3S27 A;  2R7Q A;  4J32 B;  4E7Z A;  1D1C A;  1IW7 F;  3S28 A;  2IXP A;  2ZPA A;  5T3W A;  3JT1 A;  4U5B E;  2H7B A;  4C3B A;  1D1A A;  1ZHY A;  5DVW A;  4XLP F;  4QI2 A;  2M4E A;  3L0I A;  3OEO A;  4MND A;  2NG1 A;  4O6M A;  4OD4 A;  2WB7 A;  3ZVR A;  2MWQ A;  4U5C E;  3HLZ A;  4O6Y A;  1MMA A;  3EGD A;  3O6X A;  4C7O B;  4M63 A;  4J30 B;  3OA1 A;  4CSA C;  2XXA B;  3E70 C;  1M56 C;  2C04 A;  2J9V A;  1PD0 A;  1KU2 A;  4PJM A;  4BJ6 A;  4EBB A;  1FMW A;  1V55 C;  1J8Y F;  1LKX A;  2WVN A;  3Q7G A;  3GOD A;  3JSZ A;  4OIP F;  3N24 A;  5DS6 A;  4DVY P;  1TR2 A;  4YT8 A;  1ZHW A;  2L81 A;  3K66 A;  1VK5 A;  2E87 A;  2ZXO A;  1M57 C;  2LSE A;  2P7V A;  1TWG A;  3LLK A;  2Z15 A;  3Q7L A;  2G62 A;  3RIP A;  1VMA A;  3UMH A;  1TKN A;  4JZA A;  5DLJ A;  4OD5 A;  1OKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...