2IXMA

Structure of human ptpa
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
300
structure length
300
Chain Sequence
FIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLLALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Pp2A Phosphatase Activator: Implications for its Pp2A-Specific Ppiase Activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE 2A REGULATORY SUBUNIT B
total genus 117
structure length 300
sequence length 300
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2ixmA02
2G62A 4LACB 2IXOA 2IXNA 2HV6A 2IXPA 4NY3A 2HV7A 2IXMA
chains in the Genus database with same CATH superfamily
1ZYRF 1FFTC 1AVOB 2XLMA 3EG9A 2NUPA 3NG1A 1KU2A 3RIPA 5DS6A 1V55C 3VAYA 1I4YA 1JRAA 3C7JA 3ZC4A 4F4BA 1QLEC 2J46A 3SEOA 4BJ1A 2HSBA 3K1IA 1RJ9A 2EIJC 3E70C 3B29A 5B3IA 2G3VA 1H7IA 3K7DA 1G4WR 1O87A 3KKBA 1A7EA 3EHMA 3EZHA 3MFNA 4DRHB 1IW7F 3JRMO 3DZAA 5T3TA 4MW3A 4E18A 3FOPA 3K1IC 3T6BA 3POVA 1M2OA 3ZTZA 1RKCA 4RDAA 4AE4B 4PJMA 1OXKA 2WZGA 2J0WA 2YL3A 4JURI 2D4UA 2NPUA 4U9DA 4XTKA 4O6MA 2R03A 2VCAA 3ECSA 3GEHA 2V3CC 1Z7Qc 3H2UA 1RXQA 5F28E 4D4XA 2G62A 4XQ1A 3ZWIA 5L0IA 2WZLA 2CDQA 2OJED 1B68A 1MNDA 2YZSA 3IHUA 3EGDA 4CS8C 4PK4A 5E33A 2BE5F 2L81A 3ABKC 3EPVA 2PNOA 3GWNA 2J9UA 4QDLA 5EHHA 1O5HA 2W4MA 3L34A 4HEAJ 4NTAA 2H7OA 4Q5SF 1JR8A 3TJ6A 3K1HA 4EBBA 5L0JA 1I4ZA 1ZHTA 2P7VA 1HE9A 1D1AA 2KYHA 4IJJA 1F1MA 3TK0A 4G78A 3CQZA 3A11A 2IYLD 3NYJA 1FFHA 4K1OA 4AX2A 4IAQA 2NUTB 5AC4A 5L0DA 4WJ0A 2CCYA 1AEPA 5L0GA 2ICWG 3T6GB 4H54A 2J45A 2GDCA 5B1AC 3IQ5A 4IARA 1APCA 4ZLCA 2H8AA 2R25A 5DVWA 3SZRA 1WATA 5K0IA 3B0VC 2AWYA 1MQVA 4DXWA 3LNMB 2OOCA 2Q9AA 3ABMC 3FAJA 3RQEA 2PX0A 4JTDB 2W45A 4MW8A 3KPHA 2Y3DA 2J7PD 1VTMP 1LE4A 5T3WA 4YL3A 2Q4FA 3DD7A 3MX3A 3VRCA 2PX3A 1Q0KA 2AP3A 2J9WA 4P9TA 4DVZA 2XLOA 3S84A 3RW0A 1VYIA 2ZXRA 4PR9A 1MMNA 3DM9B 1NU7D 1J8YF 3SXZA 3B9QA 4BJ5C 3EQLF 3ZG1A 4J32B 1NZEA 4Z9HA 2FFHA 3EG9B 4FESA 5L0HA 3LS1A 2XSEA 2EIMC 2KJGA 4NQFA 4C3DA 1E83A 1N1CA 3IEEA 1D1CA 1V74B 5JP7A 4U5GA 1H9TA 2MWQA 4R32A 1Q0MA 1EI7A 1NFNA 1Y4CA 4B6IA 1E85A 2WVQA 4ANJA 4EHPA 2YVKA 1BBHA 3KH2A 5JS5A 2Q9CA 1D0YA 4XEFA 5CIVA 3FDQA 1Z63A 1YZCA 1ZW2A 4BJTA 2Q7RA 2B0HA 3I5QA 1HMOA 2EPOA 3LEVA 3UNGC 5B3SC 5COMA 5E3AA 1TWHA 2HJMA 2LP4A 1T6IA 3L8IA 3LEOA 4J7YA 4YN0B 2I8BA 4U5DE 4Z9IA 4OD4A 1YLMA 2AVKA 4XPXA 4A2NB 4OIPF 3B0UX 4XLPF 4G7OF 5L3QA 1JPJA 3NKEA 1S7ZA 4NC3A 3U0CA 1YYJA 1Z3IX 3HNIA 1QSPA 3HNJA 3GM3A 1Y6DA 4I3MA 3C8ZA 3EZIA 2EPLX 1ORJA 2QE9A 4MTOA 1ST6A 4JVSA 1TWCA 1GGQA 3BRJA 4XEVA 2KSFA 3I5PA 3QW1A 1NLXA 3U8VA 1FNTc 2HS5A 2CNWA 1HW2A 5A6KA 4C3EA 4ONSA 3Q6MA 2XL4A 4MVQA 4P9FA 1K05A 1YARO 2Y3BA 3LLIA 5HV9A 1MMDA 4IWBA 2H7BA 3JZ0A 3L0IA 1D0ZA 4N06A 2KC3A 3U3FA 2XXAB 4ZLDA 1OKKA 2KGOA 3LAYA 1U6HA 4EUKB 3PHF2 1LI5A 2DI3A 2FGYA 3QVZA 1QPUA 3U8PA 1Z6AA 1SZIA 4I1MA 4J7TA 3HKKA 2A1DD 4MNDA 3DJUB 2Q3TA 2JX0A 2P0NA 3LJBA 1MMAA 4Z9JA 3ZVRA 3EGDB 3U9MA 1M2VA 1Q0GA 2CNWD 1EA8A 3B71A 1LKXA 2YHSA 3NMKA 1WN0A 1XZQA 2YQYA 1OW8A 4LLCA 2OU6A 1JOGA 2NSFA 2VB6A 3DWWA 1XWJA 1VMAA 3LLKA 4BJ5A 1OQCA 2M4EA 1VK5A 1C17M 3ATPA 4MQ9F 5E3CA 3ZTMA 4LDKA 1BZ4A 1VB5A 2EPNA 4U5FE 1LI7A 4G7ZF 3CZ6A 2QNLA 4I1OB 1YVIA 2OEXA 4OIOF 2KNHA 4OIRF 2LIGA 3DKAA 3AGTA 2MHRA 4KNWA 4P6IC 3C18A 4KBLA 2MYSA 3B0PA 5FZTA 1J8MF 4FAPB 2R7SA 2OG2A 3DM5A 3NYMA 4CDAA 1LS1A 3DAGA 3TQOA 2WB7A 1AUEA 3ZQVA 4CS8A 3GEIA 2XL8A 3Q7LA 1H9GA 3DXJF 4C3BA 5BQIA 1M57C 3N0TA 3DAFA 4JTCB 4AK9A 2YL1A 1YAUO 1CPRA 2H7VC 3GM1A 3DE9A 4EBKA 1A0BA 3O55A 3EFOA 1PD1A 4CDVA 2YKZA 2IM8A 4M63A 3J06A 2R7TA 2LFDA 4JJGA 1M6TA 2J9VA 5JLIA 5AGFA 1U0BB 3R2PA 1VLTA 2BC5A 1YYXA 2LCHA 4HFKB 1HE1A 2R7QA 1RCPA 1O3UA 4O6NA 3UR3C 3AOUA 2VH3A 3S9OA 2YLIA 5KYYB 4L6RA 4PFOA 5DS4A 3IQTA 4BG0A 3SXMA 4LDRA 5HSWA 4YK5A 3SXKA 3EGXA 5BUOA 1ZHXA 4KI2A 3M4CA 1TR2A 2QUPA 3V5ZA 1D1BA 1NU9C 2QY9A 2A68F 4DJ9A 4PJNA 2YLGA 3SYNA 4YT4A 4DOZA 1T01A 2CYDA 5EGYA 3LS0A 5TJ5E 1DOWA 1QZXA 2PBEA 1LE2A 4E7SA 4MTGA 1ZVZA 2HKVA 2UUHA 2LD6A 4GQHA 4G0HA 5DS5A 4HFFB 1U89A 2A0UA 3MYIA 2LFFA 5BQHA 3E9VA 1VLSA 5E2QA 5COFA 4YL0A 1MMGA 3N24A 3W8IA 3C8GD 5IY5C 1JMWA 2J9BA 3U2LA 2DYSC 2KW3C 4DRIB 4ULWA 4WGYA 2DYRC 1SF8A 3GM2A 2J8WA 1VYKA 2PFDA 1C03A 1Q0DA 3OEOA 3ZQYA 4DBQA 1LS4A 3CSKA 2NUTA 3V7OA 2YLDA 1OR2A 5FCLA 4U5HA 2Y39A 4WGZA 1KTMA 2XRHA 5F5FA 5COGA 2QTVA 3EH1A 3T6JA 3EFOB 1LPEA 1PD0A 2M64A 2R7OA 3F46A 2R9RB 3T4RA 5KYXA 2ASRA 4O7GA 5A6AA 3FVYA 3GORA 4N6CA 3GODA 3LESA 1EKYA 1WWPA 1L3PA 2XLHA 3RQGA 1OCZC 1QQ3A 1TQGA 3KYIA 4IGGA 4ULVA 4EWCA 4LERA 4YT8A 3TULA 1WASA 1TFOB 1OCOC 1RKEA 3JT1A 3O10A 3RVYA 2HV6A 2XL6A 4CSAA 4D4NA 2CW0F 3WODF 3AG4C 3AG1C 4GYTA 1RJ9B 2IOQA 1RKEB 2W9YA 1ZHYA 3HJCA 1OW6A 2VASA 3FXHA 3S29A 3NKDA 3UMKA 3M1CB 1V4AA 4CDYA 4EIYA 3HLZA 2G3KA 3ZSUA 4BPMA 4E0HA 1BDJB 3U3BA 4BJ6C 2HSQA 2L6FA 2R7RA 1YA7O 1OKKD 4N6HA 1WGWA 1QVXA 3FAPB 3JSEO 1BR1A 3M79A 4FWVA 3ZIBA 1ZHZA 2O9XA 4C7OB 1G4US 2IBFA 3C8GB 4IB4A 4JC7A 2L6GA 4KC9A 2J0XA 4K0DA 2L9JA 4JCHA 4DBRA 5CI8A 3KL4A 4CS9A 2YEVA 4NTFA 5B1BC 1OCRC 1PCXA 4RBNA 3GANA 2EINC 2NG1A 2OEVA 2R7VA 4CS7A 3C63A 2XLEA 3IQCA 4IAOA 1ORSC 2LK4A 4YJWA 4CIPA 1FMVA 3MLGA 2HMZA 1Q0FA 3AJMA 4N4WA 2GFHA 4U5CE 2YL0A 4YWQA 5KYWB 2EPKX 2P61A 1IZMA 1T9KA 1JAFA 4MVOA 4DRJB 3AG2C 3RF3A 1FAPB 3JYHA 3CEXA 1YDIA 3G4ZA 3VF0A 4E0IA 4OIQF 2YRFA 1SYQA 3Q7GA 1K04A 2OQMA 2CGEA 1H6GA 4JTAB 4XPWA 4JKVA 4QI2A 1A41A 3QW0A 4PACA 2V26A 3US6A 5T1DB 2R7XA 4EBJA 2AU5A 5KYUB 1LIHA 3QZCA 2B0JA 3X2QC 4AL0A 4EKWA 3SNHA 1LM3B 1E86A 3G4XA 2XM4A 3U9JA 2QLAA 2ZPAA 3H2VA 3UMHA 2VCBA 4MVZA 1G5ZA 4GEHA 1NSGB 3O39A 1ZU4A 3BEHA 3M4BA 4MVSA 2NUPB 1FMWA 4W8KA 3Q6NA 4A4AA 3ASOC 3EH2A 3FOOA 4XEKA 3AGUA 4QI0A 3S27A 4CSAC 5JT4A 3O6XA 2L7AA 2RSEB 4YL1A 5DQZA 2WVOA 2L6HA 3U5SA 4E7ZA 2GA0A 4U5EE 2HUJA 4NCQA 5KYNA 1A7VA 2C04A 4K7BA 4PJJA 4AE4A 2RD9A 4Q4ZF 2PF4E 4H4KC 4O6YA 2X51A 5DLJA 5KYYA 2EILC 3AQCA 3NMJA 3C62A 1PV3A 1T6QA 3H65A 3TOMA 4W8PA 2YWAA 1UFBA 3S28A 4I44A 2EPMX 3VYWA 2HV7A 1UG7A 2XM0A 1SMYF 2A6HF 3PMRA 5GPGB 3N2ZB 4CS9C 5L3VA 3K66A 1JPNA 4OD5A 3C8GA 1TWAA 3PDMP 5JUAA 4JRZA 2A6EF 1C02A 2DGJA 2Q9BA 2Z15A 3FMSA 3JTLO 1M56C 1ZZPA 3LUTB 4MTFA 3JRTA 5F5HA 3W8HA 2IXOA 3F47A 3JSZA 1CPQA 3CAXA 1ORYA 3DE8A 3OWTA 3HNLA 2C03A 1R5ID 4HE8D 3ASNC 4MS2A 1RMVA 2FAPB 3X1OA 2KK1A 4CJGA 4UDVA 2WZFA 1HMDA 4YT5A 3TJ5A 5KYWA 3QVYA 1M2VB 2Y3HA 4J30B 1VOMA 1Z5ZA 2HFIA 2XXAA 1WTYA 3NYLA 3QMKA 3W2WA 2OCCC 3UMIA 3R7CA 1S05A 2OKUA 2D5RB 4XPYA 2R05A 4BEJA 1GM5A 3MYFA 3EJNA 2P6VA 1HW1A 3PCVA 4YT2A 3SP1A 3LNRA 4U5BE 4XWJA 2HMQA 3RFYA 2NSGA 1NG1A 2R7WA 1FR0A 3A9CA 3GWLA 1BR2A 3NDBB 1EQ1A 1E84A 1T5OA 1LVKA 4JCZA 3AG3C 2X0CA 4JEBA 4KNVA 5KYUA 2LQGA 1OXBA 2A0BA 3W2VA 3HTKC 1Z23A 3UGOA 2R7UA 2UUIA 4JEAA 1K40A 4CBEA 3GEEA 1NBBA 3DMDA 4ER9A 3TD7A 3NMIA 4AL1A 1NFOA 4C7OA 2XLVA 2HJ3A 2I15A 3FHDA 2JPUA 2Y69C 2EIKC 2ETSA 3L1MA 4IRUA 3M15A 1GS9A 1YA9A 2F22A 3G50A 2ZXOA 2GAQA 1SR2A 2VC9A 3ZDLA 1CGNA 4NTBA 4FX5A 2YL7A 4WABA 3RKOF 5L0CA 3K6BA 3SXYA 4CX9A 5A6JA 3TOLA 2IXMA 3KMIA 5JRAA 3U2MA 2BL2A 4G7HF 1GQAA 1OW7A 1KNYA 2AWCA 2WVNA 2ZD9A 5BQGA 4NY3A 4X0RA 5CI9A 2Y3GA 1V54C 3EGXB 4PJLA 3WHNA 3NRHA 4E17A 4LLEA 4LACB 3OA1A 1A7DA 5L0FA 4JIOA 4JJFA 1CGME 1CGOA 256BA 2IXNA 1HY5A 1YJGA 3JYYA 2HZ8A 5D91A 1W2WA 4OINF 3MBGA 4O79A 2XLDA 4XLNF 2ZXWC 3K33A 3L8JA 3UGPA 2DB4A 5DQTA 1OR3A 2XS8A 3IPMO 5A6BA 1TFKB 2TMVP 1MNEA 4Q7CA 2P1AA 3ABLC 3EHNA 2PP4A 3AQBA 1BR4A 1OCCC 1FTSA 1D0XA 2A69F 2E87A 3JCUQ 3V5YA 4BEMJ 1I5NA 1T6UA 2KQ9A 1ZU5A 3W4YA 1TWGA 3VM6A 2J7PA 2W4BA 2OJQA 5AC5A 4JW1A 4PFPA 3QTHA 2XLWA 4LDQA 4BJ6A 2GWWA 3RQFA 4JZAA 3RVZA 3DI5A 3KYJA 4MVRA 2R02A 1R4TA 1XZPA 2Q00A 1G8XA 1YZAA 4MVUA 3RYLA 3ITFA 1ZHWA 2VCCA 4CJOA 1ZW3A 3WG7C 5A6BD 5KYXB 4MVMA 5D92A 3V5XA 5JVEA 1E2XA 1L7CA 3DJNB 3IQ6A 4RD9A 3RH3A 4CIHA 2LSEA 4DVYP 4JE9A 1WOLA 1QKRA 5A69A 2ZXPA 4U9EA 3T9OA 3S90A 2JD3A 1DOVA 1TKNA 2WL8A 5EK0A 5JSLA 2XS1A 3S0XA 2IXPA 3HNKA 3I4UA 3WAQA
chains in the Genus database with same CATH topology
1ZYRF 1FFTC 3EG9A 2NUPA 3NG1A 1KU2A 3RIPA 5DS6A 1V55C 3VAYA 3ZC4A 4F4BA 1QLEC 2J46A 3SEOA 4BJ1A 1RJ9A 2EIJC 3E70C 2G3VA 3K7DA 3KKBA 1O87A 3EHMA 3EZHA 1IW7F 3POVA 3DZAA 5T3TA 3K1IC 3T6BA 1M2OA 4AE4B 4RDAA 4PJMA 2WZGA 2J0WA 4JURI 4XTKA 4O6MA 3ECSA 2V3CC 2G62A 2WZLA 2CDQA 2YZSA 1MNDA 3EGDA 4CS8C 4PK4A 5E33A 2BE5F 2L81A 3ABKC 3EPVA 2J9UA 4QDLA 5EHHA 1O5HA 2W4MA 3L34A 4HEAJ 2H7OA 4Q5SF 4EBBA 3K1HA 1ZHTA 2P7VA 1D1AA 4IJJA 3CQZA 2IYLD 3NYJA 1FFHA 4AX2A 2NUTB 4WJ0A 2J45A 5B1AC 4ZLCA 5DVWA 3SZRA 3B0VC 2Q9AA 3ABMC 3FAJA 2PX0A 2W45A 2Y3DA 2J7PD 5T3WA 3DD7A 3MX3A 2PX3A 2J9WA 4DVZA 1VYIA 2ZXRA 1MMNA 3DM9B 1NU7D 1J8YF 4BJ5C 3B9QA 3EQLF 3ZG1A 4J32B 1NZEA 2FFHA 3EG9B 4FESA 3LS1A 2XSEA 2EIMC 2KJGA 4C3DA 1N1CA 3IEEA 1D1CA 4U5GA 2MWQA 4B6IA 2WVQA 4ANJA 3KH2A 2Q9CA 1D0YA 1Z63A 3FDQA 4BJTA 3I5QA 3UNGC 3LEVA 5B3SC 1TWHA 4YN0B 2I8BA 4U5DE 4OD4A 4OIPF 4A2NB 4G7OF 3B0UX 4XLPF 5L3QA 1JPJA 3NKEA 1S7ZA 1Z3IX 4I3MA 3EZIA 1ST6A 4JVSA 1TWCA 3I5PA 2CNWA 4C3EA 3Q6MA 2XL4A 2Y3BA 3LLIA 1MMDA 4IWBA 2H7BA 3L0IA 2XXAB 1D0ZA 4N06A 4ZLDA 1OKKA 2KGOA 3LAYA 3PHF2 2FGYA 1Z6AA 1SZIA 4I1MA 2A1DD 4MNDA 3DJUB 2Q3TA 3LJBA 1MMAA 3ZVRA 3EGDB 1M2VA 2CNWD 1LKXA 2YHSA 4LLCA 2VB6A 1VMAA 3LLKA 4BJ5A 2M4EA 1VK5A 5E3CA 4MQ9F 4U5FE 4G7ZF 3CZ6A 4I1OB 4OIOF 2KNHA 4OIRF 4KNWA 4P6IC 4KBLA 2MYSA 3B0PA 2R7SA 1J8MF 2OG2A 3DM5A 3NYMA 1LS1A 3DAGA 2WB7A 4CS8A 3Q7LA 4C3BA 3DXJF 1M57C 3N0TA 3DAFA 4AK9A 2H7VC 3EFOA 1PD1A 4M63A 2R7TA 4JJGA 2J9VA 4HFKB 2R7QA 4O6NA 3UR3C 2VH3A 5KYYB 4PFOA 5DS4A 4BG0A 5HSWA 3EGXA 5BUOA 1ZHXA 4KI2A 1TR2A 1D1BA 1NU9C 2QY9A 2A68F 4PJNA 3SYNA 4YT4A 4DOZA 5EGYA 3LS0A 1QZXA 4E7SA 4G0HA 5DS5A 4HFFB 3E9VA 5E2QA 1MMGA 3N24A 3W8IA 5IY5C 2DYSC 2KW3C 4ULWA 2DYRC 1SF8A 2PFDA 1VYKA 3OEOA 4DBQA 3CSKA 2NUTA 3V7OA 5FCLA 4U5HA 2Y39A 2XRHA 5F5FA 2QTVA 3EH1A 3T6JA 3EFOB 1PD0A 3F46A 2R7OA 3T4RA 5KYXA 4O7GA 3FVYA 3GODA 3LESA 1OCZC 4YT8A 4EWCA 4LERA 1OCOC 3JT1A 2HV6A 4CSAA 2CW0F 3WODF 3AG4C 3AG1C 4GYTA 1RJ9B 2IOQA 2W9YA 1ZHYA 3HJCA 2VASA 3S29A 3UMKA 3NKDA 3M1CB 3HLZA 2G3KA 3ZSUA 4BJ6C 2R7RA 1OKKD 1WGWA 3ZIBA 1BR1A 4FWVA 1ZHZA 2O9XA 4C7OB 4KC9A 2J0XA 4K0DA 2L9JA 4JCHA 4DBRA 5CI8A 3KL4A 4CS9A 2YEVA 5B1BC 1OCRC 1PCXA 4RBNA 3GANA 2EINC 2NG1A 2R7VA 4CS7A 4IAOA 4YJWA 1FMVA 3MLGA 4U5CE 5KYWB 2GFHA 4YWQA 1IZMA 3AG2C 3JYHA 4OIQF 3Q7GA 2CGEA 4QI2A 2V26A 5T1DB 2R7XA 5KYUB 3QZCA 2B0JA 3X2QC 3SNHA 2ZPAA 3UMHA 4GEHA 3O39A 1ZU4A 2NUPB 1FMWA 4W8KA 3Q6NA 3ASOC 3EH2A 4QI0A 3S27A 4CSAC 3O6XA 5DQZA 2WVOA 4E7ZA 4U5EE 5KYNA 2C04A 4K7BA 4PJJA 4AE4A 4Q4ZF 2PF4E 4H4KC 4O6YA 2X51A 5DLJA 5KYYA 2EILC 3AQCA 3H65A 3S28A 4I44A 3VYWA 2HV7A 1SMYF 3PMRA 2A6HF 4CS9C 3N2ZB 5L3VA 3K66A 1JPNA 4OD5A 1TWAA 2A6EF 2DGJA 2Z15A 2Q9BA 1M56C 3W8HA 5F5HA 3JRTA 2IXOA 3F47A 3JSZA 5E3AA 3OWTA 4HE8D 2C03A 3ASNC 3X1OA 2WZFA 4YT5A 5KYWA 1M2VB 2Y3HA 4J30B 1VOMA 1Z5ZA 2XXAA 3NYLA 3QMKA 3W2WA 2OCCC 3UMIA 2D5RB 4BEJA 3EJNA 2P6VA 4YT2A 3SP1A 3LNRA 4U5BE 4XWJA 3RFYA 1NG1A 2R7WA 3NDBB 1BR2A 1LVKA 3AG3C 4KNVA 5KYUA 3W2VA 3HTKC 1Z23A 3UGOA 2R7UA 4CBEA 3DMDA 3TD7A 4C7OA 3FHDA 2Y69C 2EIKC 4IRUA 2ZXOA 3RKOF 4FX5A 3K6BA 2IXMA 3KMIA 4G7HF 2WVNA 4NY3A 4X0RA 5CI9A 2Y3GA 1V54C 3EGXB 4PJLA 3NRHA 4LLEA 4LACB 3OA1A 4JJFA 2IXNA 5D91A 1W2WA 4OINF 4O79A 4XLNF 2ZXWC 3K33A 3UGPA 5DQTA 1MNEA 4Q7CA 3ABLC 3EHNA 3AQBA 3JCUQ 2PP4A 1OCCC 1BR4A 1FTSA 1D0XA 2A69F 2E87A 2KQ9A 1ZU5A 1TWGA 2J7PA 2W4BA 4JW1A 4PFPA 4BJ6A 4JZAA 1G8XA 3RYLA 3ITFA 1ZHWA 5KYXB 3WG7C 5D92A 3DJNB 3RH3A 4RD9A 4CIHA 2LSEA 4DVYP 2ZXPA 2JD3A 1TKNA 2WL8A 3S0XA 2IXPA 3I4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G62 A;  4LAC B;  2IXO A;  2IXN A;  2HV6 A;  2IXP A;  4NY3 A;  2HV7 A;  2IXM A; 
#chains in the Genus database with same CATH topology
 1ZYR F;  1FFT C;  1AVO B;  2XLM A;  3EG9 A;  2NUP A;  3NG1 A;  1KU2 A;  3RIP A;  5DS6 A;  1V55 C;  3VAY A;  1I4Y A;  1JRA A;  3C7J A;  3ZC4 A;  4F4B A;  1QLE C;  2J46 A;  3SEO A;  4BJ1 A;  2HSB A;  3K1I A;  1RJ9 A;  2EIJ C;  3E70 C;  3B29 A;  5B3I A;  2G3V A;  1H7I A;  3K7D A;  1G4W R;  1O87 A;  3KKB A;  1A7E A;  3EHM A;  3EZH A;  3MFN A;  4DRH B;  1IW7 F;  3JRM O;  3DZA A;  5T3T A;  4MW3 A;  4E18 A;  3FOP A;  3K1I C;  3T6B A;  3POV A;  1M2O A;  3ZTZ A;  1RKC A;  4RDA A;  4AE4 B;  4PJM A;  1OXK A;  2WZG A;  2J0W A;  2YL3 A;  4JUR I;  2D4U A;  2NPU A;  4U9D A;  4XTK A;  4O6M A;  2R03 A;  2VCA A;  3ECS A;  3GEH A;  2V3C C;  1Z7Q c;  3H2U A;  1RXQ A;  5F28 E;  4D4X A;  2G62 A;  4XQ1 A;  3ZWI A;  5L0I A;  2WZL A;  2CDQ A;  2OJE D;  1B68 A;  1MND A;  2YZS A;  3IHU A;  3EGD A;  4CS8 C;  4PK4 A;  5E33 A;  2BE5 F;  2L81 A;  3ABK C;  3EPV A;  2PNO A;  3GWN A;  2J9U A;  4QDL A;  5EHH A;  1O5H A;  2W4M A;  3L34 A;  4HEA J;  4NTA A;  2H7O A;  4Q5S F;  1JR8 A;  3TJ6 A;  3K1H A;  4EBB A;  5L0J A;  1I4Z A;  1ZHT A;  2P7V A;  1HE9 A;  1D1A A;  2KYH A;  4IJJ A;  1F1M A;  3TK0 A;  4G78 A;  3CQZ A;  3A11 A;  2IYL D;  3NYJ A;  1FFH A;  4K1O A;  4AX2 A;  4IAQ A;  2NUT B;  5AC4 A;  5L0D A;  4WJ0 A;  2CCY A;  1AEP A;  5L0G A;  2ICW G;  3T6G B;  4H54 A;  2J45 A;  2GDC A;  5B1A C;  3IQ5 A;  4IAR A;  1APC A;  4ZLC A;  2H8A A;  2R25 A;  5DVW A;  3SZR A;  1WAT A;  5K0I A;  3B0V C;  2AWY A;  1MQV A;  4DXW A;  3LNM B;  2OOC A;  2Q9A A;  3ABM C;  3FAJ A;  3RQE A;  2PX0 A;  4JTD B;  2W45 A;  4MW8 A;  3KPH A;  2Y3D A;  2J7P D;  1VTM P;  1LE4 A;  5T3W A;  4YL3 A;  2Q4F A;  3DD7 A;  3MX3 A;  3VRC A;  2PX3 A;  1Q0K A;  2AP3 A;  2J9W A;  4P9T A;  4DVZ A;  2XLO A;  3S84 A;  3RW0 A;  1VYI A;  2ZXR A;  4PR9 A;  1MMN A;  3DM9 B;  1NU7 D;  1J8Y F;  3SXZ A;  3B9Q A;  4BJ5 C;  3EQL F;  3ZG1 A;  4J32 B;  1NZE A;  4Z9H A;  2FFH A;  3EG9 B;  4FES A;  5L0H A;  3LS1 A;  2XSE A;  2EIM C;  2KJG A;  4NQF A;  4C3D A;  1E83 A;  1N1C A;  3IEE A;  1D1C A;  1V74 B;  5JP7 A;  4U5G A;  1H9T A;  2MWQ A;  4R32 A;  1Q0M A;  1EI7 A;  1NFN A;  1Y4C A;  4B6I A;  1E85 A;  2WVQ A;  4ANJ A;  4EHP A;  2YVK A;  1BBH A;  3KH2 A;  5JS5 A;  2Q9C A;  1D0Y A;  4XEF A;  5CIV A;  3FDQ A;  1Z63 A;  1YZC A;  1ZW2 A;  4BJT A;  2Q7R A;  2B0H A;  3I5Q A;  1HMO A;  2EPO A;  3LEV A;  3UNG C;  5B3S C;  5COM A;  5E3A A;  1TWH A;  2HJM A;  2LP4 A;  1T6I A;  3L8I A;  3LEO A;  4J7Y A;  4YN0 B;  2I8B A;  4U5D E;  4Z9I A;  4OD4 A;  1YLM A;  2AVK A;  4XPX A;  4A2N B;  4OIP F;  3B0U X;  4XLP F;  4G7O F;  5L3Q A;  1JPJ A;  3NKE A;  1S7Z A;  4NC3 A;  3U0C A;  1YYJ A;  1Z3I X;  3HNI A;  1QSP A;  3HNJ A;  3GM3 A;  1Y6D A;  4I3M A;  3C8Z A;  3EZI A;  2EPL X;  1ORJ A;  2QE9 A;  4MTO A;  1ST6 A;  4JVS A;  1TWC A;  1GGQ A;  3BRJ A;  4XEV A;  2KSF A;  3I5P A;  3QW1 A;  1NLX A;  3U8V A;  1FNT c;  2HS5 A;  2CNW A;  1HW2 A;  5A6K A;  4C3E A;  4ONS A;  3Q6M A;  2XL4 A;  4MVQ A;  4P9F A;  1K05 A;  1YAR O;  2Y3B A;  3LLI A;  5HV9 A;  1MMD A;  4IWB A;  2H7B A;  3JZ0 A;  3L0I A;  1D0Z A;  4N06 A;  2KC3 A;  3U3F A;  2XXA B;  4ZLD A;  1OKK A;  2KGO A;  3LAY A;  1U6H A;  4EUK B;  3PHF 2;  1LI5 A;  2DI3 A;  2FGY A;  3QVZ A;  1QPU A;  3U8P A;  1Z6A A;  1SZI A;  4I1M A;  4J7T A;  3HKK A;  2A1D D;  4MND A;  3DJU B;  2Q3T A;  2JX0 A;  2P0N A;  3LJB A;  1MMA A;  4Z9J A;  3ZVR A;  3EGD B;  3U9M A;  1M2V A;  1Q0G A;  2CNW D;  1EA8 A;  3B71 A;  1LKX A;  2YHS A;  3NMK A;  1WN0 A;  1XZQ A;  2YQY A;  1OW8 A;  4LLC A;  2OU6 A;  1JOG A;  2NSF A;  2VB6 A;  3DWW A;  1XWJ A;  1VMA A;  3LLK A;  4BJ5 A;  1OQC A;  2M4E A;  1VK5 A;  1C17 M;  3ATP A;  4MQ9 F;  5E3C A;  3ZTM A;  4LDK A;  1BZ4 A;  1VB5 A;  2EPN A;  4U5F E;  1LI7 A;  4G7Z F;  3CZ6 A;  2QNL A;  4I1O B;  1YVI A;  2OEX A;  4OIO F;  2KNH A;  4OIR F;  2LIG A;  3DKA A;  3AGT A;  2MHR A;  4KNW A;  4P6I C;  3C18 A;  4KBL A;  2MYS A;  3B0P A;  5FZT A;  1J8M F;  4FAP B;  2R7S A;  2OG2 A;  3DM5 A;  3NYM A;  4CDA A;  1LS1 A;  3DAG A;  3TQO A;  2WB7 A;  1AUE A;  3ZQV A;  4CS8 A;  3GEI A;  2XL8 A;  3Q7L A;  1H9G A;  3DXJ F;  4C3B A;  5BQI A;  1M57 C;  3N0T A;  3DAF A;  4JTC B;  4AK9 A;  2YL1 A;  1YAU O;  1CPR A;  2H7V C;  3GM1 A;  3DE9 A;  4EBK A;  1A0B A;  3O55 A;  3EFO A;  1PD1 A;  4CDV A;  2YKZ A;  2IM8 A;  4M63 A;  3J06 A;  2R7T A;  2LFD A;  4JJG A;  1M6T A;  2J9V A;  5JLI A;  5AGF A;  1U0B B;  3R2P A;  1VLT A;  2BC5 A;  1YYX A;  2LCH A;  4HFK B;  1HE1 A;  2R7Q A;  1RCP A;  1O3U A;  4O6N A;  3UR3 C;  3AOU A;  2VH3 A;  3S9O A;  2YLI A;  5KYY B;  4L6R A;  4PFO A;  5DS4 A;  3IQT A;  4BG0 A;  3SXM A;  4LDR A;  5HSW A;  4YK5 A;  3SXK A;  3EGX A;  5BUO A;  1ZHX A;  4KI2 A;  3M4C A;  1TR2 A;  2QUP A;  3V5Z A;  1D1B A;  1NU9 C;  2QY9 A;  2A68 F;  4DJ9 A;  4PJN A;  2YLG A;  3SYN A;  4YT4 A;  4DOZ A;  1T01 A;  2CYD A;  5EGY A;  3LS0 A;  5TJ5 E;  1DOW A;  1QZX A;  2PBE A;  1LE2 A;  4E7S A;  4MTG A;  1ZVZ A;  2HKV A;  2UUH A;  2LD6 A;  4GQH A;  4G0H A;  5DS5 A;  4HFF B;  1U89 A;  2A0U A;  3MYI A;  2LFF A;  5BQH A;  3E9V A;  1VLS A;  5E2Q A;  5COF A;  4YL0 A;  1MMG A;  3N24 A;  3W8I A;  3C8G D;  5IY5 C;  1JMW A;  2J9B A;  3U2L A;  2DYS C;  2KW3 C;  4DRI B;  4ULW A;  4WGY A;  2DYR C;  1SF8 A;  3GM2 A;  2J8W A;  1VYK A;  2PFD A;  1C03 A;  1Q0D A;  3OEO A;  3ZQY A;  4DBQ A;  1LS4 A;  3CSK A;  2NUT A;  3V7O A;  2YLD A;  1OR2 A;  5FCL A;  4U5H A;  2Y39 A;  4WGZ A;  1KTM A;  2XRH A;  5F5F A;  5COG A;  2QTV A;  3EH1 A;  3T6J A;  3EFO B;  1LPE A;  1PD0 A;  2M64 A;  2R7O A;  3F46 A;  2R9R B;  3T4R A;  5KYX A;  2ASR A;  4O7G A;  5A6A A;  3FVY A;  3GOR A;  4N6C A;  3GOD A;  3LES A;  1EKY A;  1WWP A;  1L3P A;  2XLH A;  3RQG A;  1OCZ C;  1QQ3 A;  1TQG A;  3KYI A;  4IGG A;  4ULV A;  4EWC A;  4LER A;  4YT8 A;  3TUL A;  1WAS A;  1TFO B;  1OCO C;  1RKE A;  3JT1 A;  3O10 A;  3RVY A;  2HV6 A;  2XL6 A;  4CSA A;  4D4N A;  2CW0 F;  3WOD F;  3AG4 C;  3AG1 C;  4GYT A;  1RJ9 B;  2IOQ A;  1RKE B;  2W9Y A;  1ZHY A;  3HJC A;  1OW6 A;  2VAS A;  3FXH A;  3S29 A;  3NKD A;  3UMK A;  3M1C B;  1V4A A;  4CDY A;  4EIY A;  3HLZ A;  2G3K A;  3ZSU A;  4BPM A;  4E0H A;  1BDJ B;  3U3B A;  4BJ6 C;  2HSQ A;  2L6F A;  2R7R A;  1YA7 O;  1OKK D;  4N6H A;  1WGW A;  1QVX A;  3FAP B;  3JSE O;  1BR1 A;  3M79 A;  4FWV A;  3ZIB A;  1ZHZ A;  2O9X A;  4C7O B;  1G4U S;  2IBF A;  3C8G B;  4IB4 A;  4JC7 A;  2L6G A;  4KC9 A;  2J0X A;  4K0D A;  2L9J A;  4JCH A;  4DBR A;  5CI8 A;  3KL4 A;  4CS9 A;  2YEV A;  4NTF A;  5B1B C;  1OCR C;  1PCX A;  4RBN A;  3GAN A;  2EIN C;  2NG1 A;  2OEV A;  2R7V A;  4CS7 A;  3C63 A;  2XLE A;  3IQC A;  4IAO A;  1ORS C;  2LK4 A;  4YJW A;  4CIP A;  1FMV A;  3MLG A;  2HMZ A;  1Q0F A;  3AJM A;  4N4W A;  2GFH A;  4U5C E;  2YL0 A;  4YWQ A;  5KYW B;  2EPK X;  2P61 A;  1IZM A;  1T9K A;  1JAF A;  4MVO A;  4DRJ B;  3AG2 C;  3RF3 A;  1FAP B;  3JYH A;  3CEX A;  1YDI A;  3G4Z A;  3VF0 A;  4E0I A;  4OIQ F;  2YRF A;  1SYQ A;  3Q7G A;  1K04 A;  2OQM A;  2CGE A;  1H6G A;  4JTA B;  4XPW A;  4JKV A;  4QI2 A;  1A41 A;  3QW0 A;  4PAC A;  2V26 A;  3US6 A;  5T1D B;  2R7X A;  4EBJ A;  2AU5 A;  5KYU B;  1LIH A;  3QZC A;  2B0J A;  3X2Q C;  4AL0 A;  4EKW A;  3SNH A;  1LM3 B;  1E86 A;  3G4X A;  2XM4 A;  3U9J A;  2QLA A;  2ZPA A;  3H2V A;  3UMH A;  2VCB A;  4MVZ A;  1G5Z A;  4GEH A;  1NSG B;  3O39 A;  1ZU4 A;  3BEH A;  3M4B A;  4MVS A;  2NUP B;  1FMW A;  4W8K A;  3Q6N A;  4A4A A;  3ASO C;  3EH2 A;  3FOO A;  4XEK A;  3AGU A;  4QI0 A;  3S27 A;  4CSA C;  5JT4 A;  3O6X A;  2L7A A;  2RSE B;  4YL1 A;  5DQZ A;  2WVO A;  2L6H A;  3U5S A;  4E7Z A;  2GA0 A;  4U5E E;  2HUJ A;  4NCQ A;  5KYN A;  1A7V A;  2C04 A;  4K7B A;  4PJJ A;  4AE4 A;  2RD9 A;  4Q4Z F;  2PF4 E;  4H4K C;  4O6Y A;  2X51 A;  5DLJ A;  5KYY A;  2EIL C;  3AQC A;  3NMJ A;  3C62 A;  1PV3 A;  1T6Q A;  3H65 A;  3TOM A;  4W8P A;  2YWA A;  1UFB A;  3S28 A;  4I44 A;  2EPM X;  3VYW A;  2HV7 A;  1UG7 A;  2XM0 A;  1SMY F;  2A6H F;  3PMR A;  5GPG B;  3N2Z B;  4CS9 C;  5L3V A;  3K66 A;  1JPN A;  4OD5 A;  3C8G A;  1TWA A;  3PDM P;  5JUA A;  4JRZ A;  2A6E F;  1C02 A;  2DGJ A;  2Q9B A;  2Z15 A;  3FMS A;  3JTL O;  1M56 C;  1ZZP A;  3LUT B;  4MTF A;  3JRT A;  5F5H A;  3W8H A;  2IXO A;  3F47 A;  3JSZ A;  1CPQ A;  3CAX A;  1ORY A;  3DE8 A;  3OWT A;  3HNL A;  2C03 A;  1R5I D;  4HE8 D;  3ASN C;  4MS2 A;  1RMV A;  2FAP B;  3X1O A;  2KK1 A;  4CJG A;  4UDV A;  2WZF A;  1HMD A;  4YT5 A;  3TJ5 A;  5KYW A;  3QVY A;  1M2V B;  2Y3H A;  4J30 B;  1VOM A;  1Z5Z A;  2HFI A;  2XXA A;  1WTY A;  3NYL A;  3QMK A;  3W2W A;  2OCC C;  3UMI A;  3R7C A;  1S05 A;  2OKU A;  2D5R B;  4XPY A;  2R05 A;  4BEJ A;  1GM5 A;  3MYF A;  3EJN A;  2P6V A;  1HW1 A;  3PCV A;  4YT2 A;  3SP1 A;  3LNR A;  4U5B E;  4XWJ A;  2HMQ A;  3RFY A;  2NSG A;  1NG1 A;  2R7W A;  1FR0 A;  3A9C A;  3GWL A;  1BR2 A;  3NDB B;  1EQ1 A;  1E84 A;  1T5O A;  1LVK A;  4JCZ A;  3AG3 C;  2X0C A;  4JEB A;  4KNV A;  5KYU A;  2LQG A;  1OXB A;  2A0B A;  3W2V A;  3HTK C;  1Z23 A;  3UGO A;  2R7U A;  2UUI A;  4JEA A;  1K40 A;  4CBE A;  3GEE A;  1NBB A;  3DMD A;  4ER9 A;  3TD7 A;  3NMI A;  4AL1 A;  1NFO A;  4C7O A;  2XLV A;  2HJ3 A;  2I15 A;  3FHD A;  2JPU A;  2Y69 C;  2EIK C;  2ETS A;  3L1M A;  4IRU A;  3M15 A;  1GS9 A;  1YA9 A;  2F22 A;  3G50 A;  2ZXO A;  2GAQ A;  1SR2 A;  2VC9 A;  3ZDL A;  1CGN A;  4NTB A;  4FX5 A;  2YL7 A;  4WAB A;  3RKO F;  5L0C A;  3K6B A;  3SXY A;  4CX9 A;  5A6J A;  3TOL A;  2IXM A;  3KMI A;  5JRA A;  3U2M A;  2BL2 A;  4G7H F;  1GQA A;  1OW7 A;  1KNY A;  2AWC A;  2WVN A;  2ZD9 A;  5BQG A;  4NY3 A;  4X0R A;  5CI9 A;  2Y3G A;  1V54 C;  3EGX B;  4PJL A;  3WHN A;  3NRH A;  4E17 A;  4LLE A;  4LAC B;  3OA1 A;  1A7D A;  5L0F A;  4JIO A;  4JJF A;  1CGM E;  1CGO A;  256B A;  2IXN A;  1HY5 A;  1YJG A;  3JYY A;  2HZ8 A;  5D91 A;  1W2W A;  4OIN F;  3MBG A;  4O79 A;  2XLD A;  4XLN F;  2ZXW C;  3K33 A;  3L8J A;  3UGP A;  2DB4 A;  5DQT A;  1OR3 A;  2XS8 A;  3IPM O;  5A6B A;  1TFK B;  2TMV P;  1MNE A;  4Q7C A;  2P1A A;  3ABL C;  3EHN A;  2PP4 A;  3AQB A;  1BR4 A;  1OCC C;  1FTS A;  1D0X A;  2A69 F;  2E87 A;  3JCU Q;  3V5Y A;  4BEM J;  1I5N A;  1T6U A;  2KQ9 A;  1ZU5 A;  3W4Y A;  1TWG A;  3VM6 A;  2J7P A;  2W4B A;  2OJQ A;  5AC5 A;  4JW1 A;  4PFP A;  3QTH A;  2XLW A;  4LDQ A;  4BJ6 A;  2GWW A;  3RQF A;  4JZA A;  3RVZ A;  3DI5 A;  3KYJ A;  4MVR A;  2R02 A;  1R4T A;  1XZP A;  2Q00 A;  1G8X A;  1YZA A;  4MVU A;  3RYL A;  3ITF A;  1ZHW A;  2VCC A;  4CJO A;  1ZW3 A;  3WG7 C;  5A6B D;  5KYX B;  4MVM A;  5D92 A;  3V5X A;  5JVE A;  1E2X A;  1L7C A;  3DJN B;  3IQ6 A;  4RD9 A;  3RH3 A;  4CIH A;  2LSE A;  4DVY P;  4JE9 A;  1WOL A;  1QKR A;  5A69 A;  2ZXP A;  4U9E A;  3T9O A;  3S90 A;  2JD3 A;  1DOV A;  1TKN A;  2WL8 A;  5EK0 A;  5JSL A;  2XS1 A;  3S0X A;  2IXP A;  3HNK A;  3I4U A;  3WAQ A; 
#chains in the Genus database with same CATH homology
 1ZYR F;  1FFT C;  3EG9 A;  2NUP A;  3NG1 A;  1KU2 A;  3RIP A;  5DS6 A;  1V55 C;  3VAY A;  3ZC4 A;  4F4B A;  1QLE C;  2J46 A;  3SEO A;  4BJ1 A;  1RJ9 A;  2EIJ C;  3E70 C;  2G3V A;  3K7D A;  3KKB A;  1O87 A;  3EHM A;  3EZH A;  1IW7 F;  3POV A;  3DZA A;  5T3T A;  3K1I C;  3T6B A;  1M2O A;  4AE4 B;  4RDA A;  4PJM A;  2WZG A;  2J0W A;  4JUR I;  4XTK A;  4O6M A;  3ECS A;  2V3C C;  2G62 A;  2WZL A;  2CDQ A;  2YZS A;  1MND A;  3EGD A;  4CS8 C;  4PK4 A;  5E33 A;  2BE5 F;  2L81 A;  3ABK C;  3EPV A;  2J9U A;  4QDL A;  5EHH A;  1O5H A;  2W4M A;  3L34 A;  4HEA J;  2H7O A;  4Q5S F;  4EBB A;  3K1H A;  1ZHT A;  2P7V A;  1D1A A;  4IJJ A;  3CQZ A;  2IYL D;  3NYJ A;  1FFH A;  4AX2 A;  2NUT B;  4WJ0 A;  2J45 A;  5B1A C;  4ZLC A;  5DVW A;  3SZR A;  3B0V C;  2Q9A A;  3ABM C;  3FAJ A;  2PX0 A;  2W45 A;  2Y3D A;  2J7P D;  5T3W A;  3DD7 A;  3MX3 A;  2PX3 A;  2J9W A;  4DVZ A;  1VYI A;  2ZXR A;  1MMN A;  3DM9 B;  1NU7 D;  1J8Y F;  4BJ5 C;  3B9Q A;  3EQL F;  3ZG1 A;  4J32 B;  1NZE A;  2FFH A;  3EG9 B;  4FES A;  3LS1 A;  2XSE A;  2EIM C;  2KJG A;  4C3D A;  1N1C A;  3IEE A;  1D1C A;  4U5G A;  2MWQ A;  4B6I A;  2WVQ A;  4ANJ A;  3KH2 A;  2Q9C A;  1D0Y A;  1Z63 A;  3FDQ A;  4BJT A;  3I5Q A;  3UNG C;  3LEV A;  5B3S C;  1TWH A;  4YN0 B;  2I8B A;  4U5D E;  4OD4 A;  4OIP F;  4A2N B;  4G7O F;  3B0U X;  4XLP F;  5L3Q A;  1JPJ A;  3NKE A;  1S7Z A;  1Z3I X;  4I3M A;  3EZI A;  1ST6 A;  4JVS A;  1TWC A;  3I5P A;  2CNW A;  4C3E A;  3Q6M A;  2XL4 A;  2Y3B A;  3LLI A;  1MMD A;  4IWB A;  2H7B A;  3L0I A;  2XXA B;  1D0Z A;  4N06 A;  4ZLD A;  1OKK A;  2KGO A;  3LAY A;  3PHF 2;  2FGY A;  1Z6A A;  1SZI A;  4I1M A;  2A1D D;  4MND A;  3DJU B;  2Q3T A;  3LJB A;  1MMA A;  3ZVR A;  3EGD B;  1M2V A;  2CNW D;  1LKX A;  2YHS A;  4LLC A;  2VB6 A;  1VMA A;  3LLK A;  4BJ5 A;  2M4E A;  1VK5 A;  5E3C A;  4MQ9 F;  4U5F E;  4G7Z F;  3CZ6 A;  4I1O B;  4OIO F;  2KNH A;  4OIR F;  4KNW A;  4P6I C;  4KBL A;  2MYS A;  3B0P A;  2R7S A;  1J8M F;  2OG2 A;  3DM5 A;  3NYM A;  1LS1 A;  3DAG A;  2WB7 A;  4CS8 A;  3Q7L A;  4C3B A;  3DXJ F;  1M57 C;  3N0T A;  3DAF A;  4AK9 A;  2H7V C;  3EFO A;  1PD1 A;  4M63 A;  2R7T A;  4JJG A;  2J9V A;  4HFK B;  2R7Q A;  4O6N A;  3UR3 C;  2VH3 A;  5KYY B;  4PFO A;  5DS4 A;  4BG0 A;  5HSW A;  3EGX A;  5BUO A;  1ZHX A;  4KI2 A;  1TR2 A;  1D1B A;  1NU9 C;  2QY9 A;  2A68 F;  4PJN A;  3SYN A;  4YT4 A;  4DOZ A;  5EGY A;  3LS0 A;  1QZX A;  4E7S A;  4G0H A;  5DS5 A;  4HFF B;  3E9V A;  5E2Q A;  1MMG A;  3N24 A;  3W8I A;  5IY5 C;  2DYS C;  2KW3 C;  4ULW A;  2DYR C;  1SF8 A;  2PFD A;  1VYK A;  3OEO A;  4DBQ A;  3CSK A;  2NUT A;  3V7O A;  5FCL A;  4U5H A;  2Y39 A;  2XRH A;  5F5F A;  2QTV A;  3EH1 A;  3T6J A;  3EFO B;  1PD0 A;  3F46 A;  2R7O A;  3T4R A;  5KYX A;  4O7G A;  3FVY A;  3GOD A;  3LES A;  1OCZ C;  4YT8 A;  4EWC A;  4LER A;  1OCO C;  3JT1 A;  2HV6 A;  4CSA A;  2CW0 F;  3WOD F;  3AG4 C;  3AG1 C;  4GYT A;  1RJ9 B;  2IOQ A;  2W9Y A;  1ZHY A;  3HJC A;  2VAS A;  3S29 A;  3UMK A;  3NKD A;  3M1C B;  3HLZ A;  2G3K A;  3ZSU A;  4BJ6 C;  2R7R A;  1OKK D;  1WGW A;  3ZIB A;  1BR1 A;  4FWV A;  1ZHZ A;  2O9X A;  4C7O B;  4KC9 A;  2J0X A;  4K0D A;  2L9J A;  4JCH A;  4DBR A;  5CI8 A;  3KL4 A;  4CS9 A;  2YEV A;  5B1B C;  1OCR C;  1PCX A;  4RBN A;  3GAN A;  2EIN C;  2NG1 A;  2R7V A;  4CS7 A;  4IAO A;  4YJW A;  1FMV A;  3MLG A;  4U5C E;  5KYW B;  2GFH A;  4YWQ A;  1IZM A;  3AG2 C;  3JYH A;  4OIQ F;  3Q7G A;  2CGE A;  4QI2 A;  2V26 A;  5T1D B;  2R7X A;  5KYU B;  3QZC A;  2B0J A;  3X2Q C;  3SNH A;  2ZPA A;  3UMH A;  4GEH A;  3O39 A;  1ZU4 A;  2NUP B;  1FMW A;  4W8K A;  3Q6N A;  3ASO C;  3EH2 A;  4QI0 A;  3S27 A;  4CSA C;  3O6X A;  5DQZ A;  2WVO A;  4E7Z A;  4U5E E;  5KYN A;  2C04 A;  4K7B A;  4PJJ A;  4AE4 A;  4Q4Z F;  2PF4 E;  4H4K C;  4O6Y A;  2X51 A;  5DLJ A;  5KYY A;  2EIL C;  3AQC A;  3H65 A;  3S28 A;  4I44 A;  3VYW A;  2HV7 A;  1SMY F;  3PMR A;  2A6H F;  4CS9 C;  3N2Z B;  5L3V A;  3K66 A;  1JPN A;  4OD5 A;  1TWA A;  2A6E F;  2DGJ A;  2Z15 A;  2Q9B A;  1M56 C;  3W8H A;  5F5H A;  3JRT A;  2IXO A;  3F47 A;  3JSZ A;  5E3A A;  3OWT A;  4HE8 D;  2C03 A;  3ASN C;  3X1O A;  2WZF A;  4YT5 A;  5KYW A;  1M2V B;  2Y3H A;  4J30 B;  1VOM A;  1Z5Z A;  2XXA A;  3NYL A;  3QMK A;  3W2W A;  2OCC C;  3UMI A;  2D5R B;  4BEJ A;  3EJN A;  2P6V A;  4YT2 A;  3SP1 A;  3LNR A;  4U5B E;  4XWJ A;  3RFY A;  1NG1 A;  2R7W A;  3NDB B;  1BR2 A;  1LVK A;  3AG3 C;  4KNV A;  5KYU A;  3W2V A;  3HTK C;  1Z23 A;  3UGO A;  2R7U A;  4CBE A;  3DMD A;  3TD7 A;  4C7O A;  3FHD A;  2Y69 C;  2EIK C;  4IRU A;  2ZXO A;  3RKO F;  4FX5 A;  3K6B A;  2IXM A;  3KMI A;  4G7H F;  2WVN A;  4NY3 A;  4X0R A;  5CI9 A;  2Y3G A;  1V54 C;  3EGX B;  4PJL A;  3NRH A;  4LLE A;  4LAC B;  3OA1 A;  4JJF A;  2IXN A;  5D91 A;  1W2W A;  4OIN F;  4O79 A;  4XLN F;  2ZXW C;  3K33 A;  3UGP A;  5DQT A;  1MNE A;  4Q7C A;  3ABL C;  3EHN A;  3AQB A;  3JCU Q;  2PP4 A;  1OCC C;  1BR4 A;  1FTS A;  1D0X A;  2A69 F;  2E87 A;  2KQ9 A;  1ZU5 A;  1TWG A;  2J7P A;  2W4B A;  4JW1 A;  4PFP A;  4BJ6 A;  4JZA A;  1G8X A;  3RYL A;  3ITF A;  1ZHW A;  5KYX B;  3WG7 C;  5D92 A;  3DJN B;  3RH3 A;  4RD9 A;  4CIH A;  2LSE A;  4DVY P;  2ZXP A;  2JD3 A;  1TKN A;  2WL8 A;  3S0X A;  2IXP A;  3I4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...