2IXMA

Structure of human ptpa
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
300
structure length
300
Chain Sequence
FIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLLALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE 2A REGULATORY SUBUNIT B
publication title Crystal Structure of the Pp2A Phosphatase Activator: Implications for its Pp2A-Specific Ppiase Activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 117
structure length 300
sequence length 300
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2ixmA02
2HV6A 2IXMA 2IXPA 4LACB 2IXOA 4NY3A 2HV7A 2IXNA 2G62A
chains in the Genus database with same CATH superfamily
2A0UA 1R5ID 4YJWA 1ZU4A 2FAPB 3S27A 2P61A 1E85A 4DVZA 1O87A 5K0IA 1BR4A 1MMGA 4MVSA 4XPWA 5BQHA 1APCA 2XL8A 2QTVA 3DAFA 3S84A 1D0YA 1LI5A 1HMOA 4BJ6A 3L0IA 5F5HA 1VLTA 4IRUA 1KTMA 4JKVA 2J45A 2LFDA 4NCQA 3DAGA 4IAOA 1JOGA 2NUPA 3QZCA 4J32B 5B1AC 5L3QA 5JS5A 2ZXWC 3JYYA 1FFHA 3VF0A 3RYLA 4DRHB 2YL3A 3HJCA 3NYLA 1ZW3A 4O6NA 3TD7A 3GEHA 5L0GA 3L34A 3NKDA 3S0XA 3AGUA 4AX2A 3C8GD 1E83A 4PR9A 1B68A 3ZIBA 2XLWA 3FHDA 3PCVA 4O6MA 3U5SA 3U0CA 3UGOA 2M64A 3KPHA 5KYYB 4XQ1A 5JRAA 3DXJF 3IQ5A 4MTGA 1MMDA 5DQTA 4WGZA 4HFFB 3SXMA 4E0IA 3T6JA 3EFOB 1K40A 2EIMC 2L6GA 3M1CB 1GGQA 1NLXA 3R2PA 3IQCA 1Z7Qc 4G7HF 1Y4CA 1ZHZA 1PCXA 4C7OA 4C3EA 2Q9CA 2YKZA 2W4BA 3KYJA 3UGPA 1JPNA 4I44A 1BZ4A 1OCCC 4BPMA 3U8PA 1JAFA 3C7JA 1A7VA 1TWCA 2PFDA 4WGYA 2VC9A 2Y39A 1J8MF 1NU9C 4WABA 1TR2A 1LS1A 2EPOA 3EZHA 4DOZA 1O5HA 4U5BE 1WN0A 3ZQYA 4N4WA 1WWPA 2EPMX 4DJ9A 4YL1A 4U5HA 3ZSUA 4JTAB 2J7PA 1O3UA 1OW8A 4ANJA 4J30B 3Q6NA 4IGGA 2YLDA 2UUIA 4P9FA 3RH3A 2H7VC 3PHF2 2MHRA 4JW1A 1NFOA 2E87A 3QVZA 2KNHA 3SP1A 1OR2A 4E7ZA 5AGFA 3C62A 1ZZPA 2J9VA 2LCHA 1RJ9B 2VCAA 1UFBA 1FTSA 1WOLA 2OOCA 2W45A 2KSFA 1ORYA 3IEEA 3AG1C 5AC4A 3VYWA 4CS9C 3A11A 3V5XA 1ZVZA 4JJGA 2OQMA 1D1CA 1HY5A 2GAQA 4MVZA 4PJMA 2A6HF 1BBHA 2R7OA 4OD5A 4J7TA 4CIHA 1FMWA 4YT5A 2H7BA 2Y3DA 1YYJA 2GDCA 1H6GA 1T9KA 2Q9AA 2NG1A 3LEOA 4YL0A 3EZIA 4GYTA 3AGTA 4WJ0A 4YT4A 4FWVA 2XL6A 3GM2A 1QZXA 3T6BA 2XSEA 5L0DA 1ORSC 2ZXOA 3MYFA 4ZLCA 2IXPA 4JZAA 4PFOA 2NPUA 5FCLA 4NY3A 2YL7A 3QVYA 4JTCB 5CI9A 3DE9A 4JCHA 3SEOA 3DM5A 4AK9A 3K1IC 4Q4ZF 1TKNA 3MYIA 4OIRF 4YT8A 5KYXA 2MWQA 4XWJA 2J7PD 4MVQA 4N6HA 2R7RA 3EG9B 3IQ6A 3I4UA 2YLIA 4D4NA 1YJGA 4ONSA 2DB4A 2XLMA 5KYWA 2R7VA 1EQ1A 1RKEA 1L7CA 4KNVA 1OXKA 1T6UA 2PX3A 3RF3A 3ZTZA 3X1OA 4PJLA 3WODF 3RKOF 2I15A 5L3VA 2HZ8A 1JPJA 2PNOA 3EGXA 3K66A 2D5RB 3ASNC 3ZTMA 2R7SA 1U0BB 2VB6A 3TOMA 1T01A 1VTMP 3N24A 4PJNA 4A2NB 2XLHA 1EI7A 3RVYA 2XM4A 4Q5SF 1VYIA 5A6AA 2OU6A 4MW8A 3W2WA 4CS7A 2LIGA 5D92A 2XXAA 4UDVA 2R05A 1HE1A 1R4TA 3UR3C 1JRAA 2EILC 3UNGC 1PD1A 1C17M 1YVIA 1DOWA 1XZPA 3HNIA 5JUAA 4YWQA 1E2XA 5JVEA 1FR0A 2CDQA 2Y3GA 2R7XA 4O79A 3J06A 3ATPA 2RD9A 1HW2A 3R7CA 4MW3A 5FZTA 4YN0B 4R32A 4NQFA 2IOQA 4K0DA 2BC5A 3FOPA 4AE4A 5KYNA 4CSAC 4L6RA 4OD4A 1LPEA 4MTOA 3JZ0A 2GWWA 3FAJA 3DWWA 4Z9IA 1T5OA 1M2OA 2R25A 5B3SC 2XLVA 4RD9A 5TJ5E 4MTFA 3SXKA 5AC5A 2CCYA 3ABKC 1Q0FA 4XLNF 3NG1A 2P6VA 5B1BC 5DS6A 5DS5A 3POVA 4QI2A 1BDJB 4DRIB 1C02A 1PV3A 3FVYA 4Q7CA 5A69A 3HTKC 2DYSC 3FXHA 1LKXA 3C18A 4IAQA 1V54C 3LS0A 2HFIA 1TQGA 2J8WA 3EJNA 5A6KA 2FGYA 1VLSA 3DI5A 1HE9A 3NDBB 1FMVA 4I1OB 5JP7A 2IM8A 3EGDA 3QW1A 3ZC4A 1ZHYA 4H54A 1K04A 3I5QA 4JE9A 2Y69C 4IJJA 3DJUB 2Y3BA 3ZWIA 4OIOF 1YZAA 2L6HA 1RKCA 3L8JA 4CDVA 1ZU5A 1QKRA 2YRFA 4K1OA 5T3TA 4CS8A 3FDQA 3JRMO 3GANA 5HSWA 1M2VB 1WTYA 1GM5A 2QE9A 1Q0DA 4M63A 2P1AA 2LK4A 4U5GA 4E17A 4XLPF 2R7UA 2KC3A 4FESA 5KYUA 4BJ5C 4E0HA 2X0CA 3AJMA 2J9BA 4EBBA 2R9RB 1V74B 3SZRA 3RVZA 3JSZA 1MNEA 3X2QC 2NSGA 5T1DB 2HJ3A 3KL4A 4IB4A 2HSBA 1E84A 2M4EA 3MFNA 3OWTA 3RQEA 2A0BA 1MMNA 1TWGA 4QDLA 5COFA 4I1MA 1OW6A 1SF8A 1TFKB 2LP4A 4U9DA 4X0RA 3W8IA 5KYYA 1QLEC 3G50A 3N0TA 2PP4A 4Z9JA 2VCCA 2CGEA 1KNYA 4P9TA 2YWAA 1YLMA 2GFHA 2EPKX 2Y3HA 4GEHA 3TJ5A 1D1AA 4BJ6C 4CSAA 1BR1A 4U9EA 4JC7A 2WZLA 1WATA 3EHMA 2EIJC 1AUEA 2P7VA 3SNHA 3EFOA 3S9OA 3SXZA 1QSPA 1NBBA 5B3IA 2J0XA 4Z9HA 1YA9A 1VMAA 4LDQA 1GQAA 2A1DD 4MQ9F 2BE5F 2JD3A 1ZHWA 2AVKA 2EIKC 3ZQVA 2R7QA 3HLZA 5DS4A 4NTFA 3S90A 1NZEA 1OKKA 1EA8A 3M4BA 1Q0MA 3MBGA 1L3PA 4KBLA 2LFFA 1QVXA 2NUTB 4CBEA 3OA1A 3QW0A 2WZFA 4RBNA 3AG4C 1Q0GA 5DQZA 4J7YA 1XZQA 3V5YA 2VH3A 4O6YA 3FOOA 1D0ZA 2AU5A 3GEEA 1LE4A 3V7OA 4U5FE 4EKWA 2G3KA 2C03A 3AQBA 1Z6AA 5E3CA 1FFTC 4PACA 2ICWG 4DVYP 2NSFA 3ZG1A 2XLDA 3ITFA 5IY5C 3IHUA 3E70C 1T6IA 1RJ9A 2HMZA 2YLGA 1MNDA 2CYDA 1A7DA 3M4CA 3DD7A 1YZCA 3T6GB 1H7IA 3I5PA 3KYIA 1V55C 2YHSA 2KQ9A 4U5DE 3C8GB 5CIVA 2WB7A 2L9JA 3C63A 4E18A 2J46A 2EPNA 3L8IA 4LACB 2BL2A 3NRHA 1OR3A 3JSEO 2OEXA 4MS2A 1SZIA 4N06A 5L0HA 2JX0A 3ASOC 1ZHTA 2YZSA 4H4KC 4A4AA 5E3AA 1VOMA 4G78A 1CGNA 3JTLO 2F22A 1MMAA 2ZXPA 4LLEA 1NU7D 3MX3A 2WVOA 1OKKD 3AOUA 4JTDB 4EUKB 2Q3TA 3QTHA 5BUOA 2LQGA 2XL4A 2XLOA 3E9VA 3TK0A 1CGOA 3F47A 1RMVA 1I5NA 3JYHA 3TQOA 3WHNA 4N6CA 4RDAA 3IPMO 4XTKA 1GS9A 3QMKA 4EHPA 1V4AA 5JLIA 2IXMA 3HNKA 1WASA 2DI3A 4U5EE 1ZYRF 1G8XA 4B6IA 4CDYA 3ABLC 1TFOB 3B0UX 3L1MA 3EG9A 2HS5A 2RSEB 1HMDA 3G4ZA 3LJBA 4D4XA 2PX0A 4YT2A 5D91A 2R7WA 4GQHA 2YL0A 2KJGA 2YQYA 3HKKA 1H9GA 3CZ6A 3LS1A 3NKEA 3Q6MA 4JJFA 1NG1A 2NUPB 3EH1A 4KNWA 3B29A 1OQCA 4FX5A 2EINC 1M6TA 2H8AA 3O6XA 4P6IC 2O9XA 3CQZA 4NTBA 2I8BA 1Z3IX 4JEAA 4AL1A 2OJED 4CJOA 4MVMA 3W8HA 4OIQF 3GWLA 3LLIA 3UMKA 3F46A 2VASA 4JIOA 2Q9BA 4CX9A 2DGJA 4EBJA 5COGA 3V5ZA 3MLGA 3WAQA 5A6BA 3KMIA 3VAYA 2D4UA 3NMJA 1VB5A 2OCCC 2AP3A 2HKVA 3GWNA 3OEOA 3LLKA 4IWBA 5CI8A 4BEJA 1H9TA 1TWHA 3U3BA 1CPRA 3LAYA 3U2LA 2DYRC 3DM9B 4DBQA 2IBFA 4ULWA 2Q4FA 4G7ZF 4JRZA 3RQFA 1LE2A 3BRJA 4XPXA 4ZLDA 4NC3A 1YAUO 3Q7LA 2CNWA 3GODA 2W4MA 1IZMA 4IARA 5L0JA 3RFYA 4ER9A 4HEAJ 3S28A 3NYMA 4CIPA 2R03A 1HW1A 3PDMP 4C7OB 4XPYA 4LDRA 1YA7O 3DJNB 4CJGA 3LUTB 5KYUB 3UMHA 2V3CC 4CS9A 1I4ZA 4MVOA 2XS8A 2MYSA 3B0VC 1WGWA 3LNMB 3N2ZB 4XEKA 1C03A 1AVOB 2FFHA 1F1MA 1T6QA 1QQ3A 4MVUA 3TOLA 1OW7A 2XS1A 3EQLF 3JT1A 3O10A 3VM6A 5EHHA 1Y6DA 3DE8A 4I3MA 1CPQA 1NFNA 1LM3B 2IYLD 4YL3A 3UMIA 1SYQA 3HNJA 2YVKA 3NMKA 2ZD9A 5EGYA 1DOVA 4DRJB 2KGOA 4JVSA 2QY9A 4G7OF 2A69F 1KU2A 3T4RA 2Z15A 5F28E 1RXQA 3ZVRA 3KKBA 3M15A 5A6BD 3B9QA 2VCBA 3K33A 1SMYF 3TJ6A 5A6JA 3EH2A 3EHNA 3K1IA 4U5CE 2G62A 3NMIA 1FAPB 5BQGA 4KI2A 3O55A 2HUJA 3K7DA 1OCRC 3U9MA 1EKYA 2EPLX 3GM1A 3LEVA 3U2MA 3GORA 3A9CA 3DKAA 1SR2A 4W8KA 1M2VA 1XWJA 2CNWD 2C04A 2A6EF 3VRCA 2HJMA 2L6FA 4HFKB 4PFPA 4C3BA 1A0BA 4KC9A 2QLAA 4F4BA 2WVNA 3U3FA 3LNRA 2J9WA 2PF4E 3HNLA 2B0JA 5E33A 1IW7F 2ZXRA 1Z5ZA 1U6HA 3BEHA 3U9JA 3H2UA 4K7BA 4MVRA 1N1CA 3SYNA 3Q7GA 5DVWA 3ZDLA 4EIYA 1JR8A 2LD6A 3GM3A 4FAPB 2YEVA 3K6BA 5KYXB 5L0IA 4AL0A 1TWAA 1RCPA 4LLCA 4CS8C 1FNTc 1OCZC 2H7OA 5KYWB 2G3VA 4LDKA 1RKEB 2ZPAA 1YDIA 3LESA 1G4US 5F5FA 2ASRA 2KYHA 3B71A 3PMRA 3AQCA 3EPVA 2XRHA 4NTAA 4XEVA 1VYKA 3RW0A 3US6A 3AG2C 3B0PA 3GEIA 3DMDA 5JSLA 1NSGB 1PD0A 2QUPA 4G0HA 2WL8A 3TULA 256BA 3ABMC 3EGXB 3CEXA 2HV6A 2OJQA 2Q00A 2CW0F 1A41A 1YYXA 2AWYA 4JEBA 5HV9A 3KH2A 5EK0A 1LI7A 1U89A 1Q0KA 1OCOC 2AWCA 2KK1A 3G4XA 2IXOA 4BG0A 2R02A 3CSKA 1E86A 2XXAB 2A68F 3S29A 4PJJA 5BQIA 5T3WA 1LS4A 3RIPA 3NYJA 3K1HA 2NUTA 2Q7RA 1OXBA 4W8PA 2PBEA 1VK5A 5COMA 1AEPA 2W9YA 3DZAA 5JT4A 3JRTA 1ZHXA 2KW3C 2HSQA 4JCZA 4HE8D 4XEFA 4OINF 3C8ZA 1K05A 4BJTA 3H65A 3RQGA 3WG7C 4C3DA 2OEVA 2GA0A 3IQTA 1BR2A 5GPGB 2OKUA 3T9OA 2J0WA 2OG2A 4O7GA 4AE4B 1YARO 4E7SA 1Z23A 1M57C 2LSEA 2JPUA 2X51A 3ECSA 1A7EA 2HV7A 2UUHA 4JURI 4EWCA 4OIPF 2B0HA 5DLJA 1G4WR 1I4YA 5E2QA 4QI0A 3W4YA 3JCUQ 4MNDA 1D1BA 2L81A 3O39A 1LVKA 1ZW2A 3SXYA 1J8YF 4EBKA 3C8GA 4LERA 2R7TA 1D0XA 1S05A 2ETSA 3AG3C 1JMWA 1S7ZA 1ST6A 3CAXA 2HMQA 4BJ1A 3H2VA 2IXNA 3W2VA 5L0CA 3FMSA 1Z63A 2WVQA 2YL1A 1CGME 1MQVA 1QPUA 1UG7A 2L7AA 2QNLA 4ULVA 4DXWA 4BJ5A 1ORJA 4YK5A 2J9UA 3FAPB 2V26A 4PK4A 2XM0A 3U8VA 5L0FA 3M79A 1W2WA 1G5ZA 2XLEA 3EGDB 2P0NA 2WZGA 4CDAA 4BEMJ 2TMVP 4DBRA 1M56C 1LIHA
chains in the Genus database with same CATH topology
4YJWA 1ZU4A 3S27A 4DVZA 1O87A 1BR4A 1MMGA 3DAFA 2QTVA 1D0YA 4BJ6A 3L0IA 5F5HA 4IRUA 2J45A 3DAGA 4IAOA 5B1AC 2NUPA 3QZCA 4J32B 5L3QA 2ZXWC 1FFHA 3RYLA 3HJCA 3NYLA 4O6NA 3TD7A 3L34A 3NKDA 3S0XA 4AX2A 3ZIBA 3FHDA 4O6MA 3UGOA 5KYYB 3DXJF 1MMDA 5DQTA 4HFFB 3T6JA 3EFOB 2EIMC 3M1CB 4G7HF 1ZHZA 1PCXA 4C7OA 4C3EA 2Q9CA 2W4BA 1JPNA 4I44A 1OCCC 1TWCA 2PFDA 2Y39A 1J8MF 1NU9C 4DOZA 1TR2A 1LS1A 3EZHA 1O5HA 4U5BE 3ZSUA 4U5HA 2J7PA 4ANJA 4J30B 3Q6NA 3RH3A 2H7VC 3PHF2 4JW1A 2E87A 2KNHA 3SP1A 4E7ZA 2J9VA 1RJ9B 1FTSA 2W45A 3IEEA 3AG1C 3VYWA 4CS9C 4JJGA 1D1CA 4PJMA 2A6HF 2R7OA 4OD5A 4CIHA 1FMWA 4YT5A 2H7BA 2Y3DA 2Q9AA 2NG1A 3EZIA 4GYTA 4WJ0A 4YT4A 4FWVA 3T6BA 1QZXA 2XSEA 2ZXOA 4ZLCA 2IXPA 4JZAA 4PFOA 5FCLA 4NY3A 5CI9A 4JCHA 3SEOA 3DM5A 4AK9A 3K1IC 4Q4ZF 1TKNA 4OIRF 4YT8A 5KYXA 2MWQA 4XWJA 2J7PD 2R7RA 3EG9B 3I4UA 5KYWA 2R7VA 4KNVA 2PX3A 3X1OA 4PJLA 3WODF 3RKOF 5L3VA 1JPJA 3EGXA 3K66A 2D5RB 3ASNC 2R7SA 2VB6A 3N24A 4PJNA 4A2NB 4Q5SF 1VYIA 3W2WA 2XXAA 4CS7A 5D92A 3UR3C 3UNGC 2EILC 1PD1A 4YWQA 2CDQA 2Y3GA 2R7XA 4O79A 4YN0B 2IOQA 4K0DA 4AE4A 5KYNA 4CSAC 4OD4A 3FAJA 1M2OA 5B3SC 4RD9A 3ABKC 4XLNF 3NG1A 2P6VA 5B1BC 5DS6A 5DS5A 3POVA 4QI2A 3FVYA 4Q7CA 3HTKC 2DYSC 1LKXA 1V54C 3LS0A 3EJNA 2FGYA 3NDBB 1FMVA 4I1OB 3EGDA 3UGPA 3ZC4A 1ZHYA 4OIOF 3I5QA 2Y69C 4IJJA 3DJUB 2Y3BA 3FDQA 1ZU5A 4CS8A 3GANA 5HSWA 1M2VB 4M63A 4U5GA 4XLPF 2R7UA 4FESA 5KYUA 4BJ5C 4EBBA 3SZRA 3JSZA 1MNEA 3X2QC 5T1DB 3KL4A 2M4EA 3OWTA 1MMNA 1TWGA 4QDLA 4I1MA 1SF8A 4X0RA 3W8IA 5KYYA 1QLEC 3N0TA 2PP4A 2CGEA 2GFHA 2Y3HA 4BJ6C 4GEHA 1D1AA 1BR1A 3SNHA 2WZLA 3EHMA 2EIJC 2P7VA 3EFOA 2J0XA 1VMAA 2A1DD 4MQ9F 2BE5F 2JD3A 1ZHWA 2EIKC 2R7QA 3HLZA 5DS4A 1NZEA 1OKKA 4KBLA 2NUTB 4CBEA 3OA1A 2WZFA 4RBNA 3AG4C 5DQZA 2VH3A 4O6YA 1D0ZA 3V7OA 4U5FE 2G3KA 2C03A 3AQBA 1Z6AA 5E3CA 1FFTC 4DVYP 3ZG1A 3ITFA 5IY5C 3E70C 1RJ9A 1MNDA 3DD7A 3I5PA 1V55C 2YHSA 2KQ9A 4U5DE 2WB7A 2L9JA 2J46A 4LACB 3NRHA 1SZIA 4N06A 3ASOC 1ZHTA 2YZSA 4H4KC 5E3AA 1VOMA 1MMAA 2ZXPA 4LLEA 1NU7D 3MX3A 2WVOA 1OKKD 2Q3TA 5BUOA 2XL4A 3E9VA 3F47A 3JYHA 4RDAA 4XTKA 3QMKA 2IXMA 4U5EE 3B0UX 4B6IA 1ZYRF 1G8XA 3ABLC 3EG9A 3LJBA 4YT2A 2PX0A 2R7WA 5D91A 2KJGA 3NKEA 5CI8A 5T3TA 3CZ6A 3LS1A 4JJFA 3Q6MA 1NG1A 2NUPB 3EH1A 4KNWA 4P6IC 4FX5A 2EINC 3O6XA 2O9XA 3CQZA 2I8BA 1Z3IX 4OIQF 3W8HA 3LLIA 3UMKA 3F46A 2VASA 2Q9BA 2DGJA 3MLGA 3KMIA 3VAYA 2OCCC 4IWBA 3OEOA 3LLKA 4BEJA 1TWHA 3LAYA 2DYRC 3DM9B 4DBQA 4ULWA 4G7ZF 4ZLDA 3Q7LA 2CNWA 3GODA 2W4MA 1IZMA 3RFYA 4HEAJ 3S28A 3NYMA 4C7OB 3DJNB 5KYUB 3UMHA 2V3CC 4CS9A 2MYSA 3B0VC 1WGWA 3N2ZB 2FFHA 3EQLF 3JT1A 5EHHA 4I3MA 3UMIA 2IYLD 5EGYA 2KGOA 4JVSA 2QY9A 4G7OF 2A69F 1KU2A 3T4RA 2Z15A 3ZVRA 3KKBA 3B9QA 3K33A 1SMYF 3EH2A 3EHNA 4U5CE 2G62A 4KI2A 3K7DA 1OCRC 3LEVA 4W8KA 1M2VA 2CNWD 2C04A 2A6EF 4HFKB 4C3BA 4PFPA 4KC9A 4F4BA 2WVNA 3LNRA 2J9WA 2PF4E 5E33A 2B0JA 1IW7F 2ZXRA 1Z5ZA 4K7BA 1N1CA 3SYNA 3Q7GA 5DVWA 2YEVA 3K6BA 5KYXB 1TWAA 4LLCA 4CS8C 1OCZC 2H7OA 5KYWB 2G3VA 2ZPAA 3LESA 5F5FA 3PMRA 3AQCA 3EPVA 2XRHA 1VYKA 3AG2C 3B0PA 3DMDA 1PD0A 4G0HA 2WL8A 3ABMC 3EGXB 4CSAA 2HV6A 2CW0F 3KH2A 1OCOC 4BG0A 2IXOA 3CSKA 2XXAB 2A68F 3S29A 4PJJA 5T3WA 3RIPA 3NYJA 3K1HA 2NUTA 1VK5A 2W9YA 3DZAA 3JRTA 1ZHXA 2KW3C 4HE8D 4OINF 4BJTA 4C3DA 3H65A 3WG7C 1BR2A 2J0WA 2OG2A 4O7GA 4AE4B 4E7SA 1Z23A 1M57C 2LSEA 2X51A 3ECSA 2HV7A 4JURI 4EWCA 4OIPF 5DLJA 5E2QA 4QI0A 3JCUQ 4MNDA 1D1BA 2L81A 3O39A 1LVKA 1J8YF 4LERA 2R7TA 1D0XA 3AG3C 1S7ZA 1ST6A 4BJ1A 2IXNA 3W2VA 1Z63A 2WVQA 4BJ5A 2J9UA 2V26A 4PK4A 1W2WA 3EGDB 2WZGA 4DBRA 1M56C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV6 A;  2IXM A;  2IXP A;  4LAC B;  2IXO A;  4NY3 A;  2HV7 A;  2IXN A;  2G62 A; 
#chains in the Genus database with same CATH topology
 2A0U A;  1R5I D;  4YJW A;  1ZU4 A;  2FAP B;  3S27 A;  2P61 A;  1E85 A;  4DVZ A;  1O87 A;  5K0I A;  1BR4 A;  1MMG A;  4MVS A;  4XPW A;  5BQH A;  1APC A;  2XL8 A;  2QTV A;  3DAF A;  3S84 A;  1D0Y A;  1LI5 A;  1HMO A;  4BJ6 A;  3L0I A;  5F5H A;  1VLT A;  4IRU A;  1KTM A;  4JKV A;  2J45 A;  2LFD A;  4NCQ A;  3DAG A;  4IAO A;  1JOG A;  2NUP A;  3QZC A;  4J32 B;  5B1A C;  5L3Q A;  5JS5 A;  2ZXW C;  3JYY A;  1FFH A;  3VF0 A;  3RYL A;  4DRH B;  2YL3 A;  3HJC A;  3NYL A;  1ZW3 A;  4O6N A;  3TD7 A;  3GEH A;  5L0G A;  3L34 A;  3NKD A;  3S0X A;  3AGU A;  4AX2 A;  3C8G D;  1E83 A;  4PR9 A;  1B68 A;  3ZIB A;  2XLW A;  3FHD A;  3PCV A;  4O6M A;  3U5S A;  3U0C A;  3UGO A;  2M64 A;  3KPH A;  5KYY B;  4XQ1 A;  5JRA A;  3DXJ F;  3IQ5 A;  4MTG A;  1MMD A;  5DQT A;  4WGZ A;  4HFF B;  3SXM A;  4E0I A;  3T6J A;  3EFO B;  1K40 A;  2EIM C;  2L6G A;  3M1C B;  1GGQ A;  1NLX A;  3R2P A;  3IQC A;  1Z7Q c;  4G7H F;  1Y4C A;  1ZHZ A;  1PCX A;  4C7O A;  4C3E A;  2Q9C A;  2YKZ A;  2W4B A;  3KYJ A;  3UGP A;  1JPN A;  4I44 A;  1BZ4 A;  1OCC C;  4BPM A;  3U8P A;  1JAF A;  3C7J A;  1A7V A;  1TWC A;  2PFD A;  4WGY A;  2VC9 A;  2Y39 A;  1J8M F;  1NU9 C;  4WAB A;  1TR2 A;  1LS1 A;  2EPO A;  3EZH A;  4DOZ A;  1O5H A;  4U5B E;  1WN0 A;  3ZQY A;  4N4W A;  1WWP A;  2EPM X;  4DJ9 A;  4YL1 A;  4U5H A;  3ZSU A;  4JTA B;  2J7P A;  1O3U A;  1OW8 A;  4ANJ A;  4J30 B;  3Q6N A;  4IGG A;  2YLD A;  2UUI A;  4P9F A;  3RH3 A;  2H7V C;  3PHF 2;  2MHR A;  4JW1 A;  1NFO A;  2E87 A;  3QVZ A;  2KNH A;  3SP1 A;  1OR2 A;  4E7Z A;  5AGF A;  3C62 A;  1ZZP A;  2J9V A;  2LCH A;  1RJ9 B;  2VCA A;  1UFB A;  1FTS A;  1WOL A;  2OOC A;  2W45 A;  2KSF A;  1ORY A;  3IEE A;  3AG1 C;  5AC4 A;  3VYW A;  4CS9 C;  3A11 A;  3V5X A;  1ZVZ A;  4JJG A;  2OQM A;  1D1C A;  1HY5 A;  2GAQ A;  4MVZ A;  4PJM A;  2A6H F;  1BBH A;  2R7O A;  4OD5 A;  4J7T A;  4CIH A;  1FMW A;  4YT5 A;  2H7B A;  2Y3D A;  1YYJ A;  2GDC A;  1H6G A;  1T9K A;  2Q9A A;  2NG1 A;  3LEO A;  4YL0 A;  3EZI A;  4GYT A;  3AGT A;  4WJ0 A;  4YT4 A;  4FWV A;  2XL6 A;  3GM2 A;  1QZX A;  3T6B A;  2XSE A;  5L0D A;  1ORS C;  2ZXO A;  3MYF A;  4ZLC A;  2IXP A;  4JZA A;  4PFO A;  2NPU A;  5FCL A;  4NY3 A;  2YL7 A;  3QVY A;  4JTC B;  5CI9 A;  3DE9 A;  4JCH A;  3SEO A;  3DM5 A;  4AK9 A;  3K1I C;  4Q4Z F;  1TKN A;  3MYI A;  4OIR F;  4YT8 A;  5KYX A;  2MWQ A;  4XWJ A;  2J7P D;  4MVQ A;  4N6H A;  2R7R A;  3EG9 B;  3IQ6 A;  3I4U A;  2YLI A;  4D4N A;  1YJG A;  4ONS A;  2DB4 A;  2XLM A;  5KYW A;  2R7V A;  1EQ1 A;  1RKE A;  1L7C A;  4KNV A;  1OXK A;  1T6U A;  2PX3 A;  3RF3 A;  3ZTZ A;  3X1O A;  4PJL A;  3WOD F;  3RKO F;  2I15 A;  5L3V A;  2HZ8 A;  1JPJ A;  2PNO A;  3EGX A;  3K66 A;  2D5R B;  3ASN C;  3ZTM A;  2R7S A;  1U0B B;  2VB6 A;  3TOM A;  1T01 A;  1VTM P;  3N24 A;  4PJN A;  4A2N B;  2XLH A;  1EI7 A;  3RVY A;  2XM4 A;  4Q5S F;  1VYI A;  5A6A A;  2OU6 A;  4MW8 A;  3W2W A;  4CS7 A;  2LIG A;  5D92 A;  2XXA A;  4UDV A;  2R05 A;  1HE1 A;  1R4T A;  3UR3 C;  1JRA A;  2EIL C;  3UNG C;  1PD1 A;  1C17 M;  1YVI A;  1DOW A;  1XZP A;  3HNI A;  5JUA A;  4YWQ A;  1E2X A;  5JVE A;  1FR0 A;  2CDQ A;  2Y3G A;  2R7X A;  4O79 A;  3J06 A;  3ATP A;  2RD9 A;  1HW2 A;  3R7C A;  4MW3 A;  5FZT A;  4YN0 B;  4R32 A;  4NQF A;  2IOQ A;  4K0D A;  2BC5 A;  3FOP A;  4AE4 A;  5KYN A;  4CSA C;  4L6R A;  4OD4 A;  1LPE A;  4MTO A;  3JZ0 A;  2GWW A;  3FAJ A;  3DWW A;  4Z9I A;  1T5O A;  1M2O A;  2R25 A;  5B3S C;  2XLV A;  4RD9 A;  5TJ5 E;  4MTF A;  3SXK A;  5AC5 A;  2CCY A;  3ABK C;  1Q0F A;  4XLN F;  3NG1 A;  2P6V A;  5B1B C;  5DS6 A;  5DS5 A;  3POV A;  4QI2 A;  1BDJ B;  4DRI B;  1C02 A;  1PV3 A;  3FVY A;  4Q7C A;  5A69 A;  3HTK C;  2DYS C;  3FXH A;  1LKX A;  3C18 A;  4IAQ A;  1V54 C;  3LS0 A;  2HFI A;  1TQG A;  2J8W A;  3EJN A;  5A6K A;  2FGY A;  1VLS A;  3DI5 A;  1HE9 A;  3NDB B;  1FMV A;  4I1O B;  5JP7 A;  2IM8 A;  3EGD A;  3QW1 A;  3ZC4 A;  1ZHY A;  4H54 A;  1K04 A;  3I5Q A;  4JE9 A;  2Y69 C;  4IJJ A;  3DJU B;  2Y3B A;  3ZWI A;  4OIO F;  1YZA A;  2L6H A;  1RKC A;  3L8J A;  4CDV A;  1ZU5 A;  1QKR A;  2YRF A;  4K1O A;  5T3T A;  4CS8 A;  3FDQ A;  3JRM O;  3GAN A;  5HSW A;  1M2V B;  1WTY A;  1GM5 A;  2QE9 A;  1Q0D A;  4M63 A;  2P1A A;  2LK4 A;  4U5G A;  4E17 A;  4XLP F;  2R7U A;  2KC3 A;  4FES A;  5KYU A;  4BJ5 C;  4E0H A;  2X0C A;  3AJM A;  2J9B A;  4EBB A;  2R9R B;  1V74 B;  3SZR A;  3RVZ A;  3JSZ A;  1MNE A;  3X2Q C;  2NSG A;  5T1D B;  2HJ3 A;  3KL4 A;  4IB4 A;  2HSB A;  1E84 A;  2M4E A;  3MFN A;  3OWT A;  3RQE A;  2A0B A;  1MMN A;  1TWG A;  4QDL A;  5COF A;  4I1M A;  1OW6 A;  1SF8 A;  1TFK B;  2LP4 A;  4U9D A;  4X0R A;  3W8I A;  5KYY A;  1QLE C;  3G50 A;  3N0T A;  2PP4 A;  4Z9J A;  2VCC A;  2CGE A;  1KNY A;  4P9T A;  2YWA A;  1YLM A;  2GFH A;  2EPK X;  2Y3H A;  4GEH A;  3TJ5 A;  1D1A A;  4BJ6 C;  4CSA A;  1BR1 A;  4U9E A;  4JC7 A;  2WZL A;  1WAT A;  3EHM A;  2EIJ C;  1AUE A;  2P7V A;  3SNH A;  3EFO A;  3S9O A;  3SXZ A;  1QSP A;  1NBB A;  5B3I A;  2J0X A;  4Z9H A;  1YA9 A;  1VMA A;  4LDQ A;  1GQA A;  2A1D D;  4MQ9 F;  2BE5 F;  2JD3 A;  1ZHW A;  2AVK A;  2EIK C;  3ZQV A;  2R7Q A;  3HLZ A;  5DS4 A;  4NTF A;  3S90 A;  1NZE A;  1OKK A;  1EA8 A;  3M4B A;  1Q0M A;  3MBG A;  1L3P A;  4KBL A;  2LFF A;  1QVX A;  2NUT B;  4CBE A;  3OA1 A;  3QW0 A;  2WZF A;  4RBN A;  3AG4 C;  1Q0G A;  5DQZ A;  4J7Y A;  1XZQ A;  3V5Y A;  2VH3 A;  4O6Y A;  3FOO A;  1D0Z A;  2AU5 A;  3GEE A;  1LE4 A;  3V7O A;  4U5F E;  4EKW A;  2G3K A;  2C03 A;  3AQB A;  1Z6A A;  5E3C A;  1FFT C;  4PAC A;  2ICW G;  4DVY P;  2NSF A;  3ZG1 A;  2XLD A;  3ITF A;  5IY5 C;  3IHU A;  3E70 C;  1T6I A;  1RJ9 A;  2HMZ A;  2YLG A;  1MND A;  2CYD A;  1A7D A;  3M4C A;  3DD7 A;  1YZC A;  3T6G B;  1H7I A;  3I5P A;  3KYI A;  1V55 C;  2YHS A;  2KQ9 A;  4U5D E;  3C8G B;  5CIV A;  2WB7 A;  2L9J A;  3C63 A;  4E18 A;  2J46 A;  2EPN A;  3L8I A;  4LAC B;  2BL2 A;  3NRH A;  1OR3 A;  3JSE O;  2OEX A;  4MS2 A;  1SZI A;  4N06 A;  5L0H A;  2JX0 A;  3ASO C;  1ZHT A;  2YZS A;  4H4K C;  4A4A A;  5E3A A;  1VOM A;  4G78 A;  1CGN A;  3JTL O;  2F22 A;  1MMA A;  2ZXP A;  4LLE A;  1NU7 D;  3MX3 A;  2WVO A;  1OKK D;  3AOU A;  4JTD B;  4EUK B;  2Q3T A;  3QTH A;  5BUO A;  2LQG A;  2XL4 A;  2XLO A;  3E9V A;  3TK0 A;  1CGO A;  3F47 A;  1RMV A;  1I5N A;  3JYH A;  3TQO A;  3WHN A;  4N6C A;  4RDA A;  3IPM O;  4XTK A;  1GS9 A;  3QMK A;  4EHP A;  1V4A A;  5JLI A;  2IXM A;  3HNK A;  1WAS A;  2DI3 A;  4U5E E;  1ZYR F;  1G8X A;  4B6I A;  4CDY A;  3ABL C;  1TFO B;  3B0U X;  3L1M A;  3EG9 A;  2HS5 A;  2RSE B;  1HMD A;  3G4Z A;  3LJB A;  4D4X A;  2PX0 A;  4YT2 A;  5D91 A;  2R7W A;  4GQH A;  2YL0 A;  2KJG A;  2YQY A;  3HKK A;  1H9G A;  3CZ6 A;  3LS1 A;  3NKE A;  3Q6M A;  4JJF A;  1NG1 A;  2NUP B;  3EH1 A;  4KNW A;  3B29 A;  1OQC A;  4FX5 A;  2EIN C;  1M6T A;  2H8A A;  3O6X A;  4P6I C;  2O9X A;  3CQZ A;  4NTB A;  2I8B A;  1Z3I X;  4JEA A;  4AL1 A;  2OJE D;  4CJO A;  4MVM A;  3W8H A;  4OIQ F;  3GWL A;  3LLI A;  3UMK A;  3F46 A;  2VAS A;  4JIO A;  2Q9B A;  4CX9 A;  2DGJ A;  4EBJ A;  5COG A;  3V5Z A;  3MLG A;  3WAQ A;  5A6B A;  3KMI A;  3VAY A;  2D4U A;  3NMJ A;  1VB5 A;  2OCC C;  2AP3 A;  2HKV A;  3GWN A;  3OEO A;  3LLK A;  4IWB A;  5CI8 A;  4BEJ A;  1H9T A;  1TWH A;  3U3B A;  1CPR A;  3LAY A;  3U2L A;  2DYR C;  3DM9 B;  4DBQ A;  2IBF A;  4ULW A;  2Q4F A;  4G7Z F;  4JRZ A;  3RQF A;  1LE2 A;  3BRJ A;  4XPX A;  4ZLD A;  4NC3 A;  1YAU O;  3Q7L A;  2CNW A;  3GOD A;  2W4M A;  1IZM A;  4IAR A;  5L0J A;  3RFY A;  4ER9 A;  4HEA J;  3S28 A;  3NYM A;  4CIP A;  2R03 A;  1HW1 A;  3PDM P;  4C7O B;  4XPY A;  4LDR A;  1YA7 O;  3DJN B;  4CJG A;  3LUT B;  5KYU B;  3UMH A;  2V3C C;  4CS9 A;  1I4Z A;  4MVO A;  2XS8 A;  2MYS A;  3B0V C;  1WGW A;  3LNM B;  3N2Z B;  4XEK A;  1C03 A;  1AVO B;  2FFH A;  1F1M A;  1T6Q A;  1QQ3 A;  4MVU A;  3TOL A;  1OW7 A;  2XS1 A;  3EQL F;  3JT1 A;  3O10 A;  3VM6 A;  5EHH A;  1Y6D A;  3DE8 A;  4I3M A;  1CPQ A;  1NFN A;  1LM3 B;  2IYL D;  4YL3 A;  3UMI A;  1SYQ A;  3HNJ A;  2YVK A;  3NMK A;  2ZD9 A;  5EGY A;  1DOV A;  4DRJ B;  2KGO A;  4JVS A;  2QY9 A;  4G7O F;  2A69 F;  1KU2 A;  3T4R A;  2Z15 A;  5F28 E;  1RXQ A;  3ZVR A;  3KKB A;  3M15 A;  5A6B D;  3B9Q A;  2VCB A;  3K33 A;  1SMY F;  3TJ6 A;  5A6J A;  3EH2 A;  3EHN A;  3K1I A;  4U5C E;  2G62 A;  3NMI A;  1FAP B;  5BQG A;  4KI2 A;  3O55 A;  2HUJ A;  3K7D A;  1OCR C;  3U9M A;  1EKY A;  2EPL X;  3GM1 A;  3LEV A;  3U2M A;  3GOR A;  3A9C A;  3DKA A;  1SR2 A;  4W8K A;  1M2V A;  1XWJ A;  2CNW D;  2C04 A;  2A6E F;  3VRC A;  2HJM A;  2L6F A;  4HFK B;  4PFP A;  4C3B A;  1A0B A;  4KC9 A;  2QLA A;  4F4B A;  2WVN A;  3U3F A;  3LNR A;  2J9W A;  2PF4 E;  3HNL A;  2B0J A;  5E33 A;  1IW7 F;  2ZXR A;  1Z5Z A;  1U6H A;  3BEH A;  3U9J A;  3H2U A;  4K7B A;  4MVR A;  1N1C A;  3SYN A;  3Q7G A;  5DVW A;  3ZDL A;  4EIY A;  1JR8 A;  2LD6 A;  3GM3 A;  4FAP B;  2YEV A;  3K6B A;  5KYX B;  5L0I A;  4AL0 A;  1TWA A;  1RCP A;  4LLC A;  4CS8 C;  1FNT c;  1OCZ C;  2H7O A;  5KYW B;  2G3V A;  4LDK A;  1RKE B;  2ZPA A;  1YDI A;  3LES A;  1G4U S;  5F5F A;  2ASR A;  2KYH A;  3B71 A;  3PMR A;  3AQC A;  3EPV A;  2XRH A;  4NTA A;  4XEV A;  1VYK A;  3RW0 A;  3US6 A;  3AG2 C;  3B0P A;  3GEI A;  3DMD A;  5JSL A;  1NSG B;  1PD0 A;  2QUP A;  4G0H A;  2WL8 A;  3TUL A;  256B A;  3ABM C;  3EGX B;  3CEX A;  2HV6 A;  2OJQ A;  2Q00 A;  2CW0 F;  1A41 A;  1YYX A;  2AWY A;  4JEB A;  5HV9 A;  3KH2 A;  5EK0 A;  1LI7 A;  1U89 A;  1Q0K A;  1OCO C;  2AWC A;  2KK1 A;  3G4X A;  2IXO A;  4BG0 A;  2R02 A;  3CSK A;  1E86 A;  2XXA B;  2A68 F;  3S29 A;  4PJJ A;  5BQI A;  5T3W A;  1LS4 A;  3RIP A;  3NYJ A;  3K1H A;  2NUT A;  2Q7R A;  1OXB A;  4W8P A;  2PBE A;  1VK5 A;  5COM A;  1AEP A;  2W9Y A;  3DZA A;  5JT4 A;  3JRT A;  1ZHX A;  2KW3 C;  2HSQ A;  4JCZ A;  4HE8 D;  4XEF A;  4OIN F;  3C8Z A;  1K05 A;  4BJT A;  3H65 A;  3RQG A;  3WG7 C;  4C3D A;  2OEV A;  2GA0 A;  3IQT A;  1BR2 A;  5GPG B;  2OKU A;  3T9O A;  2J0W A;  2OG2 A;  4O7G A;  4AE4 B;  1YAR O;  4E7S A;  1Z23 A;  1M57 C;  2LSE A;  2JPU A;  2X51 A;  3ECS A;  1A7E A;  2HV7 A;  2UUH A;  4JUR I;  4EWC A;  4OIP F;  2B0H A;  5DLJ A;  1G4W R;  1I4Y A;  5E2Q A;  4QI0 A;  3W4Y A;  3JCU Q;  4MND A;  1D1B A;  2L81 A;  3O39 A;  1LVK A;  1ZW2 A;  3SXY A;  1J8Y F;  4EBK A;  3C8G A;  4LER A;  2R7T A;  1D0X A;  1S05 A;  2ETS A;  3AG3 C;  1JMW A;  1S7Z A;  1ST6 A;  3CAX A;  2HMQ A;  4BJ1 A;  3H2V A;  2IXN A;  3W2V A;  5L0C A;  3FMS A;  1Z63 A;  2WVQ A;  2YL1 A;  1CGM E;  1MQV A;  1QPU A;  1UG7 A;  2L7A A;  2QNL A;  4ULV A;  4DXW A;  4BJ5 A;  1ORJ A;  4YK5 A;  2J9U A;  3FAP B;  2V26 A;  4PK4 A;  2XM0 A;  3U8V A;  5L0F A;  3M79 A;  1W2W A;  1G5Z A;  2XLE A;  3EGD B;  2P0N A;  2WZG A;  4CDA A;  4BEM J;  2TMV P;  4DBR A;  1M56 C;  1LIH A; 
#chains in the Genus database with same CATH homology
 4YJW A;  1ZU4 A;  3S27 A;  4DVZ A;  1O87 A;  1BR4 A;  1MMG A;  3DAF A;  2QTV A;  1D0Y A;  4BJ6 A;  3L0I A;  5F5H A;  4IRU A;  2J45 A;  3DAG A;  4IAO A;  5B1A C;  2NUP A;  3QZC A;  4J32 B;  5L3Q A;  2ZXW C;  1FFH A;  3RYL A;  3HJC A;  3NYL A;  4O6N A;  3TD7 A;  3L34 A;  3NKD A;  3S0X A;  4AX2 A;  3ZIB A;  3FHD A;  4O6M A;  3UGO A;  5KYY B;  3DXJ F;  1MMD A;  5DQT A;  4HFF B;  3T6J A;  3EFO B;  2EIM C;  3M1C B;  4G7H F;  1ZHZ A;  1PCX A;  4C7O A;  4C3E A;  2Q9C A;  2W4B A;  1JPN A;  4I44 A;  1OCC C;  1TWC A;  2PFD A;  2Y39 A;  1J8M F;  1NU9 C;  4DOZ A;  1TR2 A;  1LS1 A;  3EZH A;  1O5H A;  4U5B E;  3ZSU A;  4U5H A;  2J7P A;  4ANJ A;  4J30 B;  3Q6N A;  3RH3 A;  2H7V C;  3PHF 2;  4JW1 A;  2E87 A;  2KNH A;  3SP1 A;  4E7Z A;  2J9V A;  1RJ9 B;  1FTS A;  2W45 A;  3IEE A;  3AG1 C;  3VYW A;  4CS9 C;  4JJG A;  1D1C A;  4PJM A;  2A6H F;  2R7O A;  4OD5 A;  4CIH A;  1FMW A;  4YT5 A;  2H7B A;  2Y3D A;  2Q9A A;  2NG1 A;  3EZI A;  4GYT A;  4WJ0 A;  4YT4 A;  4FWV A;  3T6B A;  1QZX A;  2XSE A;  2ZXO A;  4ZLC A;  2IXP A;  4JZA A;  4PFO A;  5FCL A;  4NY3 A;  5CI9 A;  4JCH A;  3SEO A;  3DM5 A;  4AK9 A;  3K1I C;  4Q4Z F;  1TKN A;  4OIR F;  4YT8 A;  5KYX A;  2MWQ A;  4XWJ A;  2J7P D;  2R7R A;  3EG9 B;  3I4U A;  5KYW A;  2R7V A;  4KNV A;  2PX3 A;  3X1O A;  4PJL A;  3WOD F;  3RKO F;  5L3V A;  1JPJ A;  3EGX A;  3K66 A;  2D5R B;  3ASN C;  2R7S A;  2VB6 A;  3N24 A;  4PJN A;  4A2N B;  4Q5S F;  1VYI A;  3W2W A;  2XXA A;  4CS7 A;  5D92 A;  3UR3 C;  3UNG C;  2EIL C;  1PD1 A;  4YWQ A;  2CDQ A;  2Y3G A;  2R7X A;  4O79 A;  4YN0 B;  2IOQ A;  4K0D A;  4AE4 A;  5KYN A;  4CSA C;  4OD4 A;  3FAJ A;  1M2O A;  5B3S C;  4RD9 A;  3ABK C;  4XLN F;  3NG1 A;  2P6V A;  5B1B C;  5DS6 A;  5DS5 A;  3POV A;  4QI2 A;  3FVY A;  4Q7C A;  3HTK C;  2DYS C;  1LKX A;  1V54 C;  3LS0 A;  3EJN A;  2FGY A;  3NDB B;  1FMV A;  4I1O B;  3EGD A;  3UGP A;  3ZC4 A;  1ZHY A;  4OIO F;  3I5Q A;  2Y69 C;  4IJJ A;  3DJU B;  2Y3B A;  3FDQ A;  1ZU5 A;  4CS8 A;  3GAN A;  5HSW A;  1M2V B;  4M63 A;  4U5G A;  4XLP F;  2R7U A;  4FES A;  5KYU A;  4BJ5 C;  4EBB A;  3SZR A;  3JSZ A;  1MNE A;  3X2Q C;  5T1D B;  3KL4 A;  2M4E A;  3OWT A;  1MMN A;  1TWG A;  4QDL A;  4I1M A;  1SF8 A;  4X0R A;  3W8I A;  5KYY A;  1QLE C;  3N0T A;  2PP4 A;  2CGE A;  2GFH A;  2Y3H A;  4BJ6 C;  4GEH A;  1D1A A;  1BR1 A;  3SNH A;  2WZL A;  3EHM A;  2EIJ C;  2P7V A;  3EFO A;  2J0X A;  1VMA A;  2A1D D;  4MQ9 F;  2BE5 F;  2JD3 A;  1ZHW A;  2EIK C;  2R7Q A;  3HLZ A;  5DS4 A;  1NZE A;  1OKK A;  4KBL A;  2NUT B;  4CBE A;  3OA1 A;  2WZF A;  4RBN A;  3AG4 C;  5DQZ A;  2VH3 A;  4O6Y A;  1D0Z A;  3V7O A;  4U5F E;  2G3K A;  2C03 A;  3AQB A;  1Z6A A;  5E3C A;  1FFT C;  4DVY P;  3ZG1 A;  3ITF A;  5IY5 C;  3E70 C;  1RJ9 A;  1MND A;  3DD7 A;  3I5P A;  1V55 C;  2YHS A;  2KQ9 A;  4U5D E;  2WB7 A;  2L9J A;  2J46 A;  4LAC B;  3NRH A;  1SZI A;  4N06 A;  3ASO C;  1ZHT A;  2YZS A;  4H4K C;  5E3A A;  1VOM A;  1MMA A;  2ZXP A;  4LLE A;  1NU7 D;  3MX3 A;  2WVO A;  1OKK D;  2Q3T A;  5BUO A;  2XL4 A;  3E9V A;  3F47 A;  3JYH A;  4RDA A;  4XTK A;  3QMK A;  2IXM A;  4U5E E;  3B0U X;  4B6I A;  1ZYR F;  1G8X A;  3ABL C;  3EG9 A;  3LJB A;  4YT2 A;  2PX0 A;  2R7W A;  5D91 A;  2KJG A;  3NKE A;  5CI8 A;  5T3T A;  3CZ6 A;  3LS1 A;  4JJF A;  3Q6M A;  1NG1 A;  2NUP B;  3EH1 A;  4KNW A;  4P6I C;  4FX5 A;  2EIN C;  3O6X A;  2O9X A;  3CQZ A;  2I8B A;  1Z3I X;  4OIQ F;  3W8H A;  3LLI A;  3UMK A;  3F46 A;  2VAS A;  2Q9B A;  2DGJ A;  3MLG A;  3KMI A;  3VAY A;  2OCC C;  4IWB A;  3OEO A;  3LLK A;  4BEJ A;  1TWH A;  3LAY A;  2DYR C;  3DM9 B;  4DBQ A;  4ULW A;  4G7Z F;  4ZLD A;  3Q7L A;  2CNW A;  3GOD A;  2W4M A;  1IZM A;  3RFY A;  4HEA J;  3S28 A;  3NYM A;  4C7O B;  3DJN B;  5KYU B;  3UMH A;  2V3C C;  4CS9 A;  2MYS A;  3B0V C;  1WGW A;  3N2Z B;  2FFH A;  3EQL F;  3JT1 A;  5EHH A;  4I3M A;  3UMI A;  2IYL D;  5EGY A;  2KGO A;  4JVS A;  2QY9 A;  4G7O F;  2A69 F;  1KU2 A;  3T4R A;  2Z15 A;  3ZVR A;  3KKB A;  3B9Q A;  3K33 A;  1SMY F;  3EH2 A;  3EHN A;  4U5C E;  2G62 A;  4KI2 A;  3K7D A;  1OCR C;  3LEV A;  4W8K A;  1M2V A;  2CNW D;  2C04 A;  2A6E F;  4HFK B;  4C3B A;  4PFP A;  4KC9 A;  4F4B A;  2WVN A;  3LNR A;  2J9W A;  2PF4 E;  5E33 A;  2B0J A;  1IW7 F;  2ZXR A;  1Z5Z A;  4K7B A;  1N1C A;  3SYN A;  3Q7G A;  5DVW A;  2YEV A;  3K6B A;  5KYX B;  1TWA A;  4LLC A;  4CS8 C;  1OCZ C;  2H7O A;  5KYW B;  2G3V A;  2ZPA A;  3LES A;  5F5F A;  3PMR A;  3AQC A;  3EPV A;  2XRH A;  1VYK A;  3AG2 C;  3B0P A;  3DMD A;  1PD0 A;  4G0H A;  2WL8 A;  3ABM C;  3EGX B;  4CSA A;  2HV6 A;  2CW0 F;  3KH2 A;  1OCO C;  4BG0 A;  2IXO A;  3CSK A;  2XXA B;  2A68 F;  3S29 A;  4PJJ A;  5T3W A;  3RIP A;  3NYJ A;  3K1H A;  2NUT A;  1VK5 A;  2W9Y A;  3DZA A;  3JRT A;  1ZHX A;  2KW3 C;  4HE8 D;  4OIN F;  4BJT A;  4C3D A;  3H65 A;  3WG7 C;  1BR2 A;  2J0W A;  2OG2 A;  4O7G A;  4AE4 B;  4E7S A;  1Z23 A;  1M57 C;  2LSE A;  2X51 A;  3ECS A;  2HV7 A;  4JUR I;  4EWC A;  4OIP F;  5DLJ A;  5E2Q A;  4QI0 A;  3JCU Q;  4MND A;  1D1B A;  2L81 A;  3O39 A;  1LVK A;  1J8Y F;  4LER A;  2R7T A;  1D0X A;  3AG3 C;  1S7Z A;  1ST6 A;  4BJ1 A;  2IXN A;  3W2V A;  1Z63 A;  2WVQ A;  4BJ5 A;  2J9U A;  2V26 A;  4PK4 A;  1W2W A;  3EGD B;  2WZG A;  4DBR A;  1M56 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...