4CJOA

Spectroscopically-validated structure of ferrous cytochrome c prime from alcaligenes xylosoxidans, reduced at 180k using x-rays
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 48
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cjoA00
2XM0A 3HNIA 3QW1A 3M15A 4L6RA 4D4XA 2XL6A 4NC3A 1YYXA 4CDYA 1GQAA 2XLDA 3IQ5A 3C62A 5JUAA 4IB4A 5JSLA 2YL7A 3M79A 2YKZA 3TOLA 4N4WA 3DE8A 5JLIA 3NMJA 4JEAA 1LM3B 1S05A 4WGYA 3HNLA 1APCA 1BBHA 3C63A 2J9BA 1E84A 2XLWA 1CGOA 3U8PA 1JAFA 3ZQYA 2XLMA 3ZQVA 3DE9A 2J8WA 4CDVA 3M4CA 3ZTMA 3QVYA 2CCYA 2XLHA 4WGZA 1YYJA 1QPUA 4JKVA 2YLIA 3L1MA 3FOOA 3NMIA 3HNJA 4ULVA 1MQVA 1M6TA 2YLGA 2QLAA 1CPRA 4N6HA 5JRAA 1YZCA 4CJOA 2XM4A 256BA 1NBBA 2YL1A 3ZWIA 3NMKA 1CPQA 1E85A 3VRCA 4U9EA 5AGFA 2XLVA 2XLOA 3HNKA 2YLDA 3M4BA 1A7VA 1E86A 1QQ3A 3ZTZA 3FOPA 4JE9A 4CDAA 5JS5A 1E83A 4CIPA 4D4NA 4ER9A 3TOMA 3QVZA 4CJGA 5B3IA 5JT4A 5JP7A 1EKYA 2YL0A 1RCPA 2BC5A 2XLEA 4CX9A 4IARA 3QW0A 5JVEA 2YL3A 4JEBA 1YZAA 2XL8A 4U9DA 1CGNA 4EIYA 4IAQA 3IQ6A
chains in the Genus database with same CATH superfamily
2OEXA 2VH3A 4P9TA 3K6BA 1XZPA 2PNOA 2XM0A 4MW8A 3QW1A 1T6QA 4YL1A 1M2OA 3CQZA 4HE8D 4FAPB 1Q0KA 3EZHA 4BJ6A 4CS9A 4D4XA 4HFFB 2YHSA 5FCLA 1D0YA 1I4ZA 2P61A 4X0RA 4CSAA 1K05A 2YRFA 1GQAA 4JCHA 1F1MA 1MMDA 3IQ5A 3Q7GA 1Z23A 1JMWA 2OKUA 3M1CB 4LERA 4EHPA 3JT1A 1BR4A 3MX3A 1FAPB 5JUAA 2L7AA 3G4ZA 1VYIA 2HFIA 4XTKA 1WASA 4FESA 5JSLA 3T6GB 4DBQA 4WJ0A 5L0GA 2JD3A 1RKEB 2XXAA 1D1AA 1NSGB 1RJ9A 3HLZA 4ZLDA 1WATA 2IXNA 2Q4FA 5DQTA 1ZHYA 3TD7A 1OW7A 3JCUQ 3JSZA 1QKRA 5JLIA 3ZG1A 4EKWA 3KYJA 2R7SA 3ABMC 4KNVA 2LFDA 2EPLX 3K7DA 3EZIA 3HNLA 3Q7LA 1LI5A 3HKKA 1G8XA 4OD5A 4DOZA 2NSFA 3C8GA 3LLIA 2A6HF 4QI0A 3GEIA 4Q4ZF 1N1CA 1V74B 3U8PA 1JAFA 2Q00A 1CGME 3JSEO 2H8AA 1L7CA 3CEXA 3M4CA 3F47A 2IYLD 2OEVA 3I5QA 4OIRF 3O55A 1JPNA 1MMNA 1YJGA 2YWAA 3MFNA 1ZHXA 4R32A 4E7ZA 1NG1A 5KYXB 3POVA 3GORA 1B68A 4I1OB 3L1MA 3ASNC 3DWWA 3FOOA 4EBKA 3WG7C 1NLXA 2LFFA 4GYTA 5E33A 2UUHA 1M6TA 2P6VA 2J0XA 2YLGA 2ZXOA 3Q6MA 1CPRA 5L0JA 2EPMX 5T1DB 1LE4A 3SXMA 3SP1A 2M64A 2GFHA 3IQTA 3S90A 3DM5A 3W2WA 2A0BA 256BA 3A9CA 3E70C 1VYKA 3ZWIA 3LS0A 4G78A 1VK5A 3K33A 4JTDB 3U8VA 1FNTc 1OCCC 1OXBA 1E85A 2NSGA 3VRCA 4U9EA 4EUKB 2PBEA 2R05A 3S0XA 2XLVA 4JRZA 1NFOA 4BG0A 3U0CA 2A1DD 2YLDA 2A0UA 4J32B 3TK0A 4JJFA 1A7VA 4AL0A 2QUPA 1E86A 2LD6A 5CI8A 3Q6NA 2C03A 1AVOB 3K66A 5F28E 2FAPB 4FWVA 4JURI 2WB7A 3GM3A 2D4UA 4W8PA 3O6XA 1J8MF 1YARO 2J7PA 2LSEA 3TOMA 4PFPA 1ZYRF 2IOQA 4XLNF 4PJLA 3WHNA 5B3IA 5JT4A 5KYWA 1EKYA 5A69A 4XEFA 5D92A 4CX9A 2HZ8A 3C8GD 1SMYF 1QLEC 4F4BA 1MMAA 3EGDA 3G4XA 4GQHA 5KYUA 1TWGA 4DRJB 5L0CA 2YL3A 1YZAA 4PJNA 1KNYA 3EQLF 3SYNA 3QTHA 4MVUA 4EIYA 2XXAB 3EJNA 4K1OA 1RJ9B 2J45A 1Q0MA 4LDRA 3WAQA 4G7HF 1PCXA 1FR0A 3UMKA 4E18A 2EIMC 5BUOA 3RVZA 1C02A 3X2QC 3HNIA 2E87A 4XPWA 5KYNA 3M15A 1TWHA 4L6RA 4YL3A 5DVWA 3GM2A 4MTFA 4KBLA 3AGTA 2ZD9A 1BZ4A 2XL6A 1PD0A 3U3FA 1OQCA 4PJJA 1NZEA 1YYXA 4Q7CA 1D0ZA 3B0UX 1SF8A 2P1AA 2YZSA 4LDQA 3EH2A 3C8GB 3C62A 3MYFA 4O6NA 3T6BA 4U5DE 3DKAA 5AC4A 1L3PA 4BJ5C 2W45A 4FX5A 1WTYA 2YL7A 2YVKA 3M79A 2YKZA 1H9GA 1HW1A 2PF4E 1LPEA 1ZHTA 4JW1A 3TOLA 5DS5A 3KH2A 3L8JA 3DE8A 3TULA 3BRJA 2VCAA 3WODF 2DI3A 4UDVA 4LLCA 2AWCA 4YT5A 1HMDA 2OJED 1LM3B 1S05A 2X51A 2X0CA 3C63A 3UGOA 1O87A 3AJMA 2KGOA 2WZLA 3OA1A 4MVSA 4BJ5A 1OR2A 4LLEA 3R7CA 1AUEA 2EPOA 4MTGA 4PACA 5BQGA 2PX3A 2W4BA 3RIPA 4ONSA 1LKXA 1TWAA 2KNHA 3DI5A 3NYMA 2NUTA 4YJWA 5L0DA 3VM6A 2F22A 2J8WA 2HSBA 3ZTMA 3DXJF 1T5OA 3G50A 2R02A 3QVYA 2CCYA 2DYRC 2XLHA 5CI9A 1TR2A 2I15A 4XEVA 2XS8A 2H7BA 2EINC 1RKCA 5CIVA 1YYJA 3O10A 2PP4A 5A6AA 1FMVA 1OXKA 2KW3C 3U9MA 4I44A 1YA7O 3U2LA 4IAOA 1R5ID 3ABLC 4BEMJ 1A0BA 1M2VA 2O9XA 4DVZA 4OIOF 2QLAA 1K04A 4N6HA 4DXWA 5COFA 1YZCA 1DOWA 5EGYA 5B1AC 5L3VA 4G7ZF 3LEOA 3NYLA 5T3TA 1BR1A 2WL8A 1NBBA 2YL1A 1FFTC 2Q7RA 1FTSA 3KPHA 1U6HA 2IXPA 1SYQA 3JRMO 4A2NB 4CIHA 2IXOA 5EHHA 5KYWB 4RBNA 1G4WR 2R9RB 1NFNA 3KYIA 5IY5C 3MLGA 1Z63A 2HJ3A 2R7UA 2AU5A 2G3KA 4NY3A 5L3QA 2R7VA 4MW3A 2PFDA 3HNKA 4P9FA 3EGDB 2CNWA 5KYUB 3RQGA 4CS8C 1VTMP 4OD4A 3M4BA 3JRTA 4KNWA 3UMIA 2R7WA 1U89A 5TJ5E 1YVIA 2BL2A 3GWNA 4CDAA 1OCRC 1T9KA 2FFHA 2M4EA 2QTVA 3ZDLA 1JPJA 1QZXA 2A68F 2CGEA 3B29A 2PX0A 3C8ZA 1OW8A 3H2VA 3JTLO 3SXKA 3QMKA 4DRHB 2V3CC 1GS9A 4RDAA 4KI2A 1VMAA 1QVXA 2Q9BA 2Q9CA 2GA0A 2DYSC 4I3MA 3QZCA 2NPUA 2OCCC 3JYHA 3PMRA 4K0DA 1PD1A 1H7IA 2L81A 1RMVA 1U0BB 3IQCA 4CS8A 5JP7A 1OW6A 4N06A 2YL0A 1RCPA 2XLEA 3FXHA 3PDMP 2JX0A 3EH1A 3UR3C 2YEVA 5K0IA 1ZW2A 2WZFA 3LS1A 2HUJA 2NUPA 3DZAA 4MVQA 4J7TA 3US6A 5DLJA 4U9DA 5D91A 1SZIA 2KK1A 4JVSA 3LEVA 4DJ9A 2KYHA 1W2WA 2DB4A 3CAXA 4JJGA 1HW2A 3IQ6A 4CJGA 4E0HA 5DQZA 3DJUB 3EFOA 3LNRA 3S29A 2ASRA 1HE1A 2L6HA 3DD7A 3DM9B 4AL1A 2J46A 1ZW3A 4MQ9F 3RH3A 4Q5SF 4MVZA 4XLPF 1Q0FA 4J7YA 1IZMA 4O7GA 3H65A 1LI7A 3JYYA 4PR9A 3KL4A 4RD9A 4NC3A 3EHMA 3I4UA 4PFOA 3SXYA 4CDYA 2XLDA 4DVYP 4OIQF 4YN0B 2ZXWC 1PV3A 1LS1A 4JZAA 3ZIBA 3CZ6A 2J0WA 1LS4A 2Y3GA 5HSWA 4IB4A 1QSPA 1T6IA 2EIKC 2NUTB 1HY5A 1WWPA 4CS7A 2LIGA 3OWTA 3LJBA 2XL4A 4U5FE 1MMGA 2LK4A 1JRAA 3O39A 4N6CA 4E7SA 2Y3DA 4C7OA 1ORSC 1YDIA 5A6JA 2ZPAA 2QNLA 1MNEA 3AG2C 3FAJA 4NCQA 4OIPF 3J06A 2VC9A 2IM8A 2WVOA 5E2QA 4E0IA 1WN0A 2KC3A 2DGJA 4JEAA 2YQYA 1M57C 2R7OA 4IGGA 3SXZA 3RVYA 1APCA 1D0XA 2VCCA 4H4KC 1E84A 2KJGA 1CGOA 1JR8A 1M2VB 1IW7F 1OKKA 2AP3A 2EIJC 1V4AA 3ITFA 3B9QA 1ZHZA 1TFOB 1TQGA 3A11A 3MYIA 4LDKA 4U5HA 2XLMA 3ATPA 3I5PA 3TJ5A 4EWCA 3RKOF 3DE9A 4YK5A 1A7DA 1UFBA 4W8KA 1GM5A 1KU2A 5GPGB 2P7VA 1ZU5A 3DMDA 4G0HA 3UNGC 4XQ1A 3JZ0A 4JIOA 2B0JA 5A6KA 2EPKX 4PJMA 4WGZA 3X1OA 3W8IA 2A69F 1ZZPA 2CDQA 4GEHA 3RQEA 1D1BA 1TKNA 2WZGA 4NTAA 3L8IA 4Z9JA 2RSEB 2Y69C 1S7ZA 3V5XA 2VASA 4E17A 1Z7Qc 2J9WA 4YT8A 1LVKA 4JC7A 4QDLA 3EG9A 4PK4A 3RF3A 3T6JA 4O6YA 3V5ZA 5JRAA 4QI2A 4B6IA 4M63A 4CJOA 3S9OA 5A6BA 1XWJA 2WVNA 4A4AA 3ASOC 4K7BA 2HMQA 4CBEA 2AVKA 2WVQA 1C03A 1Q0DA 4AE4A 3B0PA 2D5RB 3W4YA 2R7TA 3GANA 1J8YF 3AQBA 3U3BA 3NKDA 1CPQA 1TFKB 4HFKB 5AGFA 3ABKC 1FFHA 2J7PD 2Q9AA 1D1CA 4MTOA 3UGPA 2XLOA 3LNMB 1ZU4A 2B0HA 3RFYA 2KQ9A 2NUPB 3ZC4A 1Z3IX 5E3CA 4MS2A 1K40A 1YAUO 2G62A 2ICWG 1LE2A 2C04A 4JE9A 2MYSA 2HSQA 2AWYA 5JS5A 3EFOB 4J30B 2LP4A 2W9YA 1E83A 4ANJA 2OQMA 2FGYA 3LUTB 2MWQA 2XRHA 3W8HA 4WABA 1E2XA 2TMVP 4ER9A 2Y39A 4C3EA 3TQOA 3FAPB 4LACB 1KTMA 1OKKD 2R03A 4H54A 3AG4C 4KC9A 3E9VA 2OU6A 1V54C 1Z5ZA 3U5SA 1ZVZA 4XPXA 1R4TA 4BPMA 2XL8A 4G7OF 3AG3C 1OCOC 4IAQA 3H2UA 4C7OB 3NDBB 5B1BC 1G5ZA 2EPNA 2JPUA 2UUIA 2IBFA 1T6UA 5COGA 3U9JA 3RQFA 3EHNA 1GGQA 1ZHWA 4EBJA 3KKBA 2GWWA 1NU9C 1OR3A 2L6GA 3VYWA 3L34A 3LLKA 2A6EF 1C17M 3K1HA 3S27A 1I4YA 1EA8A 4C3BA 1VLTA 4C3DA 3V7OA 2Y3BA 1WOLA 2GAQA 2RD9A 5FZTA 2Y3HA 3EGXA 1MNDA 2HJMA 4IJJA 3CSKA 4MVMA 1OCZC 4U5CE 3L0IA 1HMOA 2L6FA 4Z9IA 5A6BD 5KYYA 1LIHA 4OINF 4U5GA 4YT4A 2OG2A 4N4WA 2HS5A 2H7OA 5COMA 3T4RA 1O3UA 2HMZA 1Z6AA 5F5FA 3PHF2 3VAYA 5T3WA 4YWQA 2L9JA 4IRUA 4XWJA 5BQHA 1EI7A 3C7JA 1JOGA 3NMJA 2ETSA 4WGYA 3K1IC 3MBGA 4JCZA 1BBHA 2J9VA 3TJ6A 2HKVA 2J9UA 2J9BA 3AQCA 2XLWA 3GEEA 2KSFA 4MVOA 4MNDA 1A41A 4HEAJ 3EG9B 2HV6A 3GODA 4ULWA 2IXMA 4DBRA 3HTKC 2ZXRA 2Z15A 3ZQYA 3DJNB 2P0NA 3LAYA 4EBBA 3R2PA 3ZQVA 4CDVA 1AEPA 2VCBA 1RKEA 4XPYA 4AE4B 3SEOA 1BR2A 3AOUA 5DS4A 1I5NA 3NG1A 1VB5A 3K1IA 3N2ZB 4Z9HA 2LQGA 1EQ1A 3HJCA 4AX2A 1QPUA 4JKVA 2YLIA 3UMHA 3V5YA 3IEEA 4U5EE 1NU7D 5EK0A 4BEJA 4DRIB 5DS6A 1V55C 3NMIA 3HNJA 4ULVA 4XEKA 3RW0A 1O5HA 2OOCA 2R25A 2VB6A 4YT2A 2LCHA 1Y4CA 1MQVA 2CNWD 2MHRA 3NKEA 2CYDA 1RXQA 1ST6A 2NG1A 3NYJA 4U5BE 4AK9A 3ECSA 5L0HA 5L0IA 4JTAB 3S84A 3LESA 1G4US 3GM1A 3IPMO 3FHDA 5AC5A 4NTBA 3U2MA 3BEHA 5L0FA 1H9TA 1DOVA 2XM4A 4O79A 3S28A 4JTCB 1YA9A 3OEOA 3DAFA 4YL0A 3NMKA 1Q0GA 1FMWA 2QE9A 5KYXA 3GEHA 3IHUA 2W4MA 3ZVRA 3FDQA 1BDJB 4ZLCA 2XSEA 2OJQA 2V26A 2GDCA 3KMIA 2I8BA 1QQ3A 3ZTZA 5B3SC 3FOPA 4MVRA 3B71A 4BJTA 3SNHA 3FVYA 5E3AA 4IWBA 1A7EA 4CIPA 1HE9A 2R7RA 4D4NA 3B0VC 2R7XA 1ORYA 2CW0F 2ZXPA 1H6GA 1SR2A 2HV7A 5F5HA 3AG1C 4I1MA 3DAGA 1YLMA 3N24A 4NQFA 3SZRA 3ZSUA 2H7VC 4O6MA 2R7QA 3C18A 3GWLA 3NRHA 2XS1A 3T9OA 5BQIA 5HV9A 3VF0A 3QVZA 3RYLA 1Y6DA 4BJ6C 4CS9C 3FMSA 4CSAC 2BC5A 2QY9A 4P6IC 1T01A 3AGUA 1VLSA 3N0TA 3QW0A 2Q3TA 4IARA 2EILC 3EGXB 1VOMA 4NTFA 1ORJA 1WGWA 3F46A 5JVEA 4JEBA 2BE5F 1TWCA 4BJ1A 5KYYB 3EPVA 1CGNA 1M56C 1UG7A 1XZQA 3PCVA 3W2VA 2G3VA
chains in the Genus database with same CATH topology
2XM0A 3HNIA 3QW1A 3M15A 4L6RA 4D4XA 2XL6A 4NC3A 1YYXA 4CDYA 1GQAA 2XLDA 3IQ5A 3C62A 5JUAA 4IB4A 5JSLA 2YL7A 3M79A 2YKZA 3TOLA 4N4WA 3DE8A 5JLIA 3NMJA 4JEAA 1LM3B 1S05A 4WGYA 3HNLA 1APCA 1BBHA 3C63A 2J9BA 1E84A 2XLWA 1CGOA 3U8PA 1JAFA 3ZQYA 2XLMA 3ZQVA 3DE9A 2J8WA 4CDVA 3M4CA 3ZTMA 3QVYA 2CCYA 2XLHA 4WGZA 1YYJA 1QPUA 4JKVA 2YLIA 3L1MA 3FOOA 3NMIA 3HNJA 4ULVA 1MQVA 1M6TA 2YLGA 2QLAA 1CPRA 4N6HA 5JRAA 1YZCA 4CJOA 2XM4A 256BA 1NBBA 2YL1A 3ZWIA 3NMKA 1CPQA 1E85A 3VRCA 4U9EA 5AGFA 2XLVA 2XLOA 3HNKA 2YLDA 3M4BA 1A7VA 1E86A 1QQ3A 3ZTZA 3FOPA 4JE9A 4CDAA 5JS5A 1E83A 4CIPA 4D4NA 4ER9A 3TOMA 3QVZA 4CJGA 5B3IA 5JT4A 5JP7A 1EKYA 2YL0A 1RCPA 2BC5A 2XLEA 4CX9A 4IARA 3QW0A 5JVEA 2YL3A 4JEBA 1YZAA 2XL8A 4U9DA 1CGNA 4EIYA 4IAQA 3IQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM0 A;  3HNI A;  3QW1 A;  3M15 A;  4L6R A;  4D4X A;  2XL6 A;  4NC3 A;  1YYX A;  4CDY A;  1GQA A;  2XLD A;  3IQ5 A;  3C62 A;  5JUA A;  4IB4 A;  5JSL A;  2YL7 A;  3M79 A;  2YKZ A;  3TOL A;  4N4W A;  3DE8 A;  5JLI A;  3NMJ A;  4JEA A;  1LM3 B;  1S05 A;  4WGY A;  3HNL A;  1APC A;  1BBH A;  3C63 A;  2J9B A;  1E84 A;  2XLW A;  1CGO A;  3U8P A;  1JAF A;  3ZQY A;  2XLM A;  3ZQV A;  3DE9 A;  2J8W A;  4CDV A;  3M4C A;  3ZTM A;  3QVY A;  2CCY A;  2XLH A;  4WGZ A;  1YYJ A;  1QPU A;  4JKV A;  2YLI A;  3L1M A;  3FOO A;  3NMI A;  3HNJ A;  4ULV A;  1MQV A;  1M6T A;  2YLG A;  2QLA A;  1CPR A;  4N6H A;  5JRA A;  1YZC A;  4CJO A;  2XM4 A;  256B A;  1NBB A;  2YL1 A;  3ZWI A;  3NMK A;  1CPQ A;  1E85 A;  3VRC A;  4U9E A;  5AGF A;  2XLV A;  2XLO A;  3HNK A;  2YLD A;  3M4B A;  1A7V A;  1E86 A;  1QQ3 A;  3ZTZ A;  3FOP A;  4JE9 A;  4CDA A;  5JS5 A;  1E83 A;  4CIP A;  4D4N A;  4ER9 A;  3TOM A;  3QVZ A;  4CJG A;  5B3I A;  5JT4 A;  5JP7 A;  1EKY A;  2YL0 A;  1RCP A;  2BC5 A;  2XLE A;  4CX9 A;  4IAR A;  3QW0 A;  5JVE A;  2YL3 A;  4JEB A;  1YZA A;  2XL8 A;  4U9D A;  1CGN A;  4EIY A;  4IAQ A;  3IQ6 A; 
#chains in the Genus database with same CATH topology
 2OEX A;  2VH3 A;  4P9T A;  3K6B A;  1XZP A;  2PNO A;  2XM0 A;  4MW8 A;  3QW1 A;  1T6Q A;  4YL1 A;  1M2O A;  3CQZ A;  4HE8 D;  4FAP B;  1Q0K A;  3EZH A;  4BJ6 A;  4CS9 A;  4D4X A;  4HFF B;  2YHS A;  5FCL A;  1D0Y A;  1I4Z A;  2P61 A;  4X0R A;  4CSA A;  1K05 A;  2YRF A;  1GQA A;  4JCH A;  1F1M A;  1MMD A;  3IQ5 A;  3Q7G A;  1Z23 A;  1JMW A;  2OKU A;  3M1C B;  4LER A;  4EHP A;  3JT1 A;  1BR4 A;  3MX3 A;  1FAP B;  5JUA A;  2L7A A;  3G4Z A;  1VYI A;  2HFI A;  4XTK A;  1WAS A;  4FES A;  5JSL A;  3T6G B;  4DBQ A;  4WJ0 A;  5L0G A;  2JD3 A;  1RKE B;  2XXA A;  1D1A A;  1NSG B;  1RJ9 A;  3HLZ A;  4ZLD A;  1WAT A;  2IXN A;  2Q4F A;  5DQT A;  1ZHY A;  3TD7 A;  1OW7 A;  3JCU Q;  3JSZ A;  1QKR A;  5JLI A;  3ZG1 A;  4EKW A;  3KYJ A;  2R7S A;  3ABM C;  4KNV A;  2LFD A;  2EPL X;  3K7D A;  3EZI A;  3HNL A;  3Q7L A;  1LI5 A;  3HKK A;  1G8X A;  4OD5 A;  4DOZ A;  2NSF A;  3C8G A;  3LLI A;  2A6H F;  4QI0 A;  3GEI A;  4Q4Z F;  1N1C A;  1V74 B;  3U8P A;  1JAF A;  2Q00 A;  1CGM E;  3JSE O;  2H8A A;  1L7C A;  3CEX A;  3M4C A;  3F47 A;  2IYL D;  2OEV A;  3I5Q A;  4OIR F;  3O55 A;  1JPN A;  1MMN A;  1YJG A;  2YWA A;  3MFN A;  1ZHX A;  4R32 A;  4E7Z A;  1NG1 A;  5KYX B;  3POV A;  3GOR A;  1B68 A;  4I1O B;  3L1M A;  3ASN C;  3DWW A;  3FOO A;  4EBK A;  3WG7 C;  1NLX A;  2LFF A;  4GYT A;  5E33 A;  2UUH A;  1M6T A;  2P6V A;  2J0X A;  2YLG A;  2ZXO A;  3Q6M A;  1CPR A;  5L0J A;  2EPM X;  5T1D B;  1LE4 A;  3SXM A;  3SP1 A;  2M64 A;  2GFH A;  3IQT A;  3S90 A;  3DM5 A;  3W2W A;  2A0B A;  256B A;  3A9C A;  3E70 C;  1VYK A;  3ZWI A;  3LS0 A;  4G78 A;  1VK5 A;  3K33 A;  4JTD B;  3U8V A;  1FNT c;  1OCC C;  1OXB A;  1E85 A;  2NSG A;  3VRC A;  4U9E A;  4EUK B;  2PBE A;  2R05 A;  3S0X A;  2XLV A;  4JRZ A;  1NFO A;  4BG0 A;  3U0C A;  2A1D D;  2YLD A;  2A0U A;  4J32 B;  3TK0 A;  4JJF A;  1A7V A;  4AL0 A;  2QUP A;  1E86 A;  2LD6 A;  5CI8 A;  3Q6N A;  2C03 A;  1AVO B;  3K66 A;  5F28 E;  2FAP B;  4FWV A;  4JUR I;  2WB7 A;  3GM3 A;  2D4U A;  4W8P A;  3O6X A;  1J8M F;  1YAR O;  2J7P A;  2LSE A;  3TOM A;  4PFP A;  1ZYR F;  2IOQ A;  4XLN F;  4PJL A;  3WHN A;  5B3I A;  5JT4 A;  5KYW A;  1EKY A;  5A69 A;  4XEF A;  5D92 A;  4CX9 A;  2HZ8 A;  3C8G D;  1SMY F;  1QLE C;  4F4B A;  1MMA A;  3EGD A;  3G4X A;  4GQH A;  5KYU A;  1TWG A;  4DRJ B;  5L0C A;  2YL3 A;  1YZA A;  4PJN A;  1KNY A;  3EQL F;  3SYN A;  3QTH A;  4MVU A;  4EIY A;  2XXA B;  3EJN A;  4K1O A;  1RJ9 B;  2J45 A;  1Q0M A;  4LDR A;  3WAQ A;  4G7H F;  1PCX A;  1FR0 A;  3UMK A;  4E18 A;  2EIM C;  5BUO A;  3RVZ A;  1C02 A;  3X2Q C;  3HNI A;  2E87 A;  4XPW A;  5KYN A;  3M15 A;  1TWH A;  4L6R A;  4YL3 A;  5DVW A;  3GM2 A;  4MTF A;  4KBL A;  3AGT A;  2ZD9 A;  1BZ4 A;  2XL6 A;  1PD0 A;  3U3F A;  1OQC A;  4PJJ A;  1NZE A;  1YYX A;  4Q7C A;  1D0Z A;  3B0U X;  1SF8 A;  2P1A A;  2YZS A;  4LDQ A;  3EH2 A;  3C8G B;  3C62 A;  3MYF A;  4O6N A;  3T6B A;  4U5D E;  3DKA A;  5AC4 A;  1L3P A;  4BJ5 C;  2W45 A;  4FX5 A;  1WTY A;  2YL7 A;  2YVK A;  3M79 A;  2YKZ A;  1H9G A;  1HW1 A;  2PF4 E;  1LPE A;  1ZHT A;  4JW1 A;  3TOL A;  5DS5 A;  3KH2 A;  3L8J A;  3DE8 A;  3TUL A;  3BRJ A;  2VCA A;  3WOD F;  2DI3 A;  4UDV A;  4LLC A;  2AWC A;  4YT5 A;  1HMD A;  2OJE D;  1LM3 B;  1S05 A;  2X51 A;  2X0C A;  3C63 A;  3UGO A;  1O87 A;  3AJM A;  2KGO A;  2WZL A;  3OA1 A;  4MVS A;  4BJ5 A;  1OR2 A;  4LLE A;  3R7C A;  1AUE A;  2EPO A;  4MTG A;  4PAC A;  5BQG A;  2PX3 A;  2W4B A;  3RIP A;  4ONS A;  1LKX A;  1TWA A;  2KNH A;  3DI5 A;  3NYM A;  2NUT A;  4YJW A;  5L0D A;  3VM6 A;  2F22 A;  2J8W A;  2HSB A;  3ZTM A;  3DXJ F;  1T5O A;  3G50 A;  2R02 A;  3QVY A;  2CCY A;  2DYR C;  2XLH A;  5CI9 A;  1TR2 A;  2I15 A;  4XEV A;  2XS8 A;  2H7B A;  2EIN C;  1RKC A;  5CIV A;  1YYJ A;  3O10 A;  2PP4 A;  5A6A A;  1FMV A;  1OXK A;  2KW3 C;  3U9M A;  4I44 A;  1YA7 O;  3U2L A;  4IAO A;  1R5I D;  3ABL C;  4BEM J;  1A0B A;  1M2V A;  2O9X A;  4DVZ A;  4OIO F;  2QLA A;  1K04 A;  4N6H A;  4DXW A;  5COF A;  1YZC A;  1DOW A;  5EGY A;  5B1A C;  5L3V A;  4G7Z F;  3LEO A;  3NYL A;  5T3T A;  1BR1 A;  2WL8 A;  1NBB A;  2YL1 A;  1FFT C;  2Q7R A;  1FTS A;  3KPH A;  1U6H A;  2IXP A;  1SYQ A;  3JRM O;  4A2N B;  4CIH A;  2IXO A;  5EHH A;  5KYW B;  4RBN A;  1G4W R;  2R9R B;  1NFN A;  3KYI A;  5IY5 C;  3MLG A;  1Z63 A;  2HJ3 A;  2R7U A;  2AU5 A;  2G3K A;  4NY3 A;  5L3Q A;  2R7V A;  4MW3 A;  2PFD A;  3HNK A;  4P9F A;  3EGD B;  2CNW A;  5KYU B;  3RQG A;  4CS8 C;  1VTM P;  4OD4 A;  3M4B A;  3JRT A;  4KNW A;  3UMI A;  2R7W A;  1U89 A;  5TJ5 E;  1YVI A;  2BL2 A;  3GWN A;  4CDA A;  1OCR C;  1T9K A;  2FFH A;  2M4E A;  2QTV A;  3ZDL A;  1JPJ A;  1QZX A;  2A68 F;  2CGE A;  3B29 A;  2PX0 A;  3C8Z A;  1OW8 A;  3H2V A;  3JTL O;  3SXK A;  3QMK A;  4DRH B;  2V3C C;  1GS9 A;  4RDA A;  4KI2 A;  1VMA A;  1QVX A;  2Q9B A;  2Q9C A;  2GA0 A;  2DYS C;  4I3M A;  3QZC A;  2NPU A;  2OCC C;  3JYH A;  3PMR A;  4K0D A;  1PD1 A;  1H7I A;  2L81 A;  1RMV A;  1U0B B;  3IQC A;  4CS8 A;  5JP7 A;  1OW6 A;  4N06 A;  2YL0 A;  1RCP A;  2XLE A;  3FXH A;  3PDM P;  2JX0 A;  3EH1 A;  3UR3 C;  2YEV A;  5K0I A;  1ZW2 A;  2WZF A;  3LS1 A;  2HUJ A;  2NUP A;  3DZA A;  4MVQ A;  4J7T A;  3US6 A;  5DLJ A;  4U9D A;  5D91 A;  1SZI A;  2KK1 A;  4JVS A;  3LEV A;  4DJ9 A;  2KYH A;  1W2W A;  2DB4 A;  3CAX A;  4JJG A;  1HW2 A;  3IQ6 A;  4CJG A;  4E0H A;  5DQZ A;  3DJU B;  3EFO A;  3LNR A;  3S29 A;  2ASR A;  1HE1 A;  2L6H A;  3DD7 A;  3DM9 B;  4AL1 A;  2J46 A;  1ZW3 A;  4MQ9 F;  3RH3 A;  4Q5S F;  4MVZ A;  4XLP F;  1Q0F A;  4J7Y A;  1IZM A;  4O7G A;  3H65 A;  1LI7 A;  3JYY A;  4PR9 A;  3KL4 A;  4RD9 A;  4NC3 A;  3EHM A;  3I4U A;  4PFO A;  3SXY A;  4CDY A;  2XLD A;  4DVY P;  4OIQ F;  4YN0 B;  2ZXW C;  1PV3 A;  1LS1 A;  4JZA A;  3ZIB A;  3CZ6 A;  2J0W A;  1LS4 A;  2Y3G A;  5HSW A;  4IB4 A;  1QSP A;  1T6I A;  2EIK C;  2NUT B;  1HY5 A;  1WWP A;  4CS7 A;  2LIG A;  3OWT A;  3LJB A;  2XL4 A;  4U5F E;  1MMG A;  2LK4 A;  1JRA A;  3O39 A;  4N6C A;  4E7S A;  2Y3D A;  4C7O A;  1ORS C;  1YDI A;  5A6J A;  2ZPA A;  2QNL A;  1MNE A;  3AG2 C;  3FAJ A;  4NCQ A;  4OIP F;  3J06 A;  2VC9 A;  2IM8 A;  2WVO A;  5E2Q A;  4E0I A;  1WN0 A;  2KC3 A;  2DGJ A;  4JEA A;  2YQY A;  1M57 C;  2R7O A;  4IGG A;  3SXZ A;  3RVY A;  1APC A;  1D0X A;  2VCC A;  4H4K C;  1E84 A;  2KJG A;  1CGO A;  1JR8 A;  1M2V B;  1IW7 F;  1OKK A;  2AP3 A;  2EIJ C;  1V4A A;  3ITF A;  3B9Q A;  1ZHZ A;  1TFO B;  1TQG A;  3A11 A;  3MYI A;  4LDK A;  4U5H A;  2XLM A;  3ATP A;  3I5P A;  3TJ5 A;  4EWC A;  3RKO F;  3DE9 A;  4YK5 A;  1A7D A;  1UFB A;  4W8K A;  1GM5 A;  1KU2 A;  5GPG B;  2P7V A;  1ZU5 A;  3DMD A;  4G0H A;  3UNG C;  4XQ1 A;  3JZ0 A;  4JIO A;  2B0J A;  5A6K A;  2EPK X;  4PJM A;  4WGZ A;  3X1O A;  3W8I A;  2A69 F;  1ZZP A;  2CDQ A;  4GEH A;  3RQE A;  1D1B A;  1TKN A;  2WZG A;  4NTA A;  3L8I A;  4Z9J A;  2RSE B;  2Y69 C;  1S7Z A;  3V5X A;  2VAS A;  4E17 A;  1Z7Q c;  2J9W A;  4YT8 A;  1LVK A;  4JC7 A;  4QDL A;  3EG9 A;  4PK4 A;  3RF3 A;  3T6J A;  4O6Y A;  3V5Z A;  5JRA A;  4QI2 A;  4B6I A;  4M63 A;  4CJO A;  3S9O A;  5A6B A;  1XWJ A;  2WVN A;  4A4A A;  3ASO C;  4K7B A;  2HMQ A;  4CBE A;  2AVK A;  2WVQ A;  1C03 A;  1Q0D A;  4AE4 A;  3B0P A;  2D5R B;  3W4Y A;  2R7T A;  3GAN A;  1J8Y F;  3AQB A;  3U3B A;  3NKD A;  1CPQ A;  1TFK B;  4HFK B;  5AGF A;  3ABK C;  1FFH A;  2J7P D;  2Q9A A;  1D1C A;  4MTO A;  3UGP A;  2XLO A;  3LNM B;  1ZU4 A;  2B0H A;  3RFY A;  2KQ9 A;  2NUP B;  3ZC4 A;  1Z3I X;  5E3C A;  4MS2 A;  1K40 A;  1YAU O;  2G62 A;  2ICW G;  1LE2 A;  2C04 A;  4JE9 A;  2MYS A;  2HSQ A;  2AWY A;  5JS5 A;  3EFO B;  4J30 B;  2LP4 A;  2W9Y A;  1E83 A;  4ANJ A;  2OQM A;  2FGY A;  3LUT B;  2MWQ A;  2XRH A;  3W8H A;  4WAB A;  1E2X A;  2TMV P;  4ER9 A;  2Y39 A;  4C3E A;  3TQO A;  3FAP B;  4LAC B;  1KTM A;  1OKK D;  2R03 A;  4H54 A;  3AG4 C;  4KC9 A;  3E9V A;  2OU6 A;  1V54 C;  1Z5Z A;  3U5S A;  1ZVZ A;  4XPX A;  1R4T A;  4BPM A;  2XL8 A;  4G7O F;  3AG3 C;  1OCO C;  4IAQ A;  3H2U A;  4C7O B;  3NDB B;  5B1B C;  1G5Z A;  2EPN A;  2JPU A;  2UUI A;  2IBF A;  1T6U A;  5COG A;  3U9J A;  3RQF A;  3EHN A;  1GGQ A;  1ZHW A;  4EBJ A;  3KKB A;  2GWW A;  1NU9 C;  1OR3 A;  2L6G A;  3VYW A;  3L34 A;  3LLK A;  2A6E F;  1C17 M;  3K1H A;  3S27 A;  1I4Y A;  1EA8 A;  4C3B A;  1VLT A;  4C3D A;  3V7O A;  2Y3B A;  1WOL A;  2GAQ A;  2RD9 A;  5FZT A;  2Y3H A;  3EGX A;  1MND A;  2HJM A;  4IJJ A;  3CSK A;  4MVM A;  1OCZ C;  4U5C E;  3L0I A;  1HMO A;  2L6F A;  4Z9I A;  5A6B D;  5KYY A;  1LIH A;  4OIN F;  4U5G A;  4YT4 A;  2OG2 A;  4N4W A;  2HS5 A;  2H7O A;  5COM A;  3T4R A;  1O3U A;  2HMZ A;  1Z6A A;  5F5F A;  3PHF 2;  3VAY A;  5T3W A;  4YWQ A;  2L9J A;  4IRU A;  4XWJ A;  5BQH A;  1EI7 A;  3C7J A;  1JOG A;  3NMJ A;  2ETS A;  4WGY A;  3K1I C;  3MBG A;  4JCZ A;  1BBH A;  2J9V A;  3TJ6 A;  2HKV A;  2J9U A;  2J9B A;  3AQC A;  2XLW A;  3GEE A;  2KSF A;  4MVO A;  4MND A;  1A41 A;  4HEA J;  3EG9 B;  2HV6 A;  3GOD A;  4ULW A;  2IXM A;  4DBR A;  3HTK C;  2ZXR A;  2Z15 A;  3ZQY A;  3DJN B;  2P0N A;  3LAY A;  4EBB A;  3R2P A;  3ZQV A;  4CDV A;  1AEP A;  2VCB A;  1RKE A;  4XPY A;  4AE4 B;  3SEO A;  1BR2 A;  3AOU A;  5DS4 A;  1I5N A;  3NG1 A;  1VB5 A;  3K1I A;  3N2Z B;  4Z9H A;  2LQG A;  1EQ1 A;  3HJC A;  4AX2 A;  1QPU A;  4JKV A;  2YLI A;  3UMH A;  3V5Y A;  3IEE A;  4U5E E;  1NU7 D;  5EK0 A;  4BEJ A;  4DRI B;  5DS6 A;  1V55 C;  3NMI A;  3HNJ A;  4ULV A;  4XEK A;  3RW0 A;  1O5H A;  2OOC A;  2R25 A;  2VB6 A;  4YT2 A;  2LCH A;  1Y4C A;  1MQV A;  2CNW D;  2MHR A;  3NKE A;  2CYD A;  1RXQ A;  1ST6 A;  2NG1 A;  3NYJ A;  4U5B E;  4AK9 A;  3ECS A;  5L0H A;  5L0I A;  4JTA B;  3S84 A;  3LES A;  1G4U S;  3GM1 A;  3IPM O;  3FHD A;  5AC5 A;  4NTB A;  3U2M A;  3BEH A;  5L0F A;  1H9T A;  1DOV A;  2XM4 A;  4O79 A;  3S28 A;  4JTC B;  1YA9 A;  3OEO A;  3DAF A;  4YL0 A;  3NMK A;  1Q0G A;  1FMW A;  2QE9 A;  5KYX A;  3GEH A;  3IHU A;  2W4M A;  3ZVR A;  3FDQ A;  1BDJ B;  4ZLC A;  2XSE A;  2OJQ A;  2V26 A;  2GDC A;  3KMI A;  2I8B A;  1QQ3 A;  3ZTZ A;  5B3S C;  3FOP A;  4MVR A;  3B71 A;  4BJT A;  3SNH A;  3FVY A;  5E3A A;  4IWB A;  1A7E A;  4CIP A;  1HE9 A;  2R7R A;  4D4N A;  3B0V C;  2R7X A;  1ORY A;  2CW0 F;  2ZXP A;  1H6G A;  1SR2 A;  2HV7 A;  5F5H A;  3AG1 C;  4I1M A;  3DAG A;  1YLM A;  3N24 A;  4NQF A;  3SZR A;  3ZSU A;  2H7V C;  4O6M A;  2R7Q A;  3C18 A;  3GWL A;  3NRH A;  2XS1 A;  3T9O A;  5BQI A;  5HV9 A;  3VF0 A;  3QVZ A;  3RYL A;  1Y6D A;  4BJ6 C;  4CS9 C;  3FMS A;  4CSA C;  2BC5 A;  2QY9 A;  4P6I C;  1T01 A;  3AGU A;  1VLS A;  3N0T A;  3QW0 A;  2Q3T A;  4IAR A;  2EIL C;  3EGX B;  1VOM A;  4NTF A;  1ORJ A;  1WGW A;  3F46 A;  5JVE A;  4JEB A;  2BE5 F;  1TWC A;  4BJ1 A;  5KYY B;  3EPV A;  1CGN A;  1M56 C;  1UG7 A;  1XZQ A;  3PCV A;  3W2V A;  2G3V A; 
#chains in the Genus database with same CATH homology
 2XM0 A;  3HNI A;  3QW1 A;  3M15 A;  4L6R A;  4D4X A;  2XL6 A;  4NC3 A;  1YYX A;  4CDY A;  1GQA A;  2XLD A;  3IQ5 A;  3C62 A;  5JUA A;  4IB4 A;  5JSL A;  2YL7 A;  3M79 A;  2YKZ A;  3TOL A;  4N4W A;  3DE8 A;  5JLI A;  3NMJ A;  4JEA A;  1LM3 B;  1S05 A;  4WGY A;  3HNL A;  1APC A;  1BBH A;  3C63 A;  2J9B A;  1E84 A;  2XLW A;  1CGO A;  3U8P A;  1JAF A;  3ZQY A;  2XLM A;  3ZQV A;  3DE9 A;  2J8W A;  4CDV A;  3M4C A;  3ZTM A;  3QVY A;  2CCY A;  2XLH A;  4WGZ A;  1YYJ A;  1QPU A;  4JKV A;  2YLI A;  3L1M A;  3FOO A;  3NMI A;  3HNJ A;  4ULV A;  1MQV A;  1M6T A;  2YLG A;  2QLA A;  1CPR A;  4N6H A;  5JRA A;  1YZC A;  4CJO A;  2XM4 A;  256B A;  1NBB A;  2YL1 A;  3ZWI A;  3NMK A;  1CPQ A;  1E85 A;  3VRC A;  4U9E A;  5AGF A;  2XLV A;  2XLO A;  3HNK A;  2YLD A;  3M4B A;  1A7V A;  1E86 A;  1QQ3 A;  3ZTZ A;  3FOP A;  4JE9 A;  4CDA A;  5JS5 A;  1E83 A;  4CIP A;  4D4N A;  4ER9 A;  3TOM A;  3QVZ A;  4CJG A;  5B3I A;  5JT4 A;  5JP7 A;  1EKY A;  2YL0 A;  1RCP A;  2BC5 A;  2XLE A;  4CX9 A;  4IAR A;  3QW0 A;  5JVE A;  2YL3 A;  4JEB A;  1YZA A;  2XL8 A;  4U9D A;  1CGN A;  4EIY A;  4IAQ A;  3IQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...