4CJOA

Spectroscopically-validated structure of ferrous cytochrome c prime from alcaligenes xylosoxidans, reduced at 180k using x-rays
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 48
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cjoA00
4CJGA 1CGOA 5JSLA 4U9EA 1M6TA 5B3IA 1MQVA 3DE8A 3M15A 1A7VA 1YZCA 3VRCA 4CDYA 2XL6A 2XL8A 1E84A 2YLGA 2YL0A 3C62A 2YLDA 1EKYA 1NBBA 3IQ5A 4D4NA 4N4WA 4L6RA 4CX9A 2XM4A 4JE9A 3IQ6A 2J9BA 4WGZA 1YYXA 3NMJA 4JEAA 2XLWA 3HNIA 1BBHA 3HNLA 5AGFA 4EIYA 1E85A 2YKZA 4JKVA 4CJOA 1CPRA 2YL1A 3M79A 3NMIA 3QW1A 1CPQA 3HNKA 2BC5A 3L1MA 3QVZA 4IB4A 5JLIA 1QQ3A 1CGNA 1YYJA 1JAFA 3FOPA 2YLIA 3U8PA 4IARA 5JP7A 4ER9A 2XLEA 5JT4A 1E86A 3FOOA 5JUAA 4WGYA 1QPUA 1S05A 3NMKA 2YL3A 3ZQYA 3ZTZA 4U9DA 1LM3B 2XLMA 4CDVA 3ZWIA 2XLHA 2XLVA 3TOMA 3M4CA 1GQAA 2XM0A 3QVYA 3ZQVA 1E83A 4JEBA 1YZAA 4N6HA 2CCYA 3HNJA 4ULVA 1APCA 5JVEA 1RCPA 4CDAA 3DE9A 3QW0A 4CIPA 2J8WA 256BA 2XLDA 4NC3A 3ZTMA 4D4XA 2YL7A 3TOLA 5JRAA 2XLOA 3M4BA 5JS5A 2QLAA 4IAQA 3C63A
chains in the Genus database with same CATH superfamily
4CJGA 1TFKB 1V4AA 2X51A 3W8HA 2PX0A 2A69F 3AQBA 4DRHB 4J7TA 3U2MA 4C3EA 1HMOA 2WB7A 3DWWA 3S27A 4K1OA 3N24A 1T5OA 5CI9A 4BEJA 3BEHA 2DI3A 3U9MA 2L6GA 1SF8A 4NQFA 3MX3A 3WODF 3AOUA 4E0HA 1LS4A 1RKEA 3DZAA 3N0TA 1PD1A 1G8XA 3K33A 1HW2A 2ZXWC 5FZTA 3AG3C 3EHMA 2TMVP 4YT2A 5L0HA 1EKYA 2P1AA 2D5RB 1UG7A 2OCCC 2CNWA 4J7YA 2EILC 2HMQA 2G3VA 2NUPA 1RKEB 3RVYA 3H65A 5E2QA 4DOZA 3KMIA 4MW3A 4XWJA 1Z63A 2XM4A 1AVOB 1PCXA 1ZHYA 1ZHWA 2IXOA 4FAPB 2VB6A 2EPNA 5A6JA 1D0YA 4KC9A 2X0CA 4WGZA 2R7VA 3QTHA 4PJLA 3IPMO 2O9XA 2NUPB 2C04A 3HNIA 2HS5A 1BBHA 2YQYA 2LD6A 4EIYA 2R7UA 3EJNA 3U9JA 1ZW3A 4IJJA 2V3CC 5L0JA 4YWQA 2CNWD 1GGQA 1Z5ZA 1YAUO 1C02A 1YJGA 3B29A 2IXPA 3EZIA 3DMDA 1IW7F 4YJWA 2QNLA 3M79A 3R2PA 4LLCA 4MQ9F 3H2UA 4MVOA 3NMIA 1B68A 4PR9A 4XEKA 3TQOA 1T6UA 3O10A 4JIOA 5FCLA 1JR8A 3EFOA 1CPQA 3HNKA 4XPWA 3WAQA 3TJ5A 3O6XA 2IYLD 4PJJA 2EIJC 4H54A 3A9CA 3GEIA 4EBBA 2KW3C 2I15A 4XLPF 3JRTA 3Q6MA 4XPXA 5A6KA 2R02A 2Y3DA 1JAFA 4AK9A 3FOPA 4WJ0A 3EFOB 1GS9A 3GANA 3LNMB 4JCHA 2KSFA 4LDQA 4DJ9A 1YDIA 2CGEA 4IARA 1OCRC 5JP7A 5DS4A 2YEVA 4IRUA 3I5PA 1Q0DA 2J46A 1NZEA 2H7OA 3W4YA 3AJMA 4ONSA 1E86A 4J30B 3V5XA 2Z15A 4BJ1A 4WGYA 2R7SA 3LESA 4PK4A 1TFOB 1S05A 1U0BB 3ABKC 3NRHA 2BE5F 1M2VB 2CW0F 1LE2A 1A7EA 2Q3TA 3DM9B 2W4MA 1H6GA 3BRJA 4AL1A 1J8YF 3LS0A 4JC7A 4JTCB 4G0HA 2HMZA 2UUHA 1EA8A 5DVWA 1DOVA 3LJBA 3CZ6A 4WABA 1VB5A 1V74B 1ZYRF 1YARO 2DYSC 3SYNA 3U0CA 4ZLDA 4KI2A 4G78A 1OQCA 3C8ZA 3QVYA 1HW1A 4JVSA 2Q00A 3JYYA 2EPOA 4JEBA 1J8MF 3U8VA 3GWLA 4YN0B 4YL3A 4ULVA 1APCA 3LNRA 1RCPA 4BJ6C 4J32B 2CDQA 4G7OF 1T6IA 3GM1A 2WL8A 2B0JA 2L6FA 3DM5A 3EG9A 1HMDA 2Q9AA 4JRZA 4DXWA 1LIHA 1NU9C 1V55C 3EHNA 3JTLO 3UMHA 3ZTMA 2R7TA 4I1OB 2OKUA 2YL7A 3LEVA 3TOLA 2VCCA 1ORJA 5COGA 4GYTA 4I44A 4U5DE 4E0IA 1TWHA 4MW8A 3RQEA 4U9EA 5KYUA 3W2VA 2M4EA 4AL0A 3U3FA 4C7OA 1ORYA 2J7PA 2OU6A 3M15A 1A7VA 4YT5A 3VM6A 2RSEB 2HUJA 2PF4E 2EPLX 5L0CA 2KYHA 3VRCA 5DQTA 2ZD9A 3AQCA 4CDYA 3ZDLA 1OXBA 2XL8A 4K0DA 5KYWA 4G7ZF 2L7AA 4DBQA 2P0NA 3LEOA 5KYNA 1WGWA 4O79A 4OINF 4BJ5C 5KYUB 4PACA 3T4RA 3V5YA 3C62A 5DQZA 1SMYF 1NSGB 2J45A 3CEXA 3GEHA 3S9OA 1MNEA 1UFBA 2OQMA 3DAFA 3QMKA 2W9YA 2ZPAA 3AGUA 3SXKA 1EQ1A 2NPUA 3UNGC 1ZU5A 3FVYA 4NY3A 1AUEA 1WTYA 2GA0A 3PHF2 3LLIA 4XEVA 3NYJA 1KNYA 1O5HA 3K66A 3KKBA 4JE9A 3PCVA 4AE4B 4E7ZA 4AX2A 3IQ6A 5IY5C 4R32A 3WHNA 5AC4A 1OXKA 1YYXA 5L0GA 1OKKA 1RXQA 1MMGA 5CI8A 5D91A 4ANJA 4BPMA 1FMVA 3HNLA 4EBKA 1E85A 1CGME 1OCCC 4RDAA 1TKNA 2KC3A 2PNOA 1OR2A 2G62A 4I3MA 1H9GA 1QVXA 2HV7A 2RD9A 3JRMO 4JKVA 5E3CA 3SEOA 5A6AA 1CPRA 2HJMA 4QI2A 3F47A 2YL1A 4N6CA 3DAGA 5L0FA 3AG1C 2HV6A 2R05A 4DRIB 3ZG1A 1OKKD 4MVSA 1I4YA 4FESA 3GORA 1VK5A 4GEHA 4FWVA 4JURI 5COMA 1LI5A 2OEXA 3K1HA 2MYSA 3HKKA 3L1MA 1OCOC 3I5QA 4UDVA 1SR2A 1FAPB 2KK1A 3QVZA 1TWAA 4U5GA 2LFDA 4YK5A 1ZW2A 3FAPB 4BJ6A 5KYXA 2H7VC 2J0XA 5F5HA 1CGNA 4G7HF 1F1MA 1MMAA 1MMDA 3EGXA 3K7DA 2A6HF 3MLGA 4YL1A 3U8PA 1HE9A 2HJ3A 4CS9C 3PDMP 2R7XA 2JX0A 2XRHA 3HLZA 2CYDA 1YA9A 3IQTA 4MTOA 2EPMX 3C8GB 1GM5A 5KYXB 3LAYA 5JT4A 3DI5A 3FOOA 1NFNA 3TULA 2NSFA 3G4ZA 3EGXB 3C8GD 1LE4A 2EPKX 5EHHA 3NMKA 2YL3A 3ZTZA 4RBNA 4MS2A 1WOLA 4NTBA 2HZ8A 3EZHA 2AP3A 4LERA 1T6QA 4XPYA 3RFYA 5DLJA 2HKVA 3NG1A 5GPGB 3L0IA 2XLMA 4O6NA 3SP1A 4BJ5A 5T3WA 3ZWIA 5DS6A 3O55A 2XLHA 4JW1A 3S84A 3O39A 1Y6DA 1VLTA 4EBJA 1VLSA 2R9RB 2EIMC 2Q9CA 4IAOA 1YA7O 4A2NB 3EPVA 1DOWA 3RVZA 4JJGA 1KTMA 3CSKA 1LI7A 5JLIA 4RD9A 2OJQA 1W2WA 1SYQA 1YVIA 1NG1A 3RH3A 3ZQVA 1E83A 2P61A 2I8BA 2GAQA 3GODA 5JVEA 1M2VA 1U6HA 3OWTA 2F22A 3DE9A 2J8WA 4NCQA 2J9UA 3VF0A 2J0WA 4CIHA 1XWJA 1AEPA 3E70C 3KH2A 5EK0A 2XLDA 2ETSA 3RQFA 4YT8A 2Q4FA 2LIGA 5L3QA 3T6JA 2J9VA 2OOCA 1VTMP 2QUPA 1JPNA 1D1CA 4NTFA 3EGDB 5JSLA 3IHUA 3NDBB 4A4AA 1M6TA 3ITFA 3WG7C 3CQZA 3HJCA 1MQVA 4MVRA 3DE8A 5DS5A 1R5ID 1G4WR 3JSZA 4N06A 2GDCA 1YZCA 3DJNB 2MWQA 3NYMA 4LLEA 3U5SA 5BQIA 4W8PA 2Q7RA 3F46A 2KNHA 3C18A 4C3DA 2A68F 2BL2A 4QDLA 5D92A 1TWCA 1ORSC 4LDRA 2R7WA 1FMWA 4BG0A 5F28E 3B0VC 2WZFA 2QTVA 2E87A 2GWWA 3G4XA 5E3AA 3VAYA 4C3BA 1K04A 1JOGA 1Z7Qc 5EGYA 1JPJA 5A6BA 2A6EF 2OG2A 3LS1A 4P9TA 4PFOA 4GQHA 4MTGA 1NBBA 3H2VA 4YL0A 4MVQA 3RYLA 3KPHA 2G3KA 1EI7A 4JTAB 3RQGA 2Y3HA 4E7SA 1ZHXA 3ECSA 3FMSA 4L6RA 1NFOA 3UR3C 4CX9A 5KYYA 1WWPA 1PD0A 1JRAA 2VCBA 2LCHA 3K1IC 4PJMA 1ST6A 1K40A 4IWBA 4DRJB 4JEAA 4OIRF 1M2OA 2XLWA 1Z6AA 2LFFA 5F5FA 1VYKA 2A1DD 2XS1A 4EHPA 5KYYB 4CSAC 5A6BD 4KNVA 3JCUQ 5AGFA 1XZPA 1Q0FA 1U89A 1MMNA 3FHDA 2LQGA 3UMIA 3N2ZB 3M1CB 2PP4A 3Q6NA 3T6GB 5B1AC 3X1OA 3X2QC 2AWYA 5HV9A 2DYRC 2AVKA 4IGGA 4KNWA 3DD7A 4AE4A 1I5NA 3B0PA 2NG1A 1D0XA 3E9VA 3B71A 3RW0A 1M57C 5TJ5E 3OEOA 5L0DA 1TQGA 3FDQA 4CS7A 2W4BA 2BC5A 2Q9BA 4W8KA 3SXYA 1OW8A 2A0UA 5B3SC 3QZCA 2UUIA 4IB4A 1S7ZA 2KQ9A 3Q7GA 4DVYP 2AWCA 1QQ3A 1OW6A 2C03A 3NYLA 3UGPA 2P6VA 3LUTB 5L0IA 3T9OA 3EH1A 4FX5A 2R7RA 3GEEA 3A11A 1JMWA 1HE1A 4U5CE 1ZVZA 3AG2C 3S28A 3K6BA 1C03A 2HSQA 2XSEA 2ZXOA 5HSWA 1BR4A 1WATA 2WVOA 5JUAA 1Q0KA 2EIKC 3AG4C 2W45A 1A0BA 4OIPF 4EKWA 1OR3A 2IOQA 4HEAJ 2QY9A 2LSEA 2VASA 1ZZPA 1LM3B 3ABLC 4JJFA 2IXNA 4LACB 1Z3IX 2FFHA 2WZLA 5K0IA 3G50A 2WVNA 1FTSA 2YZSA 3C8GA 4JCZA 3TOMA 4H4KC 4HFKB 4O6YA 3U2LA 3VYWA 4E17A 3EH2A 1TR2A 4DVZA 1YLMA 2XM0A 2HSBA 4ZLCA 3S0XA 4Q7CA 1FR0A 2OEVA 3U3BA 2QE9A 4MVMA 2JPUA 3ABMC 4U5EE 5BQGA 1XZQA 1RMVA 2PFDA 2CCYA 2P7VA 3DKAA 2LP4A 4PFPA 3K1IA 4O6MA 4CDAA 3QW0A 3SXMA 2PBEA 1A7DA 2FGYA 1LKXA 256BA 2FAPB 2OJED 4XLNF 4U5FE 3Q7LA 4MVUA 4E18A 2XL4A 1Q0MA 3DXJF 4CSAA 4ULWA 5JRAA 5JS5A 2QLAA 3LLKA 2R25A 3R7CA 4IAQA 3L8JA 3C63A 1CGOA 4EUKB 3DJUB 5B3IA 2VC9A 4NTAA 3S90A 4X0RA 4CS8C 3IQCA 3J06A 1LVKA 1ZHTA 2YRFA 4MNDA 1QSPA 3ASOC 2AU5A 3MYIA 1NLXA 1T01A 2XL6A 4LDKA 3ZSUA 1RKCA 3W8IA 5A69A 1G5ZA 2VH3A 4XTKA 1BZ4A 1E84A 1QLEC 2YL0A 2YLGA 2KJGA 4CBEA 2EINC 2L81A 2Y3GA 4I1MA 4BEMJ 2YWAA 1Y4CA 3POVA 2YLDA 1M56C 2J9WA 2VCAA 3EGDA 4HFFB 4Z9JA 3SNHA 4MVZA 1R4TA 4OD4A 3IQ5A 4M63A 4D4NA 5BUOA 2Y3BA 1D1BA 4N4WA 1K05A 1C17M 3IEEA 1BDJB 2R03A 1N1CA 1TWGA 2R7OA 5AC5A 3I4UA 3C7JA 1H9TA 4OIQF 2J9BA 1O87A 3OA1A 3NMJA 3ZIBA 2R7QA 3KYJA 3RF3A 1RJ9A 1Z23A 3AGTA 1ZU4A 3MFNA 1T9KA 5L3VA 4DBRA 3FAJA 2YKZA 2YHSA 4JZAA 2DB4A 3B0UX 4O7GA 3JT1A 3RIPA 4BJTA 4CJOA 1QZXA 1V54C 1I4ZA 3W2WA 4Q5SF 3JSEO 1RJ9B 1H7IA 3UMKA 3L34A 4OD5A 3TJ6A 3HTKC 3US6A 3QW1A 2KGOA 1D1AA 4QI0A 3JZ0A 3TD7A 5E33A 4CS9A 3L8IA 5B1BC 5T3TA 3NKEA 4PJNA 2MHRA 4U5HA 1HY5A 1L7CA 1MNDA 3RKOF 1ZHZA 2HFIA 4KBLA 1YYJA 1L3PA 3GM3A 4XQ1A 3S29A 2YLIA 2D4UA 2IM8A 3KYIA 2ZXPA 3ZC4A 2WZGA 3T6BA 3FXHA 3PMRA 3CAXA 3GWNA 2IBFA 4ER9A 2XLEA 4Z9IA 2B0HA 4EWCA 3ZVRA 4P6IC 5COFA 5T1DB 3V7OA 1OW7A 2L9JA 1KU2A 3EQLF 4MTFA 2DGJA 4P9FA 4Z9HA 2NUTA 3V5ZA 1QPUA 1NU7D 4U5BE 4CS8A 2Y69C 3ZQYA 4F4BA 3UGOA 2V26A 2WVQA 4OIOF 4U9DA 1D0ZA 3NKDA 1PV3A 1WASA 4JTDB 5BQHA 3EG9B 4CDVA 2NUTB 5CIVA 1FNTc 1A41A 2NSGA 3JYHA 1VOMA 2IXMA 1Q0GA 2H8AA 2XLVA 3ASNC 1VMAA 3M4CA 1GQAA 2ASRA 1FFTC 2XXAA 1OCZC 2ICWG 2XS8A 4HE8D 2A0BA 4Q4ZF 2PX3A 2H7BA 2L6HA 1O3UA 3TK0A 1YZAA 2JD3A 4N6HA 3SXZA 3HNJA 1E2XA 3SZRA 4C7OB 3ATPA 1IZMA 1BR1A 1FFHA 1LS1A 2LK4A 2YVKA 2ZXRA 1VYIA 1G4US 3B9QA 1LPEA 2Y39A 3KL4A 1QKRA 3MBGA 3MYFA 1WN0A 1BR2A 4CIPA 2XXAB 4XEFA 4YT4A 5KYWB 2J7PD 2M64A 4NC3A 2GFHA 4D4XA 1SZIA 4K7BA 2XLOA 3M4BA 3GM2A 4B6IA
chains in the Genus database with same CATH topology
4CJGA 1CGOA 5JSLA 4U9EA 1M6TA 5B3IA 1MQVA 3DE8A 3M15A 1A7VA 1YZCA 3VRCA 4CDYA 2XL6A 2XL8A 1E84A 2YLGA 2YL0A 3C62A 2YLDA 1EKYA 1NBBA 3IQ5A 4D4NA 4N4WA 4L6RA 4CX9A 2XM4A 4JE9A 3IQ6A 2J9BA 4WGZA 1YYXA 3NMJA 4JEAA 2XLWA 3HNIA 1BBHA 3HNLA 5AGFA 4EIYA 1E85A 2YKZA 4JKVA 4CJOA 1CPRA 2YL1A 3M79A 3NMIA 3QW1A 1CPQA 3HNKA 2BC5A 3L1MA 3QVZA 4IB4A 5JLIA 1QQ3A 1CGNA 1YYJA 1JAFA 3FOPA 2YLIA 3U8PA 4IARA 5JP7A 4ER9A 2XLEA 5JT4A 1E86A 3FOOA 5JUAA 4WGYA 1QPUA 1S05A 3NMKA 2YL3A 3ZQYA 3ZTZA 4U9DA 1LM3B 2XLMA 4CDVA 3ZWIA 2XLHA 2XLVA 3TOMA 3M4CA 1GQAA 2XM0A 3QVYA 3ZQVA 1E83A 4JEBA 1YZAA 4N6HA 2CCYA 3HNJA 4ULVA 1APCA 5JVEA 1RCPA 4CDAA 3DE9A 3QW0A 4CIPA 2J8WA 256BA 2XLDA 4NC3A 3ZTMA 4D4XA 2YL7A 3TOLA 5JRAA 2XLOA 3M4BA 5JS5A 2QLAA 4IAQA 3C63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJG A;  1CGO A;  5JSL A;  4U9E A;  1M6T A;  5B3I A;  1MQV A;  3DE8 A;  3M15 A;  1A7V A;  1YZC A;  3VRC A;  4CDY A;  2XL6 A;  2XL8 A;  1E84 A;  2YLG A;  2YL0 A;  3C62 A;  2YLD A;  1EKY A;  1NBB A;  3IQ5 A;  4D4N A;  4N4W A;  4L6R A;  4CX9 A;  2XM4 A;  4JE9 A;  3IQ6 A;  2J9B A;  4WGZ A;  1YYX A;  3NMJ A;  4JEA A;  2XLW A;  3HNI A;  1BBH A;  3HNL A;  5AGF A;  4EIY A;  1E85 A;  2YKZ A;  4JKV A;  4CJO A;  1CPR A;  2YL1 A;  3M79 A;  3NMI A;  3QW1 A;  1CPQ A;  3HNK A;  2BC5 A;  3L1M A;  3QVZ A;  4IB4 A;  5JLI A;  1QQ3 A;  1CGN A;  1YYJ A;  1JAF A;  3FOP A;  2YLI A;  3U8P A;  4IAR A;  5JP7 A;  4ER9 A;  2XLE A;  5JT4 A;  1E86 A;  3FOO A;  5JUA A;  4WGY A;  1QPU A;  1S05 A;  3NMK A;  2YL3 A;  3ZQY A;  3ZTZ A;  4U9D A;  1LM3 B;  2XLM A;  4CDV A;  3ZWI A;  2XLH A;  2XLV A;  3TOM A;  3M4C A;  1GQA A;  2XM0 A;  3QVY A;  3ZQV A;  1E83 A;  4JEB A;  1YZA A;  4N6H A;  2CCY A;  3HNJ A;  4ULV A;  1APC A;  5JVE A;  1RCP A;  4CDA A;  3DE9 A;  3QW0 A;  4CIP A;  2J8W A;  256B A;  2XLD A;  4NC3 A;  3ZTM A;  4D4X A;  2YL7 A;  3TOL A;  5JRA A;  2XLO A;  3M4B A;  5JS5 A;  2QLA A;  4IAQ A;  3C63 A; 
#chains in the Genus database with same CATH topology
 4CJG A;  1TFK B;  1V4A A;  2X51 A;  3W8H A;  2PX0 A;  2A69 F;  3AQB A;  4DRH B;  4J7T A;  3U2M A;  4C3E A;  1HMO A;  2WB7 A;  3DWW A;  3S27 A;  4K1O A;  3N24 A;  1T5O A;  5CI9 A;  4BEJ A;  3BEH A;  2DI3 A;  3U9M A;  2L6G A;  1SF8 A;  4NQF A;  3MX3 A;  3WOD F;  3AOU A;  4E0H A;  1LS4 A;  1RKE A;  3DZA A;  3N0T A;  1PD1 A;  1G8X A;  3K33 A;  1HW2 A;  2ZXW C;  5FZT A;  3AG3 C;  3EHM A;  2TMV P;  4YT2 A;  5L0H A;  1EKY A;  2P1A A;  2D5R B;  1UG7 A;  2OCC C;  2CNW A;  4J7Y A;  2EIL C;  2HMQ A;  2G3V A;  2NUP A;  1RKE B;  3RVY A;  3H65 A;  5E2Q A;  4DOZ A;  3KMI A;  4MW3 A;  4XWJ A;  1Z63 A;  2XM4 A;  1AVO B;  1PCX A;  1ZHY A;  1ZHW A;  2IXO A;  4FAP B;  2VB6 A;  2EPN A;  5A6J A;  1D0Y A;  4KC9 A;  2X0C A;  4WGZ A;  2R7V A;  3QTH A;  4PJL A;  3IPM O;  2O9X A;  2NUP B;  2C04 A;  3HNI A;  2HS5 A;  1BBH A;  2YQY A;  2LD6 A;  4EIY A;  2R7U A;  3EJN A;  3U9J A;  1ZW3 A;  4IJJ A;  2V3C C;  5L0J A;  4YWQ A;  2CNW D;  1GGQ A;  1Z5Z A;  1YAU O;  1C02 A;  1YJG A;  3B29 A;  2IXP A;  3EZI A;  3DMD A;  1IW7 F;  4YJW A;  2QNL A;  3M79 A;  3R2P A;  4LLC A;  4MQ9 F;  3H2U A;  4MVO A;  3NMI A;  1B68 A;  4PR9 A;  4XEK A;  3TQO A;  1T6U A;  3O10 A;  4JIO A;  5FCL A;  1JR8 A;  3EFO A;  1CPQ A;  3HNK A;  4XPW A;  3WAQ A;  3TJ5 A;  3O6X A;  2IYL D;  4PJJ A;  2EIJ C;  4H54 A;  3A9C A;  3GEI A;  4EBB A;  2KW3 C;  2I15 A;  4XLP F;  3JRT A;  3Q6M A;  4XPX A;  5A6K A;  2R02 A;  2Y3D A;  1JAF A;  4AK9 A;  3FOP A;  4WJ0 A;  3EFO B;  1GS9 A;  3GAN A;  3LNM B;  4JCH A;  2KSF A;  4LDQ A;  4DJ9 A;  1YDI A;  2CGE A;  4IAR A;  1OCR C;  5JP7 A;  5DS4 A;  2YEV A;  4IRU A;  3I5P A;  1Q0D A;  2J46 A;  1NZE A;  2H7O A;  3W4Y A;  3AJM A;  4ONS A;  1E86 A;  4J30 B;  3V5X A;  2Z15 A;  4BJ1 A;  4WGY A;  2R7S A;  3LES A;  4PK4 A;  1TFO B;  1S05 A;  1U0B B;  3ABK C;  3NRH A;  2BE5 F;  1M2V B;  2CW0 F;  1LE2 A;  1A7E A;  2Q3T A;  3DM9 B;  2W4M A;  1H6G A;  3BRJ A;  4AL1 A;  1J8Y F;  3LS0 A;  4JC7 A;  4JTC B;  4G0H A;  2HMZ A;  2UUH A;  1EA8 A;  5DVW A;  1DOV A;  3LJB A;  3CZ6 A;  4WAB A;  1VB5 A;  1V74 B;  1ZYR F;  1YAR O;  2DYS C;  3SYN A;  3U0C A;  4ZLD A;  4KI2 A;  4G78 A;  1OQC A;  3C8Z A;  3QVY A;  1HW1 A;  4JVS A;  2Q00 A;  3JYY A;  2EPO A;  4JEB A;  1J8M F;  3U8V A;  3GWL A;  4YN0 B;  4YL3 A;  4ULV A;  1APC A;  3LNR A;  1RCP A;  4BJ6 C;  4J32 B;  2CDQ A;  4G7O F;  1T6I A;  3GM1 A;  2WL8 A;  2B0J A;  2L6F A;  3DM5 A;  3EG9 A;  1HMD A;  2Q9A A;  4JRZ A;  4DXW A;  1LIH A;  1NU9 C;  1V55 C;  3EHN A;  3JTL O;  3UMH A;  3ZTM A;  2R7T A;  4I1O B;  2OKU A;  2YL7 A;  3LEV A;  3TOL A;  2VCC A;  1ORJ A;  5COG A;  4GYT A;  4I44 A;  4U5D E;  4E0I A;  1TWH A;  4MW8 A;  3RQE A;  4U9E A;  5KYU A;  3W2V A;  2M4E A;  4AL0 A;  3U3F A;  4C7O A;  1ORY A;  2J7P A;  2OU6 A;  3M15 A;  1A7V A;  4YT5 A;  3VM6 A;  2RSE B;  2HUJ A;  2PF4 E;  2EPL X;  5L0C A;  2KYH A;  3VRC A;  5DQT A;  2ZD9 A;  3AQC A;  4CDY A;  3ZDL A;  1OXB A;  2XL8 A;  4K0D A;  5KYW A;  4G7Z F;  2L7A A;  4DBQ A;  2P0N A;  3LEO A;  5KYN A;  1WGW A;  4O79 A;  4OIN F;  4BJ5 C;  5KYU B;  4PAC A;  3T4R A;  3V5Y A;  3C62 A;  5DQZ A;  1SMY F;  1NSG B;  2J45 A;  3CEX A;  3GEH A;  3S9O A;  1MNE A;  1UFB A;  2OQM A;  3DAF A;  3QMK A;  2W9Y A;  2ZPA A;  3AGU A;  3SXK A;  1EQ1 A;  2NPU A;  3UNG C;  1ZU5 A;  3FVY A;  4NY3 A;  1AUE A;  1WTY A;  2GA0 A;  3PHF 2;  3LLI A;  4XEV A;  3NYJ A;  1KNY A;  1O5H A;  3K66 A;  3KKB A;  4JE9 A;  3PCV A;  4AE4 B;  4E7Z A;  4AX2 A;  3IQ6 A;  5IY5 C;  4R32 A;  3WHN A;  5AC4 A;  1OXK A;  1YYX A;  5L0G A;  1OKK A;  1RXQ A;  1MMG A;  5CI8 A;  5D91 A;  4ANJ A;  4BPM A;  1FMV A;  3HNL A;  4EBK A;  1E85 A;  1CGM E;  1OCC C;  4RDA A;  1TKN A;  2KC3 A;  2PNO A;  1OR2 A;  2G62 A;  4I3M A;  1H9G A;  1QVX A;  2HV7 A;  2RD9 A;  3JRM O;  4JKV A;  5E3C A;  3SEO A;  5A6A A;  1CPR A;  2HJM A;  4QI2 A;  3F47 A;  2YL1 A;  4N6C A;  3DAG A;  5L0F A;  3AG1 C;  2HV6 A;  2R05 A;  4DRI B;  3ZG1 A;  1OKK D;  4MVS A;  1I4Y A;  4FES A;  3GOR A;  1VK5 A;  4GEH A;  4FWV A;  4JUR I;  5COM A;  1LI5 A;  2OEX A;  3K1H A;  2MYS A;  3HKK A;  3L1M A;  1OCO C;  3I5Q A;  4UDV A;  1SR2 A;  1FAP B;  2KK1 A;  3QVZ A;  1TWA A;  4U5G A;  2LFD A;  4YK5 A;  1ZW2 A;  3FAP B;  4BJ6 A;  5KYX A;  2H7V C;  2J0X A;  5F5H A;  1CGN A;  4G7H F;  1F1M A;  1MMA A;  1MMD A;  3EGX A;  3K7D A;  2A6H F;  3MLG A;  4YL1 A;  3U8P A;  1HE9 A;  2HJ3 A;  4CS9 C;  3PDM P;  2R7X A;  2JX0 A;  2XRH A;  3HLZ A;  2CYD A;  1YA9 A;  3IQT A;  4MTO A;  2EPM X;  3C8G B;  1GM5 A;  5KYX B;  3LAY A;  5JT4 A;  3DI5 A;  3FOO A;  1NFN A;  3TUL A;  2NSF A;  3G4Z A;  3EGX B;  3C8G D;  1LE4 A;  2EPK X;  5EHH A;  3NMK A;  2YL3 A;  3ZTZ A;  4RBN A;  4MS2 A;  1WOL A;  4NTB A;  2HZ8 A;  3EZH A;  2AP3 A;  4LER A;  1T6Q A;  4XPY A;  3RFY A;  5DLJ A;  2HKV A;  3NG1 A;  5GPG B;  3L0I A;  2XLM A;  4O6N A;  3SP1 A;  4BJ5 A;  5T3W A;  3ZWI A;  5DS6 A;  3O55 A;  2XLH A;  4JW1 A;  3S84 A;  3O39 A;  1Y6D A;  1VLT A;  4EBJ A;  1VLS A;  2R9R B;  2EIM C;  2Q9C A;  4IAO A;  1YA7 O;  4A2N B;  3EPV A;  1DOW A;  3RVZ A;  4JJG A;  1KTM A;  3CSK A;  1LI7 A;  5JLI A;  4RD9 A;  2OJQ A;  1W2W A;  1SYQ A;  1YVI A;  1NG1 A;  3RH3 A;  3ZQV A;  1E83 A;  2P61 A;  2I8B A;  2GAQ A;  3GOD A;  5JVE A;  1M2V A;  1U6H A;  3OWT A;  2F22 A;  3DE9 A;  2J8W A;  4NCQ A;  2J9U A;  3VF0 A;  2J0W A;  4CIH A;  1XWJ A;  1AEP A;  3E70 C;  3KH2 A;  5EK0 A;  2XLD A;  2ETS A;  3RQF A;  4YT8 A;  2Q4F A;  2LIG A;  5L3Q A;  3T6J A;  2J9V A;  2OOC A;  1VTM P;  2QUP A;  1JPN A;  1D1C A;  4NTF A;  3EGD B;  5JSL A;  3IHU A;  3NDB B;  4A4A A;  1M6T A;  3ITF A;  3WG7 C;  3CQZ A;  3HJC A;  1MQV A;  4MVR A;  3DE8 A;  5DS5 A;  1R5I D;  1G4W R;  3JSZ A;  4N06 A;  2GDC A;  1YZC A;  3DJN B;  2MWQ A;  3NYM A;  4LLE A;  3U5S A;  5BQI A;  4W8P A;  2Q7R A;  3F46 A;  2KNH A;  3C18 A;  4C3D A;  2A68 F;  2BL2 A;  4QDL A;  5D92 A;  1TWC A;  1ORS C;  4LDR A;  2R7W A;  1FMW A;  4BG0 A;  5F28 E;  3B0V C;  2WZF A;  2QTV A;  2E87 A;  2GWW A;  3G4X A;  5E3A A;  3VAY A;  4C3B A;  1K04 A;  1JOG A;  1Z7Q c;  5EGY A;  1JPJ A;  5A6B A;  2A6E F;  2OG2 A;  3LS1 A;  4P9T A;  4PFO A;  4GQH A;  4MTG A;  1NBB A;  3H2V A;  4YL0 A;  4MVQ A;  3RYL A;  3KPH A;  2G3K A;  1EI7 A;  4JTA B;  3RQG A;  2Y3H A;  4E7S A;  1ZHX A;  3ECS A;  3FMS A;  4L6R A;  1NFO A;  3UR3 C;  4CX9 A;  5KYY A;  1WWP A;  1PD0 A;  1JRA A;  2VCB A;  2LCH A;  3K1I C;  4PJM A;  1ST6 A;  1K40 A;  4IWB A;  4DRJ B;  4JEA A;  4OIR F;  1M2O A;  2XLW A;  1Z6A A;  2LFF A;  5F5F A;  1VYK A;  2A1D D;  2XS1 A;  4EHP A;  5KYY B;  4CSA C;  5A6B D;  4KNV A;  3JCU Q;  5AGF A;  1XZP A;  1Q0F A;  1U89 A;  1MMN A;  3FHD A;  2LQG A;  3UMI A;  3N2Z B;  3M1C B;  2PP4 A;  3Q6N A;  3T6G B;  5B1A C;  3X1O A;  3X2Q C;  2AWY A;  5HV9 A;  2DYR C;  2AVK A;  4IGG A;  4KNW A;  3DD7 A;  4AE4 A;  1I5N A;  3B0P A;  2NG1 A;  1D0X A;  3E9V A;  3B71 A;  3RW0 A;  1M57 C;  5TJ5 E;  3OEO A;  5L0D A;  1TQG A;  3FDQ A;  4CS7 A;  2W4B A;  2BC5 A;  2Q9B A;  4W8K A;  3SXY A;  1OW8 A;  2A0U A;  5B3S C;  3QZC A;  2UUI A;  4IB4 A;  1S7Z A;  2KQ9 A;  3Q7G A;  4DVY P;  2AWC A;  1QQ3 A;  1OW6 A;  2C03 A;  3NYL A;  3UGP A;  2P6V A;  3LUT B;  5L0I A;  3T9O A;  3EH1 A;  4FX5 A;  2R7R A;  3GEE A;  3A11 A;  1JMW A;  1HE1 A;  4U5C E;  1ZVZ A;  3AG2 C;  3S28 A;  3K6B A;  1C03 A;  2HSQ A;  2XSE A;  2ZXO A;  5HSW A;  1BR4 A;  1WAT A;  2WVO A;  5JUA A;  1Q0K A;  2EIK C;  3AG4 C;  2W45 A;  1A0B A;  4OIP F;  4EKW A;  1OR3 A;  2IOQ A;  4HEA J;  2QY9 A;  2LSE A;  2VAS A;  1ZZP A;  1LM3 B;  3ABL C;  4JJF A;  2IXN A;  4LAC B;  1Z3I X;  2FFH A;  2WZL A;  5K0I A;  3G50 A;  2WVN A;  1FTS A;  2YZS A;  3C8G A;  4JCZ A;  3TOM A;  4H4K C;  4HFK B;  4O6Y A;  3U2L A;  3VYW A;  4E17 A;  3EH2 A;  1TR2 A;  4DVZ A;  1YLM A;  2XM0 A;  2HSB A;  4ZLC A;  3S0X A;  4Q7C A;  1FR0 A;  2OEV A;  3U3B A;  2QE9 A;  4MVM A;  2JPU A;  3ABM C;  4U5E E;  5BQG A;  1XZQ A;  1RMV A;  2PFD A;  2CCY A;  2P7V A;  3DKA A;  2LP4 A;  4PFP A;  3K1I A;  4O6M A;  4CDA A;  3QW0 A;  3SXM A;  2PBE A;  1A7D A;  2FGY A;  1LKX A;  256B A;  2FAP B;  2OJE D;  4XLN F;  4U5F E;  3Q7L A;  4MVU A;  4E18 A;  2XL4 A;  1Q0M A;  3DXJ F;  4CSA A;  4ULW A;  5JRA A;  5JS5 A;  2QLA A;  3LLK A;  2R25 A;  3R7C A;  4IAQ A;  3L8J A;  3C63 A;  1CGO A;  4EUK B;  3DJU B;  5B3I A;  2VC9 A;  4NTA A;  3S90 A;  4X0R A;  4CS8 C;  3IQC A;  3J06 A;  1LVK A;  1ZHT A;  2YRF A;  4MND A;  1QSP A;  3ASO C;  2AU5 A;  3MYI A;  1NLX A;  1T01 A;  2XL6 A;  4LDK A;  3ZSU A;  1RKC A;  3W8I A;  5A69 A;  1G5Z A;  2VH3 A;  4XTK A;  1BZ4 A;  1E84 A;  1QLE C;  2YL0 A;  2YLG A;  2KJG A;  4CBE A;  2EIN C;  2L81 A;  2Y3G A;  4I1M A;  4BEM J;  2YWA A;  1Y4C A;  3POV A;  2YLD A;  1M56 C;  2J9W A;  2VCA A;  3EGD A;  4HFF B;  4Z9J A;  3SNH A;  4MVZ A;  1R4T A;  4OD4 A;  3IQ5 A;  4M63 A;  4D4N A;  5BUO A;  2Y3B A;  1D1B A;  4N4W A;  1K05 A;  1C17 M;  3IEE A;  1BDJ B;  2R03 A;  1N1C A;  1TWG A;  2R7O A;  5AC5 A;  3I4U A;  3C7J A;  1H9T A;  4OIQ F;  2J9B A;  1O87 A;  3OA1 A;  3NMJ A;  3ZIB A;  2R7Q A;  3KYJ A;  3RF3 A;  1RJ9 A;  1Z23 A;  3AGT A;  1ZU4 A;  3MFN A;  1T9K A;  5L3V A;  4DBR A;  3FAJ A;  2YKZ A;  2YHS A;  4JZA A;  2DB4 A;  3B0U X;  4O7G A;  3JT1 A;  3RIP A;  4BJT A;  4CJO A;  1QZX A;  1V54 C;  1I4Z A;  3W2W A;  4Q5S F;  3JSE O;  1RJ9 B;  1H7I A;  3UMK A;  3L34 A;  4OD5 A;  3TJ6 A;  3HTK C;  3US6 A;  3QW1 A;  2KGO A;  1D1A A;  4QI0 A;  3JZ0 A;  3TD7 A;  5E33 A;  4CS9 A;  3L8I A;  5B1B C;  5T3T A;  3NKE A;  4PJN A;  2MHR A;  4U5H A;  1HY5 A;  1L7C A;  1MND A;  3RKO F;  1ZHZ A;  2HFI A;  4KBL A;  1YYJ A;  1L3P A;  3GM3 A;  4XQ1 A;  3S29 A;  2YLI A;  2D4U A;  2IM8 A;  3KYI A;  2ZXP A;  3ZC4 A;  2WZG A;  3T6B A;  3FXH A;  3PMR A;  3CAX A;  3GWN A;  2IBF A;  4ER9 A;  2XLE A;  4Z9I A;  2B0H A;  4EWC A;  3ZVR A;  4P6I C;  5COF A;  5T1D B;  3V7O A;  1OW7 A;  2L9J A;  1KU2 A;  3EQL F;  4MTF A;  2DGJ A;  4P9F A;  4Z9H A;  2NUT A;  3V5Z A;  1QPU A;  1NU7 D;  4U5B E;  4CS8 A;  2Y69 C;  3ZQY A;  4F4B A;  3UGO A;  2V26 A;  2WVQ A;  4OIO F;  4U9D A;  1D0Z A;  3NKD A;  1PV3 A;  1WAS A;  4JTD B;  5BQH A;  3EG9 B;  4CDV A;  2NUT B;  5CIV A;  1FNT c;  1A41 A;  2NSG A;  3JYH A;  1VOM A;  2IXM A;  1Q0G A;  2H8A A;  2XLV A;  3ASN C;  1VMA A;  3M4C A;  1GQA A;  2ASR A;  1FFT C;  2XXA A;  1OCZ C;  2ICW G;  2XS8 A;  4HE8 D;  2A0B A;  4Q4Z F;  2PX3 A;  2H7B A;  2L6H A;  1O3U A;  3TK0 A;  1YZA A;  2JD3 A;  4N6H A;  3SXZ A;  3HNJ A;  1E2X A;  3SZR A;  4C7O B;  3ATP A;  1IZM A;  1BR1 A;  1FFH A;  1LS1 A;  2LK4 A;  2YVK A;  2ZXR A;  1VYI A;  1G4U S;  3B9Q A;  1LPE A;  2Y39 A;  3KL4 A;  1QKR A;  3MBG A;  3MYF A;  1WN0 A;  1BR2 A;  4CIP A;  2XXA B;  4XEF A;  4YT4 A;  5KYW B;  2J7P D;  2M64 A;  4NC3 A;  2GFH A;  4D4X A;  1SZI A;  4K7B A;  2XLO A;  3M4B A;  3GM2 A;  4B6I A; 
#chains in the Genus database with same CATH homology
 4CJG A;  1CGO A;  5JSL A;  4U9E A;  1M6T A;  5B3I A;  1MQV A;  3DE8 A;  3M15 A;  1A7V A;  1YZC A;  3VRC A;  4CDY A;  2XL6 A;  2XL8 A;  1E84 A;  2YLG A;  2YL0 A;  3C62 A;  2YLD A;  1EKY A;  1NBB A;  3IQ5 A;  4D4N A;  4N4W A;  4L6R A;  4CX9 A;  2XM4 A;  4JE9 A;  3IQ6 A;  2J9B A;  4WGZ A;  1YYX A;  3NMJ A;  4JEA A;  2XLW A;  3HNI A;  1BBH A;  3HNL A;  5AGF A;  4EIY A;  1E85 A;  2YKZ A;  4JKV A;  4CJO A;  1CPR A;  2YL1 A;  3M79 A;  3NMI A;  3QW1 A;  1CPQ A;  3HNK A;  2BC5 A;  3L1M A;  3QVZ A;  4IB4 A;  5JLI A;  1QQ3 A;  1CGN A;  1YYJ A;  1JAF A;  3FOP A;  2YLI A;  3U8P A;  4IAR A;  5JP7 A;  4ER9 A;  2XLE A;  5JT4 A;  1E86 A;  3FOO A;  5JUA A;  4WGY A;  1QPU A;  1S05 A;  3NMK A;  2YL3 A;  3ZQY A;  3ZTZ A;  4U9D A;  1LM3 B;  2XLM A;  4CDV A;  3ZWI A;  2XLH A;  2XLV A;  3TOM A;  3M4C A;  1GQA A;  2XM0 A;  3QVY A;  3ZQV A;  1E83 A;  4JEB A;  1YZA A;  4N6H A;  2CCY A;  3HNJ A;  4ULV A;  1APC A;  5JVE A;  1RCP A;  4CDA A;  3DE9 A;  3QW0 A;  4CIP A;  2J8W A;  256B A;  2XLD A;  4NC3 A;  3ZTM A;  4D4X A;  2YL7 A;  3TOL A;  5JRA A;  2XLO A;  3M4B A;  5JS5 A;  2QLA A;  4IAQ A;  3C63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...