4CJOA

Spectroscopically-validated structure of ferrous cytochrome c prime from alcaligenes xylosoxidans, reduced at 180k using x-rays
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 48
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cjoA00
3TOMA 4CJOA 1CGNA 4CDYA 1CGOA 2YL7A 4IB4A 1YZCA 3QVZA 4JKVA 3ZWIA 1E86A 2YL3A 4WGYA 3ZQYA 256BA 2XLEA 4JEBA 5JSLA 2XLMA 3L1MA 3NMIA 4U9DA 5JT4A 2J9BA 2XLVA 3DE9A 1QPUA 1YYXA 1M6TA 5AGFA 3QVYA 4ER9A 5JLIA 1E85A 3HNJA 3M4CA 3HNLA 5JRAA 4N6HA 2XLOA 1A7VA 3C63A 2XM4A 1NBBA 4D4XA 5JVEA 1LM3B 1JAFA 1EKYA 3HNKA 5JP7A 1QQ3A 4IAQA 3QW0A 2XLHA 4WGZA 4CDAA 3VRCA 2J8WA 5JS5A 1RCPA 4N4WA 3C62A 4ULVA 2XLDA 4IARA 2XL8A 3NMKA 3ZQVA 1MQVA 2YL1A 4CIPA 2BC5A 2YLIA 4JE9A 3TOLA 3ZTMA 4CJGA 3M4BA 3QW1A 4CX9A 1YZAA 3U8PA 3IQ5A 2YLGA 1CPQA 2YL0A 3IQ6A 1E83A 2YLDA 3FOOA 3ZTZA 1GQAA 4CDVA 3HNIA 1E84A 1APCA 1YYJA 2XM0A 4D4NA 3NMJA 3M15A 4JEAA 4U9EA 1BBHA 2CCYA 3DE8A 3FOPA 3M79A 1S05A 4EIYA 4L6RA 2XL6A 1CPRA 2QLAA 4NC3A 5B3IA 2XLWA 2YKZA 5JUAA
chains in the Genus database with same CATH superfamily
3TJ6A 3S84A 1WTYA 4NY3A 2QE9A 1CGOA 3IPMO 3CZ6A 4IB4A 4B6IA 3KYIA 1ZU5A 1AEPA 1BDJB 4H54A 4JKVA 5D92A 3KL4A 3JZ0A 1E86A 3FHDA 3DI5A 2QTVA 3N24A 3SXKA 3U2MA 2OKUA 3ZQYA 2OQMA 4DVYP 3WG7C 5E3CA 2AU5A 2FGYA 2P1AA 2XLEA 3CSKA 1QKRA 4JEBA 4OIRF 3H65A 5EHHA 3LLIA 3JYHA 3L1MA 2J0WA 2DYRC 3UMIA 2R7SA 1G4WR 4RBNA 3T6BA 1FFHA 1QVXA 2IXMA 1Q0GA 3VAYA 2LP4A 2KJGA 3CQZA 1UG7A 1FAPB 3QVYA 2PF4E 3JSEO 3UR3C 4J30B 1TFOB 2LSEA 2KNHA 3K33A 2LK4A 3HTKC 5CIVA 3T9OA 1RMVA 3DM9B 3HNLA 3K1HA 5JRAA 2XLOA 2R7OA 1G5ZA 1XZQA 1VB5A 2MYSA 3Q6NA 5DS5A 3EGXA 1B68A 2P6VA 3DXJF 1LE2A 4J7YA 2EILC 3H2VA 5HV9A 2HSBA 3U8VA 2RD9A 3MYFA 3PMRA 4D4XA 2J46A 4LLEA 5JP7A 1QZXA 2WVOA 2Y3GA 4XWJA 3VYWA 3B0VC 3JCUQ 4Q7CA 3TULA 2XSEA 1ORYA 1RXQA 3FAPB 5B3SC 3EHNA 2EPMX 2G3KA 1EA8A 4JURI 3K1IA 5T3TA 1PCXA 4GYTA 3VRCA 4H4KC 3DMDA 2J8WA 4CDAA 3DAFA 2R03A 4JZAA 4MVRA 2DI3A 1JMWA 4IARA 3VF0A 3RQGA 3W8HA 2XL8A 2PX0A 5B1BC 3B0UX 3ASOC 2BE5F 2OU6A 4O79A 3SZRA 4J32B 4EBKA 1T9KA 1J8YF 2KC3A 3C8GD 3US6A 4PJLA 2YL1A 2XS8A 1H6GA 2WVQA 4YT2A 2A69F 4JRZA 1ZVZA 4MVOA 4JVSA 1HY5A 3WHNA 3ZC4A 4BEMJ 5L0JA 4CJGA 3GEHA 5AC5A 4LDKA 2HS5A 3C8GB 1V55C 2I8BA 1YZAA 1TWHA 4M63A 1D0YA 3GANA 4KNVA 1I4YA 4GEHA 1OKKD 3RIPA 4UDVA 4Q5SF 4KC9A 3SXZA 2YL0A 3S9OA 2CDQA 2ZD9A 3Q6MA 4RDAA 4PJMA 5FCLA 1RKEA 5BQGA 4DRIB 3KH2A 4YK5A 4YN0B 1GQAA 5L0GA 4MNDA 1VTMP 4K7BA 4AE4A 3ZSUA 1APCA 4N06A 2W45A 1ZZPA 1YYJA 4BJ6A 2DGJA 1LPEA 4LACB 2L9JA 2AWYA 2WVNA 4X0RA 2OJQA 1WN0A 4JCHA 1R4TA 3RYLA 2HUJA 2PFDA 4O6MA 4U5BE 3EG9B 1IW7F 3BRJA 1TWAA 1H9TA 3SYNA 1L7CA 4XQ1A 2J9VA 2KYHA 1OQCA 2IXNA 1S7ZA 3ATPA 3M79A 2R05A 5TJ5E 4EIYA 1LS1A 2O9XA 2J45A 4PJNA 3S0XA 4MVZA 2PNOA 2P7VA 3W2VA 1RKCA 2NUPB 1KU2A 3FAJA 3MBGA 2W9YA 2WZGA 3AG4C 4K0DA 3T6GB 4JW1A 2NUTA 2HJ3A 1T6UA 3EZHA 1TWGA 3MX3A 1HMOA 2YKZA 4KI2A 1IZMA 3TOMA 4FESA 2P61A 3G4ZA 3EH2A 4U5EE 3RKOF 1TR2A 5A69A 3FMSA 4I44A 4BJ5A 1SMYF 3ZWIA 3GWNA 4GQHA 2Y39A 2QNLA 2JX0A 1M2OA 1VLTA 256BA 2AP3A 4LDQA 4N6CA 1SR2A 2V3CC 1OR3A 5HSWA 1D1AA 1MNEA 3A9CA 2XLMA 4BJ1A 3L8IA 3ZIBA 1FFTC 3G4XA 2L6FA 2VCBA 3RVZA 3NKEA 5A6KA 4NTBA 4IAOA 1OW7A 1YJGA 2AVKA 2KGOA 2OCCC 1F1MA 3JT1A 3LS1A 4O7GA 4CS8A 4EWCA 1WATA 4U5DE 3PHF2 3C18A 1U0BB 3SEOA 2OG2A 1MMGA 3KKBA 4MVQA 5KYUA 3O55A 1ZHTA 2XS1A 1A0BA 5COMA 1K05A 3I5QA 5DVWA 5KYYB 4CSAC 2HSQA 3TD7A 1ZU4A 3LESA 5JLIA 1NU9C 1YDIA 2JD3A 3MLGA 5KYNA 2PX3A 1OXBA 3M4CA 1D0ZA 3GEIA 3ABKC 4IRUA 2GAQA 4OINF 4RD9A 2OOCA 2X51A 1A7VA 4WJ0A 5EK0A 1YVIA 3JRTA 2HFIA 2VH3A 4HEAJ 1O87A 2Q4FA 2XXAB 3C63A 2XM4A 4Z9IA 3RVYA 3ECSA 1VOMA 4YL0A 3E9VA 5JVEA 5COFA 5DQTA 1JOGA 2A6EF 2B0HA 5BQHA 1JR8A 2TMVP 3LAYA 1GGQA 3B71A 4OD4A 3DKAA 5E33A 3SXYA 1K40A 2XLHA 5A6BD 1TWCA 2VB6A 4NTFA 5E2QA 1DOVA 3HKKA 1T01A 3C8ZA 3KPHA 4QDLA 4YWQA 1T6QA 3U2LA 3AJMA 2R7UA 3F46A 1E2XA 1MQVA 2R7XA 1VMAA 2UUIA 3U3FA 1LI5A 1H7IA 4BG0A 1VYKA 3UMHA 2HV6A 4DBRA 1GS9A 5T3WA 4G7ZF 1G8XA 3C7JA 2BC5A 3ABLC 4ZLDA 2LCHA 4O6NA 5KYXA 5KYWA 3PDMP 3DJUB 3SXMA 1N1CA 4NTAA 2B0JA 2LQGA 2YHSA 1BR1A 1ZW2A 2ZXPA 3EGDB 3EPVA 4MTFA 2YLGA 4WABA 2Q7RA 2CNWA 4AX2A 4DVZA 1A7EA 5L0DA 1H9GA 3OEOA 3NDBB 2VC9A 5T1DB 1U89A 3IQ6A 1E83A 1M2VB 2YLDA 2R7WA 5F28E 4JJFA 3W8IA 5D91A 1YA7O 3FOOA 1HW2A 1JPJA 4EKWA 4CDVA 1Z3IX 1XWJA 2H7OA 1V74B 1Z23A 2HZ8A 2WZLA 3G50A 1E84A 2DYSC 2GDCA 4XEFA 4OIOF 1NSGB 4P9FA 3EFOA 3NMJA 3U9JA 4DXWA 2L7AA 4JIOA 2I15A 4C3BA 2GWWA 1MMDA 1V4AA 4U9EA 3U5SA 3L8JA 2R9RB 1K04A 3IQTA 1YARO 4NCQA 1C03A 1PD0A 3AOUA 2XL6A 1DOWA 2H7VC 2J7PA 1I4ZA 2IYLD 3PCVA 3IQCA 3GM1A 2QLAA 4NC3A 2KSFA 1ZW3A 1ORSC 2XLWA 4QI0A 1OR2A 2A0BA 4U5CE 4A4AA 4DJ9A 1ST6A 2A0UA 2IBFA 4DOZA 3O6XA 1QSPA 4IJJA 4P9TA 1Y4CA 1CGNA 1Z7Qc 4CS9A 3FXHA 1MNDA 2WB7A 2Q00A 4FWVA 4YL3A 1YZCA 4AL1A 2ASRA 3QVZA 2QUPA 3EH1A 3O10A 4G78A 5A6BA 4LLCA 4U5FE 3POVA 1Z6AA 1RJ9B 2YL3A 1G4US 2KK1A 3NYMA 3ITFA 4MTOA 3K6BA 3OA1A 2EPKX 5JSLA 2FAPB 2YEVA 2C03A 3T6JA 3NMIA 1WWPA 5DLJA 5GPGB 5JT4A 2WL8A 2Y3DA 2F22A 1Z5ZA 4DBQA 4JCZA 2OEVA 1QPUA 5AC4A 1JPNA 1YYXA 3RF3A 5L3QA 2ZPAA 4FX5A 2GA0A 2Z15A 3WODF 3AGUA 2MWQA 4XLPF 5AGFA 3DD7A 2LFDA 1VK5A 3KMIA 4JTDB 4ER9A 3QZCA 1NU7D 4C3EA 3HJCA 2M64A 3DM5A 2A6HF 3HNJA 1FTSA 4U5GA 5IY5C 3R7CA 3J06A 1FR0A 4JTAB 4E0IA 3N2ZB 3NKDA 4MVMA 1A41A 3K7DA 2VCCA 4N6HA 2HJMA 4E18A 4BPMA 1O3UA 1NFOA 2IXPA 3V7OA 1U6HA 3ABMC 3GODA 4XTKA 3UGOA 1NBBA 3GORA 2OEXA 4MS2A 3HLZA 1OW8A 1Z63A 1EKYA 3HNKA 1Y6DA 3EGXB 4MW8A 3NRHA 4YT4A 1FNTc 2CYDA 2IM8A 3JYYA 2HKVA 3KYJA 2QY9A 4E0HA 1LVKA 2HMZA 2G3VA 1ZHZA 2EIJC 2ICWG 2M4EA 2R02A 3LEOA 1EI7A 2NPUA 3QW0A 4IAQA 1NLXA 1A7DA 2J9UA 5JS5A 2PBEA 4N4WA 1SYQA 3F47A 1HMDA 4XLNF 2XLDA 3QMKA 3NMKA 4MVUA 4CSAA 2J0XA 4IGGA 1EQ1A 4MW3A 4Z9JA 4PFOA 3C8GA 3BEHA 4PACA 1YA9A 4MTGA 4MVSA 3S27A 3AG3C 2KW3C 1PV3A 4EUKB 4KBLA 4CIPA 1MMNA 1Q0FA 4C7OA 1OW6A 3AG1C 3TOLA 2YLIA 1LS4A 3ZTMA 1HE9A 2Q9AA 2A1DD 3AGTA 3EFOB 1NG1A 4IWBA 3X2QC 4CX9A 2R7VA 2J7PD 3L34A 4ONSA 4G0HA 3EZIA 1OKKA 4K1OA 4A2NB 4FAPB 2EPNA 4YJWA 3RH3A 1CPQA 2L6HA 4DRJB 1J8MF 1NZEA 3S90A 5L0FA 1T5OA 3DWWA 3I5PA 3UNGC 4Z9HA 3U9MA 1KTMA 2IOQA 2JPUA 3LS0A 1W2WA 2MHRA 3EG9A 2UUHA 4W8KA 3JRMO 2XM0A 3RW0A 5CI8A 4J7TA 1RKEB 2G62A 3RQEA 2W4MA 2RSEB 3GEEA 4XEVA 2EPOA 4PFPA 4AE4B 1D1BA 2NUPA 2OJED 4YL1A 3SNHA 1BBHA 2EIKC 3VM6A 2KQ9A 2E87A 3DE8A 3FOPA 5L0IA 1S05A 2J9WA 1Q0DA 1SZIA 2LIGA 3UGPA 3Q7GA 4R32A 3AQBA 5FZTA 3V5ZA 4OIPF 1OCRC 5K0IA 4HE8D 4YT8A 5B3IA 1MMAA 1ZHWA 2Q9CA 4OD5A 1I5NA 1LI7A 2H8AA 4JC7A 3LUTB 5JUAA 5COGA 4ZLCA 2A68F 3IEEA 3L0IA 4CJOA 1QLEC 3K66A 4CDYA 2YL7A 1HE1A 4PK4A 3U3BA 3LEVA 3UMKA 1OCCC 1D0XA 2NUTB 1GM5A 4CS7A 1JRAA 1PD1A 3B0PA 3AG2C 3S28A 3ZVRA 1WGWA 3EJNA 4WGYA 3FDQA 2Y3BA 4QI2A 3V5XA 4YT5A 4JTCB 1CGME 3GM3A 3NG1A 5A6JA 1WOLA 2LFFA 3MYIA 4U9DA 5DQZA 2VCAA 3U0CA 3M1CB 2J9BA 5DS6A 2XLVA 3DE9A 3EQLF 5B1AC 4EBJA 5KYYA 1VLSA 3AQCA 3K1IC 3ZDLA 4BJTA 4O6YA 2X0CA 1T6IA 1YLMA 4DRHB 1VYIA 1M6TA 3QTHA 2Q3TA 1HW1A 3TJ5A 4I1OB 1E85A 1AVOB 3JSZA 2D4UA 3I4UA 5CI9A 4EBBA 1AUEA 3IHUA 3NYJA 1M57C 2XXAA 2R7TA 1UFBA 5KYUB 2ETSA 4XPWA 4W8PA 2V26A 2CGEA 4BEJA 1OCOC 5E3AA 1TQGA 1TFKB 1R5ID 3W4YA 1FMVA 2EIMC 4E7ZA 2Q9BA 3H2UA 4XPXA 1XZPA 3T4RA 2CW0F 2YZSA 2C04A 2ZXWC 1LM3B 1JAFA 1OCZC 3DAGA 4NQFA 4KNWA 4C7OB 2R7QA 3B9QA 3WAQA 4CS9C 1QQ3A 2IXOA 2L81A 4I1MA 4LERA 4ANJA 3MFNA 3DZAA 3N0TA 1M56C 2HV7A 4WGZA 2YVKA 3TK0A 4BJ6C 1ZHXA 4MQ9F 1L3PA 2EPLX 2HMQA 3GM2A 4I3MA 1RCPA 2YWAA 2Y3HA 3C62A 4ULVA 5DS4A 3R2PA 3ZQVA 3GWLA 2W4BA 4G7HF 2VASA 1TKNA 1Q0MA 1FMWA 1BZ4A 4AK9A 1LIHA 5F5HA 3FVYA 3E70C 1C02A 4AL0A 3EGDA 1BR2A 1V54C 4PR9A 1BR4A 2Y69C 4JE9A 2YRFA 1D1CA 2PP4A 4U5HA 3W2WA 1M2VA 3RQFA 3M4BA 3QW1A 3U8PA 3JTLO 3LLKA 3IQ5A 4XEKA 3V5YA 4CBEA 4EHPA 2ZXOA 3X1OA 3ZG1A 2XL4A 1NFNA 2CNWD 2LD6A 5KYWB 5KYXB 4G7OF 2R25A 2H7BA 2EINC 2NSGA 2ZXRA 4F4BA 2XRHA 3LNRA 4JJGA 3RFYA 4BJ5C 1WASA 1YAUO 2YQYA 4E17A 3ZTZA 1C17M 3NYLA 1LKXA 3ASNC 3HNIA 2WZFA 1SF8A 3LNMB 2NSFA 4P6IC 2L6GA 3OWTA 3DJNB 1ZYRF 2GFHA 3S29A 4LDRA 4XPYA 2R7RA 2BL2A 1KNYA 4D4NA 4Q4ZF 3EHMA 4OIQF 2D5RB 3M15A 4JEAA 4E7SA 4PJJA 4CS8C 3B29A 2CCYA 3CEXA 5BQIA 5L3VA 2AWCA 3O39A 1O5HA 4HFFB 4C3DA 5BUOA 1Q0KA 2P0NA 3TQOA 5EGYA 4L6RA 2DB4A 2NG1A 4ULWA 4CIHA 5L0CA 1ORJA 5L0HA 1CPRA 3CAXA 1OXKA 3LJBA 3Q7LA 3SP1A 5F5FA 1ZHYA 4HFKB 1LE4A 2FFHA 5A6AA 3A11A 1RJ9A
chains in the Genus database with same CATH topology
3TOMA 4CJOA 1CGNA 4CDYA 1CGOA 2YL7A 4IB4A 1YZCA 3QVZA 4JKVA 3ZWIA 1E86A 2YL3A 4WGYA 3ZQYA 256BA 2XLEA 4JEBA 5JSLA 2XLMA 3L1MA 3NMIA 4U9DA 5JT4A 2J9BA 2XLVA 3DE9A 1QPUA 1YYXA 1M6TA 5AGFA 3QVYA 4ER9A 5JLIA 1E85A 3HNJA 3M4CA 3HNLA 5JRAA 4N6HA 2XLOA 1A7VA 3C63A 2XM4A 1NBBA 4D4XA 5JVEA 1LM3B 1JAFA 1EKYA 3HNKA 5JP7A 1QQ3A 4IAQA 3QW0A 2XLHA 4WGZA 4CDAA 3VRCA 2J8WA 5JS5A 1RCPA 4N4WA 3C62A 4ULVA 2XLDA 4IARA 2XL8A 3NMKA 3ZQVA 1MQVA 2YL1A 4CIPA 2BC5A 2YLIA 4JE9A 3TOLA 3ZTMA 4CJGA 3M4BA 3QW1A 4CX9A 1YZAA 3U8PA 3IQ5A 2YLGA 1CPQA 2YL0A 3IQ6A 1E83A 2YLDA 3FOOA 3ZTZA 1GQAA 4CDVA 3HNIA 1E84A 1APCA 1YYJA 2XM0A 4D4NA 3NMJA 3M15A 4JEAA 4U9EA 1BBHA 2CCYA 3DE8A 3FOPA 3M79A 1S05A 4EIYA 4L6RA 2XL6A 1CPRA 2QLAA 4NC3A 5B3IA 2XLWA 2YKZA 5JUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOM A;  4CJO A;  1CGN A;  4CDY A;  1CGO A;  2YL7 A;  4IB4 A;  1YZC A;  3QVZ A;  4JKV A;  3ZWI A;  1E86 A;  2YL3 A;  4WGY A;  3ZQY A;  256B A;  2XLE A;  4JEB A;  5JSL A;  2XLM A;  3L1M A;  3NMI A;  4U9D A;  5JT4 A;  2J9B A;  2XLV A;  3DE9 A;  1QPU A;  1YYX A;  1M6T A;  5AGF A;  3QVY A;  4ER9 A;  5JLI A;  1E85 A;  3HNJ A;  3M4C A;  3HNL A;  5JRA A;  4N6H A;  2XLO A;  1A7V A;  3C63 A;  2XM4 A;  1NBB A;  4D4X A;  5JVE A;  1LM3 B;  1JAF A;  1EKY A;  3HNK A;  5JP7 A;  1QQ3 A;  4IAQ A;  3QW0 A;  2XLH A;  4WGZ A;  4CDA A;  3VRC A;  2J8W A;  5JS5 A;  1RCP A;  4N4W A;  3C62 A;  4ULV A;  2XLD A;  4IAR A;  2XL8 A;  3NMK A;  3ZQV A;  1MQV A;  2YL1 A;  4CIP A;  2BC5 A;  2YLI A;  4JE9 A;  3TOL A;  3ZTM A;  4CJG A;  3M4B A;  3QW1 A;  4CX9 A;  1YZA A;  3U8P A;  3IQ5 A;  2YLG A;  1CPQ A;  2YL0 A;  3IQ6 A;  1E83 A;  2YLD A;  3FOO A;  3ZTZ A;  1GQA A;  4CDV A;  3HNI A;  1E84 A;  1APC A;  1YYJ A;  2XM0 A;  4D4N A;  3NMJ A;  3M15 A;  4JEA A;  4U9E A;  1BBH A;  2CCY A;  3DE8 A;  3FOP A;  3M79 A;  1S05 A;  4EIY A;  4L6R A;  2XL6 A;  1CPR A;  2QLA A;  4NC3 A;  5B3I A;  2XLW A;  2YKZ A;  5JUA A; 
#chains in the Genus database with same CATH topology
 3TJ6 A;  3S84 A;  1WTY A;  4NY3 A;  2QE9 A;  1CGO A;  3IPM O;  3CZ6 A;  4IB4 A;  4B6I A;  3KYI A;  1ZU5 A;  1AEP A;  1BDJ B;  4H54 A;  4JKV A;  5D92 A;  3KL4 A;  3JZ0 A;  1E86 A;  3FHD A;  3DI5 A;  2QTV A;  3N24 A;  3SXK A;  3U2M A;  2OKU A;  3ZQY A;  2OQM A;  4DVY P;  3WG7 C;  5E3C A;  2AU5 A;  2FGY A;  2P1A A;  2XLE A;  3CSK A;  1QKR A;  4JEB A;  4OIR F;  3H65 A;  5EHH A;  3LLI A;  3JYH A;  3L1M A;  2J0W A;  2DYR C;  3UMI A;  2R7S A;  1G4W R;  4RBN A;  3T6B A;  1FFH A;  1QVX A;  2IXM A;  1Q0G A;  3VAY A;  2LP4 A;  2KJG A;  3CQZ A;  1UG7 A;  1FAP B;  3QVY A;  2PF4 E;  3JSE O;  3UR3 C;  4J30 B;  1TFO B;  2LSE A;  2KNH A;  3K33 A;  2LK4 A;  3HTK C;  5CIV A;  3T9O A;  1RMV A;  3DM9 B;  3HNL A;  3K1H A;  5JRA A;  2XLO A;  2R7O A;  1G5Z A;  1XZQ A;  1VB5 A;  2MYS A;  3Q6N A;  5DS5 A;  3EGX A;  1B68 A;  2P6V A;  3DXJ F;  1LE2 A;  4J7Y A;  2EIL C;  3H2V A;  5HV9 A;  2HSB A;  3U8V A;  2RD9 A;  3MYF A;  3PMR A;  4D4X A;  2J46 A;  4LLE A;  5JP7 A;  1QZX A;  2WVO A;  2Y3G A;  4XWJ A;  3VYW A;  3B0V C;  3JCU Q;  4Q7C A;  3TUL A;  2XSE A;  1ORY A;  1RXQ A;  3FAP B;  5B3S C;  3EHN A;  2EPM X;  2G3K A;  1EA8 A;  4JUR I;  3K1I A;  5T3T A;  1PCX A;  4GYT A;  3VRC A;  4H4K C;  3DMD A;  2J8W A;  4CDA A;  3DAF A;  2R03 A;  4JZA A;  4MVR A;  2DI3 A;  1JMW A;  4IAR A;  3VF0 A;  3RQG A;  3W8H A;  2XL8 A;  2PX0 A;  5B1B C;  3B0U X;  3ASO C;  2BE5 F;  2OU6 A;  4O79 A;  3SZR A;  4J32 B;  4EBK A;  1T9K A;  1J8Y F;  2KC3 A;  3C8G D;  3US6 A;  4PJL A;  2YL1 A;  2XS8 A;  1H6G A;  2WVQ A;  4YT2 A;  2A69 F;  4JRZ A;  1ZVZ A;  4MVO A;  4JVS A;  1HY5 A;  3WHN A;  3ZC4 A;  4BEM J;  5L0J A;  4CJG A;  3GEH A;  5AC5 A;  4LDK A;  2HS5 A;  3C8G B;  1V55 C;  2I8B A;  1YZA A;  1TWH A;  4M63 A;  1D0Y A;  3GAN A;  4KNV A;  1I4Y A;  4GEH A;  1OKK D;  3RIP A;  4UDV A;  4Q5S F;  4KC9 A;  3SXZ A;  2YL0 A;  3S9O A;  2CDQ A;  2ZD9 A;  3Q6M A;  4RDA A;  4PJM A;  5FCL A;  1RKE A;  5BQG A;  4DRI B;  3KH2 A;  4YK5 A;  4YN0 B;  1GQA A;  5L0G A;  4MND A;  1VTM P;  4K7B A;  4AE4 A;  3ZSU A;  1APC A;  4N06 A;  2W45 A;  1ZZP A;  1YYJ A;  4BJ6 A;  2DGJ A;  1LPE A;  4LAC B;  2L9J A;  2AWY A;  2WVN A;  4X0R A;  2OJQ A;  1WN0 A;  4JCH A;  1R4T A;  3RYL A;  2HUJ A;  2PFD A;  4O6M A;  4U5B E;  3EG9 B;  1IW7 F;  3BRJ A;  1TWA A;  1H9T A;  3SYN A;  1L7C A;  4XQ1 A;  2J9V A;  2KYH A;  1OQC A;  2IXN A;  1S7Z A;  3ATP A;  3M79 A;  2R05 A;  5TJ5 E;  4EIY A;  1LS1 A;  2O9X A;  2J45 A;  4PJN A;  3S0X A;  4MVZ A;  2PNO A;  2P7V A;  3W2V A;  1RKC A;  2NUP B;  1KU2 A;  3FAJ A;  3MBG A;  2W9Y A;  2WZG A;  3AG4 C;  4K0D A;  3T6G B;  4JW1 A;  2NUT A;  2HJ3 A;  1T6U A;  3EZH A;  1TWG A;  3MX3 A;  1HMO A;  2YKZ A;  4KI2 A;  1IZM A;  3TOM A;  4FES A;  2P61 A;  3G4Z A;  3EH2 A;  4U5E E;  3RKO F;  1TR2 A;  5A69 A;  3FMS A;  4I44 A;  4BJ5 A;  1SMY F;  3ZWI A;  3GWN A;  4GQH A;  2Y39 A;  2QNL A;  2JX0 A;  1M2O A;  1VLT A;  256B A;  2AP3 A;  4LDQ A;  4N6C A;  1SR2 A;  2V3C C;  1OR3 A;  5HSW A;  1D1A A;  1MNE A;  3A9C A;  2XLM A;  4BJ1 A;  3L8I A;  3ZIB A;  1FFT C;  3G4X A;  2L6F A;  2VCB A;  3RVZ A;  3NKE A;  5A6K A;  4NTB A;  4IAO A;  1OW7 A;  1YJG A;  2AVK A;  2KGO A;  2OCC C;  1F1M A;  3JT1 A;  3LS1 A;  4O7G A;  4CS8 A;  4EWC A;  1WAT A;  4U5D E;  3PHF 2;  3C18 A;  1U0B B;  3SEO A;  2OG2 A;  1MMG A;  3KKB A;  4MVQ A;  5KYU A;  3O55 A;  1ZHT A;  2XS1 A;  1A0B A;  5COM A;  1K05 A;  3I5Q A;  5DVW A;  5KYY B;  4CSA C;  2HSQ A;  3TD7 A;  1ZU4 A;  3LES A;  5JLI A;  1NU9 C;  1YDI A;  2JD3 A;  3MLG A;  5KYN A;  2PX3 A;  1OXB A;  3M4C A;  1D0Z A;  3GEI A;  3ABK C;  4IRU A;  2GAQ A;  4OIN F;  4RD9 A;  2OOC A;  2X51 A;  1A7V A;  4WJ0 A;  5EK0 A;  1YVI A;  3JRT A;  2HFI A;  2VH3 A;  4HEA J;  1O87 A;  2Q4F A;  2XXA B;  3C63 A;  2XM4 A;  4Z9I A;  3RVY A;  3ECS A;  1VOM A;  4YL0 A;  3E9V A;  5JVE A;  5COF A;  5DQT A;  1JOG A;  2A6E F;  2B0H A;  5BQH A;  1JR8 A;  2TMV P;  3LAY A;  1GGQ A;  3B71 A;  4OD4 A;  3DKA A;  5E33 A;  3SXY A;  1K40 A;  2XLH A;  5A6B D;  1TWC A;  2VB6 A;  4NTF A;  5E2Q A;  1DOV A;  3HKK A;  1T01 A;  3C8Z A;  3KPH A;  4QDL A;  4YWQ A;  1T6Q A;  3U2L A;  3AJM A;  2R7U A;  3F46 A;  1E2X A;  1MQV A;  2R7X A;  1VMA A;  2UUI A;  3U3F A;  1LI5 A;  1H7I A;  4BG0 A;  1VYK A;  3UMH A;  2HV6 A;  4DBR A;  1GS9 A;  5T3W A;  4G7Z F;  1G8X A;  3C7J A;  2BC5 A;  3ABL C;  4ZLD A;  2LCH A;  4O6N A;  5KYX A;  5KYW A;  3PDM P;  3DJU B;  3SXM A;  1N1C A;  4NTA A;  2B0J A;  2LQG A;  2YHS A;  1BR1 A;  1ZW2 A;  2ZXP A;  3EGD B;  3EPV A;  4MTF A;  2YLG A;  4WAB A;  2Q7R A;  2CNW A;  4AX2 A;  4DVZ A;  1A7E A;  5L0D A;  1H9G A;  3OEO A;  3NDB B;  2VC9 A;  5T1D B;  1U89 A;  3IQ6 A;  1E83 A;  1M2V B;  2YLD A;  2R7W A;  5F28 E;  4JJF A;  3W8I A;  5D91 A;  1YA7 O;  3FOO A;  1HW2 A;  1JPJ A;  4EKW A;  4CDV A;  1Z3I X;  1XWJ A;  2H7O A;  1V74 B;  1Z23 A;  2HZ8 A;  2WZL A;  3G50 A;  1E84 A;  2DYS C;  2GDC A;  4XEF A;  4OIO F;  1NSG B;  4P9F A;  3EFO A;  3NMJ A;  3U9J A;  4DXW A;  2L7A A;  4JIO A;  2I15 A;  4C3B A;  2GWW A;  1MMD A;  1V4A A;  4U9E A;  3U5S A;  3L8J A;  2R9R B;  1K04 A;  3IQT A;  1YAR O;  4NCQ A;  1C03 A;  1PD0 A;  3AOU A;  2XL6 A;  1DOW A;  2H7V C;  2J7P A;  1I4Z A;  2IYL D;  3PCV A;  3IQC A;  3GM1 A;  2QLA A;  4NC3 A;  2KSF A;  1ZW3 A;  1ORS C;  2XLW A;  4QI0 A;  1OR2 A;  2A0B A;  4U5C E;  4A4A A;  4DJ9 A;  1ST6 A;  2A0U A;  2IBF A;  4DOZ A;  3O6X A;  1QSP A;  4IJJ A;  4P9T A;  1Y4C A;  1CGN A;  1Z7Q c;  4CS9 A;  3FXH A;  1MND A;  2WB7 A;  2Q00 A;  4FWV A;  4YL3 A;  1YZC A;  4AL1 A;  2ASR A;  3QVZ A;  2QUP A;  3EH1 A;  3O10 A;  4G78 A;  5A6B A;  4LLC A;  4U5F E;  3POV A;  1Z6A A;  1RJ9 B;  2YL3 A;  1G4U S;  2KK1 A;  3NYM A;  3ITF A;  4MTO A;  3K6B A;  3OA1 A;  2EPK X;  5JSL A;  2FAP B;  2YEV A;  2C03 A;  3T6J A;  3NMI A;  1WWP A;  5DLJ A;  5GPG B;  5JT4 A;  2WL8 A;  2Y3D A;  2F22 A;  1Z5Z A;  4DBQ A;  4JCZ A;  2OEV A;  1QPU A;  5AC4 A;  1JPN A;  1YYX A;  3RF3 A;  5L3Q A;  2ZPA A;  4FX5 A;  2GA0 A;  2Z15 A;  3WOD F;  3AGU A;  2MWQ A;  4XLP F;  5AGF A;  3DD7 A;  2LFD A;  1VK5 A;  3KMI A;  4JTD B;  4ER9 A;  3QZC A;  1NU7 D;  4C3E A;  3HJC A;  2M64 A;  3DM5 A;  2A6H F;  3HNJ A;  1FTS A;  4U5G A;  5IY5 C;  3R7C A;  3J06 A;  1FR0 A;  4JTA B;  4E0I A;  3N2Z B;  3NKD A;  4MVM A;  1A41 A;  3K7D A;  2VCC A;  4N6H A;  2HJM A;  4E18 A;  4BPM A;  1O3U A;  1NFO A;  2IXP A;  3V7O A;  1U6H A;  3ABM C;  3GOD A;  4XTK A;  3UGO A;  1NBB A;  3GOR A;  2OEX A;  4MS2 A;  3HLZ A;  1OW8 A;  1Z63 A;  1EKY A;  3HNK A;  1Y6D A;  3EGX B;  4MW8 A;  3NRH A;  4YT4 A;  1FNT c;  2CYD A;  2IM8 A;  3JYY A;  2HKV A;  3KYJ A;  2QY9 A;  4E0H A;  1LVK A;  2HMZ A;  2G3V A;  1ZHZ A;  2EIJ C;  2ICW G;  2M4E A;  2R02 A;  3LEO A;  1EI7 A;  2NPU A;  3QW0 A;  4IAQ A;  1NLX A;  1A7D A;  2J9U A;  5JS5 A;  2PBE A;  4N4W A;  1SYQ A;  3F47 A;  1HMD A;  4XLN F;  2XLD A;  3QMK A;  3NMK A;  4MVU A;  4CSA A;  2J0X A;  4IGG A;  1EQ1 A;  4MW3 A;  4Z9J A;  4PFO A;  3C8G A;  3BEH A;  4PAC A;  1YA9 A;  4MTG A;  4MVS A;  3S27 A;  3AG3 C;  2KW3 C;  1PV3 A;  4EUK B;  4KBL A;  4CIP A;  1MMN A;  1Q0F A;  4C7O A;  1OW6 A;  3AG1 C;  3TOL A;  2YLI A;  1LS4 A;  3ZTM A;  1HE9 A;  2Q9A A;  2A1D D;  3AGT A;  3EFO B;  1NG1 A;  4IWB A;  3X2Q C;  4CX9 A;  2R7V A;  2J7P D;  3L34 A;  4ONS A;  4G0H A;  3EZI A;  1OKK A;  4K1O A;  4A2N B;  4FAP B;  2EPN A;  4YJW A;  3RH3 A;  1CPQ A;  2L6H A;  4DRJ B;  1J8M F;  1NZE A;  3S90 A;  5L0F A;  1T5O A;  3DWW A;  3I5P A;  3UNG C;  4Z9H A;  3U9M A;  1KTM A;  2IOQ A;  2JPU A;  3LS0 A;  1W2W A;  2MHR A;  3EG9 A;  2UUH A;  4W8K A;  3JRM O;  2XM0 A;  3RW0 A;  5CI8 A;  4J7T A;  1RKE B;  2G62 A;  3RQE A;  2W4M A;  2RSE B;  3GEE A;  4XEV A;  2EPO A;  4PFP A;  4AE4 B;  1D1B A;  2NUP A;  2OJE D;  4YL1 A;  3SNH A;  1BBH A;  2EIK C;  3VM6 A;  2KQ9 A;  2E87 A;  3DE8 A;  3FOP A;  5L0I A;  1S05 A;  2J9W A;  1Q0D A;  1SZI A;  2LIG A;  3UGP A;  3Q7G A;  4R32 A;  3AQB A;  5FZT A;  3V5Z A;  4OIP F;  1OCR C;  5K0I A;  4HE8 D;  4YT8 A;  5B3I A;  1MMA A;  1ZHW A;  2Q9C A;  4OD5 A;  1I5N A;  1LI7 A;  2H8A A;  4JC7 A;  3LUT B;  5JUA A;  5COG A;  4ZLC A;  2A68 F;  3IEE A;  3L0I A;  4CJO A;  1QLE C;  3K66 A;  4CDY A;  2YL7 A;  1HE1 A;  4PK4 A;  3U3B A;  3LEV A;  3UMK A;  1OCC C;  1D0X A;  2NUT B;  1GM5 A;  4CS7 A;  1JRA A;  1PD1 A;  3B0P A;  3AG2 C;  3S28 A;  3ZVR A;  1WGW A;  3EJN A;  4WGY A;  3FDQ A;  2Y3B A;  4QI2 A;  3V5X A;  4YT5 A;  4JTC B;  1CGM E;  3GM3 A;  3NG1 A;  5A6J A;  1WOL A;  2LFF A;  3MYI A;  4U9D A;  5DQZ A;  2VCA A;  3U0C A;  3M1C B;  2J9B A;  5DS6 A;  2XLV A;  3DE9 A;  3EQL F;  5B1A C;  4EBJ A;  5KYY A;  1VLS A;  3AQC A;  3K1I C;  3ZDL A;  4BJT A;  4O6Y A;  2X0C A;  1T6I A;  1YLM A;  4DRH B;  1VYI A;  1M6T A;  3QTH A;  2Q3T A;  1HW1 A;  3TJ5 A;  4I1O B;  1E85 A;  1AVO B;  3JSZ A;  2D4U A;  3I4U A;  5CI9 A;  4EBB A;  1AUE A;  3IHU A;  3NYJ A;  1M57 C;  2XXA A;  2R7T A;  1UFB A;  5KYU B;  2ETS A;  4XPW A;  4W8P A;  2V26 A;  2CGE A;  4BEJ A;  1OCO C;  5E3A A;  1TQG A;  1TFK B;  1R5I D;  3W4Y A;  1FMV A;  2EIM C;  4E7Z A;  2Q9B A;  3H2U A;  4XPX A;  1XZP A;  3T4R A;  2CW0 F;  2YZS A;  2C04 A;  2ZXW C;  1LM3 B;  1JAF A;  1OCZ C;  3DAG A;  4NQF A;  4KNW A;  4C7O B;  2R7Q A;  3B9Q A;  3WAQ A;  4CS9 C;  1QQ3 A;  2IXO A;  2L81 A;  4I1M A;  4LER A;  4ANJ A;  3MFN A;  3DZA A;  3N0T A;  1M56 C;  2HV7 A;  4WGZ A;  2YVK A;  3TK0 A;  4BJ6 C;  1ZHX A;  4MQ9 F;  1L3P A;  2EPL X;  2HMQ A;  3GM2 A;  4I3M A;  1RCP A;  2YWA A;  2Y3H A;  3C62 A;  4ULV A;  5DS4 A;  3R2P A;  3ZQV A;  3GWL A;  2W4B A;  4G7H F;  2VAS A;  1TKN A;  1Q0M A;  1FMW A;  1BZ4 A;  4AK9 A;  1LIH A;  5F5H A;  3FVY A;  3E70 C;  1C02 A;  4AL0 A;  3EGD A;  1BR2 A;  1V54 C;  4PR9 A;  1BR4 A;  2Y69 C;  4JE9 A;  2YRF A;  1D1C A;  2PP4 A;  4U5H A;  3W2W A;  1M2V A;  3RQF A;  3M4B A;  3QW1 A;  3U8P A;  3JTL O;  3LLK A;  3IQ5 A;  4XEK A;  3V5Y A;  4CBE A;  4EHP A;  2ZXO A;  3X1O A;  3ZG1 A;  2XL4 A;  1NFN A;  2CNW D;  2LD6 A;  5KYW B;  5KYX B;  4G7O F;  2R25 A;  2H7B A;  2EIN C;  2NSG A;  2ZXR A;  4F4B A;  2XRH A;  3LNR A;  4JJG A;  3RFY A;  4BJ5 C;  1WAS A;  1YAU O;  2YQY A;  4E17 A;  3ZTZ A;  1C17 M;  3NYL A;  1LKX A;  3ASN C;  3HNI A;  2WZF A;  1SF8 A;  3LNM B;  2NSF A;  4P6I C;  2L6G A;  3OWT A;  3DJN B;  1ZYR F;  2GFH A;  3S29 A;  4LDR A;  4XPY A;  2R7R A;  2BL2 A;  1KNY A;  4D4N A;  4Q4Z F;  3EHM A;  4OIQ F;  2D5R B;  3M15 A;  4JEA A;  4E7S A;  4PJJ A;  4CS8 C;  3B29 A;  2CCY A;  3CEX A;  5BQI A;  5L3V A;  2AWC A;  3O39 A;  1O5H A;  4HFF B;  4C3D A;  5BUO A;  1Q0K A;  2P0N A;  3TQO A;  5EGY A;  4L6R A;  2DB4 A;  2NG1 A;  4ULW A;  4CIH A;  5L0C A;  1ORJ A;  5L0H A;  1CPR A;  3CAX A;  1OXK A;  3LJB A;  3Q7L A;  3SP1 A;  5F5F A;  1ZHY A;  4HFK B;  1LE4 A;  2FFH A;  5A6A A;  3A11 A;  1RJ9 A; 
#chains in the Genus database with same CATH homology
 3TOM A;  4CJO A;  1CGN A;  4CDY A;  1CGO A;  2YL7 A;  4IB4 A;  1YZC A;  3QVZ A;  4JKV A;  3ZWI A;  1E86 A;  2YL3 A;  4WGY A;  3ZQY A;  256B A;  2XLE A;  4JEB A;  5JSL A;  2XLM A;  3L1M A;  3NMI A;  4U9D A;  5JT4 A;  2J9B A;  2XLV A;  3DE9 A;  1QPU A;  1YYX A;  1M6T A;  5AGF A;  3QVY A;  4ER9 A;  5JLI A;  1E85 A;  3HNJ A;  3M4C A;  3HNL A;  5JRA A;  4N6H A;  2XLO A;  1A7V A;  3C63 A;  2XM4 A;  1NBB A;  4D4X A;  5JVE A;  1LM3 B;  1JAF A;  1EKY A;  3HNK A;  5JP7 A;  1QQ3 A;  4IAQ A;  3QW0 A;  2XLH A;  4WGZ A;  4CDA A;  3VRC A;  2J8W A;  5JS5 A;  1RCP A;  4N4W A;  3C62 A;  4ULV A;  2XLD A;  4IAR A;  2XL8 A;  3NMK A;  3ZQV A;  1MQV A;  2YL1 A;  4CIP A;  2BC5 A;  2YLI A;  4JE9 A;  3TOL A;  3ZTM A;  4CJG A;  3M4B A;  3QW1 A;  4CX9 A;  1YZA A;  3U8P A;  3IQ5 A;  2YLG A;  1CPQ A;  2YL0 A;  3IQ6 A;  1E83 A;  2YLD A;  3FOO A;  3ZTZ A;  1GQA A;  4CDV A;  3HNI A;  1E84 A;  1APC A;  1YYJ A;  2XM0 A;  4D4N A;  3NMJ A;  3M15 A;  4JEA A;  4U9E A;  1BBH A;  2CCY A;  3DE8 A;  3FOP A;  3M79 A;  1S05 A;  4EIY A;  4L6R A;  2XL6 A;  1CPR A;  2QLA A;  4NC3 A;  5B3I A;  2XLW A;  2YKZ A;  5JUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...