1DOVA

Crystal structure of the alpha-catenin dimerization domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
181
structure length
181
Chain Sequence
ESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CATENIN
publication title Structure of the dimerization and beta-catenin-binding region of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 86
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1999-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1dovA00
4IGGA 1T01A 4P9TA 1L7CA 3TJ5A 1ZW3A 3ZDLA 3RF3A 3H2VA 1U89A 5L0CA 1YDIA 1DOWA 1SYQA 2B0HA 5FZTA 1XWJA 4K1OA 5L0HA 2GDCA 1U6HA 4EHPA 1RKEA 2LQGA 5L0DA 5L0GA 3T6GB 1QKRA 1ST6A 4DJ9A 2IBFA 3TJ6A 1DOVA 3H2UA 3MYIA 2L7AA 2HSQA 1RKEB 1TR2A 5L0FA 1ZW2A 1H6GA 2GWWA 4PR9A 3VF0A 4E17A 4W8PA 2X0CA 4ONSA 1RKCA 5L0JA 3S90A 5L0IA 1ZVZA 4E18A
chains in the Genus database with same CATH superfamily
1Q0GA 3GM1A 4OIRF 2LIGA 1V55C 3HNLA 2VCCA 2PF4E 3JCUQ 1ZW3A 4U5GA 3NYLA 1PD1A 5T3WA 2JX0A 4O6MA 1LM3B 3NMIA 4DRJB 1MMAA 4PK4A 3ZVRA 4MVMA 4GQHA 2ZPAA 2Q9AA 2ZXPA 1WASA 1ZYRF 2MHRA 3FAJA 2AU5A 3LNMB 4JJGA 4YL1A 1RCPA 2BL2A 3GEEA 3U8VA 3U9JA 4AE4B 2VB6A 1CPQA 3LNRA 4XEKA 2L7AA 4CX9A 4G78A 4R32A 3J06A 1Z7Qc 4XEFA 1Z6AA 2OU6A 5E3CA 2O9XA 3LUTB 4RBNA 2P1AA 4OIQF 1QQ3A 2BC5A 2YL0A 4CJGA 4AE4A 2PFDA 1VB5A 3DJUB 3OEOA 3TOLA 2EPOA 2LD6A 3K1IA 2NUPA 1MMDA 1TKNA 2CDQA 1E85A 4YL0A 3U3FA 4AK9A 4JC7A 2QY9A 3KPHA 1YAUO 1K40A 2XS8A 4JURI 4AL1A 3EZHA 4CDYA 1L7CA 3TJ5A 3QW1A 4DVYP 2QUPA 3CAXA 1RJ9A 3K33A 2EPMX 4C3EA 1I4ZA 2TMVP 4BJ6A 1EQ1A 4Z9JA 4XWJA 4CSAA 4G0HA 1YJGA 5AGFA 3JYYA 1C17M 4U5FE 2EINC 3AJMA 1R4TA 3T6GB 2I8BA 3L1MA 3F46A 3RH3A 3TULA 2DB4A 3KH2A 2P61A 1FTSA 3EPVA 3CEXA 3N0TA 4EWCA 1LI7A 3Q6NA 4EBKA 5CI8A 2HV6A 1JPNA 4E0IA 3KMIA 1C02A 1YZCA 1LKXA 3O39A 4I1MA 1TWHA 5DS5A 2QLAA 4GEHA 2XM4A 3C18A 3PHF2 1Y4CA 2XM0A 3GM3A 4E18A 3ABKC 2R7XA 2HS5A 3FOOA 1M2VA 3RQEA 3S29A 2HFIA 4NY3A 4XLPF 3NG1A 2HSBA 1BDJB 3DE8A 4FESA 3RFYA 2R7VA 2A68F 4LLEA 4BPMA 1ORJA 1T6UA 2EPKX 2UUIA 3U3BA 3N2ZB 4MTGA 3X2QC 1JRAA 2FAPB 5KYNA 5BQIA 1FMWA 1YARO 3FMSA 1G4US 3C8ZA 3T6JA 1W2WA 1M57C 5L3VA 4LACB 3OWTA 2R03A 3JT1A 4JVSA 2VC9A 5KYUA 3RQGA 2DGJA 1XZPA 4J7YA 1TWAA 4ONSA 2ASRA 3SP1A 4W8KA 2HMZA 4CS8C 4YWQA 1ZVZA 3S90A 3U0CA 3AGUA 1HMOA 4PJJA 4RD9A 5COGA 3E9VA 3M4CA 3ZDLA 3PDMP 1NFNA 4PFPA 4WGYA 3ABMC 4IRUA 1V4AA 1NFOA 2VASA 4K1OA 4XLNF 4UDVA 3O10A 1MMNA 4O7GA 1QSPA 4XPYA 1LIHA 5COMA 5L0GA 3C8GB 3AGTA 3C8GD 3NKDA 4JCZA 4DJ9A 4WGZA 1K05A 3FVYA 5DVWA 4B6IA 2EIJC 2XL4A 2J45A 1HE1A 1PV3A 2L9JA 2P7VA 1VYKA 3EFOB 3DMDA 4E7SA 2W9YA 1YA9A 3WODF 2NSFA 5EHHA 1GM5A 4PFOA 3W4YA 3W2WA 4M63A 1N1CA 2KJGA 5JVEA 3MFNA 1SMYF 3S9OA 1FMVA 1TFOB 5KYXB 4G7HF 1VTMP 4KNWA 4J30B 4CIHA 4JCHA 4QI2A 2IXPA 2PX3A 2WZFA 4LDKA 1NG1A 1U89A 2FGYA 2HZ8A 3DM5A 3H2VA 2H7VC 1VOMA 1O3UA 3EH2A 5E2QA 1BR2A 4FWVA 3DM9B 4U9DA 5BQGA 3V5XA 4CS7A 4YT2A 2W4MA 2F22A 1OXBA 3MX3A 3SNHA 2FFHA 1ZU4A 2L6FA 1AVOB 2J0XA 2Y3GA 4I3MA 4MVOA 1AUEA 5L3QA 2EIKC 3M15A 4JJFA 2ZXOA 2DYRC 3JTLO 5E3AA 4OD4A 3VM6A 4AX2A 5A6JA 2P6VA 2HSQA 4H4KC 5B1BC 1PD0A 2XLOA 3L34A 3SXKA 3DI5A 1M56C 2A0BA 2AP3A 4LLCA 5B1AC 1L3PA 3GEIA 2KNHA 2Q00A 1YVIA 4Q5SF 2A6EF 1Y6DA 5T3TA 3PCVA 1SR2A 3B0UX 3B9QA 3FOPA 2XXAB 3V5ZA 3EG9A 1BBHA 1J8MF 3K6BA 1PCXA 1Q0MA 1S05A 3EJNA 3GODA 1Z23A 1M6TA 2G62A 4PJMA 1F1MA 5D91A 1HMDA 3W8IA 4BEMJ 1LI5A 1DOWA 3S84A 1FR0A 3ZG1A 4MQ9F 2IXNA 2Q3TA 4ANJA 1G4WR 1KNYA 3EHMA 5IY5C 1YYXA 2P0NA 1B68A 2IYLD 2XLEA 1AEPA 2YVKA 3GORA 3Q6MA 4EUKB 5JS5A 1ZHZA 1M2OA 2WVQA 3UNGC 3AG1C 3B29A 4CS9C 2QNLA 5DS4A 3WAQA 1T6IA 3E70C 1JMWA 2EPLX 4JTAB 4J32B 1NBBA 1Z5ZA 2G3KA 4ZLCA 2J46A 2VCAA 1TR2A 1A0BA 1ZW2A 3U8PA 2Y39A 1CGME 4ULWA 1ZHTA 1VYIA 1TFKB 2HJMA 3A11A 2AVKA 2JPUA 3IPMO 3AOUA 5DQZA 2XLDA 4JRZA 2UUHA 4MTFA 4NTFA 4P9TA 4JIOA 3U5SA 3V7OA 3DJNB 3RKOF 4HFKB 4MS2A 5L0CA 1FFHA 1A7EA 4O79A 4NC3A 3UMIA 5KYYB 5JLIA 1S7ZA 2M64A 1OCCC 2ETSA 2OOCA 3QW0A 1J8YF 3K1HA 4WJ0A 2XS1A 3L8JA 3K7DA 4JEAA 1A41A 2MWQA 3TQOA 3HNIA 2AWYA 2J0WA 4HFFB 3R7CA 2OEXA 4DXWA 4YJWA 3AQCA 2KSFA 3KYJA 2YQYA 3C62A 2ZD9A 1H9GA 2CCYA 2CGEA 4PR9A 3MYFA 4C3BA 3EGDB 4NTBA 2XL6A 1O5HA 1RKCA 3EZIA 1OQCA 5CI9A 3CZ6A 4K7BA 1EKYA 3VYWA 1NLXA 3H65A 3R2PA 3NYMA 4N4WA 2L6HA 2XLMA 1OXKA 1RXQA 1TWCA 2W45A 3EGDA 3ITFA 5BQHA 1E83A 2QE9A 2V26A 3RW0A 3ZQVA 1YDIA 2B0HA 3QVZA 3C7JA 5HSWA 3DE9A 3EGXB 4YT8A 5JSLA 5F28E 3LS0A 5L0DA 1UG7A 4G7OF 4JW1A 2EPNA 4WABA 3EQLF 1OKKA 2HJ3A 1D1CA 3OA1A 3TOMA 1IW7F 1ZHWA 4HE8D 2LCHA 4D4XA 1OW6A 4C7OB 3RQFA 1ZHXA 4MNDA 2D4UA 3ZSUA 4FAPB 3W8HA 3DAFA 4BJ5C 3I4UA 4I1OB 4P9FA 3DXJF 4N6HA 1OCOC 2R7TA 5L0IA 3V5YA 1H7IA 5K0IA 5EK0A 3UR3C 1Q0FA 3IHUA 2YL7A 2XLVA 3ZQYA 1A7VA 3GEHA 3RF3A 3CQZA 5DLJA 1NZEA 1VLSA 1Z3IX 4KC9A 5FZTA 3FHDA 2HKVA 2J9WA 4DBQA 3GM2A 2Z15A 4MVZA 4BJ1A 1Z63A 1D1BA 2WVOA 2J9UA 2LFDA 1OR3A 2J7PD 2YLIA 4BEJA 4DVZA 4DRHB 1SF8A 4CBEA 1I5NA 2J9BA 4XTKA 3G50A 2GWWA 2HV7A 2RSEB 3C8GA 3QZCA 2VH3A 3ATPA 3VF0A 3X1OA 2X0CA 3QTHA 1V74B 3HKKA 3ECSA 3LESA 3M79A 4YL3A 2HMQA 3EFOA 2WZGA 3BEHA 4IGGA 1IZMA 4YT4A 2R7RA 2MYSA 4DOZA 3Q7GA 3A9CA 2NUTB 2CW0F 3SXZA 1LS4A 2Y3HA 5A6BD 5KYXA 1QVXA 1FNTc 2YHSA 3K1IC 4L6RA 1T5OA 4EHPA 2GA0A 5GPGB 1YA7O 4IJJA 3HNJA 4U5BE 1GS9A 3LS1A 2PX0A 3BRJA 1ST6A 2NUTA 3S27A 3ZTZA 5BUOA 1JR8A 3ZIBA 1GGQA 3DKAA 1V54C 2LFFA 2VCBA 3IEEA 1TQGA 4JTDB 4YK5A 2OEVA 4BJ6C 3SZRA 1OW8A 4CSAC 3W2VA 1D0ZA 2EIMC 4XPWA 3ZWIA 1QLEC 3PMRA 3JYHA 2A69F 2WB7A 2LP4A 256BA 4GYTA 1T9KA 4XEVA 3DZAA 2OKUA 4LDRA 2ZXRA 2ICWG 2R05A 2NSGA 1VMAA 4QDLA 2C03A 2CNWD 2E87A 3O55A 1SYQA 2EILC 4Z9HA 3QMKA 3SXYA 1WWPA 3ASOC 4BJ5A 3LEOA 3EHNA 2XXAA 4CDVA 1D0YA 2J8WA 3M4BA 3O6XA 3QVYA 3NDBB 2RD9A 3NMJA 5KYWB 2IBFA 4CS8A 4YT5A 3FAPB 1VK5A 4C3DA 4MVSA 4ER9A 1H9TA 2QTVA 4MW3A 4U5DE 4BJTA 1MNDA 3L0IA 1RMVA 1HE9A 1NU9C 1E2XA 1H6GA 1ZZPA 1LVKA 4W8PA 4X0RA 4CJOA 2D5RB 2YL3A 3GANA 4FX5A 2R9RB 2Q7RA 5TJ5E 1MMGA 1G8XA 3TD7A 3VAYA 1YYJA 4N6CA 4IARA 3F47A 4JTCB 3K66A 4JZAA 1CGNA 4E17A 3GWLA 2V3CC 4BG0A 4DBRA 3IQ5A 2A6HF 3B71A 1KU2A 5F5FA 3I5PA 1QPUA 4CDAA 4LERA 1WTYA 2J9VA 4NTAA 4EKWA 3RIPA 2WVNA 4LDQA 4U5EE 2XLHA 2DI3A 3VRCA 4Z9IA 1CPRA 1BR4A 3TJ6A 5KYYA 2PBEA 4OIOF 2NUPB 3AG3C 4N06A 4A2NB 2R7WA 4K0DA 2YLDA 3SXMA 5JRAA 3HJCA 4J7TA 4IWBA 4KBLA 1HY5A 2GFHA 4MVQA 2IXOA 1XZQA 1LPEA 1RJ9B 2BE5F 3LEVA 3CSKA 4A4AA 4I44A 3AG4C 4MTOA 4U9EA 2OG2A 4XPXA 1WOLA 2NG1A 2Q4FA 4EBBA 3RYLA 5DS6A 3C63A 3G4ZA 1VLTA 3JSEO 1I4YA 1EA8A 2DYSC 4O6YA 1MNEA 4U5CE 2L6GA 5JT4A 1HW1A 3RVYA 2LQGA 2YWAA 2R7QA 1A7DA 1OR2A 2WL8A 1D0XA 1ZU5A 2R7SA 2LK4A 4DRIB 1G5ZA 1C03A 1BZ4A 4EIYA 3SYNA 1O87A 3EGXA 1GQAA 3IQ6A 4OD5A 2L81A 2IM8A 5FCLA 2G3VA 5L0FA 1M2VB 1JAFA 2KW3C 1CGOA 1WN0A 3M1CB 5B3SC 4E7ZA 4CIPA 1WATA 1APCA 4NCQA 3U2MA 5L0JA 1D1AA 4C7OA 2YL1A 3MBGA 1BR1A 4HEAJ 1OCZC 5A6AA 1FFTC 3ZC4A 2YKZA 1EI7A 1OKKD 4PJLA 4CS9A 3NKEA 2XL8A 4MVUA 2OJED 3T4RA 3LAYA 1XWJA 3FXHA 2A0UA 1LE2A 4IB4A 3KYIA 1LS1A 2AWCA 5KYUB 5EGYA 1MQVA 2M4EA 3LLIA 1OCRC 1QKRA 1TWGA 4OINF 1WGWA 5HV9A 2Q9CA 4QI0A 3H2UA 4F4BA 1NU7D 4NQFA 1UFBA 1FAPB 3UGOA 1OW7A 2IOQA 4U5HA 3MLGA 1JOGA 2KQ9A 3US6A 5T1DB 5F5HA 5JP7A 3GWNA 2LSEA 1JPJA 3U2LA 2J7PA 5AC4A 2HUJA 4ZLDA 1R5ID 2YEVA 3RVZA 4IAQA 5CIVA 2XRHA 3Q7LA 1YZAA 2GAQA 2R7UA 4AL0A 1NSGB 2PNOA 1LE4A 1T01A 4OIPF 2C04A 2ZXWC 2KC3A 3ABLC 3U9MA 3UMKA 2OCCC 3L8IA 3SEOA 4H54A 2R25A 3LJBA 2YRFA 5COFA 2JD3A 4IAOA 3ZTMA 4EBJA 1E86A 5L0HA 1KTMA 2Y69C 1U6HA 4D4NA 5A6KA 2KYHA 2XSEA 3DD7A 3NMKA 3WG7C 3DWWA 1SZIA 3S0XA 2W4BA 3AQBA 4MVRA 4O6NA 5B3IA 5A6BA 1DOVA 2KGOA 2XLWA 2NPUA 3MYIA 3WHNA 4PACA 2YLGA 4JEBA 3UMHA 3HLZA 1E84A 3UGPA 2H8AA 4Q4ZF 1ORYA 4G7ZF 4JKVA 1ZHYA 3KKBA 2CYDA 3HNKA 2R02A 3I5QA 4MW8A 5JUAA 2OQMA 5D92A 3S28A 3IQTA 2OJQA 2X51A 3ASNC 2B0JA 2WZLA 4XQ1A 3DAGA 4YN0B 4KI2A 3JRTA 3KL4A 3POVA 3NYJA 2R7OA 4ULVA 3TK0A 2Y3BA 1T6QA 5E33A 2GDCA 2A1DD 4KNVA 2KK1A 1YLMA 3IQCA 4RDAA 3B0PA 4Q7CA 3EH1A 3FDQA 3NRHA 3G4XA 2CNWA 3JZ0A 1K04A 2IXMA 3N24A 3T9OA 3B0VC 2Y3DA 2YZSA 3HTKC 3JRMO 3T6BA 1HW2A 2Q9BA 1U0BB 2I15A 4PJNA 1Q0DA 1RKEB 2H7OA 2H7BA 3AG2C 3JSZA 3LLKA 1Q0KA 4JE9A 5AC5A 3EG9B 5DQTA 1QZXA 1ORSC 4E0HA 5KYWA 5A69A 2PP4A 4P6IC 1RKEA
chains in the Genus database with same CATH topology
4IGGA 1T01A 4P9TA 1L7CA 3TJ5A 1ZW3A 3ZDLA 3RF3A 3H2VA 1U89A 5L0CA 1YDIA 1DOWA 1SYQA 2B0HA 5FZTA 1XWJA 4K1OA 5L0HA 2GDCA 1U6HA 4EHPA 1RKEA 2LQGA 5L0DA 5L0GA 3T6GB 1QKRA 1ST6A 4DJ9A 2IBFA 3TJ6A 1DOVA 3H2UA 3MYIA 2L7AA 2HSQA 1RKEB 1TR2A 5L0FA 1ZW2A 1H6GA 2GWWA 4PR9A 3VF0A 4E17A 4W8PA 2X0CA 4ONSA 1RKCA 5L0JA 3S90A 5L0IA 1ZVZA 4E18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGG A;  1T01 A;  4P9T A;  1L7C A;  3TJ5 A;  1ZW3 A;  3ZDL A;  3RF3 A;  3H2V A;  1U89 A;  5L0C A;  1YDI A;  1DOW A;  1SYQ A;  2B0H A;  5FZT A;  1XWJ A;  4K1O A;  5L0H A;  2GDC A;  1U6H A;  4EHP A;  1RKE A;  2LQG A;  5L0D A;  5L0G A;  3T6G B;  1QKR A;  1ST6 A;  4DJ9 A;  2IBF A;  3TJ6 A;  1DOV A;  3H2U A;  3MYI A;  2L7A A;  2HSQ A;  1RKE B;  1TR2 A;  5L0F A;  1ZW2 A;  1H6G A;  2GWW A;  4PR9 A;  3VF0 A;  4E17 A;  4W8P A;  2X0C A;  4ONS A;  1RKC A;  5L0J A;  3S90 A;  5L0I A;  1ZVZ A;  4E18 A; 
#chains in the Genus database with same CATH topology
 1Q0G A;  3GM1 A;  4OIR F;  2LIG A;  1V55 C;  3HNL A;  2VCC A;  2PF4 E;  3JCU Q;  1ZW3 A;  4U5G A;  3NYL A;  1PD1 A;  5T3W A;  2JX0 A;  4O6M A;  1LM3 B;  3NMI A;  4DRJ B;  1MMA A;  4PK4 A;  3ZVR A;  4MVM A;  4GQH A;  2ZPA A;  2Q9A A;  2ZXP A;  1WAS A;  1ZYR F;  2MHR A;  3FAJ A;  2AU5 A;  3LNM B;  4JJG A;  4YL1 A;  1RCP A;  2BL2 A;  3GEE A;  3U8V A;  3U9J A;  4AE4 B;  2VB6 A;  1CPQ A;  3LNR A;  4XEK A;  2L7A A;  4CX9 A;  4G78 A;  4R32 A;  3J06 A;  1Z7Q c;  4XEF A;  1Z6A A;  2OU6 A;  5E3C A;  2O9X A;  3LUT B;  4RBN A;  2P1A A;  4OIQ F;  1QQ3 A;  2BC5 A;  2YL0 A;  4CJG A;  4AE4 A;  2PFD A;  1VB5 A;  3DJU B;  3OEO A;  3TOL A;  2EPO A;  2LD6 A;  3K1I A;  2NUP A;  1MMD A;  1TKN A;  2CDQ A;  1E85 A;  4YL0 A;  3U3F A;  4AK9 A;  4JC7 A;  2QY9 A;  3KPH A;  1YAU O;  1K40 A;  2XS8 A;  4JUR I;  4AL1 A;  3EZH A;  4CDY A;  1L7C A;  3TJ5 A;  3QW1 A;  4DVY P;  2QUP A;  3CAX A;  1RJ9 A;  3K33 A;  2EPM X;  4C3E A;  1I4Z A;  2TMV P;  4BJ6 A;  1EQ1 A;  4Z9J A;  4XWJ A;  4CSA A;  4G0H A;  1YJG A;  5AGF A;  3JYY A;  1C17 M;  4U5F E;  2EIN C;  3AJM A;  1R4T A;  3T6G B;  2I8B A;  3L1M A;  3F46 A;  3RH3 A;  3TUL A;  2DB4 A;  3KH2 A;  2P61 A;  1FTS A;  3EPV A;  3CEX A;  3N0T A;  4EWC A;  1LI7 A;  3Q6N A;  4EBK A;  5CI8 A;  2HV6 A;  1JPN A;  4E0I A;  3KMI A;  1C02 A;  1YZC A;  1LKX A;  3O39 A;  4I1M A;  1TWH A;  5DS5 A;  2QLA A;  4GEH A;  2XM4 A;  3C18 A;  3PHF 2;  1Y4C A;  2XM0 A;  3GM3 A;  4E18 A;  3ABK C;  2R7X A;  2HS5 A;  3FOO A;  1M2V A;  3RQE A;  3S29 A;  2HFI A;  4NY3 A;  4XLP F;  3NG1 A;  2HSB A;  1BDJ B;  3DE8 A;  4FES A;  3RFY A;  2R7V A;  2A68 F;  4LLE A;  4BPM A;  1ORJ A;  1T6U A;  2EPK X;  2UUI A;  3U3B A;  3N2Z B;  4MTG A;  3X2Q C;  1JRA A;  2FAP B;  5KYN A;  5BQI A;  1FMW A;  1YAR O;  3FMS A;  1G4U S;  3C8Z A;  3T6J A;  1W2W A;  1M57 C;  5L3V A;  4LAC B;  3OWT A;  2R03 A;  3JT1 A;  4JVS A;  2VC9 A;  5KYU A;  3RQG A;  2DGJ A;  1XZP A;  4J7Y A;  1TWA A;  4ONS A;  2ASR A;  3SP1 A;  4W8K A;  2HMZ A;  4CS8 C;  4YWQ A;  1ZVZ A;  3S90 A;  3U0C A;  3AGU A;  1HMO A;  4PJJ A;  4RD9 A;  5COG A;  3E9V A;  3M4C A;  3ZDL A;  3PDM P;  1NFN A;  4PFP A;  4WGY A;  3ABM C;  4IRU A;  1V4A A;  1NFO A;  2VAS A;  4K1O A;  4XLN F;  4UDV A;  3O10 A;  1MMN A;  4O7G A;  1QSP A;  4XPY A;  1LIH A;  5COM A;  5L0G A;  3C8G B;  3AGT A;  3C8G D;  3NKD A;  4JCZ A;  4DJ9 A;  4WGZ A;  1K05 A;  3FVY A;  5DVW A;  4B6I A;  2EIJ C;  2XL4 A;  2J45 A;  1HE1 A;  1PV3 A;  2L9J A;  2P7V A;  1VYK A;  3EFO B;  3DMD A;  4E7S A;  2W9Y A;  1YA9 A;  3WOD F;  2NSF A;  5EHH A;  1GM5 A;  4PFO A;  3W4Y A;  3W2W A;  4M63 A;  1N1C A;  2KJG A;  5JVE A;  3MFN A;  1SMY F;  3S9O A;  1FMV A;  1TFO B;  5KYX B;  4G7H F;  1VTM P;  4KNW A;  4J30 B;  4CIH A;  4JCH A;  4QI2 A;  2IXP A;  2PX3 A;  2WZF A;  4LDK A;  1NG1 A;  1U89 A;  2FGY A;  2HZ8 A;  3DM5 A;  3H2V A;  2H7V C;  1VOM A;  1O3U A;  3EH2 A;  5E2Q A;  1BR2 A;  4FWV A;  3DM9 B;  4U9D A;  5BQG A;  3V5X A;  4CS7 A;  4YT2 A;  2W4M A;  2F22 A;  1OXB A;  3MX3 A;  3SNH A;  2FFH A;  1ZU4 A;  2L6F A;  1AVO B;  2J0X A;  2Y3G A;  4I3M A;  4MVO A;  1AUE A;  5L3Q A;  2EIK C;  3M15 A;  4JJF A;  2ZXO A;  2DYR C;  3JTL O;  5E3A A;  4OD4 A;  3VM6 A;  4AX2 A;  5A6J A;  2P6V A;  2HSQ A;  4H4K C;  5B1B C;  1PD0 A;  2XLO A;  3L34 A;  3SXK A;  3DI5 A;  1M56 C;  2A0B A;  2AP3 A;  4LLC A;  5B1A C;  1L3P A;  3GEI A;  2KNH A;  2Q00 A;  1YVI A;  4Q5S F;  2A6E F;  1Y6D A;  5T3T A;  3PCV A;  1SR2 A;  3B0U X;  3B9Q A;  3FOP A;  2XXA B;  3V5Z A;  3EG9 A;  1BBH A;  1J8M F;  3K6B A;  1PCX A;  1Q0M A;  1S05 A;  3EJN A;  3GOD A;  1Z23 A;  1M6T A;  2G62 A;  4PJM A;  1F1M A;  5D91 A;  1HMD A;  3W8I A;  4BEM J;  1LI5 A;  1DOW A;  3S84 A;  1FR0 A;  3ZG1 A;  4MQ9 F;  2IXN A;  2Q3T A;  4ANJ A;  1G4W R;  1KNY A;  3EHM A;  5IY5 C;  1YYX A;  2P0N A;  1B68 A;  2IYL D;  2XLE A;  1AEP A;  2YVK A;  3GOR A;  3Q6M A;  4EUK B;  5JS5 A;  1ZHZ A;  1M2O A;  2WVQ A;  3UNG C;  3AG1 C;  3B29 A;  4CS9 C;  2QNL A;  5DS4 A;  3WAQ A;  1T6I A;  3E70 C;  1JMW A;  2EPL X;  4JTA B;  4J32 B;  1NBB A;  1Z5Z A;  2G3K A;  4ZLC A;  2J46 A;  2VCA A;  1TR2 A;  1A0B A;  1ZW2 A;  3U8P A;  2Y39 A;  1CGM E;  4ULW A;  1ZHT A;  1VYI A;  1TFK B;  2HJM A;  3A11 A;  2AVK A;  2JPU A;  3IPM O;  3AOU A;  5DQZ A;  2XLD A;  4JRZ A;  2UUH A;  4MTF A;  4NTF A;  4P9T A;  4JIO A;  3U5S A;  3V7O A;  3DJN B;  3RKO F;  4HFK B;  4MS2 A;  5L0C A;  1FFH A;  1A7E A;  4O79 A;  4NC3 A;  3UMI A;  5KYY B;  5JLI A;  1S7Z A;  2M64 A;  1OCC C;  2ETS A;  2OOC A;  3QW0 A;  1J8Y F;  3K1H A;  4WJ0 A;  2XS1 A;  3L8J A;  3K7D A;  4JEA A;  1A41 A;  2MWQ A;  3TQO A;  3HNI A;  2AWY A;  2J0W A;  4HFF B;  3R7C A;  2OEX A;  4DXW A;  4YJW A;  3AQC A;  2KSF A;  3KYJ A;  2YQY A;  3C62 A;  2ZD9 A;  1H9G A;  2CCY A;  2CGE A;  4PR9 A;  3MYF A;  4C3B A;  3EGD B;  4NTB A;  2XL6 A;  1O5H A;  1RKC A;  3EZI A;  1OQC A;  5CI9 A;  3CZ6 A;  4K7B A;  1EKY A;  3VYW A;  1NLX A;  3H65 A;  3R2P A;  3NYM A;  4N4W A;  2L6H A;  2XLM A;  1OXK A;  1RXQ A;  1TWC A;  2W45 A;  3EGD A;  3ITF A;  5BQH A;  1E83 A;  2QE9 A;  2V26 A;  3RW0 A;  3ZQV A;  1YDI A;  2B0H A;  3QVZ A;  3C7J A;  5HSW A;  3DE9 A;  3EGX B;  4YT8 A;  5JSL A;  5F28 E;  3LS0 A;  5L0D A;  1UG7 A;  4G7O F;  4JW1 A;  2EPN A;  4WAB A;  3EQL F;  1OKK A;  2HJ3 A;  1D1C A;  3OA1 A;  3TOM A;  1IW7 F;  1ZHW A;  4HE8 D;  2LCH A;  4D4X A;  1OW6 A;  4C7O B;  3RQF A;  1ZHX A;  4MND A;  2D4U A;  3ZSU A;  4FAP B;  3W8H A;  3DAF A;  4BJ5 C;  3I4U A;  4I1O B;  4P9F A;  3DXJ F;  4N6H A;  1OCO C;  2R7T A;  5L0I A;  3V5Y A;  1H7I A;  5K0I A;  5EK0 A;  3UR3 C;  1Q0F A;  3IHU A;  2YL7 A;  2XLV A;  3ZQY A;  1A7V A;  3GEH A;  3RF3 A;  3CQZ A;  5DLJ A;  1NZE A;  1VLS A;  1Z3I X;  4KC9 A;  5FZT A;  3FHD A;  2HKV A;  2J9W A;  4DBQ A;  3GM2 A;  2Z15 A;  4MVZ A;  4BJ1 A;  1Z63 A;  1D1B A;  2WVO A;  2J9U A;  2LFD A;  1OR3 A;  2J7P D;  2YLI A;  4BEJ A;  4DVZ A;  4DRH B;  1SF8 A;  4CBE A;  1I5N A;  2J9B A;  4XTK A;  3G50 A;  2GWW A;  2HV7 A;  2RSE B;  3C8G A;  3QZC A;  2VH3 A;  3ATP A;  3VF0 A;  3X1O A;  2X0C A;  3QTH A;  1V74 B;  3HKK A;  3ECS A;  3LES A;  3M79 A;  4YL3 A;  2HMQ A;  3EFO A;  2WZG A;  3BEH A;  4IGG A;  1IZM A;  4YT4 A;  2R7R A;  2MYS A;  4DOZ A;  3Q7G A;  3A9C A;  2NUT B;  2CW0 F;  3SXZ A;  1LS4 A;  2Y3H A;  5A6B D;  5KYX A;  1QVX A;  1FNT c;  2YHS A;  3K1I C;  4L6R A;  1T5O A;  4EHP A;  2GA0 A;  5GPG B;  1YA7 O;  4IJJ A;  3HNJ A;  4U5B E;  1GS9 A;  3LS1 A;  2PX0 A;  3BRJ A;  1ST6 A;  2NUT A;  3S27 A;  3ZTZ A;  5BUO A;  1JR8 A;  3ZIB A;  1GGQ A;  3DKA A;  1V54 C;  2LFF A;  2VCB A;  3IEE A;  1TQG A;  4JTD B;  4YK5 A;  2OEV A;  4BJ6 C;  3SZR A;  1OW8 A;  4CSA C;  3W2V A;  1D0Z A;  2EIM C;  4XPW A;  3ZWI A;  1QLE C;  3PMR A;  3JYH A;  2A69 F;  2WB7 A;  2LP4 A;  256B A;  4GYT A;  1T9K A;  4XEV A;  3DZA A;  2OKU A;  4LDR A;  2ZXR A;  2ICW G;  2R05 A;  2NSG A;  1VMA A;  4QDL A;  2C03 A;  2CNW D;  2E87 A;  3O55 A;  1SYQ A;  2EIL C;  4Z9H A;  3QMK A;  3SXY A;  1WWP A;  3ASO C;  4BJ5 A;  3LEO A;  3EHN A;  2XXA A;  4CDV A;  1D0Y A;  2J8W A;  3M4B A;  3O6X A;  3QVY A;  3NDB B;  2RD9 A;  3NMJ A;  5KYW B;  2IBF A;  4CS8 A;  4YT5 A;  3FAP B;  1VK5 A;  4C3D A;  4MVS A;  4ER9 A;  1H9T A;  2QTV A;  4MW3 A;  4U5D E;  4BJT A;  1MND A;  3L0I A;  1RMV A;  1HE9 A;  1NU9 C;  1E2X A;  1H6G A;  1ZZP A;  1LVK A;  4W8P A;  4X0R A;  4CJO A;  2D5R B;  2YL3 A;  3GAN A;  4FX5 A;  2R9R B;  2Q7R A;  5TJ5 E;  1MMG A;  1G8X A;  3TD7 A;  3VAY A;  1YYJ A;  4N6C A;  4IAR A;  3F47 A;  4JTC B;  3K66 A;  4JZA A;  1CGN A;  4E17 A;  3GWL A;  2V3C C;  4BG0 A;  4DBR A;  3IQ5 A;  2A6H F;  3B71 A;  1KU2 A;  5F5F A;  3I5P A;  1QPU A;  4CDA A;  4LER A;  1WTY A;  2J9V A;  4NTA A;  4EKW A;  3RIP A;  2WVN A;  4LDQ A;  4U5E E;  2XLH A;  2DI3 A;  3VRC A;  4Z9I A;  1CPR A;  1BR4 A;  3TJ6 A;  5KYY A;  2PBE A;  4OIO F;  2NUP B;  3AG3 C;  4N06 A;  4A2N B;  2R7W A;  4K0D A;  2YLD A;  3SXM A;  5JRA A;  3HJC A;  4J7T A;  4IWB A;  4KBL A;  1HY5 A;  2GFH A;  4MVQ A;  2IXO A;  1XZQ A;  1LPE A;  1RJ9 B;  2BE5 F;  3LEV A;  3CSK A;  4A4A A;  4I44 A;  3AG4 C;  4MTO A;  4U9E A;  2OG2 A;  4XPX A;  1WOL A;  2NG1 A;  2Q4F A;  4EBB A;  3RYL A;  5DS6 A;  3C63 A;  3G4Z A;  1VLT A;  3JSE O;  1I4Y A;  1EA8 A;  2DYS C;  4O6Y A;  1MNE A;  4U5C E;  2L6G A;  5JT4 A;  1HW1 A;  3RVY A;  2LQG A;  2YWA A;  2R7Q A;  1A7D A;  1OR2 A;  2WL8 A;  1D0X A;  1ZU5 A;  2R7S A;  2LK4 A;  4DRI B;  1G5Z A;  1C03 A;  1BZ4 A;  4EIY A;  3SYN A;  1O87 A;  3EGX A;  1GQA A;  3IQ6 A;  4OD5 A;  2L81 A;  2IM8 A;  5FCL A;  2G3V A;  5L0F A;  1M2V B;  1JAF A;  2KW3 C;  1CGO A;  1WN0 A;  3M1C B;  5B3S C;  4E7Z A;  4CIP A;  1WAT A;  1APC A;  4NCQ A;  3U2M A;  5L0J A;  1D1A A;  4C7O A;  2YL1 A;  3MBG A;  1BR1 A;  4HEA J;  1OCZ C;  5A6A A;  1FFT C;  3ZC4 A;  2YKZ A;  1EI7 A;  1OKK D;  4PJL A;  4CS9 A;  3NKE A;  2XL8 A;  4MVU A;  2OJE D;  3T4R A;  3LAY A;  1XWJ A;  3FXH A;  2A0U A;  1LE2 A;  4IB4 A;  3KYI A;  1LS1 A;  2AWC A;  5KYU B;  5EGY A;  1MQV A;  2M4E A;  3LLI A;  1OCR C;  1QKR A;  1TWG A;  4OIN F;  1WGW A;  5HV9 A;  2Q9C A;  4QI0 A;  3H2U A;  4F4B A;  1NU7 D;  4NQF A;  1UFB A;  1FAP B;  3UGO A;  1OW7 A;  2IOQ A;  4U5H A;  3MLG A;  1JOG A;  2KQ9 A;  3US6 A;  5T1D B;  5F5H A;  5JP7 A;  3GWN A;  2LSE A;  1JPJ A;  3U2L A;  2J7P A;  5AC4 A;  2HUJ A;  4ZLD A;  1R5I D;  2YEV A;  3RVZ A;  4IAQ A;  5CIV A;  2XRH A;  3Q7L A;  1YZA A;  2GAQ A;  2R7U A;  4AL0 A;  1NSG B;  2PNO A;  1LE4 A;  1T01 A;  4OIP F;  2C04 A;  2ZXW C;  2KC3 A;  3ABL C;  3U9M A;  3UMK A;  2OCC C;  3L8I A;  3SEO A;  4H54 A;  2R25 A;  3LJB A;  2YRF A;  5COF A;  2JD3 A;  4IAO A;  3ZTM A;  4EBJ A;  1E86 A;  5L0H A;  1KTM A;  2Y69 C;  1U6H A;  4D4N A;  5A6K A;  2KYH A;  2XSE A;  3DD7 A;  3NMK A;  3WG7 C;  3DWW A;  1SZI A;  3S0X A;  2W4B A;  3AQB A;  4MVR A;  4O6N A;  5B3I A;  5A6B A;  1DOV A;  2KGO A;  2XLW A;  2NPU A;  3MYI A;  3WHN A;  4PAC A;  2YLG A;  4JEB A;  3UMH A;  3HLZ A;  1E84 A;  3UGP A;  2H8A A;  4Q4Z F;  1ORY A;  4G7Z F;  4JKV A;  1ZHY A;  3KKB A;  2CYD A;  3HNK A;  2R02 A;  3I5Q A;  4MW8 A;  5JUA A;  2OQM A;  5D92 A;  3S28 A;  3IQT A;  2OJQ A;  2X51 A;  3ASN C;  2B0J A;  2WZL A;  4XQ1 A;  3DAG A;  4YN0 B;  4KI2 A;  3JRT A;  3KL4 A;  3POV A;  3NYJ A;  2R7O A;  4ULV A;  3TK0 A;  2Y3B A;  1T6Q A;  5E33 A;  2GDC A;  2A1D D;  4KNV A;  2KK1 A;  1YLM A;  3IQC A;  4RDA A;  3B0P A;  4Q7C A;  3EH1 A;  3FDQ A;  3NRH A;  3G4X A;  2CNW A;  3JZ0 A;  1K04 A;  2IXM A;  3N24 A;  3T9O A;  3B0V C;  2Y3D A;  2YZS A;  3HTK C;  3JRM O;  3T6B A;  1HW2 A;  2Q9B A;  1U0B B;  2I15 A;  4PJN A;  1Q0D A;  1RKE B;  2H7O A;  2H7B A;  3AG2 C;  3JSZ A;  3LLK A;  1Q0K A;  4JE9 A;  5AC5 A;  3EG9 B;  5DQT A;  1QZX A;  1ORS C;  4E0H A;  5KYW A;  5A69 A;  2PP4 A;  4P6I C;  1RKE A; 
#chains in the Genus database with same CATH homology
 4IGG A;  1T01 A;  4P9T A;  1L7C A;  3TJ5 A;  1ZW3 A;  3ZDL A;  3RF3 A;  3H2V A;  1U89 A;  5L0C A;  1YDI A;  1DOW A;  1SYQ A;  2B0H A;  5FZT A;  1XWJ A;  4K1O A;  5L0H A;  2GDC A;  1U6H A;  4EHP A;  1RKE A;  2LQG A;  5L0D A;  5L0G A;  3T6G B;  1QKR A;  1ST6 A;  4DJ9 A;  2IBF A;  3TJ6 A;  1DOV A;  3H2U A;  3MYI A;  2L7A A;  2HSQ A;  1RKE B;  1TR2 A;  5L0F A;  1ZW2 A;  1H6G A;  2GWW A;  4PR9 A;  3VF0 A;  4E17 A;  4W8P A;  2X0C A;  4ONS A;  1RKC A;  5L0J A;  3S90 A;  5L0I A;  1ZVZ A;  4E18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...