1DOVA

Crystal structure of the alpha-catenin dimerization domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
181
structure length
181
Chain Sequence
b'ESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CATENIN
publication title Structure of the dimerization and beta-catenin-binding region of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 86
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1999-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1dovA00
1RKEA 5L0GA 1ZW3A 1ZVZA 4DJ9A 4ONSA 5L0JA 5L0DA 2GWWA 3H2VA 1YDIA 4PR9A 1T01A 4EHPA 1SYQA 1U89A 3ZDLA 3RF3A 2X0CA 1ZW2A 2LQGA 2B0HA 1DOVA 1TR2A 4P9TA 2L7AA 4W8PA 3H2UA 4E18A 1H6GA 1DOWA 2GDCA 1L7CA 5L0HA 3VF0A 5FZTA 4E17A 3TJ5A 2IBFA 1RKCA 1XWJA 4IGGA 5L0CA 5L0FA 5L0IA 2HSQA 3T6GB 1QKRA 1RKEB 4K1OA 3TJ6A 3S90A 1U6HA 3MYIA 1ST6A
chains in the Genus database with same CATH superfamily
2EIKC 2VCAA 3GANA 1GGQA 3HLZA 3V5XA 1T6QA 1V4AA 3OA1A 4RDAA 2GWWA 1O87A 2ICWG 3US6A 4PR9A 2PNOA 3LUTB 1OW8A 2DB4A 1Z3IX 3Q6MA 5DQTA 3GM3A 4OIRF 3POVA 2A0UA 2PFDA 3N0TA 3PDMP 1H9TA 3N24A 3S9OA 4BEMJ 1CGNA 1ZHXA 2WVNA 4WJ0A 3UMIA 4AE4A 3JT1A 3KYIA 5A6JA 4G7ZF 1I4YA 3U2LA 4O6YA 3QW1A 4E7ZA 3AG4C 1WTYA 3I5PA 4G78A 1LE2A 3M1CB 4H54A 4IWBA 5B1AC 3DM5A 1JAFA 5B3SC 5F28E 1M2VA 1R4TA 4U5BE 2EIJC 1E85A 1FMVA 2D5RB 2WB7A 2QUPA 1Y6DA 3ZG1A 1Z63A 4ONSA 2XLDA 2JD3A 3VYWA 3KYJA 4I3MA 1BR1A 4DXWA 1D0XA 1YDIA 2OKUA 2YZSA 3JCUQ 1I4ZA 3ABMC 1U89A 2L6FA 2OEVA 5E2QA 5A69A 1E2XA 2CYDA 4JZAA 3MFNA 3C18A 2IOQA 2YKZA 1ZU5A 3S0XA 5A6AA 2TMVP 1XZPA 2LCHA 1TWHA 3ABLC 4U5DE 2J7PD 4EKWA 1YA9A 4KC9A 4PFOA 4DRHB 1JR8A 1BDJB 3K1IA 3VM6A 2NSGA 3NYJA 1A7DA 4JCHA 2Q7RA 1LIHA 3C7JA 4Q7CA 1VLTA 1ZHZA 2WL8A 3B71A 4A2NB 2NUPB 1JMWA 1OCRC 1QLEC 4K0DA 1SMYF 2J46A 3I5QA 4QDLA 1RKEA 3ZVRA 5KYNA 2FGYA 1ZHYA 4OIOF 1JPJA 3GWNA 4G7OF 4DOZA 3EGXA 4JJFA 1WN0A 3ASOC 1V74B 2AWYA 2PP4A 3GEIA 3G4XA 1RMVA 3MX3A 2KSFA 4P9TA 2YLDA 1H7IA 3IQTA 4J7YA 1Q0DA 3EZIA 5COFA 4LACB 4MVSA 2EILC 3JYYA 5FZTA 4YL1A 2R7QA 2IBFA 3TOMA 4YT2A 5DS5A 2AWCA 4D4NA 1B68A 3M4CA 4CS7A 5JRAA 1W2WA 1S05A 2R7UA 1OW7A 5DS4A 1NG1A 1D1CA 1PV3A 2H7VC 4P9FA 2BC5A 1PCXA 3Q7LA 5COGA 4BJ6C 1QQ3A 3I4UA 3DE9A 1TFOB 1C02A 2CNWD 2Q3TA 3ZQYA 3NG1A 4O79A 2Q9BA 1EKYA 4IRUA 2LQGA 3JYHA 1DOVA 2RSEB 2J9VA 1OW6A 3AOUA 4N06A 1LKXA 4U5CE 3ZWIA 4RD9A 5AC4A 1VMAA 2NSFA 1DOWA 3K1IC 3V5ZA 4CX9A 2ZXRA 4CSAC 1GS9A 3RKOF 1Q0KA 2AVKA 2QTVA 1T6IA 3CEXA 5JVEA 1EI7A 2LFDA 3KH2A 4OD5A 1YARO 4MTGA 2I15A 4MQ9F 4NTBA 1CGOA 3B29A 3NMJA 2HSQA 3C8GD 2YEVA 3A9CA 2EPNA 4QI0A 4YK5A 3G4ZA 1TWCA 2FAPB 2Y3HA 2Y3BA 3MYIA 4XLNF 3RIPA 1GM5A 2YHSA 4LDQA 4N6CA 2WVQA 2UUIA 1VTMP 4P6IC 4MVUA 1SZIA 2NUTB 2OU6A 3DXJF 3UR3C 3KMIA 1E86A 2QLAA 3DKAA 4G0HA 4GEHA 1TKNA 4WABA 3RH3A 2XLVA 1H9GA 5CI8A 3ITFA 4IAQA 1D1AA 5EHHA 1FAPB 4F4BA 1SR2A 2J7PA 2EPMX 5GPGB 4DBRA 3DMDA 4LLEA 4W8PA 2IXPA 5D91A 3S28A 1IZMA 3WAQA 4EUKB 4RBNA 4ANJA 4FAPB 5A6KA 1H6GA 3TULA 1J8MF 4U9DA 2XLHA 3RQFA 3U2MA 3UMKA 5KYYB 1FR0A 3L8IA 3MBGA 3SXKA 1OR3A 2R7SA 3EHMA 1HW2A 4IGGA 2HKVA 1WOLA 3R7CA 1TWAA 2J0WA 3QVYA 1QKRA 1TQGA 2XXAB 2GFHA 4LERA 4K1OA 3UNGC 3S90A 3M4BA 2LSEA 3RVZA 1NFNA 4BJTA 3IEEA 2OQMA 2NUPA 2Y3GA 2EPLX 3DWWA 3L0IA 1LPEA 5E3CA 3C62A 4C7OB 3AGTA 2VB6A 5DS6A 1HMDA 3ZDLA 3NDBB 4JW1A 1ZW2A 2HZ8A 2ZXWC 2A0BA 3OEOA 5BQGA 4R32A 3X1OA 3LESA 2QY9A 1OCCC 4Q4ZF 2A68F 3GORA 2OG2A 5T1DB 4AK9A 2JPUA 3ABKC 4YN0B 3DZAA 4MTFA 2VH3A 4UDVA 1A7VA 3IQ6A 3E70C 4IAOA 4U5EE 5L0GA 1A7EA 3UGPA 1K05A 3NYLA 2BL2A 4JEBA 2C03A 4MS2A 1VLSA 2MYSA 2OJED 4PFPA 1R5ID 3ZQVA 2XL4A 4J30B 3FDQA 5D92A 2HV7A 5EK0A 3EH2A 1M2OA 1OCOC 3ZTZA 2R25A 2A69F 2CNWA 2PBEA 1Z5ZA 1FMWA 2YWAA 3O10A 4I1MA 2R7TA 4EIYA 2Q9CA 2AP3A 2DI3A 3FHDA 3S29A 2G62A 2VC9A 1SYQA 3EQLF 5F5FA 1J8YF 1L3PA 4MW8A 4BJ6A 3B0PA 4HEAJ 3JTLO 3KL4A 3AJMA 4W8KA 2HV6A 3IPMO 3FOOA 2F22A 1ZZPA 3OWTA 4XLPF 1FFHA 1JPNA 3NRHA 3QZCA 4KNWA 1YJGA 2M64A 2KGOA 4MTOA 1YYXA 1OCZC 4CSAA 2DYSC 5L0IA 1TWGA 3N2ZB 1ORYA 2KC3A 3RVYA 3U3FA 2XLEA 3DJNB 1WWPA 2Y39A 4CDVA 2HFIA 5KYUB 4BG0A 5KYWB 3HNLA 1Z6AA 2MWQA 1D0ZA 3CSKA 4LDRA 4U5HA 3X2QC 2A1DD 4JJGA 1MQVA 3C8ZA 4WGZA 3HNKA 4YT8A 2NUTA 5KYXB 3DM9B 1T6UA 4E18A 4JRZA 3JRTA 2YRFA 4NY3A 1T9KA 4YJWA 2M4EA 1G4US 3FAJA 3IQ5A 3RF3A 3TK0A 2W4MA 2HS5A 1IW7F 1M56C 2R7OA 2L7AA 3HKKA 3EZHA 4L6RA 3UGOA 3T4RA 3LAYA 1L7CA 3EHNA 1FTSA 1YLMA 2LFFA 2P1AA 3EGDB 2Z15A 3LS1A 3T6BA 2L6HA 2ZD9A 4CS8A 3EG9B 5KYYA 1CPQA 4U5GA 1QZXA 3H65A 4LDKA 5IY5C 3KKBA 2MHRA 2IXMA 2J0XA 1G5ZA 1OKKD 1U6HA 3TJ6A 2XS1A 2XXAA 3WODF 2EPKX 1LI7A 3F46A 5E3AA 5F5HA 4EBKA 2YLGA 2P61A 3FVYA 1TFKB 2OCCC 2ZXPA 2J9WA 1OXKA 1ZYRF 4YT4A 1VB5A 2B0JA 1LS1A 2H7BA 4E7SA 2X51A 4XPXA 1WATA 3EH1A 1M57C 1Q0MA 1MNDA 1NU9C 4FESA 4YL0A 3NMIA 4G7HF 3U5SA 3FMSA 4BJ5C 4C7OA 1FFTC 1KTMA 3A11A 2BE5F 3H2UA 3V7OA 2PX0A 5JP7A 5E33A 1E83A 1AVOB 4B6IA 4Z9JA 4U9EA 3JSEO 3FXHA 4PACA 3C8GB 1NBBA 4H4KC 3TQOA 1RJ9B 1RCPA 3ZTMA 2JX0A 3EFOB 4JTAB 1RKCA 4YT5A 4BJ1A 4JURI 4BEJA 5L0FA 3U3BA 5L0CA 3L1MA 5BQHA 1VYKA 1WASA 4JKVA 4OINF 1VK5A 3LEVA 1TR2A 2IXNA 3AG1C 3RYLA 3S27A 4KBLA 1OXBA 4MNDA 2WZFA 4N6HA 4DVZA 3E9VA 4HE8D 1BZ4A 3W8IA 2LP4A 3C63A 5BUOA 4J32B 2QE9A 3DE8A 4JTDB 3VRCA 4CJGA 3LEOA 2ASRA 2B0HA 2IM8A 2W4BA 4MVQA 1NSGB 4U5FE 1E84A 4JC7A 2ETSA 4CBEA 4MVRA 4CS8C 1PD0A 5HV9A 1NU7D 4CS9A 4DRIB 5L0HA 3O39A 2YL7A 3TOLA 2CCYA 3K1HA 4FWVA 3SP1A 2Q9AA 3LLIA 1QSPA 2A6EF 3W8HA 2J45A 4O7GA 4O6NA 2C04A 3AG3C 1Y4CA 2Q00A 2KQ9A 3GWLA 4JCZA 4M63A 3SEOA 4AX2A 4E0HA 2CDQA 1NZEA 2EIMC 5KYUA 3SXMA 2XL8A 2L81A 2VCBA 4FX5A 2OJQA 2XLMA 5KYWA 1K40A 1MMAA 2G3VA 2GAQA 2KJGA 5COMA 5L0DA 3DI5A 2V3CC 1EA8A 1T01A 1ZU4A 1T5OA 2YL3A 3EJNA 3DAFA 4JE9A 4DBQA 5KYXA 1K04A 1YYJA 2L9JA 3Q7GA 1C03A 2P0NA 3PCVA 4PJNA 1UG7A 4ULWA 2GDCA 1MMDA 4Z9IA 3ZC4A 1EQ1A 2P7VA 3T6JA 1XWJA 3AGUA 3EGDA 3W2VA 5JS5A 2WVOA 3AQCA 5JUAA 5K0IA 1HMOA 3EG9A 3W2WA 2PF4E 3LLKA 2DYRC 1AUEA 2IYLD 3IQCA 5L3QA 2GA0A 4MVZA 2W45A 1ZVZA 3IHUA 4LLCA 5L0JA 4K7BA 3RQEA 1YVIA 3K7DA 3M15A 4HFFB 2VASA 3TD7A 4GQHA 1G8XA 3WHNA 2J8WA 3O6XA 2YL1A 3ZSUA 4NC3A 2HJ3A 4DVYP 4EWCA 1Q0GA 4CS9C 2R7RA 2E87A 1YZAA 2UUHA 1OR2A 1S7ZA 1HE9A 5AGFA 3CAXA 1V54C 1JOGA 4HFKB 5A6BD 3S84A 4XPYA 2NPUA 1HY5A 4BJ5A 3NKDA 3L34A 3VF0A 3JRMO 1RXQA 4NTFA 3C8GA 4I44A 3NMKA 2XLOA 1RJ9A 2J9BA 2PX3A 4CJOA 3EFOA 4WGYA 2XRHA 3GEEA 1UFBA 1V55C 3T6GB 2KK1A 3JZ0A 4KI2A 1M6TA 1YZCA 1ZHTA 4X0RA 2V26A 3G50A 1MMNA 1PD1A 2H7OA 2R03A 5HSWA 3QMKA 5CI9A 2A6HF 5DVWA 4EBBA 3FOPA 5T3WA 3PMRA 2R7XA 1WGWA 2EINC 2G3KA 5DQZA 3SXYA 1Z7Qc 2Q4FA 1N1CA 3GM1A 2LK4A 1BR4A 4IARA 1KNYA 4YL3A 3U8PA 1VYIA 2I8BA 2DGJA 1KU2A 2HUJA 3HJCA 1I5NA 1ZHWA 3EPVA 2P6VA 3KPHA 1U0BB 4E17A 4DRJB 4NTAA 3CZ6A 3QW0A 1VOMA 1YAUO 2WZLA 3GEHA 4JIOA 3RQGA 1BR2A 5B1BC 3WG7C 4MW3A 3VAYA 3J06A 2R02A 5CIVA 1NFOA 1QPUA 1YA7O 1ZW3A 3FAPB 4O6MA 2CW0F 4DJ9A 1JRAA 2HMZA 4I1OB 3LJBA 4NQFA 3DJUB 4XTKA 1Z23A 2HJMA 1C17M 2VCCA 3QTHA 3GODA 4EHPA 2W9YA 3LNMB 2L6GA 3RFYA 5T3TA 4Q5SF 4AE4B 2Y3DA 2CGEA 3T9OA 3U0CA 1XZQA 3B9QA 5TJ5E 2R9RB 3B0VC 4QI2A 1QVXA 1LVKA 2KNHA 1O5HA 2ZXOA 4KNVA 1HE1A 3SNHA 3F47A 3U8VA 4C3BA 4CIPA 3DAGA 2XM0A 3K33A 1APCA 3NYMA 3V5YA 5FCLA 3BRJA 3Q6NA 2LIGA 3K6BA 4XEKA 1M2VB 1ORSC 2OEXA 1SF8A 4C3DA 4OIPF 4NCQA 3B0UX 4C3EA 3SXZA 2ZPAA 3M79A 3MLGA 4JVSA 1F1MA 2XM4A 4MVOA 4MVMA 4CDYA 2EPOA 3K66A 4D4XA 3U9JA 1FNTc 3NKEA 4GYTA 2R7VA 256BA 4IB4A 1NLXA 1MNEA 1LE4A 3ZIBA 1ORJA 5DLJA 2QNLA 2KYHA 3LS0A 3AQBA 2YVKA 4OD4A 5JLIA 3QVZA 2R05A 4BPMA 3O55A 2XSEA 3DD7A 1D1BA 3SYNA 3SZRA 1MMGA 5A6BA 1A0BA 2H8AA 4AL1A 5JT4A 2IXOA 2YLIA 4PJJA 4N4WA 4PJMA 2D4UA 2OOCA 3ECSA 2O9XA 4A4AA 1O3UA 2XLWA 3AG2C 1D0YA 4JEAA 2YL0A 5AC5A 4XWJA 3CQZA 3L8JA 3PHF2 2NG1A 5BQIA 2RD9A 4EBJA 2J9UA 1LI5A 1RKEB 2HSBA 2XL6A 4ER9A 5L3VA 2HMQA 3HTKC 3BEHA 5EGYA 3MYFA 1CPRA 2FFHA 4IJJA 1AEPA 3EGXB 4XEFA 1BBHA 4AL0A 1LM3B 2XS8A 3ASNC 2KW3C 3HNJA 4CIHA 1HW1A 3HNIA 2R7WA 3H2VA 3JSZA 1G4WR 4J7TA 1Q0FA 4PJLA 4XQ1A 4XEVA 3UMHA 4E0IA 3RW0A 2X0CA 5B3IA 1A41A 4ULVA 3W4YA 4YWQA 1CGME 4OIQF 3LNRA 4ZLDA 1GQAA 4JTCB 3ATPA 4Z9HA 4CDAA 2AU5A 1LS4A 4PK4A 3U9MA 4XPWA 4ZLCA 2YQYA 3R2PA 5JSLA 1OKKA 2WZGA 3GM2A 1OQCA 2LD6A 2Y69C 3TJ5A 1ST6A
chains in the Genus database with same CATH topology
1RKEA 5L0GA 1ZW3A 1ZVZA 4DJ9A 4ONSA 5L0JA 5L0DA 2GWWA 3H2VA 1YDIA 4PR9A 1T01A 4EHPA 1SYQA 1U89A 3ZDLA 3RF3A 2X0CA 1ZW2A 2LQGA 2B0HA 1DOVA 1TR2A 4P9TA 2L7AA 4W8PA 3H2UA 4E18A 1H6GA 1DOWA 2GDCA 1L7CA 5L0HA 3VF0A 5FZTA 4E17A 3TJ5A 2IBFA 1RKCA 1XWJA 4IGGA 5L0CA 5L0FA 5L0IA 2HSQA 3T6GB 1QKRA 1RKEB 4K1OA 3TJ6A 3S90A 1U6HA 3MYIA 1ST6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKE A;  5L0G A;  1ZW3 A;  1ZVZ A;  4DJ9 A;  4ONS A;  5L0J A;  5L0D A;  2GWW A;  3H2V A;  1YDI A;  4PR9 A;  1T01 A;  4EHP A;  1SYQ A;  1U89 A;  3ZDL A;  3RF3 A;  2X0C A;  1ZW2 A;  2LQG A;  2B0H A;  1DOV A;  1TR2 A;  4P9T A;  2L7A A;  4W8P A;  3H2U A;  4E18 A;  1H6G A;  1DOW A;  2GDC A;  1L7C A;  5L0H A;  3VF0 A;  5FZT A;  4E17 A;  3TJ5 A;  2IBF A;  1RKC A;  1XWJ A;  4IGG A;  5L0C A;  5L0F A;  5L0I A;  2HSQ A;  3T6G B;  1QKR A;  1RKE B;  4K1O A;  3TJ6 A;  3S90 A;  1U6H A;  3MYI A;  1ST6 A; 
#chains in the Genus database with same CATH topology
 2EIK C;  2VCA A;  3GAN A;  1GGQ A;  3HLZ A;  3V5X A;  1T6Q A;  1V4A A;  3OA1 A;  4RDA A;  2GWW A;  1O87 A;  2ICW G;  3US6 A;  4PR9 A;  2PNO A;  3LUT B;  1OW8 A;  2DB4 A;  1Z3I X;  3Q6M A;  5DQT A;  3GM3 A;  4OIR F;  3POV A;  2A0U A;  2PFD A;  3N0T A;  3PDM P;  1H9T A;  3N24 A;  3S9O A;  4BEM J;  1CGN A;  1ZHX A;  2WVN A;  4WJ0 A;  3UMI A;  4AE4 A;  3JT1 A;  3KYI A;  5A6J A;  4G7Z F;  1I4Y A;  3U2L A;  4O6Y A;  3QW1 A;  4E7Z A;  3AG4 C;  1WTY A;  3I5P A;  4G78 A;  1LE2 A;  3M1C B;  4H54 A;  4IWB A;  5B1A C;  3DM5 A;  1JAF A;  5B3S C;  5F28 E;  1M2V A;  1R4T A;  4U5B E;  2EIJ C;  1E85 A;  1FMV A;  2D5R B;  2WB7 A;  2QUP A;  1Y6D A;  3ZG1 A;  1Z63 A;  4ONS A;  2XLD A;  2JD3 A;  3VYW A;  3KYJ A;  4I3M A;  1BR1 A;  4DXW A;  1D0X A;  1YDI A;  2OKU A;  2YZS A;  3JCU Q;  1I4Z A;  3ABM C;  1U89 A;  2L6F A;  2OEV A;  5E2Q A;  5A69 A;  1E2X A;  2CYD A;  4JZA A;  3MFN A;  3C18 A;  2IOQ A;  2YKZ A;  1ZU5 A;  3S0X A;  5A6A A;  2TMV P;  1XZP A;  2LCH A;  1TWH A;  3ABL C;  4U5D E;  2J7P D;  4EKW A;  1YA9 A;  4KC9 A;  4PFO A;  4DRH B;  1JR8 A;  1BDJ B;  3K1I A;  3VM6 A;  2NSG A;  3NYJ A;  1A7D A;  4JCH A;  2Q7R A;  1LIH A;  3C7J A;  4Q7C A;  1VLT A;  1ZHZ A;  2WL8 A;  3B71 A;  4A2N B;  2NUP B;  1JMW A;  1OCR C;  1QLE C;  4K0D A;  1SMY F;  2J46 A;  3I5Q A;  4QDL A;  1RKE A;  3ZVR A;  5KYN A;  2FGY A;  1ZHY A;  4OIO F;  1JPJ A;  3GWN A;  4G7O F;  4DOZ A;  3EGX A;  4JJF A;  1WN0 A;  3ASO C;  1V74 B;  2AWY A;  2PP4 A;  3GEI A;  3G4X A;  1RMV A;  3MX3 A;  2KSF A;  4P9T A;  2YLD A;  1H7I A;  3IQT A;  4J7Y A;  1Q0D A;  3EZI A;  5COF A;  4LAC B;  4MVS A;  2EIL C;  3JYY A;  5FZT A;  4YL1 A;  2R7Q A;  2IBF A;  3TOM A;  4YT2 A;  5DS5 A;  2AWC A;  4D4N A;  1B68 A;  3M4C A;  4CS7 A;  5JRA A;  1W2W A;  1S05 A;  2R7U A;  1OW7 A;  5DS4 A;  1NG1 A;  1D1C A;  1PV3 A;  2H7V C;  4P9F A;  2BC5 A;  1PCX A;  3Q7L A;  5COG A;  4BJ6 C;  1QQ3 A;  3I4U A;  3DE9 A;  1TFO B;  1C02 A;  2CNW D;  2Q3T A;  3ZQY A;  3NG1 A;  4O79 A;  2Q9B A;  1EKY A;  4IRU A;  2LQG A;  3JYH A;  1DOV A;  2RSE B;  2J9V A;  1OW6 A;  3AOU A;  4N06 A;  1LKX A;  4U5C E;  3ZWI A;  4RD9 A;  5AC4 A;  1VMA A;  2NSF A;  1DOW A;  3K1I C;  3V5Z A;  4CX9 A;  2ZXR A;  4CSA C;  1GS9 A;  3RKO F;  1Q0K A;  2AVK A;  2QTV A;  1T6I A;  3CEX A;  5JVE A;  1EI7 A;  2LFD A;  3KH2 A;  4OD5 A;  1YAR O;  4MTG A;  2I15 A;  4MQ9 F;  4NTB A;  1CGO A;  3B29 A;  3NMJ A;  2HSQ A;  3C8G D;  2YEV A;  3A9C A;  2EPN A;  4QI0 A;  4YK5 A;  3G4Z A;  1TWC A;  2FAP B;  2Y3H A;  2Y3B A;  3MYI A;  4XLN F;  3RIP A;  1GM5 A;  2YHS A;  4LDQ A;  4N6C A;  2WVQ A;  2UUI A;  1VTM P;  4P6I C;  4MVU A;  1SZI A;  2NUT B;  2OU6 A;  3DXJ F;  3UR3 C;  3KMI A;  1E86 A;  2QLA A;  3DKA A;  4G0H A;  4GEH A;  1TKN A;  4WAB A;  3RH3 A;  2XLV A;  1H9G A;  5CI8 A;  3ITF A;  4IAQ A;  1D1A A;  5EHH A;  1FAP B;  4F4B A;  1SR2 A;  2J7P A;  2EPM X;  5GPG B;  4DBR A;  3DMD A;  4LLE A;  4W8P A;  2IXP A;  5D91 A;  3S28 A;  1IZM A;  3WAQ A;  4EUK B;  4RBN A;  4ANJ A;  4FAP B;  5A6K A;  1H6G A;  3TUL A;  1J8M F;  4U9D A;  2XLH A;  3RQF A;  3U2M A;  3UMK A;  5KYY B;  1FR0 A;  3L8I A;  3MBG A;  3SXK A;  1OR3 A;  2R7S A;  3EHM A;  1HW2 A;  4IGG A;  2HKV A;  1WOL A;  3R7C A;  1TWA A;  2J0W A;  3QVY A;  1QKR A;  1TQG A;  2XXA B;  2GFH A;  4LER A;  4K1O A;  3UNG C;  3S90 A;  3M4B A;  2LSE A;  3RVZ A;  1NFN A;  4BJT A;  3IEE A;  2OQM A;  2NUP A;  2Y3G A;  2EPL X;  3DWW A;  3L0I A;  1LPE A;  5E3C A;  3C62 A;  4C7O B;  3AGT A;  2VB6 A;  5DS6 A;  1HMD A;  3ZDL A;  3NDB B;  4JW1 A;  1ZW2 A;  2HZ8 A;  2ZXW C;  2A0B A;  3OEO A;  5BQG A;  4R32 A;  3X1O A;  3LES A;  2QY9 A;  1OCC C;  4Q4Z F;  2A68 F;  3GOR A;  2OG2 A;  5T1D B;  4AK9 A;  2JPU A;  3ABK C;  4YN0 B;  3DZA A;  4MTF A;  2VH3 A;  4UDV A;  1A7V A;  3IQ6 A;  3E70 C;  4IAO A;  4U5E E;  5L0G A;  1A7E A;  3UGP A;  1K05 A;  3NYL A;  2BL2 A;  4JEB A;  2C03 A;  4MS2 A;  1VLS A;  2MYS A;  2OJE D;  4PFP A;  1R5I D;  3ZQV A;  2XL4 A;  4J30 B;  3FDQ A;  5D92 A;  2HV7 A;  5EK0 A;  3EH2 A;  1M2O A;  1OCO C;  3ZTZ A;  2R25 A;  2A69 F;  2CNW A;  2PBE A;  1Z5Z A;  1FMW A;  2YWA A;  3O10 A;  4I1M A;  2R7T A;  4EIY A;  2Q9C A;  2AP3 A;  2DI3 A;  3FHD A;  3S29 A;  2G62 A;  2VC9 A;  1SYQ A;  3EQL F;  5F5F A;  1J8Y F;  1L3P A;  4MW8 A;  4BJ6 A;  3B0P A;  4HEA J;  3JTL O;  3KL4 A;  3AJM A;  4W8K A;  2HV6 A;  3IPM O;  3FOO A;  2F22 A;  1ZZP A;  3OWT A;  4XLP F;  1FFH A;  1JPN A;  3NRH A;  3QZC A;  4KNW A;  1YJG A;  2M64 A;  2KGO A;  4MTO A;  1YYX A;  1OCZ C;  4CSA A;  2DYS C;  5L0I A;  1TWG A;  3N2Z B;  1ORY A;  2KC3 A;  3RVY A;  3U3F A;  2XLE A;  3DJN B;  1WWP A;  2Y39 A;  4CDV A;  2HFI A;  5KYU B;  4BG0 A;  5KYW B;  3HNL A;  1Z6A A;  2MWQ A;  1D0Z A;  3CSK A;  4LDR A;  4U5H A;  3X2Q C;  2A1D D;  4JJG A;  1MQV A;  3C8Z A;  4WGZ A;  3HNK A;  4YT8 A;  2NUT A;  5KYX B;  3DM9 B;  1T6U A;  4E18 A;  4JRZ A;  3JRT A;  2YRF A;  4NY3 A;  1T9K A;  4YJW A;  2M4E A;  1G4U S;  3FAJ A;  3IQ5 A;  3RF3 A;  3TK0 A;  2W4M A;  2HS5 A;  1IW7 F;  1M56 C;  2R7O A;  2L7A A;  3HKK A;  3EZH A;  4L6R A;  3UGO A;  3T4R A;  3LAY A;  1L7C A;  3EHN A;  1FTS A;  1YLM A;  2LFF A;  2P1A A;  3EGD B;  2Z15 A;  3LS1 A;  3T6B A;  2L6H A;  2ZD9 A;  4CS8 A;  3EG9 B;  5KYY A;  1CPQ A;  4U5G A;  1QZX A;  3H65 A;  4LDK A;  5IY5 C;  3KKB A;  2MHR A;  2IXM A;  2J0X A;  1G5Z A;  1OKK D;  1U6H A;  3TJ6 A;  2XS1 A;  2XXA A;  3WOD F;  2EPK X;  1LI7 A;  3F46 A;  5E3A A;  5F5H A;  4EBK A;  2YLG A;  2P61 A;  3FVY A;  1TFK B;  2OCC C;  2ZXP A;  2J9W A;  1OXK A;  1ZYR F;  4YT4 A;  1VB5 A;  2B0J A;  1LS1 A;  2H7B A;  4E7S A;  2X51 A;  4XPX A;  1WAT A;  3EH1 A;  1M57 C;  1Q0M A;  1MND A;  1NU9 C;  4FES A;  4YL0 A;  3NMI A;  4G7H F;  3U5S A;  3FMS A;  4BJ5 C;  4C7O A;  1FFT C;  1KTM A;  3A11 A;  2BE5 F;  3H2U A;  3V7O A;  2PX0 A;  5JP7 A;  5E33 A;  1E83 A;  1AVO B;  4B6I A;  4Z9J A;  4U9E A;  3JSE O;  3FXH A;  4PAC A;  3C8G B;  1NBB A;  4H4K C;  3TQO A;  1RJ9 B;  1RCP A;  3ZTM A;  2JX0 A;  3EFO B;  4JTA B;  1RKC A;  4YT5 A;  4BJ1 A;  4JUR I;  4BEJ A;  5L0F A;  3U3B A;  5L0C A;  3L1M A;  5BQH A;  1VYK A;  1WAS A;  4JKV A;  4OIN F;  1VK5 A;  3LEV A;  1TR2 A;  2IXN A;  3AG1 C;  3RYL A;  3S27 A;  4KBL A;  1OXB A;  4MND A;  2WZF A;  4N6H A;  4DVZ A;  3E9V A;  4HE8 D;  1BZ4 A;  3W8I A;  2LP4 A;  3C63 A;  5BUO A;  4J32 B;  2QE9 A;  3DE8 A;  4JTD B;  3VRC A;  4CJG A;  3LEO A;  2ASR A;  2B0H A;  2IM8 A;  2W4B A;  4MVQ A;  1NSG B;  4U5F E;  1E84 A;  4JC7 A;  2ETS A;  4CBE A;  4MVR A;  4CS8 C;  1PD0 A;  5HV9 A;  1NU7 D;  4CS9 A;  4DRI B;  5L0H A;  3O39 A;  2YL7 A;  3TOL A;  2CCY A;  3K1H A;  4FWV A;  3SP1 A;  2Q9A A;  3LLI A;  1QSP A;  2A6E F;  3W8H A;  2J45 A;  4O7G A;  4O6N A;  2C04 A;  3AG3 C;  1Y4C A;  2Q00 A;  2KQ9 A;  3GWL A;  4JCZ A;  4M63 A;  3SEO A;  4AX2 A;  4E0H A;  2CDQ A;  1NZE A;  2EIM C;  5KYU A;  3SXM A;  2XL8 A;  2L81 A;  2VCB A;  4FX5 A;  2OJQ A;  2XLM A;  5KYW A;  1K40 A;  1MMA A;  2G3V A;  2GAQ A;  2KJG A;  5COM A;  5L0D A;  3DI5 A;  2V3C C;  1EA8 A;  1T01 A;  1ZU4 A;  1T5O A;  2YL3 A;  3EJN A;  3DAF A;  4JE9 A;  4DBQ A;  5KYX A;  1K04 A;  1YYJ A;  2L9J A;  3Q7G A;  1C03 A;  2P0N A;  3PCV A;  4PJN A;  1UG7 A;  4ULW A;  2GDC A;  1MMD A;  4Z9I A;  3ZC4 A;  1EQ1 A;  2P7V A;  3T6J A;  1XWJ A;  3AGU A;  3EGD A;  3W2V A;  5JS5 A;  2WVO A;  3AQC A;  5JUA A;  5K0I A;  1HMO A;  3EG9 A;  3W2W A;  2PF4 E;  3LLK A;  2DYR C;  1AUE A;  2IYL D;  3IQC A;  5L3Q A;  2GA0 A;  4MVZ A;  2W45 A;  1ZVZ A;  3IHU A;  4LLC A;  5L0J A;  4K7B A;  3RQE A;  1YVI A;  3K7D A;  3M15 A;  4HFF B;  2VAS A;  3TD7 A;  4GQH A;  1G8X A;  3WHN A;  2J8W A;  3O6X A;  2YL1 A;  3ZSU A;  4NC3 A;  2HJ3 A;  4DVY P;  4EWC A;  1Q0G A;  4CS9 C;  2R7R A;  2E87 A;  1YZA A;  2UUH A;  1OR2 A;  1S7Z A;  1HE9 A;  5AGF A;  3CAX A;  1V54 C;  1JOG A;  4HFK B;  5A6B D;  3S84 A;  4XPY A;  2NPU A;  1HY5 A;  4BJ5 A;  3NKD A;  3L34 A;  3VF0 A;  3JRM O;  1RXQ A;  4NTF A;  3C8G A;  4I44 A;  3NMK A;  2XLO A;  1RJ9 A;  2J9B A;  2PX3 A;  4CJO A;  3EFO A;  4WGY A;  2XRH A;  3GEE A;  1UFB A;  1V55 C;  3T6G B;  2KK1 A;  3JZ0 A;  4KI2 A;  1M6T A;  1YZC A;  1ZHT A;  4X0R A;  2V26 A;  3G50 A;  1MMN A;  1PD1 A;  2H7O A;  2R03 A;  5HSW A;  3QMK A;  5CI9 A;  2A6H F;  5DVW A;  4EBB A;  3FOP A;  5T3W A;  3PMR A;  2R7X A;  1WGW A;  2EIN C;  2G3K A;  5DQZ A;  3SXY A;  1Z7Q c;  2Q4F A;  1N1C A;  3GM1 A;  2LK4 A;  1BR4 A;  4IAR A;  1KNY A;  4YL3 A;  3U8P A;  1VYI A;  2I8B A;  2DGJ A;  1KU2 A;  2HUJ A;  3HJC A;  1I5N A;  1ZHW A;  3EPV A;  2P6V A;  3KPH A;  1U0B B;  4E17 A;  4DRJ B;  4NTA A;  3CZ6 A;  3QW0 A;  1VOM A;  1YAU O;  2WZL A;  3GEH A;  4JIO A;  3RQG A;  1BR2 A;  5B1B C;  3WG7 C;  4MW3 A;  3VAY A;  3J06 A;  2R02 A;  5CIV A;  1NFO A;  1QPU A;  1YA7 O;  1ZW3 A;  3FAP B;  4O6M A;  2CW0 F;  4DJ9 A;  1JRA A;  2HMZ A;  4I1O B;  3LJB A;  4NQF A;  3DJU B;  4XTK A;  1Z23 A;  2HJM A;  1C17 M;  2VCC A;  3QTH A;  3GOD A;  4EHP A;  2W9Y A;  3LNM B;  2L6G A;  3RFY A;  5T3T A;  4Q5S F;  4AE4 B;  2Y3D A;  2CGE A;  3T9O A;  3U0C A;  1XZQ A;  3B9Q A;  5TJ5 E;  2R9R B;  3B0V C;  4QI2 A;  1QVX A;  1LVK A;  2KNH A;  1O5H A;  2ZXO A;  4KNV A;  1HE1 A;  3SNH A;  3F47 A;  3U8V A;  4C3B A;  4CIP A;  3DAG A;  2XM0 A;  3K33 A;  1APC A;  3NYM A;  3V5Y A;  5FCL A;  3BRJ A;  3Q6N A;  2LIG A;  3K6B A;  4XEK A;  1M2V B;  1ORS C;  2OEX A;  1SF8 A;  4C3D A;  4OIP F;  4NCQ A;  3B0U X;  4C3E A;  3SXZ A;  2ZPA A;  3M79 A;  3MLG A;  4JVS A;  1F1M A;  2XM4 A;  4MVO A;  4MVM A;  4CDY A;  2EPO A;  3K66 A;  4D4X A;  3U9J A;  1FNT c;  3NKE A;  4GYT A;  2R7V A;  256B A;  4IB4 A;  1NLX A;  1MNE A;  1LE4 A;  3ZIB A;  1ORJ A;  5DLJ A;  2QNL A;  2KYH A;  3LS0 A;  3AQB A;  2YVK A;  4OD4 A;  5JLI A;  3QVZ A;  2R05 A;  4BPM A;  3O55 A;  2XSE A;  3DD7 A;  1D1B A;  3SYN A;  3SZR A;  1MMG A;  5A6B A;  1A0B A;  2H8A A;  4AL1 A;  5JT4 A;  2IXO A;  2YLI A;  4PJJ A;  4N4W A;  4PJM A;  2D4U A;  2OOC A;  3ECS A;  2O9X A;  4A4A A;  1O3U A;  2XLW A;  3AG2 C;  1D0Y A;  4JEA A;  2YL0 A;  5AC5 A;  4XWJ A;  3CQZ A;  3L8J A;  3PHF 2;  2NG1 A;  5BQI A;  2RD9 A;  4EBJ A;  2J9U A;  1LI5 A;  1RKE B;  2HSB A;  2XL6 A;  4ER9 A;  5L3V A;  2HMQ A;  3HTK C;  3BEH A;  5EGY A;  3MYF A;  1CPR A;  2FFH A;  4IJJ A;  1AEP A;  3EGX B;  4XEF A;  1BBH A;  4AL0 A;  1LM3 B;  2XS8 A;  3ASN C;  2KW3 C;  3HNJ A;  4CIH A;  1HW1 A;  3HNI A;  2R7W A;  3H2V A;  3JSZ A;  1G4W R;  4J7T A;  1Q0F A;  4PJL A;  4XQ1 A;  4XEV A;  3UMH A;  4E0I A;  3RW0 A;  2X0C A;  5B3I A;  1A41 A;  4ULV A;  3W4Y A;  4YWQ A;  1CGM E;  4OIQ F;  3LNR A;  4ZLD A;  1GQA A;  4JTC B;  3ATP A;  4Z9H A;  4CDA A;  2AU5 A;  1LS4 A;  4PK4 A;  3U9M A;  4XPW A;  4ZLC A;  2YQY A;  3R2P A;  5JSL A;  1OKK A;  2WZG A;  3GM2 A;  1OQC A;  2LD6 A;  2Y69 C;  3TJ5 A;  1ST6 A; 
#chains in the Genus database with same CATH homology
 1RKE A;  5L0G A;  1ZW3 A;  1ZVZ A;  4DJ9 A;  4ONS A;  5L0J A;  5L0D A;  2GWW A;  3H2V A;  1YDI A;  4PR9 A;  1T01 A;  4EHP A;  1SYQ A;  1U89 A;  3ZDL A;  3RF3 A;  2X0C A;  1ZW2 A;  2LQG A;  2B0H A;  1DOV A;  1TR2 A;  4P9T A;  2L7A A;  4W8P A;  3H2U A;  4E18 A;  1H6G A;  1DOW A;  2GDC A;  1L7C A;  5L0H A;  3VF0 A;  5FZT A;  4E17 A;  3TJ5 A;  2IBF A;  1RKC A;  1XWJ A;  4IGG A;  5L0C A;  5L0F A;  5L0I A;  2HSQ A;  3T6G B;  1QKR A;  1RKE B;  4K1O A;  3TJ6 A;  3S90 A;  1U6H A;  3MYI A;  1ST6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...