1DOVA

Crystal structure of the alpha-catenin dimerization domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
181
structure length
181
Chain Sequence
ESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the dimerization and beta-catenin-binding region of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords ALPHA-CATENIN
total genus 86
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1999-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1dovA00
3H2VA 1H6GA 4W8PA 1RKEB 1ZVZA 5FZTA 5L0JA 4E18A 1YDIA 1U89A 1DOVA 4EHPA 4IGGA 2HSQA 1XWJA 3H2UA 4K1OA 3TJ6A 3RF3A 5L0GA 1QKRA 1ZW2A 1SYQA 5L0FA 4PR9A 1U6HA 1DOWA 4P9TA 2LQGA 1L7CA 4ONSA 1ST6A 1ZW3A 5L0DA 5L0IA 2B0HA 3MYIA 4DJ9A 3S90A 2IBFA 1RKCA 2GDCA 1TR2A 5L0CA 1T01A 2L7AA 3ZDLA 4E17A 1RKEA 2X0CA 3T6GB 3VF0A 3TJ5A 5L0HA 2GWWA
chains in the Genus database with same CATH superfamily
1ZU4A 4MVSA 4C3DA 1YA7O 5COGA 4LERA 2CW0F 2G3KA 3PMRA 1D1AA 1JOGA 3C8ZA 4CSAA 1A7DA 3K33A 1N1CA 3KKBA 3SXKA 3US6A 4J7YA 4EWCA 3X1OA 2Y39A 4MS2A 2LSEA 3Q7GA 4O79A 1LM3B 4CIPA 4FESA 1Z6AA 4JTCB 5A6KA 1RMVA 4YWQA 3QVYA 4XTKA 2XLEA 3T9OA 3U0CA 2R7XA 3CAXA 2OG2A 2J9UA 3MFNA 1I4ZA 4GQHA 2BC5A 2WL8A 1HMOA 3E9VA 4O6YA 5KYNA 3K6BA 1EI7A 1TWAA 1RCPA 3C63A 4JVSA 1PD1A 3DE8A 4HE8D 4JTAB 4YJWA 1RKCA 3NMKA 2XS1A 5A6JA 2VCBA 2KNHA 1JR8A 3VM6A 4PK4A 1OQCA 4G7ZF 2QE9A 5IY5C 1QSPA 4CX9A 2OCCC 2A6EF 5D91A 1ZU5A 1LI5A 1OCRC 4YN0B 1V54C 1U89A 2L6HA 1VYIA 3EGXB 1VMAA 2R7TA 1TFKB 1OKKD 2HJ3A 1U0BB 4MTOA 3U9MA 3ABKC 3V7OA 4F4BA 2D4UA 5L0CA 4JJFA 1OXBA 2ZXPA 1SZIA 1J8YF 1EKYA 2HV6A 4P9FA 1QVXA 4MTGA 4Z9HA 3ABMC 1WGWA 2H8AA 1FTSA 4I1MA 5EK0A 5KYXB 4ZLDA 3I4UA 3SZRA 4MVZA 2QLAA 2DGJA 2AVKA 4E7ZA 1Q0MA 4OIPF 2WZLA 3QMKA 5F5HA 4BJ5A 4PJNA 3RYLA 2AWCA 1T6IA 1RKEB 1WWPA 2Y3BA 3LLKA 2YEVA 1TWGA 3V5ZA 3HTKC 2QNLA 2VASA 1LKXA 3E70C 1H9GA 3GM1A 1V74B 1OCCC 3LEOA 1QKRA 3IQTA 1YLMA 1E84A 2L6FA 2RSEB 2NSGA 4LLEA 4WJ0A 2UUHA 4YT5A 2R25A 3VAYA 2HJMA 1YVIA 4CS7A 3UNGC 1K40A 1PCXA 3G50A 3QTHA 2YL7A 3AQBA 5BQGA 1APCA 4OIRF 3S90A 4Q5SF 4XQ1A 4DOZA 1VLSA 5B3SC 1HW1A 3L8IA 1Z23A 2GA0A 2IXNA 3LNMB 3B0UX 3AQCA 1NFOA 2PP4A 2WZGA 2XL6A 1GGQA 1QPUA 5KYYA 4OINF 4IAQA 3R7CA 1LI7A 3TOLA 3J06A 1AVOB 1G5ZA 3S27A 4YL1A 1FFTC 1SR2A 1TKNA 3JZ0A 3KYIA 2OEXA 3Q6NA 2NUTA 1MMNA 4EBJA 3RKOF 3NRHA 4ER9A 3GANA 4I1OB 4PFOA 1E86A 1HE9A 2R9RB 4YT8A 3K1HA 3RQGA 3ITFA 2ICWG 3DAGA 2EILC 3AG4C 3GODA 1EQ1A 2PF4E 1LVKA 2R02A 3DAFA 3DZAA 4O6MA 1LE4A 1XZPA 4GYTA 4XWJA 3U2LA 4MVQA 2IXPA 4AL1A 2KW3C 2F22A 2NPUA 3MYFA 3LUTB 1WN0A 4CJGA 1BR2A 3LNRA 2FAPB 1SF8A 2R03A 3IHUA 4JJGA 1HE1A 3CEXA 3H2VA 3HKKA 5B3IA 5BQIA 3EGDA 1NLXA 4N6CA 3B0PA 4EUKB 1MNDA 1QQ3A 3WAQA 1Q0KA 4IWBA 3EHMA 3GWLA 3HJCA 3CZ6A 4CDAA 3C62A 1GQAA 2HSQA 1XWJA 2HV7A 3DMDA 3GWNA 3LS1A 3NMJA 4H4KC 2A0BA 4N4WA 2Q9AA 3RH3A 1ZW2A 3WODF 3ZTMA 5JRAA 1Y4CA 1A7EA 1PD0A 1L7CA 2EPLX 2LQGA 2PFDA 2Q00A 3AOUA 2EPNA 3EZHA 1WOLA 1M57C 3U3FA 1I4YA 5JLIA 1K04A 1UG7A 4CDYA 2KQ9A 3FAJA 3HNIA 4U5HA 1V55C 4HEAJ 1BDJB 1T01A 2VCAA 4BPMA 1VK5A 4CS8C 4FAPB 4NCQA 2EINC 3C8GD 3VF0A 5DQTA 1YYJA 3MLGA 2XLMA 3B0VC 1T6UA 2XRHA 5EGYA 5JSLA 2R7SA 1V4AA 3ABLC 3QZCA 1Q0GA 4BJ6C 4NY3A 3U3BA 2X51A 3HNJA 4E18A 4YT4A 2AU5A 1E85A 2R05A 2TMVP 2JD3A 5A6AA 2J46A 1GS9A 2L9JA 3EH2A 4CJOA 3LAYA 1NBBA 4BJ1A 3PHF2 1M6TA 3JSEO 2Z15A 4DXWA 2W4BA 4U9DA 3AGUA 3SP1A 4PR9A 4E0IA 3NG1A 3EFOA 4DRIB 3W2VA 4CS9A 5L0IA 3AG1C 3MYIA 4GEHA 2BE5F 3V5YA 1GM5A 2Q4FA 2HKVA 4JC7A 3TOMA 4A2NB 3U8PA 2XL4A 1Q0FA 4DJ9A 4WGYA 3W8HA 5COFA 1LIHA 2KGOA 1OW8A 3Q7LA 4FWVA 1LPEA 3W2WA 1BR4A 1YZCA 3NYLA 3ZG1A 1S05A 3LLIA 3GEHA 4YT2A 5JVEA 2CGEA 2YKZA 3RIPA 2J0WA 3GEIA 4H54A 4PJJA 4CS8A 4Z9JA 1Z7Qc 5B1AC 5L0JA 1M56C 1YAUO 3FOPA 1C02A 1TWHA 4IRUA 3RVYA 4YK5A 3S84A 3QW0A 1K05A 5F28E 3ZC4A 4DVYP 2KYHA 1BBHA 1RJ9A 1A7VA 3L34A 3A9CA 3AG3C 1IW7F 5L3QA 1VTMP 4U9EA 2PX0A 3ECSA 1L3PA 3LESA 2CCYA 2ZXWC 1CGNA 4JZAA 2YQYA 3UR3C 3ATPA 3KMIA 1TFOB 1KU2A 1NZEA 2EIKC 4MVRA 3SXZA 3R2PA 3ZVRA 4MVUA 2Y3DA 3EFOB 3VYWA 4OD5A 3K7DA 5KYYB 3JYYA 3L1MA 3M79A 3ZIBA 2ZXOA 2YHSA 2KJGA 4X0RA 4C7OA 2HS5A 1H6GA 2QY9A 2J9BA 2IYLD 2A0UA 2NSFA 3AGTA 3T4RA 2PBEA 3X2QC 4MQ9F 3EG9A 3DXJF 4JEBA 2DB4A 4LDQA 5E3AA 4KC9A 1BR1A 2XLWA 4G78A 4XEVA 2J7PA 5DVWA 5HSWA 1UFBA 2YZSA 3EQLF 3K1IC 3LJBA 4JIOA 2CNWD 3O55A 1U6HA 2H7BA 3JRTA 2WZFA 1ZW3A 4JURI 1LE2A 1JPJA 1YYXA 5COMA 3NMIA 4JW1A 1ZZPA 1T9KA 3UGPA 2XLHA 1CPQA 1VB5A 1ZHWA 2KK1A 256BA 3C8GB 4MVOA 2YLGA 5L0HA 4LDKA 5JT4A 1QZXA 4CIHA 4EKWA 2R7VA 3EPVA 4XLPF 2R7QA 3NKEA 1G4US 3JYHA 5AC5A 2XXAB 4D4NA 4KBLA 2GFHA 1ZYRF 1YDIA 1KNYA 2AWYA 3N0TA 4IAOA 1I5NA 4JE9A 2YRFA 4OIQF 2G62A 2CYDA 1LS1A 4C7OB 1HY5A 1A0BA 4RD9A 3ZWIA 4YL0A 4MVMA 3IQ6A 3GORA 4Q4ZF 1YJGA 2LP4A 2GAQA 1MMAA 2P7VA 3B29A 3EGXA 3RFYA 3BEHA 3KYJA 4U5FE 5A6BA 2E87A 2IBFA 2HSBA 1ORSC 2KC3A 1YZAA 3SXMA 2L7AA 2J9VA 4CSAC 4BJ5C 2ETSA 2HFIA 1Q0DA 5T1DB 1Z5ZA 1CGME 2V3CC 1M2VA 1FFHA 1J8MF 2IOQA 4PJLA 1RJ9B 4XPXA 4RBNA 1R4TA 4L6RA 4P6IC 4AL0A 2A68F 4EBBA 1JRAA 2R7UA 2J7PD 2EIMC 1E83A 3QVZA 2MYSA 4KNWA 4BEMJ 5E33A 3FOOA 2YWAA 2LIGA 4HFFB 5T3TA 5DQZA 3TJ6A 4XPYA 2ZD9A 4FX5A 2H7VC 5L0FA 3IQCA 3U9JA 2YVKA 4QI2A 4PACA 4P9TA 1S7ZA 2J9WA 2P0NA 3T6JA 2XLDA 2LCHA 3DKAA 1OXKA 1T5OA 3U8VA 1NFNA 1NU9C 3G4XA 3M15A 3EG9B 4JKVA 5GPGB 1ORJA 4HFKB 4XLNF 3FAPB 1TR2A 3LS0A 4IB4A 1ZHXA 2JPUA 4E17A 1ZHZA 3G4ZA 2XM0A 3K66A 3U5SA 3L0IA 4MNDA 2GWWA 4NTAA 3EZIA 2Q9CA 4W8PA 4CBEA 2V26A 1WTYA 4KI2A 1LS4A 2RD9A 3DI5A 2OJQA 4DBQA 2IM8A 4IGGA 4JCZA 4C3BA 1VOMA 2LD6A 2L6GA 2Q3TA 2J45A 4N6HA 5CI8A 3PDMP 3DE9A 3RQFA 1MMGA 2ZXRA 3RF3A 1HMDA 5E2QA 5BQHA 4DVZA 4C3EA 4ULWA 4JTDB 4E0HA 5L3VA 4OIOF 5KYWB 3WHNA 3HNKA 1FR0A 4E7SA 1IZMA 2Q7RA 1XZQA 3CQZA 1QLEC 3IQ5A 4OD4A 1OCOC 5DS6A 4IJJA 4ANJA 2A6HF 1D1BA 3DWWA 5HV9A 3GM2A 4JRZA 2GDCA 3O39A 4B6IA 2HMQA 2XL8A 1CPRA 1C03A 1G8XA 1MNEA 2BL2A 2X0CA 3VRCA 2WB7A 1MMDA 1O5HA 2I8BA 3OA1A 2AP3A 3C7JA 3KL4A 4U5GA 4QDLA 4K0DA 3H65A 1ZVZA 3W8IA 5FZTA 2G3VA 2R7RA 1TWCA 2NUPA 1FAPB 3LEVA 5CI9A 3OEOA 4EHPA 1O3UA 2XLVA 5KYXA 3TQOA 1ZHYA 1HW2A 4CS9C 3EGDB 3IPMO 1JAFA 3S29A 4MW3A 1M2VB 3MX3A 2EPKX 2IXMA 1NSGB 1DOWA 2NG1A 2J0XA 4ONSA 3SNHA 5F5FA 2QUPA 3M4BA 4EIYA 3EHNA 1FNTc 1Z63A 3B71A 2DYSC 2LK4A 4AE4B 2P1AA 2C04A 1FMWA 2ASRA 1Y6DA 1D0ZA 2CNWA 2I15A 1OCZC 2A69F 2EPOA 2HZ8A 1WASA 4AK9A 3ZQYA 1RKEA 3TJ5A 1VLTA 4YL3A 2R7WA 1OW7A 5AGFA 1TQGA 2D5RB 3DD7A 4Q7CA 2PNOA 3DJNB 5DS5A 5K0IA 4RDAA 2CDQA 3HNLA 5T3WA 1WATA 2O9XA 3ZQVA 3NDBB 2R7OA 2DI3A 2NUPB 1NG1A 3SYNA 1R5ID 1AEPA 4J30B 2UUIA 1O87A 1KTMA 4K1OA 4W8KA 5E3CA 1B68A 2L81A 3TD7A 3ZTZA 2Y69C 2FGYA 3FXHA 5JUAA 4U5CE 1SMYF 3BRJA 4BG0A 2OEVA 3NYJA 2B0HA 2EPMX 2VB6A 4IARA 4QI0A 1D1CA 2A1DD 1JPNA 2Y3HA 3OWTA 3RQEA 4D4XA 5EHHA 3UGOA 2XLOA 1EA8A 3GM3A 1H9TA 3POVA 1H7IA 3S9OA 5D92A 4MTFA 4NQFA 2M4EA 2ZPAA 3MBGA 4XEFA 2WVOA 3DM5A 1T6QA 1OKKA 3AJMA 3K1IA 2W4MA 4R32A 3JCUQ 4BEJA 5KYUB 5CIVA 2NUTB 4LACB 5DLJA 3V5XA 5AC4A 3B9QA 1C17M 4AE4A 4N06A 1DOVA 4LDRA 3T6BA 4A4AA 5DS4A 4AX2A 2WVQA 2VCCA 1JMWA 3H2UA 4UDVA 1OR2A 3DM9B 3GEEA 3JRMO 3RVZA 5L0GA 4DBRA 2WVNA 2JX0A 4NC3A 5TJ5E 3TULA 4G0HA 2M64A 1G4WR 5L0DA 4Z9IA 2H7OA 2LFDA 2IXOA 4WGZA 4XPWA 1D0XA 4J7TA 3S0XA 4O6NA 2YLIA 3M1CB 3WG7C 3S28A 4M63A 3ZDLA 3NYMA 2XM4A 3FHDA 3N24A 1F1MA 2OJED 3EH1A 3U2MA 2W45A 4G7OF 2OKUA 3JSZA 1MQVA 4DRHB 1ZHTA 3JT1A 2FFHA 3N2ZB 1W2WA 2EIJC 5BUOA 1E2XA 3CSKA 3EJNA 3ASNC 3C8GA 4JEAA 4O7GA 3NKDA 2J8WA 3PCVA 4I3MA 3UMHA 3UMKA 2MWQA 1D0YA 5KYUA 2P6VA 5A6BD 5A69A 2HMZA 3SXYA 3F47A 3QW1A 4K7BA 1YARO 3I5QA 3UMIA 1FMVA 3TK0A 4WABA 2HUJA 4I44A 3RW0A 4NTBA 1YA9A 4EBKA 1BZ4A 2LFFA 4ZLCA 2XS8A 2YL0A 2MHRA 3O10A 1M2OA 2C03A 4MW8A 1Z3IX 4U5BE 3I5PA 1OR3A 1CGOA 2OOCA 2Y3GA 1AUEA 4PJMA 4G7HF 3ASOC 2W9YA 3FMSA 3IEEA 3KPHA 2QTVA 1A41A 1NU7D 4JCHA 2OU6A 3KH2A 2XXAA 1PV3A 3HLZA 3DJUB 3JTLO 4BJ6A 4PFPA 3O6XA 2VH3A 2PX3A 5JP7A 5KYWA 1SYQA 1RXQA 3A11A 3AG2C 1ORYA 4U5DE 5FCLA 4LLCA 5B1BC 4CDVA 2VC9A 1ST6A 4ULVA 3F46A 2Q9BA 4NTFA 1VYKA 2XSEA 3ZSUA 2YLDA 4BJTA 3L8JA 2DYRC 3FVYA 4U5EE 3SEOA 2KSFA 2B0JA 3C18A 3M4CA 4DRJB 2OQMA 4KNVA 3W4YA 2P61A 4J32B 3FDQA 3Q6MA 3T6GB 5JS5A 1OW6A 4XEKA 2YL1A 2YL3A
chains in the Genus database with same CATH topology
3H2VA 1H6GA 4W8PA 1RKEB 1ZVZA 5FZTA 5L0JA 4E18A 1YDIA 1U89A 1DOVA 4EHPA 4IGGA 2HSQA 1XWJA 3H2UA 4K1OA 3TJ6A 3RF3A 5L0GA 1QKRA 1ZW2A 1SYQA 5L0FA 4PR9A 1U6HA 1DOWA 4P9TA 2LQGA 1L7CA 4ONSA 1ST6A 1ZW3A 5L0DA 5L0IA 2B0HA 3MYIA 4DJ9A 3S90A 2IBFA 1RKCA 2GDCA 1TR2A 5L0CA 1T01A 2L7AA 3ZDLA 4E17A 1RKEA 2X0CA 3T6GB 3VF0A 3TJ5A 5L0HA 2GWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2V A;  1H6G A;  4W8P A;  1RKE B;  1ZVZ A;  5FZT A;  5L0J A;  4E18 A;  1YDI A;  1U89 A;  1DOV A;  4EHP A;  4IGG A;  2HSQ A;  1XWJ A;  3H2U A;  4K1O A;  3TJ6 A;  3RF3 A;  5L0G A;  1QKR A;  1ZW2 A;  1SYQ A;  5L0F A;  4PR9 A;  1U6H A;  1DOW A;  4P9T A;  2LQG A;  1L7C A;  4ONS A;  1ST6 A;  1ZW3 A;  5L0D A;  5L0I A;  2B0H A;  3MYI A;  4DJ9 A;  3S90 A;  2IBF A;  1RKC A;  2GDC A;  1TR2 A;  5L0C A;  1T01 A;  2L7A A;  3ZDL A;  4E17 A;  1RKE A;  2X0C A;  3T6G B;  3VF0 A;  3TJ5 A;  5L0H A;  2GWW A; 
#chains in the Genus database with same CATH topology
 1ZU4 A;  4MVS A;  4C3D A;  1YA7 O;  5COG A;  4LER A;  2CW0 F;  2G3K A;  3PMR A;  1D1A A;  1JOG A;  3C8Z A;  4CSA A;  1A7D A;  3K33 A;  1N1C A;  3KKB A;  3SXK A;  3US6 A;  4J7Y A;  4EWC A;  3X1O A;  2Y39 A;  4MS2 A;  2LSE A;  3Q7G A;  4O79 A;  1LM3 B;  4CIP A;  4FES A;  1Z6A A;  4JTC B;  5A6K A;  1RMV A;  4YWQ A;  3QVY A;  4XTK A;  2XLE A;  3T9O A;  3U0C A;  2R7X A;  3CAX A;  2OG2 A;  2J9U A;  3MFN A;  1I4Z A;  4GQH A;  2BC5 A;  2WL8 A;  1HMO A;  3E9V A;  4O6Y A;  5KYN A;  3K6B A;  1EI7 A;  1TWA A;  1RCP A;  3C63 A;  4JVS A;  1PD1 A;  3DE8 A;  4HE8 D;  4JTA B;  4YJW A;  1RKC A;  3NMK A;  2XS1 A;  5A6J A;  2VCB A;  2KNH A;  1JR8 A;  3VM6 A;  4PK4 A;  1OQC A;  4G7Z F;  2QE9 A;  5IY5 C;  1QSP A;  4CX9 A;  2OCC C;  2A6E F;  5D91 A;  1ZU5 A;  1LI5 A;  1OCR C;  4YN0 B;  1V54 C;  1U89 A;  2L6H A;  1VYI A;  3EGX B;  1VMA A;  2R7T A;  1TFK B;  1OKK D;  2HJ3 A;  1U0B B;  4MTO A;  3U9M A;  3ABK C;  3V7O A;  4F4B A;  2D4U A;  5L0C A;  4JJF A;  1OXB A;  2ZXP A;  1SZI A;  1J8Y F;  1EKY A;  2HV6 A;  4P9F A;  1QVX A;  4MTG A;  4Z9H A;  3ABM C;  1WGW A;  2H8A A;  1FTS A;  4I1M A;  5EK0 A;  5KYX B;  4ZLD A;  3I4U A;  3SZR A;  4MVZ A;  2QLA A;  2DGJ A;  2AVK A;  4E7Z A;  1Q0M A;  4OIP F;  2WZL A;  3QMK A;  5F5H A;  4BJ5 A;  4PJN A;  3RYL A;  2AWC A;  1T6I A;  1RKE B;  1WWP A;  2Y3B A;  3LLK A;  2YEV A;  1TWG A;  3V5Z A;  3HTK C;  2QNL A;  2VAS A;  1LKX A;  3E70 C;  1H9G A;  3GM1 A;  1V74 B;  1OCC C;  3LEO A;  1QKR A;  3IQT A;  1YLM A;  1E84 A;  2L6F A;  2RSE B;  2NSG A;  4LLE A;  4WJ0 A;  2UUH A;  4YT5 A;  2R25 A;  3VAY A;  2HJM A;  1YVI A;  4CS7 A;  3UNG C;  1K40 A;  1PCX A;  3G50 A;  3QTH A;  2YL7 A;  3AQB A;  5BQG A;  1APC A;  4OIR F;  3S90 A;  4Q5S F;  4XQ1 A;  4DOZ A;  1VLS A;  5B3S C;  1HW1 A;  3L8I A;  1Z23 A;  2GA0 A;  2IXN A;  3LNM B;  3B0U X;  3AQC A;  1NFO A;  2PP4 A;  2WZG A;  2XL6 A;  1GGQ A;  1QPU A;  5KYY A;  4OIN F;  4IAQ A;  3R7C A;  1LI7 A;  3TOL A;  3J06 A;  1AVO B;  1G5Z A;  3S27 A;  4YL1 A;  1FFT C;  1SR2 A;  1TKN A;  3JZ0 A;  3KYI A;  2OEX A;  3Q6N A;  2NUT A;  1MMN A;  4EBJ A;  3RKO F;  3NRH A;  4ER9 A;  3GAN A;  4I1O B;  4PFO A;  1E86 A;  1HE9 A;  2R9R B;  4YT8 A;  3K1H A;  3RQG A;  3ITF A;  2ICW G;  3DAG A;  2EIL C;  3AG4 C;  3GOD A;  1EQ1 A;  2PF4 E;  1LVK A;  2R02 A;  3DAF A;  3DZA A;  4O6M A;  1LE4 A;  1XZP A;  4GYT A;  4XWJ A;  3U2L A;  4MVQ A;  2IXP A;  4AL1 A;  2KW3 C;  2F22 A;  2NPU A;  3MYF A;  3LUT B;  1WN0 A;  4CJG A;  1BR2 A;  3LNR A;  2FAP B;  1SF8 A;  2R03 A;  3IHU A;  4JJG A;  1HE1 A;  3CEX A;  3H2V A;  3HKK A;  5B3I A;  5BQI A;  3EGD A;  1NLX A;  4N6C A;  3B0P A;  4EUK B;  1MND A;  1QQ3 A;  3WAQ A;  1Q0K A;  4IWB A;  3EHM A;  3GWL A;  3HJC A;  3CZ6 A;  4CDA A;  3C62 A;  1GQA A;  2HSQ A;  1XWJ A;  2HV7 A;  3DMD A;  3GWN A;  3LS1 A;  3NMJ A;  4H4K C;  2A0B A;  4N4W A;  2Q9A A;  3RH3 A;  1ZW2 A;  3WOD F;  3ZTM A;  5JRA A;  1Y4C A;  1A7E A;  1PD0 A;  1L7C A;  2EPL X;  2LQG A;  2PFD A;  2Q00 A;  3AOU A;  2EPN A;  3EZH A;  1WOL A;  1M57 C;  3U3F A;  1I4Y A;  5JLI A;  1K04 A;  1UG7 A;  4CDY A;  2KQ9 A;  3FAJ A;  3HNI A;  4U5H A;  1V55 C;  4HEA J;  1BDJ B;  1T01 A;  2VCA A;  4BPM A;  1VK5 A;  4CS8 C;  4FAP B;  4NCQ A;  2EIN C;  3C8G D;  3VF0 A;  5DQT A;  1YYJ A;  3MLG A;  2XLM A;  3B0V C;  1T6U A;  2XRH A;  5EGY A;  5JSL A;  2R7S A;  1V4A A;  3ABL C;  3QZC A;  1Q0G A;  4BJ6 C;  4NY3 A;  3U3B A;  2X51 A;  3HNJ A;  4E18 A;  4YT4 A;  2AU5 A;  1E85 A;  2R05 A;  2TMV P;  2JD3 A;  5A6A A;  2J46 A;  1GS9 A;  2L9J A;  3EH2 A;  4CJO A;  3LAY A;  1NBB A;  4BJ1 A;  3PHF 2;  1M6T A;  3JSE O;  2Z15 A;  4DXW A;  2W4B A;  4U9D A;  3AGU A;  3SP1 A;  4PR9 A;  4E0I A;  3NG1 A;  3EFO A;  4DRI B;  3W2V A;  4CS9 A;  5L0I A;  3AG1 C;  3MYI A;  4GEH A;  2BE5 F;  3V5Y A;  1GM5 A;  2Q4F A;  2HKV A;  4JC7 A;  3TOM A;  4A2N B;  3U8P A;  2XL4 A;  1Q0F A;  4DJ9 A;  4WGY A;  3W8H A;  5COF A;  1LIH A;  2KGO A;  1OW8 A;  3Q7L A;  4FWV A;  1LPE A;  3W2W A;  1BR4 A;  1YZC A;  3NYL A;  3ZG1 A;  1S05 A;  3LLI A;  3GEH A;  4YT2 A;  5JVE A;  2CGE A;  2YKZ A;  3RIP A;  2J0W A;  3GEI A;  4H54 A;  4PJJ A;  4CS8 A;  4Z9J A;  1Z7Q c;  5B1A C;  5L0J A;  1M56 C;  1YAU O;  3FOP A;  1C02 A;  1TWH A;  4IRU A;  3RVY A;  4YK5 A;  3S84 A;  3QW0 A;  1K05 A;  5F28 E;  3ZC4 A;  4DVY P;  2KYH A;  1BBH A;  1RJ9 A;  1A7V A;  3L34 A;  3A9C A;  3AG3 C;  1IW7 F;  5L3Q A;  1VTM P;  4U9E A;  2PX0 A;  3ECS A;  1L3P A;  3LES A;  2CCY A;  2ZXW C;  1CGN A;  4JZA A;  2YQY A;  3UR3 C;  3ATP A;  3KMI A;  1TFO B;  1KU2 A;  1NZE A;  2EIK C;  4MVR A;  3SXZ A;  3R2P A;  3ZVR A;  4MVU A;  2Y3D A;  3EFO B;  3VYW A;  4OD5 A;  3K7D A;  5KYY B;  3JYY A;  3L1M A;  3M79 A;  3ZIB A;  2ZXO A;  2YHS A;  2KJG A;  4X0R A;  4C7O A;  2HS5 A;  1H6G A;  2QY9 A;  2J9B A;  2IYL D;  2A0U A;  2NSF A;  3AGT A;  3T4R A;  2PBE A;  3X2Q C;  4MQ9 F;  3EG9 A;  3DXJ F;  4JEB A;  2DB4 A;  4LDQ A;  5E3A A;  4KC9 A;  1BR1 A;  2XLW A;  4G78 A;  4XEV A;  2J7P A;  5DVW A;  5HSW A;  1UFB A;  2YZS A;  3EQL F;  3K1I C;  3LJB A;  4JIO A;  2CNW D;  3O55 A;  1U6H A;  2H7B A;  3JRT A;  2WZF A;  1ZW3 A;  4JUR I;  1LE2 A;  1JPJ A;  1YYX A;  5COM A;  3NMI A;  4JW1 A;  1ZZP A;  1T9K A;  3UGP A;  2XLH A;  1CPQ A;  1VB5 A;  1ZHW A;  2KK1 A;  256B A;  3C8G B;  4MVO A;  2YLG A;  5L0H A;  4LDK A;  5JT4 A;  1QZX A;  4CIH A;  4EKW A;  2R7V A;  3EPV A;  4XLP F;  2R7Q A;  3NKE A;  1G4U S;  3JYH A;  5AC5 A;  2XXA B;  4D4N A;  4KBL A;  2GFH A;  1ZYR F;  1YDI A;  1KNY A;  2AWY A;  3N0T A;  4IAO A;  1I5N A;  4JE9 A;  2YRF A;  4OIQ F;  2G62 A;  2CYD A;  1LS1 A;  4C7O B;  1HY5 A;  1A0B A;  4RD9 A;  3ZWI A;  4YL0 A;  4MVM A;  3IQ6 A;  3GOR A;  4Q4Z F;  1YJG A;  2LP4 A;  2GAQ A;  1MMA A;  2P7V A;  3B29 A;  3EGX A;  3RFY A;  3BEH A;  3KYJ A;  4U5F E;  5A6B A;  2E87 A;  2IBF A;  2HSB A;  1ORS C;  2KC3 A;  1YZA A;  3SXM A;  2L7A A;  2J9V A;  4CSA C;  4BJ5 C;  2ETS A;  2HFI A;  1Q0D A;  5T1D B;  1Z5Z A;  1CGM E;  2V3C C;  1M2V A;  1FFH A;  1J8M F;  2IOQ A;  4PJL A;  1RJ9 B;  4XPX A;  4RBN A;  1R4T A;  4L6R A;  4P6I C;  4AL0 A;  2A68 F;  4EBB A;  1JRA A;  2R7U A;  2J7P D;  2EIM C;  1E83 A;  3QVZ A;  2MYS A;  4KNW A;  4BEM J;  5E33 A;  3FOO A;  2YWA A;  2LIG A;  4HFF B;  5T3T A;  5DQZ A;  3TJ6 A;  4XPY A;  2ZD9 A;  4FX5 A;  2H7V C;  5L0F A;  3IQC A;  3U9J A;  2YVK A;  4QI2 A;  4PAC A;  4P9T A;  1S7Z A;  2J9W A;  2P0N A;  3T6J A;  2XLD A;  2LCH A;  3DKA A;  1OXK A;  1T5O A;  3U8V A;  1NFN A;  1NU9 C;  3G4X A;  3M15 A;  3EG9 B;  4JKV A;  5GPG B;  1ORJ A;  4HFK B;  4XLN F;  3FAP B;  1TR2 A;  3LS0 A;  4IB4 A;  1ZHX A;  2JPU A;  4E17 A;  1ZHZ A;  3G4Z A;  2XM0 A;  3K66 A;  3U5S A;  3L0I A;  4MND A;  2GWW A;  4NTA A;  3EZI A;  2Q9C A;  4W8P A;  4CBE A;  2V26 A;  1WTY A;  4KI2 A;  1LS4 A;  2RD9 A;  3DI5 A;  2OJQ A;  4DBQ A;  2IM8 A;  4IGG A;  4JCZ A;  4C3B A;  1VOM A;  2LD6 A;  2L6G A;  2Q3T A;  2J45 A;  4N6H A;  5CI8 A;  3PDM P;  3DE9 A;  3RQF A;  1MMG A;  2ZXR A;  3RF3 A;  1HMD A;  5E2Q A;  5BQH A;  4DVZ A;  4C3E A;  4ULW A;  4JTD B;  4E0H A;  5L3V A;  4OIO F;  5KYW B;  3WHN A;  3HNK A;  1FR0 A;  4E7S A;  1IZM A;  2Q7R A;  1XZQ A;  3CQZ A;  1QLE C;  3IQ5 A;  4OD4 A;  1OCO C;  5DS6 A;  4IJJ A;  4ANJ A;  2A6H F;  1D1B A;  3DWW A;  5HV9 A;  3GM2 A;  4JRZ A;  2GDC A;  3O39 A;  4B6I A;  2HMQ A;  2XL8 A;  1CPR A;  1C03 A;  1G8X A;  1MNE A;  2BL2 A;  2X0C A;  3VRC A;  2WB7 A;  1MMD A;  1O5H A;  2I8B A;  3OA1 A;  2AP3 A;  3C7J A;  3KL4 A;  4U5G A;  4QDL A;  4K0D A;  3H65 A;  1ZVZ A;  3W8I A;  5FZT A;  2G3V A;  2R7R A;  1TWC A;  2NUP A;  1FAP B;  3LEV A;  5CI9 A;  3OEO A;  4EHP A;  1O3U A;  2XLV A;  5KYX A;  3TQO A;  1ZHY A;  1HW2 A;  4CS9 C;  3EGD B;  3IPM O;  1JAF A;  3S29 A;  4MW3 A;  1M2V B;  3MX3 A;  2EPK X;  2IXM A;  1NSG B;  1DOW A;  2NG1 A;  2J0X A;  4ONS A;  3SNH A;  5F5F A;  2QUP A;  3M4B A;  4EIY A;  3EHN A;  1FNT c;  1Z63 A;  3B71 A;  2DYS C;  2LK4 A;  4AE4 B;  2P1A A;  2C04 A;  1FMW A;  2ASR A;  1Y6D A;  1D0Z A;  2CNW A;  2I15 A;  1OCZ C;  2A69 F;  2EPO A;  2HZ8 A;  1WAS A;  4AK9 A;  3ZQY A;  1RKE A;  3TJ5 A;  1VLT A;  4YL3 A;  2R7W A;  1OW7 A;  5AGF A;  1TQG A;  2D5R B;  3DD7 A;  4Q7C A;  2PNO A;  3DJN B;  5DS5 A;  5K0I A;  4RDA A;  2CDQ A;  3HNL A;  5T3W A;  1WAT A;  2O9X A;  3ZQV A;  3NDB B;  2R7O A;  2DI3 A;  2NUP B;  1NG1 A;  3SYN A;  1R5I D;  1AEP A;  4J30 B;  2UUI A;  1O87 A;  1KTM A;  4K1O A;  4W8K A;  5E3C A;  1B68 A;  2L81 A;  3TD7 A;  3ZTZ A;  2Y69 C;  2FGY A;  3FXH A;  5JUA A;  4U5C E;  1SMY F;  3BRJ A;  4BG0 A;  2OEV A;  3NYJ A;  2B0H A;  2EPM X;  2VB6 A;  4IAR A;  4QI0 A;  1D1C A;  2A1D D;  1JPN A;  2Y3H A;  3OWT A;  3RQE A;  4D4X A;  5EHH A;  3UGO A;  2XLO A;  1EA8 A;  3GM3 A;  1H9T A;  3POV A;  1H7I A;  3S9O A;  5D92 A;  4MTF A;  4NQF A;  2M4E A;  2ZPA A;  3MBG A;  4XEF A;  2WVO A;  3DM5 A;  1T6Q A;  1OKK A;  3AJM A;  3K1I A;  2W4M A;  4R32 A;  3JCU Q;  4BEJ A;  5KYU B;  5CIV A;  2NUT B;  4LAC B;  5DLJ A;  3V5X A;  5AC4 A;  3B9Q A;  1C17 M;  4AE4 A;  4N06 A;  1DOV A;  4LDR A;  3T6B A;  4A4A A;  5DS4 A;  4AX2 A;  2WVQ A;  2VCC A;  1JMW A;  3H2U A;  4UDV A;  1OR2 A;  3DM9 B;  3GEE A;  3JRM O;  3RVZ A;  5L0G A;  4DBR A;  2WVN A;  2JX0 A;  4NC3 A;  5TJ5 E;  3TUL A;  4G0H A;  2M64 A;  1G4W R;  5L0D A;  4Z9I A;  2H7O A;  2LFD A;  2IXO A;  4WGZ A;  4XPW A;  1D0X A;  4J7T A;  3S0X A;  4O6N A;  2YLI A;  3M1C B;  3WG7 C;  3S28 A;  4M63 A;  3ZDL A;  3NYM A;  2XM4 A;  3FHD A;  3N24 A;  1F1M A;  2OJE D;  3EH1 A;  3U2M A;  2W45 A;  4G7O F;  2OKU A;  3JSZ A;  1MQV A;  4DRH B;  1ZHT A;  3JT1 A;  2FFH A;  3N2Z B;  1W2W A;  2EIJ C;  5BUO A;  1E2X A;  3CSK A;  3EJN A;  3ASN C;  3C8G A;  4JEA A;  4O7G A;  3NKD A;  2J8W A;  3PCV A;  4I3M A;  3UMH A;  3UMK A;  2MWQ A;  1D0Y A;  5KYU A;  2P6V A;  5A6B D;  5A69 A;  2HMZ A;  3SXY A;  3F47 A;  3QW1 A;  4K7B A;  1YAR O;  3I5Q A;  3UMI A;  1FMV A;  3TK0 A;  4WAB A;  2HUJ A;  4I44 A;  3RW0 A;  4NTB A;  1YA9 A;  4EBK A;  1BZ4 A;  2LFF A;  4ZLC A;  2XS8 A;  2YL0 A;  2MHR A;  3O10 A;  1M2O A;  2C03 A;  4MW8 A;  1Z3I X;  4U5B E;  3I5P A;  1OR3 A;  1CGO A;  2OOC A;  2Y3G A;  1AUE A;  4PJM A;  4G7H F;  3ASO C;  2W9Y A;  3FMS A;  3IEE A;  3KPH A;  2QTV A;  1A41 A;  1NU7 D;  4JCH A;  2OU6 A;  3KH2 A;  2XXA A;  1PV3 A;  3HLZ A;  3DJU B;  3JTL O;  4BJ6 A;  4PFP A;  3O6X A;  2VH3 A;  2PX3 A;  5JP7 A;  5KYW A;  1SYQ A;  1RXQ A;  3A11 A;  3AG2 C;  1ORY A;  4U5D E;  5FCL A;  4LLC A;  5B1B C;  4CDV A;  2VC9 A;  1ST6 A;  4ULV A;  3F46 A;  2Q9B A;  4NTF A;  1VYK A;  2XSE A;  3ZSU A;  2YLD A;  4BJT A;  3L8J A;  2DYR C;  3FVY A;  4U5E E;  3SEO A;  2KSF A;  2B0J A;  3C18 A;  3M4C A;  4DRJ B;  2OQM A;  4KNV A;  3W4Y A;  2P61 A;  4J32 B;  3FDQ A;  3Q6M A;  3T6G B;  5JS5 A;  1OW6 A;  4XEK A;  2YL1 A;  2YL3 A; 
#chains in the Genus database with same CATH homology
 3H2V A;  1H6G A;  4W8P A;  1RKE B;  1ZVZ A;  5FZT A;  5L0J A;  4E18 A;  1YDI A;  1U89 A;  1DOV A;  4EHP A;  4IGG A;  2HSQ A;  1XWJ A;  3H2U A;  4K1O A;  3TJ6 A;  3RF3 A;  5L0G A;  1QKR A;  1ZW2 A;  1SYQ A;  5L0F A;  4PR9 A;  1U6H A;  1DOW A;  4P9T A;  2LQG A;  1L7C A;  4ONS A;  1ST6 A;  1ZW3 A;  5L0D A;  5L0I A;  2B0H A;  3MYI A;  4DJ9 A;  3S90 A;  2IBF A;  1RKC A;  2GDC A;  1TR2 A;  5L0C A;  1T01 A;  2L7A A;  3ZDL A;  4E17 A;  1RKE A;  2X0C A;  3T6G B;  3VF0 A;  3TJ5 A;  5L0H A;  2GWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...