1DOVA

Crystal structure of the alpha-catenin dimerization domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
181
structure length
181
Chain Sequence
b'ESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CATENIN
molecule tags Cell adhesion
source organism Mus musculus
publication title Structure of the dimerization and beta-catenin-binding region of alpha-catenin.
pubmed doi rcsb
total genus 86
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1999-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1dovA00
1RKCA 2GWWA 5L0JA 1SYQA 5FZTA 2X0CA 4DJ9A 3S90A 1U89A 1ZW2A 5L0DA 3MYIA 3TJ6A 1XWJA 1L7CA 5L0GA 1T01A 4K1OA 3TJ5A 1U6HA 1TR2A 3T6GB 3H2UA 4W8PA 3ZDLA 1ST6A 1DOVA 1RKEA 4IGGA 5L0HA 5L0IA 1DOWA 2LQGA 2L7AA 3RF3A 1ZVZA 4EHPA 2GDCA 4E18A 5L0FA 4P9TA 2B0HA 3VF0A 4ONSA 5L0CA 2HSQA 1QKRA 1ZW3A 2IBFA 4E17A 1YDIA 1RKEB 4PR9A 1H6GA 3H2VA
chains in the Genus database with same CATH superfamily
1RKCA 1S7ZA 4JEAA 4YN0B 5L0JA 1D1CA 1WTYA 3B0PA 2Q3TA 3AQCA 3OWTA 2IOQA 4ANJA 5L0DA 4PFPA 3GWNA 1WATA 1L7CA 2R7SA 2IM8A 1OCRC 2G3VA 3H2UA 5HV9A 2OEVA 1CGOA 3MYFA 4DBQA 1VK5A 2IXOA 2AP3A 3H65A 4PJLA 4AE4A 3ZTZA 4DRIB 3HNJA 2AU5A 3SXMA 4CS8C 1DOWA 2LQGA 2Y3DA 3AGTA 3LLKA 3QMKA 3T4RA 4DVZA 2CW0F 2JPUA 5A6JA 4OIQF 1V4AA 1R5ID 1VLTA 2DB4A 2HV7A 3S9OA 2WZGA 1UFBA 3K7DA 1UG7A 2DYRC 3U3BA 3PDMP 4EBBA 2IXPA 2J0XA 3CSKA 4WJ0A 4U5HA 1Q0KA 1OXBA 4EIYA 3QW0A 3HNIA 1WN0A 3DXJF 4Z9JA 1SZIA 3B0VC 4K1OA 4CDVA 4P6IC 5B3SC 4MVZA 3CEXA 3ZTMA 1LE4A 4JTAB 1LM3B 2YL3A 3AQBA 2NUPA 2KJGA 256BA 4GEHA 3SXYA 1A7VA 4IRUA 4DXWA 1W2WA 5DS4A 3HJCA 1RKEA 2B0JA 3C8GB 2A1DD 1RJ9A 3C8ZA 3EHNA 4BJ1A 1MMGA 2LD6A 3TQOA 5DQZA 4MVOA 2CNWA 2CCYA 1OKKA 3EGXB 2J0WA 4I1MA 3VF0A 4FWVA 3W2VA 5DLJA 3DD7A 1T6IA 4MTFA 4YK5A 3M4CA 1YZAA 5BQHA 2WL8A 3I5QA 4QI0A 4R32A 3FDQA 4G0HA 1F1MA 5JP7A 1H6GA 3H2VA 2CDQA 3LESA 2PX0A 1FMWA 2YHSA 3HKKA 4DRJB 4DJ9A 4JTCB 4LDQA 3DAFA 4RD9A 3MYIA 2XM0A 3QVYA 2KNHA 4KBLA 4RDAA 2WVNA 3AG2C 1EQ1A 1YJGA 3NRHA 3SEOA 2XXAB 3ZDLA 1ST6A 1Z6AA 1E2XA 2Q4FA 4PJNA 4WGYA 1OR3A 5L0IA 1D0YA 1T9KA 2AWCA 5DS6A 2R7WA 3ZC4A 3IQ6A 2Y3HA 2P0NA 2KQ9A 3EGDA 3U9MA 4CS8A 3BEHA 3DJUB 3EGXA 1H9GA 3GM1A 4JRZA 4U5GA 3M79A 1FMVA 1HE9A 2L81A 3C8GA 4JW1A 3U9JA 4PR9A 4UDVA 1RMVA 1HE1A 5AC4A 5KYYA 2RSEB 3FAPB 4C3DA 1JRAA 2IYLD 1GGQA 1NG1A 1NU7D 2P61A 2W9YA 4YL1A 4DRHB 2RD9A 1SMYF 1LI7A 1I5NA 4HFFB 3N2ZB 3IEEA 3TJ5A 4CS9A 4F4BA 1CPRA 3RKOF 1M2OA 2A68F 1LIHA 2C03A 1G4WR 3M4BA 1ZHTA 2HV6A 4O7GA 2YL1A 1RCPA 2UUHA 3LUTB 1CGME 2XXAA 3QVZA 1OCCC 2OJQA 2AVKA 3KYJA 2DYSC 2WVOA 4W8KA 2L7AA 3S29A 1JR8A 5DS5A 4ULWA 2HS5A 2XLOA 2YZSA 1I4ZA 5CIVA 1PCXA 4G7OF 1I4YA 2ICWG 2F22A 1ZHZA 1E84A 3SZRA 2NSFA 3RFYA 3U5SA 1GS9A 1U0BB 2NUTB 3G4ZA 2M64A 2D5RB 3EZIA 3G4XA 4MQ9F 3ZWIA 5KYXA 3S0XA 2GAQA 5FZTA 2P6VA 5COGA 4YT4A 1OW8A 5K0IA 3T9OA 2BL2A 2HJMA 4PACA 3VM6A 1LE2A 4YL3A 2I8BA 3MBGA 1YVIA 2J9BA 1FR0A 2J7PA 4U5BE 4NTFA 5CI9A 4CJOA 1C17M 1HY5A 1VOMA 3DZAA 1HMOA 1ZYRF 2P7VA 3BRJA 1O3UA 1NU9C 1G8XA 3AG1C 2PBEA 2WB7A 3EG9B 2VB6A 3LEVA 3V5YA 2YLDA 5B3IA 1OKKD 1VMAA 3GEIA 3S27A 2R05A 5JT4A 1BR4A 4ZLDA 1OCOC 3AGUA 2BE5F 3NMIA 3OEOA 2R02A 1Y6DA 1MMDA 4LLEA 1MMNA 4KI2A 3FAJA 2NUTA 4JEBA 5JVEA 5KYUA 2XLVA 3LS1A 3SNHA 4KC9A 4BPMA 2CYDA 2YLIA 3TD7A 1AUEA 2ZXPA 3TJ6A 3TOLA 4XEKA 4Q4ZF 1QSPA 1T01A 3DWWA 5DVWA 2O9XA 3K1HA 2EPNA 5T3TA 3RVYA 5EK0A 5F5HA 2R7VA 2HSBA 4W8PA 5BUOA 4FESA 1O87A 1NLXA 1DOVA 2PF4E 1YARO 2Z15A 1Q0FA 2L9JA 3SP1A 3ZQVA 1CGNA 3KPHA 3RF3A 2A69F 5KYWA 4YT8A 1K05A 1K40A 2I15A 3ZSUA 2EILC 3G50A 1S05A 1IW7F 1MNDA 2YWAA 3I4UA 3K1IA 3VYWA 3FOPA 4JTDB 4JVSA 2R7OA 3GODA 4CS9C 3HTKC 3W4YA 2EPKX 1H7IA 2FGYA 2JD3A 4P9FA 1LS4A 4YWQA 2R9RB 3IPMO 2BC5A 4MVSA 3U2LA 3U0CA 1TFKB 1XWJA 3KH2A 3L34A 5L0GA 1JOGA 2XM4A 1YA7O 4CDAA 1HW1A 5JSLA 3KL4A 3NKEA 5GPGB 2FFHA 4Q7CA 4MTGA 2R7RA 1OW6A 2UUIA 2XLHA 3X1OA 1WWPA 1SF8A 1T6UA 5T3WA 5JLIA 5L0HA 2LFDA 4IARA 1TKNA 1B68A 3WHNA 3E70C 4YT2A 4J7TA 1QLEC 2B0HA 1QPUA 2NSGA 3EG9A 3K33A 4A4AA 1E85A 1Z63A 1FFHA 3Q7LA 2Q00A 1QKRA 4AX2A 1EKYA 5B1BC 4G78A 3RQGA 3S28A 3T6JA 1NFNA 4BJ6C 2CGEA 1SYQA 2XLDA 2L6GA 3DAGA 1ZHWA 3JSEO 5L3QA 1E86A 2OKUA 4HE8D 1YYXA 3GANA 5DQTA 2A0UA 3KMIA 4CJGA 3C7JA 4ULVA 3DJNB 3GEHA 3U3FA 5HSWA 1NFOA 4QI2A 4JCHA 4BG0A 1V74B 4H54A 2A6EF 3K6BA 4MNDA 1FTSA 3WG7C 2NUPB 1FFTC 1A7DA 2XL4A 3EHMA 3DE8A 3O39A 4GQHA 1J8MF 4NTBA 3W2WA 1T6QA 4EBJA 4FX5A 3SYNA 2VCCA 3MFNA 4U5FE 1JMWA 1YZCA 3L0IA 1G5ZA 1BDJB 1V54C 2GDCA 2KGOA 4P9TA 1HW2A 4C3BA 3JCUQ 3Q6MA 3PMRA 4XEFA 3Q7GA 4O6MA 3LLIA 3PHF2 2WVQA 3EZHA 2LP4A 4CSAA 4OIPF 2J9WA 3KYIA 4MS2A 1ORYA 3UMKA 3ZQYA 3S90A 3ABKC 3VRCA 2JX0A 1WASA 3O55A 4WGZA 4DBRA 3UNGC 4QDLA 4ER9A 4OIOF 4NY3A 4B6IA 5E3AA 1U6HA 2L6HA 2W45A 3QZCA 2PP4A 1WGWA 4MTOA 4MVMA 1YYJA 1NBBA 3UR3C 1JPNA 1BR2A 3V5XA 4J32B 3VAYA 4PFOA 5F5FA 1E83A 1YLMA 1ZHYA 3L1MA 5AGFA 2QTVA 2XLEA 4YT5A 2KYHA 3NDBB 3EPVA 3RQEA 3EGDB 3TULA 1ZU4A 2R25A 2NG1A 4C7OB 4OIRF 3FXHA 2R03A 2YVKA 4U9EA 4E18A 2DGJA 4XPWA 3R2PA 2OOCA 1KU2A 2V26A 5E33A 4NC3A 5F28E 2AWYA 2KC3A 1ORJA 1ZW3A 3RQFA 1YA9A 1BBHA 5JS5A 1M56C 3QTHA 2PFDA 3UMHA 2GWWA 2H7OA 2GA0A 5D91A 5CI8A 4CDYA 1VB5A 4K7BA 2D4UA 2MWQA 3PCVA 3RH3A 3WAQA 1VYKA 5L3VA 1NSGB 3NKDA 1M57C 4U5CE 5A6AA 4M63A 3US6A 2EPOA 1T5OA 3C62A 4D4NA 1A41A 3AG4C 2Y3GA 4MW8A 4NTAA 4Q5SF 5IY5C 5A6KA 2YL7A 5KYYB 1VYIA 1JPJA 1HMDA 4JIOA 3O10A 3L8JA 3NG1A 2H7VC 4A2NB 3ITFA 3EH2A 3RW0A 2LFFA 1N1CA 1PD1A 2J9UA 2EIKC 2LIGA 3EJNA 2R7XA 4XEVA 3DI5A 4N6CA 3W8IA 3JZ0A 2HSQA 2QY9A 2A0BA 3EH1A 2XL6A 1YDIA 2EINC 3OA1A 1LVKA 4O6NA 3HNLA 4GYTA 2Y39A 1YAUO 1Z7Qc 3IQTA 2ZXRA 4K0DA 1M2VA 3NYMA 2LCHA 1R4TA 1MMAA 4Z9HA 2OG2A 3W8HA 2Q9CA 4XTKA 4XQ1A 4IAQA 3V7OA 2ZXOA 5COFA 5BQGA 1OCZC 1SR2A 1FAPB 2HMZA 2EPMX 3DM9B 2ZPAA 4J30B 2FAPB 5E3CA 3SXKA 4OINF 3ASOC 1G4US 2QNLA 1BR1A 3N24A 4OD4A 3WODF 4XPYA 3ATPA 4WABA 4EKWA 3N0TA 3IHUA 3S84A 2EPLX 3FHDA 4IGGA 1Y4CA 4MVUA 5A6BD 5B1AC 3U2MA 1ZHXA 4IWBA 5FCLA 4EHPA 2HZ8A 2VCAA 1XZQA 3LJBA 3EQLF 2ETSA 4MW3A 2YL0A 3LEOA 3B71A 4JCZA 2C04A 3POVA 1JAFA 2J7PD 3U8VA 2VASA 4MVQA 4CBEA 3AG3C 3GEEA 1TWCA 4U5EE 3T6GB 1A0BA 2R7UA 4IAOA 4D4XA 4N6HA 2XSEA 2ZD9A 4DVYP 1Q0DA 1ZW2A 2H7BA 2J8WA 4JJFA 1ZU5A 2J9VA 4PJMA 3V5ZA 4U9DA 3AJMA 4KNWA 4HEAJ 3ABMC 3GM3A 4JZAA 4Z9IA 4E0IA 1M6TA 2PNOA 5A69A 1H9TA 4CSAC 5AC5A 1GM5A 3GM2A 2EIMC 1EA8A 2Y69C 3CZ6A 3GORA 3TOMA 4C3EA 1Z23A 3JYYA 3C18A 2PX3A 3DE9A 1FNTc 3ZG1A 1Z5ZA 2MHRA 3UMIA 3EFOB 2HJ3A 1L3PA 1V55C 1OQCA 5A6BA 2YQYA 3HNKA 5KYWB 3R7CA 1LPEA 4E7SA 2X51A 2OCCC 3M1CB 4E7ZA 1AEPA 4IB4A 5KYNA 3IQ5A 1J8YF 3MLGA 3C8GD 3K1IC 5T1DB 2OU6A 2HFIA 1QZXA 3B9QA 4BJ5C 2J45A 4CS7A 3NMKA 4BJ6A 3ASNC 4LLCA 4EUKB 1AVOB 2XLMA 4LERA 5KYUB 4C7OA 3FOOA 3T6BA 4AK9A 4G7HF 2Q9BA 4OD5A 2ZXWC 4X0RA 4CIHA 1NZEA 1APCA 2LK4A 3ECSA 3JSZA 3LNRA 3Q6NA 3JT1A 1ZVZA 1OR2A 3QW1A 5EGYA 4YL0A 4AL1A 2IXMA 1D0ZA 2YLGA 3DM5A 1QQ3A 2DI3A 2G62A 2M4EA 2VH3A 3B29A 3M15A 1D0XA 2LSEA 2IBFA 1TWAA 2QLAA 1D1AA 3C63A 3NMJA 4I44A 1RKEB 1M2VB 2E87A 4L6RA 4RBNA 2WZLA 3F46A 2X0CA 1U89A 4BJ5A 2ASRA 5EHHA 2XS1A 3ZIBA 1TQGA 2NPUA 1OW7A 2G3KA 4J7YA 1TR2A 2IXNA 2VCBA 1PD0A 4JURI 1KTMA 2L6FA 2CNWD 4JKVA 2OJED 1KNYA 3LS0A 4HFKB 4I1OB 5KYXB 2VC9A 5JUAA 1TFOB 3DMDA 1OXKA 4CIPA 1Q0MA 2R7QA 1EI7A 1VTMP 5L0FA 1MQVA 3I5PA 1D1BA 3JRMO 2R7TA 2HUJA 3MX3A 3UGOA 4BEMJ 1C02A 1Q0GA 2J46A 3L8IA 2Q7RA 2KK1A 4AE4B 2MYSA 1GQAA 2YRFA 3FMSA 4XPXA 4AL0A 3JRTA 4CX9A 4BJTA 3O6XA 3E9VA 1PV3A 2OQMA 1VLSA 5E2QA 3CAXA 1LKXA 5BQIA 2A6HF 4PJJA 1K04A 3LNMB 3EFOA 3UGPA 3SXZA 4XWJA 2OEXA 1O5HA 4U5DE 3RVZA 2H8AA 2XRHA 2V3CC 3F47A 1LI5A 2XLWA 3IQCA 3B0UX 3GWLA 3ZVRA 4NQFA 3A11A 4XLNF 4LACB 4PK4A 1RJ9B 4O79A 4N06A 5D92A 3U8PA 2KSFA 5L0CA 4NCQA 4FAPB 1XZPA 1RXQA 4EBKA 4G7ZF 2KW3C 3RYLA 2W4MA 1C03A 3K66A 1CPQA 4IJJA 1Z3IX 2QUPA 2GFHA 4H4KC 1ZZPA 2TMVP 2EIJC 3LAYA 4DOZA 1MNEA 1ORSC 2W4BA 2YKZA 4O6YA 3KKBA 1TWHA 3JYHA 3J06A 4BEJA 3NYLA 3A9CA 3CQZA 5JRAA 4I3MA 2WZFA 1LS1A 3NYJA 1IZMA 4EWCA 2XL8A 4E0HA 1TWGA 2QE9A 4JJGA 5COMA 3RIPA 3X2QC 2YEVA 1A7EA 1WOLA 4KNVA 3FVYA 1QVXA 4MVRA 4YJWA 5TJ5E 3TK0A 4ZLCA 4XLPF 3JTLO 3HLZA 1BZ4A 4N4WA 2HMQA 3ABLC 3AOUA 4JC7A 4LDRA 2P1AA 4ONSA 3DKAA 2XS8A 2Q9AA 2Y3BA 4LDKA 4E17A 4JE9A 2HKVA
chains in the Genus database with same CATH topology
1RKCA 2GWWA 5L0JA 1SYQA 5FZTA 2X0CA 4DJ9A 3S90A 1U89A 1ZW2A 5L0DA 3MYIA 3TJ6A 1XWJA 1L7CA 5L0GA 1T01A 4K1OA 3TJ5A 1U6HA 1TR2A 3T6GB 3H2UA 4W8PA 3ZDLA 1ST6A 1DOVA 1RKEA 4IGGA 5L0HA 5L0IA 1DOWA 2LQGA 2L7AA 3RF3A 1ZVZA 4EHPA 2GDCA 4E18A 5L0FA 4P9TA 2B0HA 3VF0A 4ONSA 5L0CA 2HSQA 1QKRA 1ZW3A 2IBFA 4E17A 1YDIA 1RKEB 4PR9A 1H6GA 3H2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKC A;  2GWW A;  5L0J A;  1SYQ A;  5FZT A;  2X0C A;  4DJ9 A;  3S90 A;  1U89 A;  1ZW2 A;  5L0D A;  3MYI A;  3TJ6 A;  1XWJ A;  1L7C A;  5L0G A;  1T01 A;  4K1O A;  3TJ5 A;  1U6H A;  1TR2 A;  3T6G B;  3H2U A;  4W8P A;  3ZDL A;  1ST6 A;  1DOV A;  1RKE A;  4IGG A;  5L0H A;  5L0I A;  1DOW A;  2LQG A;  2L7A A;  3RF3 A;  1ZVZ A;  4EHP A;  2GDC A;  4E18 A;  5L0F A;  4P9T A;  2B0H A;  3VF0 A;  4ONS A;  5L0C A;  2HSQ A;  1QKR A;  1ZW3 A;  2IBF A;  4E17 A;  1YDI A;  1RKE B;  4PR9 A;  1H6G A;  3H2V A; 
#chains in the Genus database with same CATH topology
 1RKC A;  1S7Z A;  4JEA A;  4YN0 B;  5L0J A;  1D1C A;  1WTY A;  3B0P A;  2Q3T A;  3AQC A;  3OWT A;  2IOQ A;  4ANJ A;  5L0D A;  4PFP A;  3GWN A;  1WAT A;  1L7C A;  2R7S A;  2IM8 A;  1OCR C;  2G3V A;  3H2U A;  5HV9 A;  2OEV A;  1CGO A;  3MYF A;  4DBQ A;  1VK5 A;  2IXO A;  2AP3 A;  3H65 A;  4PJL A;  4AE4 A;  3ZTZ A;  4DRI B;  3HNJ A;  2AU5 A;  3SXM A;  4CS8 C;  1DOW A;  2LQG A;  2Y3D A;  3AGT A;  3LLK A;  3QMK A;  3T4R A;  4DVZ A;  2CW0 F;  2JPU A;  5A6J A;  4OIQ F;  1V4A A;  1R5I D;  1VLT A;  2DB4 A;  2HV7 A;  3S9O A;  2WZG A;  1UFB A;  3K7D A;  1UG7 A;  2DYR C;  3U3B A;  3PDM P;  4EBB A;  2IXP A;  2J0X A;  3CSK A;  4WJ0 A;  4U5H A;  1Q0K A;  1OXB A;  4EIY A;  3QW0 A;  3HNI A;  1WN0 A;  3DXJ F;  4Z9J A;  1SZI A;  3B0V C;  4K1O A;  4CDV A;  4P6I C;  5B3S C;  4MVZ A;  3CEX A;  3ZTM A;  1LE4 A;  4JTA B;  1LM3 B;  2YL3 A;  3AQB A;  2NUP A;  2KJG A;  256B A;  4GEH A;  3SXY A;  1A7V A;  4IRU A;  4DXW A;  1W2W A;  5DS4 A;  3HJC A;  1RKE A;  2B0J A;  3C8G B;  2A1D D;  1RJ9 A;  3C8Z A;  3EHN A;  4BJ1 A;  1MMG A;  2LD6 A;  3TQO A;  5DQZ A;  4MVO A;  2CNW A;  2CCY A;  1OKK A;  3EGX B;  2J0W A;  4I1M A;  3VF0 A;  4FWV A;  3W2V A;  5DLJ A;  3DD7 A;  1T6I A;  4MTF A;  4YK5 A;  3M4C A;  1YZA A;  5BQH A;  2WL8 A;  3I5Q A;  4QI0 A;  4R32 A;  3FDQ A;  4G0H A;  1F1M A;  5JP7 A;  1H6G A;  3H2V A;  2CDQ A;  3LES A;  2PX0 A;  1FMW A;  2YHS A;  3HKK A;  4DRJ B;  4DJ9 A;  4JTC B;  4LDQ A;  3DAF A;  4RD9 A;  3MYI A;  2XM0 A;  3QVY A;  2KNH A;  4KBL A;  4RDA A;  2WVN A;  3AG2 C;  1EQ1 A;  1YJG A;  3NRH A;  3SEO A;  2XXA B;  3ZDL A;  1ST6 A;  1Z6A A;  1E2X A;  2Q4F A;  4PJN A;  4WGY A;  1OR3 A;  5L0I A;  1D0Y A;  1T9K A;  2AWC A;  5DS6 A;  2R7W A;  3ZC4 A;  3IQ6 A;  2Y3H A;  2P0N A;  2KQ9 A;  3EGD A;  3U9M A;  4CS8 A;  3BEH A;  3DJU B;  3EGX A;  1H9G A;  3GM1 A;  4JRZ A;  4U5G A;  3M79 A;  1FMV A;  1HE9 A;  2L81 A;  3C8G A;  4JW1 A;  3U9J A;  4PR9 A;  4UDV A;  1RMV A;  1HE1 A;  5AC4 A;  5KYY A;  2RSE B;  3FAP B;  4C3D A;  1JRA A;  2IYL D;  1GGQ A;  1NG1 A;  1NU7 D;  2P61 A;  2W9Y A;  4YL1 A;  4DRH B;  2RD9 A;  1SMY F;  1LI7 A;  1I5N A;  4HFF B;  3N2Z B;  3IEE A;  3TJ5 A;  4CS9 A;  4F4B A;  1CPR A;  3RKO F;  1M2O A;  2A68 F;  1LIH A;  2C03 A;  1G4W R;  3M4B A;  1ZHT A;  2HV6 A;  4O7G A;  2YL1 A;  1RCP A;  2UUH A;  3LUT B;  1CGM E;  2XXA A;  3QVZ A;  1OCC C;  2OJQ A;  2AVK A;  3KYJ A;  2DYS C;  2WVO A;  4W8K A;  2L7A A;  3S29 A;  1JR8 A;  5DS5 A;  4ULW A;  2HS5 A;  2XLO A;  2YZS A;  1I4Z A;  5CIV A;  1PCX A;  4G7O F;  1I4Y A;  2ICW G;  2F22 A;  1ZHZ A;  1E84 A;  3SZR A;  2NSF A;  3RFY A;  3U5S A;  1GS9 A;  1U0B B;  2NUT B;  3G4Z A;  2M64 A;  2D5R B;  3EZI A;  3G4X A;  4MQ9 F;  3ZWI A;  5KYX A;  3S0X A;  2GAQ A;  5FZT A;  2P6V A;  5COG A;  4YT4 A;  1OW8 A;  5K0I A;  3T9O A;  2BL2 A;  2HJM A;  4PAC A;  3VM6 A;  1LE2 A;  4YL3 A;  2I8B A;  3MBG A;  1YVI A;  2J9B A;  1FR0 A;  2J7P A;  4U5B E;  4NTF A;  5CI9 A;  4CJO A;  1C17 M;  1HY5 A;  1VOM A;  3DZA A;  1HMO A;  1ZYR F;  2P7V A;  3BRJ A;  1O3U A;  1NU9 C;  1G8X A;  3AG1 C;  2PBE A;  2WB7 A;  3EG9 B;  2VB6 A;  3LEV A;  3V5Y A;  2YLD A;  5B3I A;  1OKK D;  1VMA A;  3GEI A;  3S27 A;  2R05 A;  5JT4 A;  1BR4 A;  4ZLD A;  1OCO C;  3AGU A;  2BE5 F;  3NMI A;  3OEO A;  2R02 A;  1Y6D A;  1MMD A;  4LLE A;  1MMN A;  4KI2 A;  3FAJ A;  2NUT A;  4JEB A;  5JVE A;  5KYU A;  2XLV A;  3LS1 A;  3SNH A;  4KC9 A;  4BPM A;  2CYD A;  2YLI A;  3TD7 A;  1AUE A;  2ZXP A;  3TJ6 A;  3TOL A;  4XEK A;  4Q4Z F;  1QSP A;  1T01 A;  3DWW A;  5DVW A;  2O9X A;  3K1H A;  2EPN A;  5T3T A;  3RVY A;  5EK0 A;  5F5H A;  2R7V A;  2HSB A;  4W8P A;  5BUO A;  4FES A;  1O87 A;  1NLX A;  1DOV A;  2PF4 E;  1YAR O;  2Z15 A;  1Q0F A;  2L9J A;  3SP1 A;  3ZQV A;  1CGN A;  3KPH A;  3RF3 A;  2A69 F;  5KYW A;  4YT8 A;  1K05 A;  1K40 A;  2I15 A;  3ZSU A;  2EIL C;  3G50 A;  1S05 A;  1IW7 F;  1MND A;  2YWA A;  3I4U A;  3K1I A;  3VYW A;  3FOP A;  4JTD B;  4JVS A;  2R7O A;  3GOD A;  4CS9 C;  3HTK C;  3W4Y A;  2EPK X;  1H7I A;  2FGY A;  2JD3 A;  4P9F A;  1LS4 A;  4YWQ A;  2R9R B;  3IPM O;  2BC5 A;  4MVS A;  3U2L A;  3U0C A;  1TFK B;  1XWJ A;  3KH2 A;  3L34 A;  5L0G A;  1JOG A;  2XM4 A;  1YA7 O;  4CDA A;  1HW1 A;  5JSL A;  3KL4 A;  3NKE A;  5GPG B;  2FFH A;  4Q7C A;  4MTG A;  2R7R A;  1OW6 A;  2UUI A;  2XLH A;  3X1O A;  1WWP A;  1SF8 A;  1T6U A;  5T3W A;  5JLI A;  5L0H A;  2LFD A;  4IAR A;  1TKN A;  1B68 A;  3WHN A;  3E70 C;  4YT2 A;  4J7T A;  1QLE C;  2B0H A;  1QPU A;  2NSG A;  3EG9 A;  3K33 A;  4A4A A;  1E85 A;  1Z63 A;  1FFH A;  3Q7L A;  2Q00 A;  1QKR A;  4AX2 A;  1EKY A;  5B1B C;  4G78 A;  3RQG A;  3S28 A;  3T6J A;  1NFN A;  4BJ6 C;  2CGE A;  1SYQ A;  2XLD A;  2L6G A;  3DAG A;  1ZHW A;  3JSE O;  5L3Q A;  1E86 A;  2OKU A;  4HE8 D;  1YYX A;  3GAN A;  5DQT A;  2A0U A;  3KMI A;  4CJG A;  3C7J A;  4ULV A;  3DJN B;  3GEH A;  3U3F A;  5HSW A;  1NFO A;  4QI2 A;  4JCH A;  4BG0 A;  1V74 B;  4H54 A;  2A6E F;  3K6B A;  4MND A;  1FTS A;  3WG7 C;  2NUP B;  1FFT C;  1A7D A;  2XL4 A;  3EHM A;  3DE8 A;  3O39 A;  4GQH A;  1J8M F;  4NTB A;  3W2W A;  1T6Q A;  4EBJ A;  4FX5 A;  3SYN A;  2VCC A;  3MFN A;  4U5F E;  1JMW A;  1YZC A;  3L0I A;  1G5Z A;  1BDJ B;  1V54 C;  2GDC A;  2KGO A;  4P9T A;  1HW2 A;  4C3B A;  3JCU Q;  3Q6M A;  3PMR A;  4XEF A;  3Q7G A;  4O6M A;  3LLI A;  3PHF 2;  2WVQ A;  3EZH A;  2LP4 A;  4CSA A;  4OIP F;  2J9W A;  3KYI A;  4MS2 A;  1ORY A;  3UMK A;  3ZQY A;  3S90 A;  3ABK C;  3VRC A;  2JX0 A;  1WAS A;  3O55 A;  4WGZ A;  4DBR A;  3UNG C;  4QDL A;  4ER9 A;  4OIO F;  4NY3 A;  4B6I A;  5E3A A;  1U6H A;  2L6H A;  2W45 A;  3QZC A;  2PP4 A;  1WGW A;  4MTO A;  4MVM A;  1YYJ A;  1NBB A;  3UR3 C;  1JPN A;  1BR2 A;  3V5X A;  4J32 B;  3VAY A;  4PFO A;  5F5F A;  1E83 A;  1YLM A;  1ZHY A;  3L1M A;  5AGF A;  2QTV A;  2XLE A;  4YT5 A;  2KYH A;  3NDB B;  3EPV A;  3RQE A;  3EGD B;  3TUL A;  1ZU4 A;  2R25 A;  2NG1 A;  4C7O B;  4OIR F;  3FXH A;  2R03 A;  2YVK A;  4U9E A;  4E18 A;  2DGJ A;  4XPW A;  3R2P A;  2OOC A;  1KU2 A;  2V26 A;  5E33 A;  4NC3 A;  5F28 E;  2AWY A;  2KC3 A;  1ORJ A;  1ZW3 A;  3RQF A;  1YA9 A;  1BBH A;  5JS5 A;  1M56 C;  3QTH A;  2PFD A;  3UMH A;  2GWW A;  2H7O A;  2GA0 A;  5D91 A;  5CI8 A;  4CDY A;  1VB5 A;  4K7B A;  2D4U A;  2MWQ A;  3PCV A;  3RH3 A;  3WAQ A;  1VYK A;  5L3V A;  1NSG B;  3NKD A;  1M57 C;  4U5C E;  5A6A A;  4M63 A;  3US6 A;  2EPO A;  1T5O A;  3C62 A;  4D4N A;  1A41 A;  3AG4 C;  2Y3G A;  4MW8 A;  4NTA A;  4Q5S F;  5IY5 C;  5A6K A;  2YL7 A;  5KYY B;  1VYI A;  1JPJ A;  1HMD A;  4JIO A;  3O10 A;  3L8J A;  3NG1 A;  2H7V C;  4A2N B;  3ITF A;  3EH2 A;  3RW0 A;  2LFF A;  1N1C A;  1PD1 A;  2J9U A;  2EIK C;  2LIG A;  3EJN A;  2R7X A;  4XEV A;  3DI5 A;  4N6C A;  3W8I A;  3JZ0 A;  2HSQ A;  2QY9 A;  2A0B A;  3EH1 A;  2XL6 A;  1YDI A;  2EIN C;  3OA1 A;  1LVK A;  4O6N A;  3HNL A;  4GYT A;  2Y39 A;  1YAU O;  1Z7Q c;  3IQT A;  2ZXR A;  4K0D A;  1M2V A;  3NYM A;  2LCH A;  1R4T A;  1MMA A;  4Z9H A;  2OG2 A;  3W8H A;  2Q9C A;  4XTK A;  4XQ1 A;  4IAQ A;  3V7O A;  2ZXO A;  5COF A;  5BQG A;  1OCZ C;  1SR2 A;  1FAP B;  2HMZ A;  2EPM X;  3DM9 B;  2ZPA A;  4J30 B;  2FAP B;  5E3C A;  3SXK A;  4OIN F;  3ASO C;  1G4U S;  2QNL A;  1BR1 A;  3N24 A;  4OD4 A;  3WOD F;  4XPY A;  3ATP A;  4WAB A;  4EKW A;  3N0T A;  3IHU A;  3S84 A;  2EPL X;  3FHD A;  4IGG A;  1Y4C A;  4MVU A;  5A6B D;  5B1A C;  3U2M A;  1ZHX A;  4IWB A;  5FCL A;  4EHP A;  2HZ8 A;  2VCA A;  1XZQ A;  3LJB A;  3EQL F;  2ETS A;  4MW3 A;  2YL0 A;  3LEO A;  3B71 A;  4JCZ A;  2C04 A;  3POV A;  1JAF A;  2J7P D;  3U8V A;  2VAS A;  4MVQ A;  4CBE A;  3AG3 C;  3GEE A;  1TWC A;  4U5E E;  3T6G B;  1A0B A;  2R7U A;  4IAO A;  4D4X A;  4N6H A;  2XSE A;  2ZD9 A;  4DVY P;  1Q0D A;  1ZW2 A;  2H7B A;  2J8W A;  4JJF A;  1ZU5 A;  2J9V A;  4PJM A;  3V5Z A;  4U9D A;  3AJM A;  4KNW A;  4HEA J;  3ABM C;  3GM3 A;  4JZA A;  4Z9I A;  4E0I A;  1M6T A;  2PNO A;  5A69 A;  1H9T A;  4CSA C;  5AC5 A;  1GM5 A;  3GM2 A;  2EIM C;  1EA8 A;  2Y69 C;  3CZ6 A;  3GOR A;  3TOM A;  4C3E A;  1Z23 A;  3JYY A;  3C18 A;  2PX3 A;  3DE9 A;  1FNT c;  3ZG1 A;  1Z5Z A;  2MHR A;  3UMI A;  3EFO B;  2HJ3 A;  1L3P A;  1V55 C;  1OQC A;  5A6B A;  2YQY A;  3HNK A;  5KYW B;  3R7C A;  1LPE A;  4E7S A;  2X51 A;  2OCC C;  3M1C B;  4E7Z A;  1AEP A;  4IB4 A;  5KYN A;  3IQ5 A;  1J8Y F;  3MLG A;  3C8G D;  3K1I C;  5T1D B;  2OU6 A;  2HFI A;  1QZX A;  3B9Q A;  4BJ5 C;  2J45 A;  4CS7 A;  3NMK A;  4BJ6 A;  3ASN C;  4LLC A;  4EUK B;  1AVO B;  2XLM A;  4LER A;  5KYU B;  4C7O A;  3FOO A;  3T6B A;  4AK9 A;  4G7H F;  2Q9B A;  4OD5 A;  2ZXW C;  4X0R A;  4CIH A;  1NZE A;  1APC A;  2LK4 A;  3ECS A;  3JSZ A;  3LNR A;  3Q6N A;  3JT1 A;  1ZVZ A;  1OR2 A;  3QW1 A;  5EGY A;  4YL0 A;  4AL1 A;  2IXM A;  1D0Z A;  2YLG A;  3DM5 A;  1QQ3 A;  2DI3 A;  2G62 A;  2M4E A;  2VH3 A;  3B29 A;  3M15 A;  1D0X A;  2LSE A;  2IBF A;  1TWA A;  2QLA A;  1D1A A;  3C63 A;  3NMJ A;  4I44 A;  1RKE B;  1M2V B;  2E87 A;  4L6R A;  4RBN A;  2WZL A;  3F46 A;  2X0C A;  1U89 A;  4BJ5 A;  2ASR A;  5EHH A;  2XS1 A;  3ZIB A;  1TQG A;  2NPU A;  1OW7 A;  2G3K A;  4J7Y A;  1TR2 A;  2IXN A;  2VCB A;  1PD0 A;  4JUR I;  1KTM A;  2L6F A;  2CNW D;  4JKV A;  2OJE D;  1KNY A;  3LS0 A;  4HFK B;  4I1O B;  5KYX B;  2VC9 A;  5JUA A;  1TFO B;  3DMD A;  1OXK A;  4CIP A;  1Q0M A;  2R7Q A;  1EI7 A;  1VTM P;  5L0F A;  1MQV A;  3I5P A;  1D1B A;  3JRM O;  2R7T A;  2HUJ A;  3MX3 A;  3UGO A;  4BEM J;  1C02 A;  1Q0G A;  2J46 A;  3L8I A;  2Q7R A;  2KK1 A;  4AE4 B;  2MYS A;  1GQA A;  2YRF A;  3FMS A;  4XPX A;  4AL0 A;  3JRT A;  4CX9 A;  4BJT A;  3O6X A;  3E9V A;  1PV3 A;  2OQM A;  1VLS A;  5E2Q A;  3CAX A;  1LKX A;  5BQI A;  2A6H F;  4PJJ A;  1K04 A;  3LNM B;  3EFO A;  3UGP A;  3SXZ A;  4XWJ A;  2OEX A;  1O5H A;  4U5D E;  3RVZ A;  2H8A A;  2XRH A;  2V3C C;  3F47 A;  1LI5 A;  2XLW A;  3IQC A;  3B0U X;  3GWL A;  3ZVR A;  4NQF A;  3A11 A;  4XLN F;  4LAC B;  4PK4 A;  1RJ9 B;  4O79 A;  4N06 A;  5D92 A;  3U8P A;  2KSF A;  5L0C A;  4NCQ A;  4FAP B;  1XZP A;  1RXQ A;  4EBK A;  4G7Z F;  2KW3 C;  3RYL A;  2W4M A;  1C03 A;  3K66 A;  1CPQ A;  4IJJ A;  1Z3I X;  2QUP A;  2GFH A;  4H4K C;  1ZZP A;  2TMV P;  2EIJ C;  3LAY A;  4DOZ A;  1MNE A;  1ORS C;  2W4B A;  2YKZ A;  4O6Y A;  3KKB A;  1TWH A;  3JYH A;  3J06 A;  4BEJ A;  3NYL A;  3A9C A;  3CQZ A;  5JRA A;  4I3M A;  2WZF A;  1LS1 A;  3NYJ A;  1IZM A;  4EWC A;  2XL8 A;  4E0H A;  1TWG A;  2QE9 A;  4JJG A;  5COM A;  3RIP A;  3X2Q C;  2YEV A;  1A7E A;  1WOL A;  4KNV A;  3FVY A;  1QVX A;  4MVR A;  4YJW A;  5TJ5 E;  3TK0 A;  4ZLC A;  4XLP F;  3JTL O;  3HLZ A;  1BZ4 A;  4N4W A;  2HMQ A;  3ABL C;  3AOU A;  4JC7 A;  4LDR A;  2P1A A;  4ONS A;  3DKA A;  2XS8 A;  2Q9A A;  2Y3B A;  4LDK A;  4E17 A;  4JE9 A;  2HKV A; 
#chains in the Genus database with same CATH homology
 1RKC A;  2GWW A;  5L0J A;  1SYQ A;  5FZT A;  2X0C A;  4DJ9 A;  3S90 A;  1U89 A;  1ZW2 A;  5L0D A;  3MYI A;  3TJ6 A;  1XWJ A;  1L7C A;  5L0G A;  1T01 A;  4K1O A;  3TJ5 A;  1U6H A;  1TR2 A;  3T6G B;  3H2U A;  4W8P A;  3ZDL A;  1ST6 A;  1DOV A;  1RKE A;  4IGG A;  5L0H A;  5L0I A;  1DOW A;  2LQG A;  2L7A A;  3RF3 A;  1ZVZ A;  4EHP A;  2GDC A;  4E18 A;  5L0F A;  4P9T A;  2B0H A;  3VF0 A;  4ONS A;  5L0C A;  2HSQ A;  1QKR A;  1ZW3 A;  2IBF A;  4E17 A;  1YDI A;  1RKE B;  4PR9 A;  1H6G A;  3H2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...