1DOVA

Crystal structure of the alpha-catenin dimerization domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
181
structure length
181
Chain Sequence
ESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords ALPHA-CATENIN
publication title Structure of the dimerization and beta-catenin-binding region of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
total genus 86
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1999-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1dovA00
1YDIA 3H2UA 4E18A 3ZDLA 5L0CA 1U89A 1SYQA 1ZW2A 2HSQA 1DOWA 5L0GA 3H2VA 4ONSA 1ST6A 5FZTA 1XWJA 1ZVZA 2LQGA 4DJ9A 2IBFA 1RKEB 2L7AA 5L0FA 5L0IA 1QKRA 3TJ6A 4PR9A 1RKCA 4IGGA 3S90A 2B0HA 3T6GB 1ZW3A 1DOVA 1TR2A 1H6GA 1U6HA 2X0CA 3RF3A 4P9TA 5L0DA 2GDCA 1L7CA 1T01A 3MYIA 2GWWA 3TJ5A 4E17A 5L0HA 4EHPA 5L0JA 3VF0A 4W8PA 4K1OA 1RKEA
chains in the Genus database with same CATH superfamily
1LKXA 3MBGA 4KC9A 5DS5A 2HJ3A 3L8JA 3S84A 2OEXA 3ZDLA 5DS4A 3WG7C 2BE5F 2Y69C 3M4BA 2PBEA 1PCXA 3ASOC 3I4UA 4JVSA 3DE8A 4X0RA 3FHDA 3ZQVA 3C8GA 3E70C 3IPMO 4CIHA 5COGA 5JSLA 1EQ1A 1E2XA 1TFKB 2VC9A 5A6JA 2YHSA 1QQ3A 3T9OA 2C03A 3LAYA 1KTMA 4Q4ZF 3AOUA 3RVZA 2X0CA 4C7OA 3OEOA 4Z9IA 3RF3A 1A0BA 3JSEO 2LK4A 4JTDB 4D4NA 1WN0A 4MVQA 4M63A 4W8PA 1Y6DA 1MMGA 4NTBA 1ZHYA 2JPUA 1APCA 2D5RB 2Q9BA 3DE9A 1Z5ZA 2H7BA 4OD4A 4AE4A 2XL4A 2WZLA 2P7VA 3DD7A 3NYMA 3ZTMA 3EGDA 2TMVP 2YQYA 1GS9A 2W4MA 1OKKA 2KC3A 1TWHA 1S05A 5DVWA 3TD7A 1WOLA 3KMIA 2CNWD 4HFFB 4CS9A 2J0WA 2B0HA 2H7VC 4MTGA 4YJWA 3T6GB 1NLXA 3DWWA 1QZXA 3JT1A 2MYSA 3TQOA 1OR3A 3NKDA 3VM6A 2YWAA 1A7VA 2J7PA 2XLEA 3LLIA 2XXAB 1YAUO 2OEVA 2P6VA 3KL4A 3UMKA 3AG2C 2HMQA 3U9MA 2XRHA 3FVYA 3S0XA 3JTLO 4BJ5A 1LPEA 3NRHA 3JYHA 3NDBB 3O10A 3HNKA 4PFPA 2V3CC 4G7OF 1YJGA 2HSQA 3V5ZA 2JD3A 4GYTA 4E7SA 256BA 2G62A 1F1MA 3DXJF 3JRMO 4F4BA 1O5HA 3PHF2 3EJNA 4NQFA 4CS9C 3EHMA 3WAQA 4O79A 4G7ZF 3RQGA 2YL0A 1BBHA 1K04A 4IJJA 1LM3B 1Q0GA 1JMWA 1B68A 4IRUA 2R9RB 4UDVA 1SF8A 2EIKC 2YLGA 4MVRA 3C8GD 4EWCA 3C8ZA 3FAJA 1LE4A 1H6GA 3B0VC 3J06A 1BDJB 4BJ5C 4EUKB 5EHHA 3W8IA 2KK1A 3A11A 3NKEA 3SP1A 3MYIA 2VCAA 5KYYB 1OW7A 1R5ID 2A6HF 3TJ5A 3VF0A 2A69F 4JIOA 3F46A 3EHNA 3GWNA 3SNHA 1S7ZA 2EIJC 3LS1A 5BQIA 1A41A 1CPQA 3QW1A 4U5DE 3Q7GA 3RFYA 5L3QA 3W2WA 3MFNA 1R4TA 1GQAA 3UGOA 4CX9A 2L9JA 4DVYP 4U5BE 4G78A 3G50A 3HNJA 4U9DA 3PDMP 4MVZA 2L6FA 3AQBA 3I5QA 3MX3A 3UR3C 4ANJA 2J9VA 4CSAA 3T4RA 4N6HA 4C3EA 4RBNA 3TJ6A 3OWTA 1J8YF 1RKCA 1OKKD 1LVKA 1Z6AA 2YRFA 1VYIA 5JS5A 4N06A 4O6YA 1D0YA 1M2OA 2W45A 1HY5A 1U6HA 1VB5A 1HE1A 2Y3DA 1Z23A 3LUTB 4Q7CA 5JVEA 1E86A 1FFHA 1XZPA 2A0BA 2E87A 1WTYA 3K1IA 4WJ0A 3AG3C 3ABLC 3EGXA 4GEHA 3K7DA 3CQZA 4H4KC 1RKEA 1LIHA 4OD5A 4XEFA 3C18A 4N6CA 2NSGA 3U2LA 2Q7RA 1YYJA 3L0IA 4FWVA 1DOWA 4EIYA 4CSAC 1AVOB 1BR2A 3TK0A 4BJ1A 2EPLX 3ECSA 5IY5C 4ZLDA 1A7DA 5GPGB 1A7EA 2F22A 4U5HA 3VYWA 2EPMX 2YLDA 2FAPB 5KYWA 3FMSA 1QKRA 2BC5A 2PF4E 2IXOA 1Q0MA 3RH3A 4JC7A 2XLMA 4MS2A 2XS1A 1FFTC 5E3CA 3GORA 4K0DA 2NPUA 2ZXWC 4XLPF 1FAPB 1YVIA 2EIMC 2OCCC 3K6BA 3RQEA 3U3BA 5DQZA 1EKYA 3B71A 3N24A 1T6UA 1Q0FA 4PJMA 5BUOA 5L0DA 3SXZA 5JRAA 2ICWG 1HW1A 3QVYA 2VASA 3HKKA 3LNMB 4MQ9F 4O6MA 4EBBA 5L0JA 4L6RA 2Q4FA 2UUIA 2OU6A 1QSPA 1YDIA 1AEPA 1C03A 1GGQA 3GEEA 2NUPA 2R05A 4PJJA 4XTKA 2GA0A 2R7TA 5F5HA 2EPOA 2Q00A 1YYXA 2R03A 2Y3HA 3EG9A 3LEVA 4QDLA 3HTKC 2NUTA 1WATA 3TOLA 4CIPA 1CGOA 3JCUQ 3JSZA 4LDKA 4DVZA 5KYXA 2Z15A 2EPNA 2D4UA 1M2VA 1Z3IX 4ER9A 4JCZA 1FNTc 2CGEA 3ITFA 2J0XA 5F5FA 1EI7A 4PK4A 5KYNA 4OIQF 2XSEA 1PD0A 1TFOB 2RSEB 2W9YA 4JTAB 2DYRC 1D0ZA 1VLTA 3DAFA 2J9BA 1NG1A 3SEOA 3N0TA 1IZMA 3IQ6A 3CSKA 5JP7A 2X51A 2YL7A 1U89A 1ZW2A 3EH2A 4PJNA 3NYJA 2R7UA 1CGNA 1HMDA 1OR2A 1ZHTA 2A0UA 2ZXPA 3H2VA 2LIGA 1O3UA 2EILC 2WVOA 1Y4CA 2ASRA 4JEAA 3EFOB 3UGPA 4U5GA 3FOPA 2LFDA 2OKUA 2AVKA 3ABMC 5E2QA 4KI2A 3HJCA 4BJ6A 2MWQA 1ZZPA 2L6HA 3AG4C 4PR9A 5KYUB 1UFBA 3HNIA 1OW8A 4K7BA 5T1DB 3T6JA 1VOMA 3LEOA 1Q0DA 2IXPA 4MVSA 3W4YA 4YT4A 4IAQA 1V55C 1AUEA 4NY3A 3G4XA 4GQHA 2WVNA 3K33A 2R7WA 4FESA 4I3MA 2XM0A 5BQHA 4JTCB 2G3VA 2ZXRA 3AGTA 3NMKA 2L81A 3TULA 2OQMA 3GM3A 4HFKB 1MQVA 1YZCA 2XLVA 4KNVA 3M15A 4LDRA 4LLEA 4CJGA 4YT8A 1MMDA 1XWJA 1ZHZA 1TKNA 1V74B 2G3KA 3GWLA 3DM5A 2XXAA 1SR2A 4C3DA 2L7AA 4MVUA 2Y39A 4MVMA 4NCQA 4LACB 2B0JA 4U5CE 4XPYA 3U9JA 4DRJB 5L3VA 4IWBA 1ZW3A 5TJ5E 2IXMA 4CS8A 5CI9A 4DRHB 1SZIA 3US6A 1M56C 4P9FA 2GAQA 2Q3TA 2WZGA 3B0PA 1RJ9B 1YZAA 4YL0A 3LS0A 3QMKA 5L0HA 1QLEC 1RXQA 3A9CA 4EBJA 4K1OA 5COFA 3QVZA 3U5SA 2M4EA 1T6QA 3KPHA 4OIRF 5L0CA 1TWAA 3RQFA 3O55A 2PNOA 1HE9A 1I5NA 2VH3A 3M79A 4MNDA 4AL0A 4C3BA 3Q6NA 4O7GA 4DBRA 3ZC4A 2R25A 1D1BA 2HS5A 3DKAA 1RMVA 1WGWA 2IBFA 4CJOA 1D1CA 2YZSA 1MMNA 3DJNB 5KYYA 5K0IA 4CS7A 3ZSUA 2PX0A 3B0UX 4A4AA 2XLOA 2XM4A 1W2WA 2CDQA 2DI3A 3MLGA 2P1AA 2ETSA 3H65A 4NTAA 2R7VA 1G8XA 1OCRC 3SXYA 4NC3A 4IB4A 5DLJA 2IOQA 1I4YA 1D0XA 2EPKX 1FMWA 3DJUB 2J9UA 3GODA 3R2PA 4J30B 4Z9HA 2P61A 2UUHA 1FTSA 2KJGA 2PP4A 4XPXA 1LE2A 4ZLCA 5E3AA 2OJED 1C17M 4A2NB 4CDYA 1LI5A 1WWPA 2IXNA 4I1OB 1QVXA 2LFFA 4WABA 2LSEA 2R7XA 3W8HA 3ZQYA 1NFNA 2QNLA 1OCCC 5FCLA 5DS6A 4U5EE 1OCOC 3L8IA 1J8MF 4YT2A 1YA9A 5BQGA 1ZYRF 4IARA 2HKVA 2ZPAA 3K1IC 3LJBA 1NU7D 3PMRA 4XQ1A 3HLZA 3ZWIA 4DBQA 1V54C 4P6IC 3LNRA 4MW3A 1JOGA 2H8AA 1U0BB 2HFIA 3RKOF 3DMDA 4YL3A 3FDQA 4JW1A 1YARO 1XZQA 3G4ZA 3UNGC 4BG0A 1YA7O 3ZIBA 5HV9A 2L6GA 2YKZA 3T6BA 3RVYA 4H54A 2M64A 3OA1A 2PX3A 2DB4A 2YLIA 5F28E 1MMAA 2MHRA 3ABKC 4JE9A 4B6IA 4U5FE 1Z7Qc 2O9XA 1RCPA 3M1CB 2IM8A 1MNDA 4FX5A 2A68F 2QY9A 4ULVA 5EK0A 3BEHA 2PFDA 3ZTZA 4E0IA 1I4ZA 3KYJA 1ORSC 2QTVA 2I8BA 1NSGB 3L1MA 2P0NA 4JURI 3RIPA 4JCHA 2KNHA 1UG7A 2R7QA 2YEVA 5D92A 3Q7LA 3GANA 3SXMA 2GDCA 4MTOA 4HE8D 3C8GB 3GM2A 1HW2A 3RYLA 2AP3A 3C63A 5B3SC 4BEJA 1OQCA 2KW3C 2WZFA 4C7OB 4YL1A 3AGUA 2ZXOA 5T3WA 1GM5A 4I1MA 2RD9A 2KGOA 1KU2A 4OIPF 3U8PA 5A6KA 2DGJA 5FZTA 2GFHA 1FR0A 1M57C 2LQGA 3HNLA 1ZHXA 1N1CA 3KKBA 4FAPB 5A6AA 1YLMA 4JJGA 3S28A 4YWQA 4MVOA 1VMAA 2A6EF 3O6XA 3S29A 2ZD9A 4LERA 4IGGA 2W4BA 4AE4B 1ORJA 4W8KA 1K05A 1EA8A 4XWJA 3VAYA 1K40A 4JRZA 3AG1C 1PV3A 3GEHA 1ZU4A 3EGDB 3KYIA 2KQ9A 2QE9A 4AK9A 2OJQA 3JZ0A 1E85A 3EZHA 1T01A 3RW0A 3EFOA 4OIOF 3C7JA 2LP4A 2VCCA 4WGZA 3NYLA 1OXBA 2HSBA 3KH2A 1MNEA 2OG2A 3S9OA 1OXKA 5KYUA 1NFOA 5L0GA 2XL6A 3C62A 1VLSA 3U3FA 4BJ6C 2AWCA 2HV7A 4E0HA 5JUAA 1H7IA 1LS4A 3M4CA 2YVKA 5T3TA 3V5YA 4BPMA 2XLDA 4OINF 2Q9CA 2OOCA 3MYFA 4PJLA 1JPJA 4CDVA 3DM9B 3S27A 3CZ6A 3GEIA 4JKVA 4BJTA 3NMJA 4CDAA 4QI2A 4Z9JA 1ZU5A 3F47A 1DOVA 2QUPA 1CPRA 2V26A 5AGFA 3U2MA 2FGYA 1E83A 2EINC 2VCBA 1VYKA 5B1AC 3UMHA 2NSFA 4AL1A 1TQGA 4EKWA 3IQCA 5CIVA 3EH1A 3NG1A 3JYYA 2NG1A 2H7OA 2XL8A 1PD1A 2DYSC 2J46A 3FXHA 3SZRA 5EGYA 4RD9A 1VTMP 3CEXA 1NBBA 3H2UA 4RDAA 3N2ZB 3WODF 3X1OA 3ZVRA 1T5OA 3ATPA 2XLHA 3O39A 5B3IA 4PFOA 3WHNA 2A1DD 4J32B 4ONSA 4J7TA 3L34A 1G5ZA 2R7SA 5E33A 5A6BA 1T6IA 1RJ9A 4O6NA 3NMIA 3IHUA 5B1BC 3AJMA 4CS8C 3IQTA 1L3PA 3BRJA 2AWYA 2YL1A 1NZEA 2HMZA 3W2VA 3B29A 3DI5A 2J8WA 3LLKA 2Q9AA 1ZHWA 1JR8A 4ULWA 4E7ZA 3AQCA 4NTFA 5COMA 3SXKA 4N4WA 5JT4A 3UMIA 2KSFA 1CGME 3V5XA 2LCHA 2LD6A 1NU9C 4G0HA 4LDQA 4PACA 4XLNF 1T9KA 2AU5A 2C04A 2HUJA 2JX0A 1SYQA 2VB6A 1G4US 3DZAA 3EPVA 5JLIA 5HSWA 1BR1A 1SMYF 1OW6A 2XS8A 3K1HA 1E84A 1C02A 3IQ5A 4G7HF 1ZVZA 1QPUA 2J9WA 4QI0A 4YT5A 4DJ9A 3EGXB 3POVA 1G4WR 1RKEB 4HEAJ 4I44A 2YL3A 4YN0B 5L0IA 3LESA 1TWCA 3U0CA 3I5PA 4D4XA 2R02A 1JRAA 1JAFA 2WB7A 2J45A 1LI7A 5D91A 3S90A 3K66A 1V4AA 2FFHA 4JJFA 5AC5A 4Q5SF 3QTHA 1TR2A 1Z63A 4R32A 4XEVA 1FMVA 3DAGA 4KNWA 4MTFA 1VK5A 2Y3BA 3V7OA 1M6TA 2XLWA 4BEMJ 1WASA 5CI8A 5KYWB 2GWWA 4WGYA 2J7PD 4EHPA 3ASNC 3EZIA 3IEEA 2BL2A 4IAOA 3QW0A 3X2QC 4E18A 3Q6MA 4XEKA 3EQLF 1D1AA 4JZAA 3B9QA 4LLCA 4KBLA 1ST6A 3E9VA 4XPWA 5AC4A 3JRTA 2CNWA 4EBKA 3QZCA 5A69A 3VRCA 2QLAA 3U8VA 2WVQA 1O87A 2R7RA 1BZ4A 4J7YA 4DOZA 2Y3GA 1OCZC 2IYLD 3GM1A 5L0FA 2R7OA 1H9TA 4JEBA 1BR4A 1HMOA 2KYHA 2NUPB 4AX2A 4MW8A 5DQTA 1Q0KA 2CW0F 4CBEA 1JPNA 4DRIB 5A6BD 3FAPB 4U9EA 3CAXA 2HV6A 1LS1A 2NUTB 3EG9B 3FOOA 3SYNA 3TOMA 4YK5A 4P9TA 3ZG1A 1ORYA 2CCYA 1IW7F 1H9GA 1L7CA 2WL8A 2I15A 4E17A 1M2VB 5KYXB 3R7CA 1KNYA 2CYDA 3PCVA 2HJMA 4DXWA 1TWGA 2HZ8A
chains in the Genus database with same CATH topology
1YDIA 3H2UA 4E18A 3ZDLA 5L0CA 1U89A 1SYQA 1ZW2A 2HSQA 1DOWA 5L0GA 3H2VA 4ONSA 1ST6A 5FZTA 1XWJA 1ZVZA 2LQGA 4DJ9A 2IBFA 1RKEB 2L7AA 5L0FA 5L0IA 1QKRA 3TJ6A 4PR9A 1RKCA 4IGGA 3S90A 2B0HA 3T6GB 1ZW3A 1DOVA 1TR2A 1H6GA 1U6HA 2X0CA 3RF3A 4P9TA 5L0DA 2GDCA 1L7CA 1T01A 3MYIA 2GWWA 3TJ5A 4E17A 5L0HA 4EHPA 5L0JA 3VF0A 4W8PA 4K1OA 1RKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDI A;  3H2U A;  4E18 A;  3ZDL A;  5L0C A;  1U89 A;  1SYQ A;  1ZW2 A;  2HSQ A;  1DOW A;  5L0G A;  3H2V A;  4ONS A;  1ST6 A;  5FZT A;  1XWJ A;  1ZVZ A;  2LQG A;  4DJ9 A;  2IBF A;  1RKE B;  2L7A A;  5L0F A;  5L0I A;  1QKR A;  3TJ6 A;  4PR9 A;  1RKC A;  4IGG A;  3S90 A;  2B0H A;  3T6G B;  1ZW3 A;  1DOV A;  1TR2 A;  1H6G A;  1U6H A;  2X0C A;  3RF3 A;  4P9T A;  5L0D A;  2GDC A;  1L7C A;  1T01 A;  3MYI A;  2GWW A;  3TJ5 A;  4E17 A;  5L0H A;  4EHP A;  5L0J A;  3VF0 A;  4W8P A;  4K1O A;  1RKE A; 
#chains in the Genus database with same CATH topology
 1LKX A;  3MBG A;  4KC9 A;  5DS5 A;  2HJ3 A;  3L8J A;  3S84 A;  2OEX A;  3ZDL A;  5DS4 A;  3WG7 C;  2BE5 F;  2Y69 C;  3M4B A;  2PBE A;  1PCX A;  3ASO C;  3I4U A;  4JVS A;  3DE8 A;  4X0R A;  3FHD A;  3ZQV A;  3C8G A;  3E70 C;  3IPM O;  4CIH A;  5COG A;  5JSL A;  1EQ1 A;  1E2X A;  1TFK B;  2VC9 A;  5A6J A;  2YHS A;  1QQ3 A;  3T9O A;  2C03 A;  3LAY A;  1KTM A;  4Q4Z F;  3AOU A;  3RVZ A;  2X0C A;  4C7O A;  3OEO A;  4Z9I A;  3RF3 A;  1A0B A;  3JSE O;  2LK4 A;  4JTD B;  4D4N A;  1WN0 A;  4MVQ A;  4M63 A;  4W8P A;  1Y6D A;  1MMG A;  4NTB A;  1ZHY A;  2JPU A;  1APC A;  2D5R B;  2Q9B A;  3DE9 A;  1Z5Z A;  2H7B A;  4OD4 A;  4AE4 A;  2XL4 A;  2WZL A;  2P7V A;  3DD7 A;  3NYM A;  3ZTM A;  3EGD A;  2TMV P;  2YQY A;  1GS9 A;  2W4M A;  1OKK A;  2KC3 A;  1TWH A;  1S05 A;  5DVW A;  3TD7 A;  1WOL A;  3KMI A;  2CNW D;  4HFF B;  4CS9 A;  2J0W A;  2B0H A;  2H7V C;  4MTG A;  4YJW A;  3T6G B;  1NLX A;  3DWW A;  1QZX A;  3JT1 A;  2MYS A;  3TQO A;  1OR3 A;  3NKD A;  3VM6 A;  2YWA A;  1A7V A;  2J7P A;  2XLE A;  3LLI A;  2XXA B;  1YAU O;  2OEV A;  2P6V A;  3KL4 A;  3UMK A;  3AG2 C;  2HMQ A;  3U9M A;  2XRH A;  3FVY A;  3S0X A;  3JTL O;  4BJ5 A;  1LPE A;  3NRH A;  3JYH A;  3NDB B;  3O10 A;  3HNK A;  4PFP A;  2V3C C;  4G7O F;  1YJG A;  2HSQ A;  3V5Z A;  2JD3 A;  4GYT A;  4E7S A;  256B A;  2G62 A;  1F1M A;  3DXJ F;  3JRM O;  4F4B A;  1O5H A;  3PHF 2;  3EJN A;  4NQF A;  4CS9 C;  3EHM A;  3WAQ A;  4O79 A;  4G7Z F;  3RQG A;  2YL0 A;  1BBH A;  1K04 A;  4IJJ A;  1LM3 B;  1Q0G A;  1JMW A;  1B68 A;  4IRU A;  2R9R B;  4UDV A;  1SF8 A;  2EIK C;  2YLG A;  4MVR A;  3C8G D;  4EWC A;  3C8Z A;  3FAJ A;  1LE4 A;  1H6G A;  3B0V C;  3J06 A;  1BDJ B;  4BJ5 C;  4EUK B;  5EHH A;  3W8I A;  2KK1 A;  3A11 A;  3NKE A;  3SP1 A;  3MYI A;  2VCA A;  5KYY B;  1OW7 A;  1R5I D;  2A6H F;  3TJ5 A;  3VF0 A;  2A69 F;  4JIO A;  3F46 A;  3EHN A;  3GWN A;  3SNH A;  1S7Z A;  2EIJ C;  3LS1 A;  5BQI A;  1A41 A;  1CPQ A;  3QW1 A;  4U5D E;  3Q7G A;  3RFY A;  5L3Q A;  3W2W A;  3MFN A;  1R4T A;  1GQA A;  3UGO A;  4CX9 A;  2L9J A;  4DVY P;  4U5B E;  4G78 A;  3G50 A;  3HNJ A;  4U9D A;  3PDM P;  4MVZ A;  2L6F A;  3AQB A;  3I5Q A;  3MX3 A;  3UR3 C;  4ANJ A;  2J9V A;  4CSA A;  3T4R A;  4N6H A;  4C3E A;  4RBN A;  3TJ6 A;  3OWT A;  1J8Y F;  1RKC A;  1OKK D;  1LVK A;  1Z6A A;  2YRF A;  1VYI A;  5JS5 A;  4N06 A;  4O6Y A;  1D0Y A;  1M2O A;  2W45 A;  1HY5 A;  1U6H A;  1VB5 A;  1HE1 A;  2Y3D A;  1Z23 A;  3LUT B;  4Q7C A;  5JVE A;  1E86 A;  1FFH A;  1XZP A;  2A0B A;  2E87 A;  1WTY A;  3K1I A;  4WJ0 A;  3AG3 C;  3ABL C;  3EGX A;  4GEH A;  3K7D A;  3CQZ A;  4H4K C;  1RKE A;  1LIH A;  4OD5 A;  4XEF A;  3C18 A;  4N6C A;  2NSG A;  3U2L A;  2Q7R A;  1YYJ A;  3L0I A;  4FWV A;  1DOW A;  4EIY A;  4CSA C;  1AVO B;  1BR2 A;  3TK0 A;  4BJ1 A;  2EPL X;  3ECS A;  5IY5 C;  4ZLD A;  1A7D A;  5GPG B;  1A7E A;  2F22 A;  4U5H A;  3VYW A;  2EPM X;  2YLD A;  2FAP B;  5KYW A;  3FMS A;  1QKR A;  2BC5 A;  2PF4 E;  2IXO A;  1Q0M A;  3RH3 A;  4JC7 A;  2XLM A;  4MS2 A;  2XS1 A;  1FFT C;  5E3C A;  3GOR A;  4K0D A;  2NPU A;  2ZXW C;  4XLP F;  1FAP B;  1YVI A;  2EIM C;  2OCC C;  3K6B A;  3RQE A;  3U3B A;  5DQZ A;  1EKY A;  3B71 A;  3N24 A;  1T6U A;  1Q0F A;  4PJM A;  5BUO A;  5L0D A;  3SXZ A;  5JRA A;  2ICW G;  1HW1 A;  3QVY A;  2VAS A;  3HKK A;  3LNM B;  4MQ9 F;  4O6M A;  4EBB A;  5L0J A;  4L6R A;  2Q4F A;  2UUI A;  2OU6 A;  1QSP A;  1YDI A;  1AEP A;  1C03 A;  1GGQ A;  3GEE A;  2NUP A;  2R05 A;  4PJJ A;  4XTK A;  2GA0 A;  2R7T A;  5F5H A;  2EPO A;  2Q00 A;  1YYX A;  2R03 A;  2Y3H A;  3EG9 A;  3LEV A;  4QDL A;  3HTK C;  2NUT A;  1WAT A;  3TOL A;  4CIP A;  1CGO A;  3JCU Q;  3JSZ A;  4LDK A;  4DVZ A;  5KYX A;  2Z15 A;  2EPN A;  2D4U A;  1M2V A;  1Z3I X;  4ER9 A;  4JCZ A;  1FNT c;  2CGE A;  3ITF A;  2J0X A;  5F5F A;  1EI7 A;  4PK4 A;  5KYN A;  4OIQ F;  2XSE A;  1PD0 A;  1TFO B;  2RSE B;  2W9Y A;  4JTA B;  2DYR C;  1D0Z A;  1VLT A;  3DAF A;  2J9B A;  1NG1 A;  3SEO A;  3N0T A;  1IZM A;  3IQ6 A;  3CSK A;  5JP7 A;  2X51 A;  2YL7 A;  1U89 A;  1ZW2 A;  3EH2 A;  4PJN A;  3NYJ A;  2R7U A;  1CGN A;  1HMD A;  1OR2 A;  1ZHT A;  2A0U A;  2ZXP A;  3H2V A;  2LIG A;  1O3U A;  2EIL C;  2WVO A;  1Y4C A;  2ASR A;  4JEA A;  3EFO B;  3UGP A;  4U5G A;  3FOP A;  2LFD A;  2OKU A;  2AVK A;  3ABM C;  5E2Q A;  4KI2 A;  3HJC A;  4BJ6 A;  2MWQ A;  1ZZP A;  2L6H A;  3AG4 C;  4PR9 A;  5KYU B;  1UFB A;  3HNI A;  1OW8 A;  4K7B A;  5T1D B;  3T6J A;  1VOM A;  3LEO A;  1Q0D A;  2IXP A;  4MVS A;  3W4Y A;  4YT4 A;  4IAQ A;  1V55 C;  1AUE A;  4NY3 A;  3G4X A;  4GQH A;  2WVN A;  3K33 A;  2R7W A;  4FES A;  4I3M A;  2XM0 A;  5BQH A;  4JTC B;  2G3V A;  2ZXR A;  3AGT A;  3NMK A;  2L81 A;  3TUL A;  2OQM A;  3GM3 A;  4HFK B;  1MQV A;  1YZC A;  2XLV A;  4KNV A;  3M15 A;  4LDR A;  4LLE A;  4CJG A;  4YT8 A;  1MMD A;  1XWJ A;  1ZHZ A;  1TKN A;  1V74 B;  2G3K A;  3GWL A;  3DM5 A;  2XXA A;  1SR2 A;  4C3D A;  2L7A A;  4MVU A;  2Y39 A;  4MVM A;  4NCQ A;  4LAC B;  2B0J A;  4U5C E;  4XPY A;  3U9J A;  4DRJ B;  5L3V A;  4IWB A;  1ZW3 A;  5TJ5 E;  2IXM A;  4CS8 A;  5CI9 A;  4DRH B;  1SZI A;  3US6 A;  1M56 C;  4P9F A;  2GAQ A;  2Q3T A;  2WZG A;  3B0P A;  1RJ9 B;  1YZA A;  4YL0 A;  3LS0 A;  3QMK A;  5L0H A;  1QLE C;  1RXQ A;  3A9C A;  4EBJ A;  4K1O A;  5COF A;  3QVZ A;  3U5S A;  2M4E A;  1T6Q A;  3KPH A;  4OIR F;  5L0C A;  1TWA A;  3RQF A;  3O55 A;  2PNO A;  1HE9 A;  1I5N A;  2VH3 A;  3M79 A;  4MND A;  4AL0 A;  4C3B A;  3Q6N A;  4O7G A;  4DBR A;  3ZC4 A;  2R25 A;  1D1B A;  2HS5 A;  3DKA A;  1RMV A;  1WGW A;  2IBF A;  4CJO A;  1D1C A;  2YZS A;  1MMN A;  3DJN B;  5KYY A;  5K0I A;  4CS7 A;  3ZSU A;  2PX0 A;  3B0U X;  4A4A A;  2XLO A;  2XM4 A;  1W2W A;  2CDQ A;  2DI3 A;  3MLG A;  2P1A A;  2ETS A;  3H65 A;  4NTA A;  2R7V A;  1G8X A;  1OCR C;  3SXY A;  4NC3 A;  4IB4 A;  5DLJ A;  2IOQ A;  1I4Y A;  1D0X A;  2EPK X;  1FMW A;  3DJU B;  2J9U A;  3GOD A;  3R2P A;  4J30 B;  4Z9H A;  2P61 A;  2UUH A;  1FTS A;  2KJG A;  2PP4 A;  4XPX A;  1LE2 A;  4ZLC A;  5E3A A;  2OJE D;  1C17 M;  4A2N B;  4CDY A;  1LI5 A;  1WWP A;  2IXN A;  4I1O B;  1QVX A;  2LFF A;  4WAB A;  2LSE A;  2R7X A;  3W8H A;  3ZQY A;  1NFN A;  2QNL A;  1OCC C;  5FCL A;  5DS6 A;  4U5E E;  1OCO C;  3L8I A;  1J8M F;  4YT2 A;  1YA9 A;  5BQG A;  1ZYR F;  4IAR A;  2HKV A;  2ZPA A;  3K1I C;  3LJB A;  1NU7 D;  3PMR A;  4XQ1 A;  3HLZ A;  3ZWI A;  4DBQ A;  1V54 C;  4P6I C;  3LNR A;  4MW3 A;  1JOG A;  2H8A A;  1U0B B;  2HFI A;  3RKO F;  3DMD A;  4YL3 A;  3FDQ A;  4JW1 A;  1YAR O;  1XZQ A;  3G4Z A;  3UNG C;  4BG0 A;  1YA7 O;  3ZIB A;  5HV9 A;  2L6G A;  2YKZ A;  3T6B A;  3RVY A;  4H54 A;  2M64 A;  3OA1 A;  2PX3 A;  2DB4 A;  2YLI A;  5F28 E;  1MMA A;  2MHR A;  3ABK C;  4JE9 A;  4B6I A;  4U5F E;  1Z7Q c;  2O9X A;  1RCP A;  3M1C B;  2IM8 A;  1MND A;  4FX5 A;  2A68 F;  2QY9 A;  4ULV A;  5EK0 A;  3BEH A;  2PFD A;  3ZTZ A;  4E0I A;  1I4Z A;  3KYJ A;  1ORS C;  2QTV A;  2I8B A;  1NSG B;  3L1M A;  2P0N A;  4JUR I;  3RIP A;  4JCH A;  2KNH A;  1UG7 A;  2R7Q A;  2YEV A;  5D92 A;  3Q7L A;  3GAN A;  3SXM A;  2GDC A;  4MTO A;  4HE8 D;  3C8G B;  3GM2 A;  1HW2 A;  3RYL A;  2AP3 A;  3C63 A;  5B3S C;  4BEJ A;  1OQC A;  2KW3 C;  2WZF A;  4C7O B;  4YL1 A;  3AGU A;  2ZXO A;  5T3W A;  1GM5 A;  4I1M A;  2RD9 A;  2KGO A;  1KU2 A;  4OIP F;  3U8P A;  5A6K A;  2DGJ A;  5FZT A;  2GFH A;  1FR0 A;  1M57 C;  2LQG A;  3HNL A;  1ZHX A;  1N1C A;  3KKB A;  4FAP B;  5A6A A;  1YLM A;  4JJG A;  3S28 A;  4YWQ A;  4MVO A;  1VMA A;  2A6E F;  3O6X A;  3S29 A;  2ZD9 A;  4LER A;  4IGG A;  2W4B A;  4AE4 B;  1ORJ A;  4W8K A;  1K05 A;  1EA8 A;  4XWJ A;  3VAY A;  1K40 A;  4JRZ A;  3AG1 C;  1PV3 A;  3GEH A;  1ZU4 A;  3EGD B;  3KYI A;  2KQ9 A;  2QE9 A;  4AK9 A;  2OJQ A;  3JZ0 A;  1E85 A;  3EZH A;  1T01 A;  3RW0 A;  3EFO A;  4OIO F;  3C7J A;  2LP4 A;  2VCC A;  4WGZ A;  3NYL A;  1OXB A;  2HSB A;  3KH2 A;  1MNE A;  2OG2 A;  3S9O A;  1OXK A;  5KYU A;  1NFO A;  5L0G A;  2XL6 A;  3C62 A;  1VLS A;  3U3F A;  4BJ6 C;  2AWC A;  2HV7 A;  4E0H A;  5JUA A;  1H7I A;  1LS4 A;  3M4C A;  2YVK A;  5T3T A;  3V5Y A;  4BPM A;  2XLD A;  4OIN F;  2Q9C A;  2OOC A;  3MYF A;  4PJL A;  1JPJ A;  4CDV A;  3DM9 B;  3S27 A;  3CZ6 A;  3GEI A;  4JKV A;  4BJT A;  3NMJ A;  4CDA A;  4QI2 A;  4Z9J A;  1ZU5 A;  3F47 A;  1DOV A;  2QUP A;  1CPR A;  2V26 A;  5AGF A;  3U2M A;  2FGY A;  1E83 A;  2EIN C;  2VCB A;  1VYK A;  5B1A C;  3UMH A;  2NSF A;  4AL1 A;  1TQG A;  4EKW A;  3IQC A;  5CIV A;  3EH1 A;  3NG1 A;  3JYY A;  2NG1 A;  2H7O A;  2XL8 A;  1PD1 A;  2DYS C;  2J46 A;  3FXH A;  3SZR A;  5EGY A;  4RD9 A;  1VTM P;  3CEX A;  1NBB A;  3H2U A;  4RDA A;  3N2Z B;  3WOD F;  3X1O A;  3ZVR A;  1T5O A;  3ATP A;  2XLH A;  3O39 A;  5B3I A;  4PFO A;  3WHN A;  2A1D D;  4J32 B;  4ONS A;  4J7T A;  3L34 A;  1G5Z A;  2R7S A;  5E33 A;  5A6B A;  1T6I A;  1RJ9 A;  4O6N A;  3NMI A;  3IHU A;  5B1B C;  3AJM A;  4CS8 C;  3IQT A;  1L3P A;  3BRJ A;  2AWY A;  2YL1 A;  1NZE A;  2HMZ A;  3W2V A;  3B29 A;  3DI5 A;  2J8W A;  3LLK A;  2Q9A A;  1ZHW A;  1JR8 A;  4ULW A;  4E7Z A;  3AQC A;  4NTF A;  5COM A;  3SXK A;  4N4W A;  5JT4 A;  3UMI A;  2KSF A;  1CGM E;  3V5X A;  2LCH A;  2LD6 A;  1NU9 C;  4G0H A;  4LDQ A;  4PAC A;  4XLN F;  1T9K A;  2AU5 A;  2C04 A;  2HUJ A;  2JX0 A;  1SYQ A;  2VB6 A;  1G4U S;  3DZA A;  3EPV A;  5JLI A;  5HSW A;  1BR1 A;  1SMY F;  1OW6 A;  2XS8 A;  3K1H A;  1E84 A;  1C02 A;  3IQ5 A;  4G7H F;  1ZVZ A;  1QPU A;  2J9W A;  4QI0 A;  4YT5 A;  4DJ9 A;  3EGX B;  3POV A;  1G4W R;  1RKE B;  4HEA J;  4I44 A;  2YL3 A;  4YN0 B;  5L0I A;  3LES A;  1TWC A;  3U0C A;  3I5P A;  4D4X A;  2R02 A;  1JRA A;  1JAF A;  2WB7 A;  2J45 A;  1LI7 A;  5D91 A;  3S90 A;  3K66 A;  1V4A A;  2FFH A;  4JJF A;  5AC5 A;  4Q5S F;  3QTH A;  1TR2 A;  1Z63 A;  4R32 A;  4XEV A;  1FMV A;  3DAG A;  4KNW A;  4MTF A;  1VK5 A;  2Y3B A;  3V7O A;  1M6T A;  2XLW A;  4BEM J;  1WAS A;  5CI8 A;  5KYW B;  2GWW A;  4WGY A;  2J7P D;  4EHP A;  3ASN C;  3EZI A;  3IEE A;  2BL2 A;  4IAO A;  3QW0 A;  3X2Q C;  4E18 A;  3Q6M A;  4XEK A;  3EQL F;  1D1A A;  4JZA A;  3B9Q A;  4LLC A;  4KBL A;  1ST6 A;  3E9V A;  4XPW A;  5AC4 A;  3JRT A;  2CNW A;  4EBK A;  3QZC A;  5A69 A;  3VRC A;  2QLA A;  3U8V A;  2WVQ A;  1O87 A;  2R7R A;  1BZ4 A;  4J7Y A;  4DOZ A;  2Y3G A;  1OCZ C;  2IYL D;  3GM1 A;  5L0F A;  2R7O A;  1H9T A;  4JEB A;  1BR4 A;  1HMO A;  2KYH A;  2NUP B;  4AX2 A;  4MW8 A;  5DQT A;  1Q0K A;  2CW0 F;  4CBE A;  1JPN A;  4DRI B;  5A6B D;  3FAP B;  4U9E A;  3CAX A;  2HV6 A;  1LS1 A;  2NUT B;  3EG9 B;  3FOO A;  3SYN A;  3TOM A;  4YK5 A;  4P9T A;  3ZG1 A;  1ORY A;  2CCY A;  1IW7 F;  1H9G A;  1L7C A;  2WL8 A;  2I15 A;  4E17 A;  1M2V B;  5KYX B;  3R7C A;  1KNY A;  2CYD A;  3PCV A;  2HJM A;  4DXW A;  1TWG A;  2HZ8 A; 
#chains in the Genus database with same CATH homology
 1YDI A;  3H2U A;  4E18 A;  3ZDL A;  5L0C A;  1U89 A;  1SYQ A;  1ZW2 A;  2HSQ A;  1DOW A;  5L0G A;  3H2V A;  4ONS A;  1ST6 A;  5FZT A;  1XWJ A;  1ZVZ A;  2LQG A;  4DJ9 A;  2IBF A;  1RKE B;  2L7A A;  5L0F A;  5L0I A;  1QKR A;  3TJ6 A;  4PR9 A;  1RKC A;  4IGG A;  3S90 A;  2B0H A;  3T6G B;  1ZW3 A;  1DOV A;  1TR2 A;  1H6G A;  1U6H A;  2X0C A;  3RF3 A;  4P9T A;  5L0D A;  2GDC A;  1L7C A;  1T01 A;  3MYI A;  2GWW A;  3TJ5 A;  4E17 A;  5L0H A;  4EHP A;  5L0J A;  3VF0 A;  4W8P A;  4K1O A;  1RKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...