1ZW2A

Vinculin head (0-258) in complex with the talin rod residues 2345-2369
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
251
structure length
251
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Vinculin
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
total genus 105
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw2A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw2A01
1YDIA 2GDCA 3H2VA 2HSQA 4P9TA 3RF3A 5FZTA 4W8PA 1DOVA 4E18A 4PR9A 2B0HA 4E17A 1RKEB 3VF0A 4ONSA 2IBFA 1XWJA 2X0CA 3MYIA 3ZDLA 5L0HA 1RKEA 5L0JA 1TR2A 1ZVZA 3S90A 1H6GA 1ZW3A 1DOWA 3TJ6A 5L0DA 1ZW2A 1T01A 1SYQA 3T6GB 5L0IA 5L0FA 4IGGA 1U6HA 2LQGA 5L0CA 1U89A 1QKRA 4K1OA 3H2UA 1L7CA 1ST6A 4EHPA 3TJ5A 2GWWA 5L0GA 4DJ9A 1RKCA 2L7AA
chains in the Genus database with same CATH superfamily
1YDIA 2HSQA 2OEXA 2D4UA 3CEXA 4J32B 4J30B 2G3KA 1LS1A 2KK1A 1G5ZA 3DE8A 1SF8A 4YWQA 3FDQA 4GYTA 4AL1A 4OD5A 1O87A 5DQTA 1LPEA 3AOUA 1OQCA 2F22A 1YA9A 5BQGA 4KC9A 1NU7D 4XLPF 3S0XA 3MBGA 1DOWA 4CS9A 4U5HA 1HMDA 3QW0A 3ZSUA 1MMNA 3AG2C 2R05A 4MTOA 4NTAA 1OCCC 2XM4A 3GEEA 3PCVA 1ZHTA 2L81A 1LIHA 3NRHA 1H7IA 2Q3TA 3O39A 4WABA 1XZPA 3GODA 3LLIA 4Z9IA 3CAXA 3V7OA 3ZTMA 4YT2A 3EGDA 2WZLA 2ICWG 4GQHA 1S05A 3KPHA 4EUKB 4CS8C 3SXKA 1R4TA 2HMZA 1LE2A 5B1BC 3ZIBA 3B9QA 1W2WA 2BC5A 2UUIA 3GORA 3FHDA 1BZ4A 1ZHZA 3M4BA 2MWQA 1JRAA 2QY9A 3G4XA 3ECSA 4YK5A 1ORYA 1SZIA 1TWCA 4YL1A 3DKAA 4C3DA 2VCAA 2P61A 2A1DD 3EGXA 3K1HA 1TWGA 5CIVA 2EIKC 3RQEA 2J0XA 1M2OA 2YZSA 2A6HF 1CGNA 5E3CA 1JAFA 3JYHA 1OXKA 3H65A 2ZXWC 3G50A 4JCHA 1H9GA 4MVMA 4ZLCA 2H7OA 3N24A 2QNLA 2CNWD 3A11A 4OIQF 1GS9A 3I5PA 4MNDA 1V55C 2EIMC 1HW1A 2PFDA 1YA7O 3BRJA 3JZ0A 3KH2A 4RDAA 1OW8A 5B3SC 2G3VA 3C18A 1YYXA 4P6IC 1RKCA 3O10A 3ASOC 3V5ZA 5CI9A 2LFFA 4LERA 4EWCA 3BEHA 1JMWA 1LI5A 4PJMA 2J9VA 3WG7C 4AE4A 1RKEB 3ASNC 1A7VA 2WVOA 4JTDB 3UGOA 2AP3A 2CYDA 4G78A 2YLDA 1CPRA 4OIRF 5BUOA 1HY5A 4LDQA 1E86A 3PHF2 1G4WR 2HKVA 4AK9A 3WODF 5D92A 5HV9A 4ULVA 1ZVZA 1WTYA 2RSEB 5FCLA 3M1CB 5L3QA 2P0NA 1Q0MA 4XQ1A 2P7VA 2YL3A 2XLVA 2JPUA 1GQAA 1NFNA 2KC3A 3EGDB 2HV7A 2LQGA 2EPKX 4C3EA 4CX9A 3B71A 4J7TA 3V5XA 4KNVA 3I5QA 2NUPB 4XPYA 4A2NB 4FWVA 5KYXA 5KYYB 5HSWA 3TOMA 3L8IA 4CSAC 1NSGB 2LD6A 3FAPB 1OR2A 2A0BA 1B68A 3KMIA 5F5FA 1Z7Qc 4W8KA 1JPNA 4MW3A 2C04A 5KYUA 2R7RA 4DRJB 1I4ZA 5BQIA 4JTAB 1VMAA 2LCHA 4O6NA 4U5CE 3EGXB 3MYIA 2Q00A 1CPQA 5EHHA 2A68F 5E2QA 2KNHA 3DJUB 5GPGB 1E84A 3IQ5A 3B29A 2BE5F 3GM2A 4I1OB 4Q5SF 1ZU5A 4JTCB 4OD4A 5KYNA 4OIPF 3QW1A 4HEAJ 3RQFA 2UUHA 1WGWA 2AVKA 3NMJA 1IZMA 5L0FA 1PD0A 2EILC 4CS9C 4MTGA 3Q6MA 2PX0A 3L8JA 1CGOA 3RQGA 1EA8A 1K05A 4YL3A 1ST6A 4EHPA 2IXOA 4MVOA 3U9MA 5L3VA 1GM5A 3HTKC 5CI8A 3JRTA 3R7CA 3JCUQ 1YVIA 3KL4A 4PFPA 2JD3A 4GEHA 2HUJA 5JT4A 1E85A 1WATA 4AE4B 3ABLC 3GWNA 1DOVA 2J7PD 3AQBA 3LNRA 2ASRA 2BL2A 2FAPB 3AG4C 4I1MA 3U0CA 1VB5A 2Q9BA 5JLIA 3F46A 2X0CA 3IQ6A 2OJED 2YLGA 3EHNA 4BJ5A 5L0JA 1O3UA 2WVQA 3LEOA 2OCCC 3EG9A 4U5EE 4FX5A 4A4AA 1SMYF 4IARA 3KYJA 3JYYA 1AEPA 1R5ID 4MVRA 3T9OA 1MMAA 4MW8A 1Y6DA 1PD1A 4CBEA 3CQZA 1WASA 3SYNA 2PBEA 1TKNA 4HFFB 3NDBB 1NZEA 2MHRA 2QE9A 3LLKA 1YARO 4KBLA 3T6BA 2XL6A 1I4YA 3ABMC 3TK0A 4FESA 2Q4FA 3C63A 4NCQA 3C8GA 3ZWIA 1LS4A 2AU5A 2GWWA 3K33A 4DRHB 1M2VA 1T6UA 2L7AA 3C7JA 256BA 4LLEA 3US6A 5KYUB 4JEAA 1NU9C 5B3IA 2ZXRA 3X2QC 4G7ZF 1MMDA 3SP1A 1ZU4A 2R7QA 3FAJA 4IB4A 3DE9A 1XWJA 3A9CA 2OJQA 3QMKA 4L6RA 3S28A 1QQ3A 1RKEA 5JP7A 1EQ1A 1QSPA 3S9OA 2EPOA 4NY3A 2LSEA 4K0DA 5T3WA 1ZW2A 5COGA 1Q0DA 3O6XA 2Y3BA 3EZHA 3GM1A 3SNHA 1OKKA 1D1BA 2HS5A 2O9XA 4JJGA 4P9FA 1MMGA 2A6EF 2ZXOA 2NG1A 3FMSA 2XLDA 3NKEA 3AGTA 1PV3A 1V4AA 4WGYA 2L6FA 4C3BA 1E2XA 3ZC4A 2PF4E 2NUPA 4BJTA 1A7EA 3AG3C 1FR0A 1Z63A 5AC5A 3GEIA 3NKDA 4QI0A 2B0HA 3RYLA 1A0BA 3VF0A 2ETSA 4U9EA 2W4BA 3ZDLA 2R03A 3EG9B 3X1OA 2J9UA 1A7DA 1ZW3A 4PJNA 3SXYA 2IYLD 5F28E 4CJOA 4EBBA 1KTMA 5JUAA 3SXZA 1T01A 3U3FA 5A6AA 1SYQA 5D91A 3JRMO 2KJGA 1RCPA 5JRAA 4QDLA 2EPMX 1C17M 1RJ9B 2X51A 1M56C 4JCZA 4U5GA 2XL8A 1OCRC 3FOOA 4MVSA 5L0CA 4Q4ZF 3C8GB 2KQ9A 3CZ6A 1M2VB 2GA0A 4DJ9A 3M4CA 1BBHA 3LNMB 2YQYA 5COMA 4PJJA 1T9KA 2XLMA 1WWPA 2R25A 3OWTA 4E18A 4E7SA 5DS5A 4NQFA 3RVYA 3U9JA 1LKXA 4E17A 4O79A 2V26A 4IWBA 2D5RB 3E9VA 3JTLO 1FFTC 2R7OA 3SEOA 3UMKA 4AX2A 5T3TA 2Z15A 2OG2A 3ZTZA 4JVSA 2DI3A 3UR3C 1K40A 1RMVA 2XRHA 1TQGA 1C03A 4CDAA 4YJWA 4BJ5C 4R32A 4JW1A 1HW2A 4K7BA 3VM6A 4E0HA 1Q0GA 3T4RA 2OEVA 3UNGC 4JC7A 2W45A 1I5NA 3F47A 2FGYA 4BPMA 3K1IA 2Q9CA 4CIPA 2XXAB 3DM5A 3NYJA 2KGOA 3ZQYA 2IXNA 2HJ3A 3FVYA 4BEJA 4PR9A 3TD7A 5DLJA 5A6BA 2DGJA 4ONSA 1T5OA 2FFHA 1LE4A 2W9YA 2WZFA 2YL0A 4CS7A 1VLTA 1OCZC 3W4YA 4DOZA 4F4BA 5L0HA 1APCA 2H7VC 2R02A 3S90A 3TJ6A 1AVOB 4IAQA 2J8WA 1NG1A 2JX0A 1TFOB 2GFHA 5KYWA 1YZAA 3NG1A 2R7UA 4IGGA 3J06A 3LJBA 4ANJA 2NSGA 2YWAA 3EPVA 1KNYA 3POVA 4G0HA 5E33A 3C8GD 5AC4A 2A69F 1ORSC 3LUTB 5JS5A 2B0JA 1QZXA 4JEBA 2VCBA 2KW3C 1FNTc 4ZLDA 4U5BE 4XPXA 4NC3A 3KKBA 5F5HA 3U3BA 2QTVA 2CCYA 2ZXPA 1FTSA 3W2VA 2J46A 3HNLA 5E3AA 3CSKA 2R9RB 2Y3HA 4G7HF 2QLAA 1NLXA 4MS2A 2XSEA 3RKOF 4BJ1A 3ZG1A 4Z9HA 3AGUA 2WB7A 1J8YF 3GANA 4KI2A 1VLSA 3QZCA 4HFKB 3UMIA 1QPUA 2AWYA 4H4KC 3HKKA 4J7YA 1Z6AA 3LESA 2DYRC 1BR1A 4Z9JA 1T6IA 1ZHYA 1Z3IX 2LFDA 1U6HA 1ZHXA 3U5SA 5DS4A 3O55A 4FAPB 1U89A 3OEOA 1RJ9A 3ZVRA 2YEVA 4X0RA 3TJ5A 4N06A 2EINC 2KYHA 2I8BA 2J9BA 2OQMA 2XLEA 3WHNA 1OW6A 3W8IA 5KYXB 3RF3A 2LIGA 3MFNA 2XS8A 1G8XA 2OOCA 1J8MF 4W8PA 1JR8A 3C8ZA 2XLWA 3IQTA 4DBQA 1Z23A 1TWAA 2Q9AA 1BR4A 1HE1A 1Q0KA 2WVNA 3AQCA 3MLGA 3Q7LA 3VRCA 2LK4A 5A69A 1YAUO 4IAOA 1VYIA 4I3MA 2YKZA 2L6HA 4BJ6A 1FFHA 2VCCA 2P6VA 2LP4A 2DYSC 2EIJC 4H54A 1T6QA 1D0ZA 1VK5A 3K6BA 3NMIA 1S7ZA 1ZZPA 5T1DB 2NUTA 2NPUA 4PFOA 4RBNA 1D1CA 4DXWA 5DQZA 2YL1A 4WJ0A 1QLEC 2PP4A 3TULA 2HV6A 3HNJA 1D1AA 4QI2A 4WGZA 2V3CC 1HMOA 1A41A 3GM3A 4XEFA 2IM8A 4PJLA 1NFOA 2XLHA 1FMVA 3H2VA 5DVWA 3U2LA 1OW7A 1LVKA 5K0IA 2XXAA 3EH2A 1M57C 2IOQA 2J7PA 2XL4A 3K1IC 3NYMA 3N0TA 2YRFA 1OCOC 5B1AC 4MVUA 3RFYA 4LACB 2CDQA 4D4XA 5BQHA 4EKWA 2VC9A 3L34A 3W8HA 4O6MA 2KSFA 3UGPA 2MYSA 3QTHA 2L9JA 4MVZA 1IW7F 1LM3B 2H8AA 3VAYA 2EPNA 1C02A 1MNDA 4JKVA 1OR3A 3RH3A 4UDVA 1TWHA 4IRUA 3JT1A 4JRZA 1HE9A 2VH3A 2C03A 4RD9A 2TMVP 3EHMA 1QVXA 2QUPA 1F1MA 1UFBA 1ZYRF 2HSBA 3B0VC 2YHSA 4YN0B 5JSLA 4DVYP 4LDKA 3GEHA 3FOPA 2A0UA 3IPMO 3DXJF 4MVQA 3B0PA 2EPLX 3G4ZA 5A6BD 3MYFA 3VYWA 5JVEA 2HZ8A 4BEMJ 1JPJA 3EH1A 2I15A 3K66A 4CDYA 4NTBA 1ORJA 1SR2A 4XTKA 3AG1C 1D0YA 2NUTB 1H6GA 2RD9A 2CGEA 1CGME 2OU6A 4AL0A 3LS1A 3JSZA 3HNIA 4U5FE 4PK4A 3RW0A 4BG0A 3TQOA 2WZGA 2DB4A 3OA1A 3S84A 4EIYA 4E0IA 2XS1A 3DWWA 5KYWB 3W2WA 2P1AA 5EGYA 1V54C 2NSFA 1D0XA 2Q7RA 3DD7A 5L0GA 1H9TA 3TOLA 4JURI 2GDCA 1PCXA 1VTMP 3PMRA 4O7GA 3WAQA 4E7ZA 1ZHWA 3RIPA 4C7OA 4G7OF 2OKUA 2HJMA 3EJNA 3LS0A 5DS6A 4OIOF 2IBFA 3DZAA 3Q6NA 3EZIA 3NMKA 4IJJA 4DRIB 1Z5ZA 2R7XA 3DAFA 3T6JA 3HJCA 4XWJA 1YYJA 2AWCA 2G62A 4CJGA 4YT8A 5L0DA 4D4NA 1K04A 4CDVA 1YJGA 5L0IA 3ITFA 2M64A 2H7BA 2VB6A 4M63A 4CS8A 4EBJA 3EFOA 4BJ6C 4U9DA 1YZCA 1U0BB 2Y3GA 3DMDA 4YT4A 4MTFA 1QKRA 2CNWA 3SZRA 3H2UA 1L7CA 1VOMA 3I4UA 4JE9A 4U5DE 1M6TA 3MX3A 4LDRA 1L3PA 4ER9A 1N1CA 2PNOA 2J45A 3GWLA 4HE8D 4XEVA 5AGFA 2R7VA 3HNKA 3ZQVA 1LI7A 3K7DA 2R7WA 4NTFA 1V74B 1AUEA 4LLCA 3U8PA 3EQLF 3QVZA 2GAQA 4XEKA 5IY5C 2J9WA 1RXQA 4ULWA 1JOGA 1EKYA 3DM9B 4DVZA 2L6GA 3ABKC 1FMWA 4EBKA 2W4MA 1FAPB 2WL8A 3E70C 1G4US 4Q7CA 3C62A 3V5YA 3Q7GA 4N4WA 4JIOA 1MQVA 3IHUA 3R2PA 1OKKD 3PDMP 2R7SA 2PX3A 3LEVA 4KNWA 3NYLA 4DBRA 4PACA 2CW0F 2Y69C 4XLNF 5KYYA 3ATPA 4MQ9F 2HMQA 3JSEO 1BR2A 5A6JA 1VYKA 3UMHA 3S29A 2Y3DA 3LAYA 1YLMA 1NBBA 3QVYA 4N6CA 5COFA 3DI5A 1Y4CA 2VASA 3L0IA 4XPWA 1BDJB 4P9TA 4C7OB 3N2ZB 2Y39A 5FZTA 1E83A 3AJMA 4N6HA 4I44A 1WOLA 1O5HA 3DAGA 2XM0A 3IQCA 2HFIA 3M79A 2ZD9A 2E87A 3RVZA 3SXMA 2J0WA 5TJ5E 2M4EA 4B6IA 1Q0FA 1UG7A 4YL0A 4CIHA 3U8VA 3B0UX 1TR2A 2IXMA 1MNEA 2YVKA 3U2MA 4JZAA 4O6YA 1EI7A 5EK0A 5A6KA 1XZQA 3EFOB 3DJNB 4JJFA 3T6GB 4CSAA 2R7TA 2IXPA 3KYIA 2YL7A 2YLIA 1WN0A 2XLOA 1GGQA 3HLZA 3IEEA 2ZPAA 4K1OA 1KU2A 3FXHA 3S27A 1TFKB 3M15A 4YT5A 1OXBA 3L1MA 4OINF
chains in the Genus database with same CATH topology
1YDIA 2GDCA 3H2VA 2HSQA 4P9TA 3RF3A 5FZTA 4W8PA 1DOVA 4E18A 4PR9A 2B0HA 4E17A 1RKEB 3VF0A 4ONSA 2IBFA 1XWJA 2X0CA 3MYIA 3ZDLA 5L0HA 1RKEA 5L0JA 1TR2A 1ZVZA 3S90A 1H6GA 1ZW3A 1DOWA 3TJ6A 5L0DA 1ZW2A 1T01A 1SYQA 3T6GB 5L0IA 5L0FA 4IGGA 1U6HA 2LQGA 5L0CA 1U89A 1QKRA 4K1OA 3H2UA 1L7CA 1ST6A 4EHPA 3TJ5A 2GWWA 5L0GA 4DJ9A 1RKCA 2L7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDI A;  2GDC A;  3H2V A;  2HSQ A;  4P9T A;  3RF3 A;  5FZT A;  4W8P A;  1DOV A;  4E18 A;  4PR9 A;  2B0H A;  4E17 A;  1RKE B;  3VF0 A;  4ONS A;  2IBF A;  1XWJ A;  2X0C A;  3MYI A;  3ZDL A;  5L0H A;  1RKE A;  5L0J A;  1TR2 A;  1ZVZ A;  3S90 A;  1H6G A;  1ZW3 A;  1DOW A;  3TJ6 A;  5L0D A;  1ZW2 A;  1T01 A;  1SYQ A;  3T6G B;  5L0I A;  5L0F A;  4IGG A;  1U6H A;  2LQG A;  5L0C A;  1U89 A;  1QKR A;  4K1O A;  3H2U A;  1L7C A;  1ST6 A;  4EHP A;  3TJ5 A;  2GWW A;  5L0G A;  4DJ9 A;  1RKC A;  2L7A A; 
#chains in the Genus database with same CATH topology
 1YDI A;  2HSQ A;  2OEX A;  2D4U A;  3CEX A;  4J32 B;  4J30 B;  2G3K A;  1LS1 A;  2KK1 A;  1G5Z A;  3DE8 A;  1SF8 A;  4YWQ A;  3FDQ A;  4GYT A;  4AL1 A;  4OD5 A;  1O87 A;  5DQT A;  1LPE A;  3AOU A;  1OQC A;  2F22 A;  1YA9 A;  5BQG A;  4KC9 A;  1NU7 D;  4XLP F;  3S0X A;  3MBG A;  1DOW A;  4CS9 A;  4U5H A;  1HMD A;  3QW0 A;  3ZSU A;  1MMN A;  3AG2 C;  2R05 A;  4MTO A;  4NTA A;  1OCC C;  2XM4 A;  3GEE A;  3PCV A;  1ZHT A;  2L81 A;  1LIH A;  3NRH A;  1H7I A;  2Q3T A;  3O39 A;  4WAB A;  1XZP A;  3GOD A;  3LLI A;  4Z9I A;  3CAX A;  3V7O A;  3ZTM A;  4YT2 A;  3EGD A;  2WZL A;  2ICW G;  4GQH A;  1S05 A;  3KPH A;  4EUK B;  4CS8 C;  3SXK A;  1R4T A;  2HMZ A;  1LE2 A;  5B1B C;  3ZIB A;  3B9Q A;  1W2W A;  2BC5 A;  2UUI A;  3GOR A;  3FHD A;  1BZ4 A;  1ZHZ A;  3M4B A;  2MWQ A;  1JRA A;  2QY9 A;  3G4X A;  3ECS A;  4YK5 A;  1ORY A;  1SZI A;  1TWC A;  4YL1 A;  3DKA A;  4C3D A;  2VCA A;  2P61 A;  2A1D D;  3EGX A;  3K1H A;  1TWG A;  5CIV A;  2EIK C;  3RQE A;  2J0X A;  1M2O A;  2YZS A;  2A6H F;  1CGN A;  5E3C A;  1JAF A;  3JYH A;  1OXK A;  3H65 A;  2ZXW C;  3G50 A;  4JCH A;  1H9G A;  4MVM A;  4ZLC A;  2H7O A;  3N24 A;  2QNL A;  2CNW D;  3A11 A;  4OIQ F;  1GS9 A;  3I5P A;  4MND A;  1V55 C;  2EIM C;  1HW1 A;  2PFD A;  1YA7 O;  3BRJ A;  3JZ0 A;  3KH2 A;  4RDA A;  1OW8 A;  5B3S C;  2G3V A;  3C18 A;  1YYX A;  4P6I C;  1RKC A;  3O10 A;  3ASO C;  3V5Z A;  5CI9 A;  2LFF A;  4LER A;  4EWC A;  3BEH A;  1JMW A;  1LI5 A;  4PJM A;  2J9V A;  3WG7 C;  4AE4 A;  1RKE B;  3ASN C;  1A7V A;  2WVO A;  4JTD B;  3UGO A;  2AP3 A;  2CYD A;  4G78 A;  2YLD A;  1CPR A;  4OIR F;  5BUO A;  1HY5 A;  4LDQ A;  1E86 A;  3PHF 2;  1G4W R;  2HKV A;  4AK9 A;  3WOD F;  5D92 A;  5HV9 A;  4ULV A;  1ZVZ A;  1WTY A;  2RSE B;  5FCL A;  3M1C B;  5L3Q A;  2P0N A;  1Q0M A;  4XQ1 A;  2P7V A;  2YL3 A;  2XLV A;  2JPU A;  1GQA A;  1NFN A;  2KC3 A;  3EGD B;  2HV7 A;  2LQG A;  2EPK X;  4C3E A;  4CX9 A;  3B71 A;  4J7T A;  3V5X A;  4KNV A;  3I5Q A;  2NUP B;  4XPY A;  4A2N B;  4FWV A;  5KYX A;  5KYY B;  5HSW A;  3TOM A;  3L8I A;  4CSA C;  1NSG B;  2LD6 A;  3FAP B;  1OR2 A;  2A0B A;  1B68 A;  3KMI A;  5F5F A;  1Z7Q c;  4W8K A;  1JPN A;  4MW3 A;  2C04 A;  5KYU A;  2R7R A;  4DRJ B;  1I4Z A;  5BQI A;  4JTA B;  1VMA A;  2LCH A;  4O6N A;  4U5C E;  3EGX B;  3MYI A;  2Q00 A;  1CPQ A;  5EHH A;  2A68 F;  5E2Q A;  2KNH A;  3DJU B;  5GPG B;  1E84 A;  3IQ5 A;  3B29 A;  2BE5 F;  3GM2 A;  4I1O B;  4Q5S F;  1ZU5 A;  4JTC B;  4OD4 A;  5KYN A;  4OIP F;  3QW1 A;  4HEA J;  3RQF A;  2UUH A;  1WGW A;  2AVK A;  3NMJ A;  1IZM A;  5L0F A;  1PD0 A;  2EIL C;  4CS9 C;  4MTG A;  3Q6M A;  2PX0 A;  3L8J A;  1CGO A;  3RQG A;  1EA8 A;  1K05 A;  4YL3 A;  1ST6 A;  4EHP A;  2IXO A;  4MVO A;  3U9M A;  5L3V A;  1GM5 A;  3HTK C;  5CI8 A;  3JRT A;  3R7C A;  3JCU Q;  1YVI A;  3KL4 A;  4PFP A;  2JD3 A;  4GEH A;  2HUJ A;  5JT4 A;  1E85 A;  1WAT A;  4AE4 B;  3ABL C;  3GWN A;  1DOV A;  2J7P D;  3AQB A;  3LNR A;  2ASR A;  2BL2 A;  2FAP B;  3AG4 C;  4I1M A;  3U0C A;  1VB5 A;  2Q9B A;  5JLI A;  3F46 A;  2X0C A;  3IQ6 A;  2OJE D;  2YLG A;  3EHN A;  4BJ5 A;  5L0J A;  1O3U A;  2WVQ A;  3LEO A;  2OCC C;  3EG9 A;  4U5E E;  4FX5 A;  4A4A A;  1SMY F;  4IAR A;  3KYJ A;  3JYY A;  1AEP A;  1R5I D;  4MVR A;  3T9O A;  1MMA A;  4MW8 A;  1Y6D A;  1PD1 A;  4CBE A;  3CQZ A;  1WAS A;  3SYN A;  2PBE A;  1TKN A;  4HFF B;  3NDB B;  1NZE A;  2MHR A;  2QE9 A;  3LLK A;  1YAR O;  4KBL A;  3T6B A;  2XL6 A;  1I4Y A;  3ABM C;  3TK0 A;  4FES A;  2Q4F A;  3C63 A;  4NCQ A;  3C8G A;  3ZWI A;  1LS4 A;  2AU5 A;  2GWW A;  3K33 A;  4DRH B;  1M2V A;  1T6U A;  2L7A A;  3C7J A;  256B A;  4LLE A;  3US6 A;  5KYU B;  4JEA A;  1NU9 C;  5B3I A;  2ZXR A;  3X2Q C;  4G7Z F;  1MMD A;  3SP1 A;  1ZU4 A;  2R7Q A;  3FAJ A;  4IB4 A;  3DE9 A;  1XWJ A;  3A9C A;  2OJQ A;  3QMK A;  4L6R A;  3S28 A;  1QQ3 A;  1RKE A;  5JP7 A;  1EQ1 A;  1QSP A;  3S9O A;  2EPO A;  4NY3 A;  2LSE A;  4K0D A;  5T3W A;  1ZW2 A;  5COG A;  1Q0D A;  3O6X A;  2Y3B A;  3EZH A;  3GM1 A;  3SNH A;  1OKK A;  1D1B A;  2HS5 A;  2O9X A;  4JJG A;  4P9F A;  1MMG A;  2A6E F;  2ZXO A;  2NG1 A;  3FMS A;  2XLD A;  3NKE A;  3AGT A;  1PV3 A;  1V4A A;  4WGY A;  2L6F A;  4C3B A;  1E2X A;  3ZC4 A;  2PF4 E;  2NUP A;  4BJT A;  1A7E A;  3AG3 C;  1FR0 A;  1Z63 A;  5AC5 A;  3GEI A;  3NKD A;  4QI0 A;  2B0H A;  3RYL A;  1A0B A;  3VF0 A;  2ETS A;  4U9E A;  2W4B A;  3ZDL A;  2R03 A;  3EG9 B;  3X1O A;  2J9U A;  1A7D A;  1ZW3 A;  4PJN A;  3SXY A;  2IYL D;  5F28 E;  4CJO A;  4EBB A;  1KTM A;  5JUA A;  3SXZ A;  1T01 A;  3U3F A;  5A6A A;  1SYQ A;  5D91 A;  3JRM O;  2KJG A;  1RCP A;  5JRA A;  4QDL A;  2EPM X;  1C17 M;  1RJ9 B;  2X51 A;  1M56 C;  4JCZ A;  4U5G A;  2XL8 A;  1OCR C;  3FOO A;  4MVS A;  5L0C A;  4Q4Z F;  3C8G B;  2KQ9 A;  3CZ6 A;  1M2V B;  2GA0 A;  4DJ9 A;  3M4C A;  1BBH A;  3LNM B;  2YQY A;  5COM A;  4PJJ A;  1T9K A;  2XLM A;  1WWP A;  2R25 A;  3OWT A;  4E18 A;  4E7S A;  5DS5 A;  4NQF A;  3RVY A;  3U9J A;  1LKX A;  4E17 A;  4O79 A;  2V26 A;  4IWB A;  2D5R B;  3E9V A;  3JTL O;  1FFT C;  2R7O A;  3SEO A;  3UMK A;  4AX2 A;  5T3T A;  2Z15 A;  2OG2 A;  3ZTZ A;  4JVS A;  2DI3 A;  3UR3 C;  1K40 A;  1RMV A;  2XRH A;  1TQG A;  1C03 A;  4CDA A;  4YJW A;  4BJ5 C;  4R32 A;  4JW1 A;  1HW2 A;  4K7B A;  3VM6 A;  4E0H A;  1Q0G A;  3T4R A;  2OEV A;  3UNG C;  4JC7 A;  2W45 A;  1I5N A;  3F47 A;  2FGY A;  4BPM A;  3K1I A;  2Q9C A;  4CIP A;  2XXA B;  3DM5 A;  3NYJ A;  2KGO A;  3ZQY A;  2IXN A;  2HJ3 A;  3FVY A;  4BEJ A;  4PR9 A;  3TD7 A;  5DLJ A;  5A6B A;  2DGJ A;  4ONS A;  1T5O A;  2FFH A;  1LE4 A;  2W9Y A;  2WZF A;  2YL0 A;  4CS7 A;  1VLT A;  1OCZ C;  3W4Y A;  4DOZ A;  4F4B A;  5L0H A;  1APC A;  2H7V C;  2R02 A;  3S90 A;  3TJ6 A;  1AVO B;  4IAQ A;  2J8W A;  1NG1 A;  2JX0 A;  1TFO B;  2GFH A;  5KYW A;  1YZA A;  3NG1 A;  2R7U A;  4IGG A;  3J06 A;  3LJB A;  4ANJ A;  2NSG A;  2YWA A;  3EPV A;  1KNY A;  3POV A;  4G0H A;  5E33 A;  3C8G D;  5AC4 A;  2A69 F;  1ORS C;  3LUT B;  5JS5 A;  2B0J A;  1QZX A;  4JEB A;  2VCB A;  2KW3 C;  1FNT c;  4ZLD A;  4U5B E;  4XPX A;  4NC3 A;  3KKB A;  5F5H A;  3U3B A;  2QTV A;  2CCY A;  2ZXP A;  1FTS A;  3W2V A;  2J46 A;  3HNL A;  5E3A A;  3CSK A;  2R9R B;  2Y3H A;  4G7H F;  2QLA A;  1NLX A;  4MS2 A;  2XSE A;  3RKO F;  4BJ1 A;  3ZG1 A;  4Z9H A;  3AGU A;  2WB7 A;  1J8Y F;  3GAN A;  4KI2 A;  1VLS A;  3QZC A;  4HFK B;  3UMI A;  1QPU A;  2AWY A;  4H4K C;  3HKK A;  4J7Y A;  1Z6A A;  3LES A;  2DYR C;  1BR1 A;  4Z9J A;  1T6I A;  1ZHY A;  1Z3I X;  2LFD A;  1U6H A;  1ZHX A;  3U5S A;  5DS4 A;  3O55 A;  4FAP B;  1U89 A;  3OEO A;  1RJ9 A;  3ZVR A;  2YEV A;  4X0R A;  3TJ5 A;  4N06 A;  2EIN C;  2KYH A;  2I8B A;  2J9B A;  2OQM A;  2XLE A;  3WHN A;  1OW6 A;  3W8I A;  5KYX B;  3RF3 A;  2LIG A;  3MFN A;  2XS8 A;  1G8X A;  2OOC A;  1J8M F;  4W8P A;  1JR8 A;  3C8Z A;  2XLW A;  3IQT A;  4DBQ A;  1Z23 A;  1TWA A;  2Q9A A;  1BR4 A;  1HE1 A;  1Q0K A;  2WVN A;  3AQC A;  3MLG A;  3Q7L A;  3VRC A;  2LK4 A;  5A69 A;  1YAU O;  4IAO A;  1VYI A;  4I3M A;  2YKZ A;  2L6H A;  4BJ6 A;  1FFH A;  2VCC A;  2P6V A;  2LP4 A;  2DYS C;  2EIJ C;  4H54 A;  1T6Q A;  1D0Z A;  1VK5 A;  3K6B A;  3NMI A;  1S7Z A;  1ZZP A;  5T1D B;  2NUT A;  2NPU A;  4PFO A;  4RBN A;  1D1C A;  4DXW A;  5DQZ A;  2YL1 A;  4WJ0 A;  1QLE C;  2PP4 A;  3TUL A;  2HV6 A;  3HNJ A;  1D1A A;  4QI2 A;  4WGZ A;  2V3C C;  1HMO A;  1A41 A;  3GM3 A;  4XEF A;  2IM8 A;  4PJL A;  1NFO A;  2XLH A;  1FMV A;  3H2V A;  5DVW A;  3U2L A;  1OW7 A;  1LVK A;  5K0I A;  2XXA A;  3EH2 A;  1M57 C;  2IOQ A;  2J7P A;  2XL4 A;  3K1I C;  3NYM A;  3N0T A;  2YRF A;  1OCO C;  5B1A C;  4MVU A;  3RFY A;  4LAC B;  2CDQ A;  4D4X A;  5BQH A;  4EKW A;  2VC9 A;  3L34 A;  3W8H A;  4O6M A;  2KSF A;  3UGP A;  2MYS A;  3QTH A;  2L9J A;  4MVZ A;  1IW7 F;  1LM3 B;  2H8A A;  3VAY A;  2EPN A;  1C02 A;  1MND A;  4JKV A;  1OR3 A;  3RH3 A;  4UDV A;  1TWH A;  4IRU A;  3JT1 A;  4JRZ A;  1HE9 A;  2VH3 A;  2C03 A;  4RD9 A;  2TMV P;  3EHM A;  1QVX A;  2QUP A;  1F1M A;  1UFB A;  1ZYR F;  2HSB A;  3B0V C;  2YHS A;  4YN0 B;  5JSL A;  4DVY P;  4LDK A;  3GEH A;  3FOP A;  2A0U A;  3IPM O;  3DXJ F;  4MVQ A;  3B0P A;  2EPL X;  3G4Z A;  5A6B D;  3MYF A;  3VYW A;  5JVE A;  2HZ8 A;  4BEM J;  1JPJ A;  3EH1 A;  2I15 A;  3K66 A;  4CDY A;  4NTB A;  1ORJ A;  1SR2 A;  4XTK A;  3AG1 C;  1D0Y A;  2NUT B;  1H6G A;  2RD9 A;  2CGE A;  1CGM E;  2OU6 A;  4AL0 A;  3LS1 A;  3JSZ A;  3HNI A;  4U5F E;  4PK4 A;  3RW0 A;  4BG0 A;  3TQO A;  2WZG A;  2DB4 A;  3OA1 A;  3S84 A;  4EIY A;  4E0I A;  2XS1 A;  3DWW A;  5KYW B;  3W2W A;  2P1A A;  5EGY A;  1V54 C;  2NSF A;  1D0X A;  2Q7R A;  3DD7 A;  5L0G A;  1H9T A;  3TOL A;  4JUR I;  2GDC A;  1PCX A;  1VTM P;  3PMR A;  4O7G A;  3WAQ A;  4E7Z A;  1ZHW A;  3RIP A;  4C7O A;  4G7O F;  2OKU A;  2HJM A;  3EJN A;  3LS0 A;  5DS6 A;  4OIO F;  2IBF A;  3DZA A;  3Q6N A;  3EZI A;  3NMK A;  4IJJ A;  4DRI B;  1Z5Z A;  2R7X A;  3DAF A;  3T6J A;  3HJC A;  4XWJ A;  1YYJ A;  2AWC A;  2G62 A;  4CJG A;  4YT8 A;  5L0D A;  4D4N A;  1K04 A;  4CDV A;  1YJG A;  5L0I A;  3ITF A;  2M64 A;  2H7B A;  2VB6 A;  4M63 A;  4CS8 A;  4EBJ A;  3EFO A;  4BJ6 C;  4U9D A;  1YZC A;  1U0B B;  2Y3G A;  3DMD A;  4YT4 A;  4MTF A;  1QKR A;  2CNW A;  3SZR A;  3H2U A;  1L7C A;  1VOM A;  3I4U A;  4JE9 A;  4U5D E;  1M6T A;  3MX3 A;  4LDR A;  1L3P A;  4ER9 A;  1N1C A;  2PNO A;  2J45 A;  3GWL A;  4HE8 D;  4XEV A;  5AGF A;  2R7V A;  3HNK A;  3ZQV A;  1LI7 A;  3K7D A;  2R7W A;  4NTF A;  1V74 B;  1AUE A;  4LLC A;  3U8P A;  3EQL F;  3QVZ A;  2GAQ A;  4XEK A;  5IY5 C;  2J9W A;  1RXQ A;  4ULW A;  1JOG A;  1EKY A;  3DM9 B;  4DVZ A;  2L6G A;  3ABK C;  1FMW A;  4EBK A;  2W4M A;  1FAP B;  2WL8 A;  3E70 C;  1G4U S;  4Q7C A;  3C62 A;  3V5Y A;  3Q7G A;  4N4W A;  4JIO A;  1MQV A;  3IHU A;  3R2P A;  1OKK D;  3PDM P;  2R7S A;  2PX3 A;  3LEV A;  4KNW A;  3NYL A;  4DBR A;  4PAC A;  2CW0 F;  2Y69 C;  4XLN F;  5KYY A;  3ATP A;  4MQ9 F;  2HMQ A;  3JSE O;  1BR2 A;  5A6J A;  1VYK A;  3UMH A;  3S29 A;  2Y3D A;  3LAY A;  1YLM A;  1NBB A;  3QVY A;  4N6C A;  5COF A;  3DI5 A;  1Y4C A;  2VAS A;  3L0I A;  4XPW A;  1BDJ B;  4P9T A;  4C7O B;  3N2Z B;  2Y39 A;  5FZT A;  1E83 A;  3AJM A;  4N6H A;  4I44 A;  1WOL A;  1O5H A;  3DAG A;  2XM0 A;  3IQC A;  2HFI A;  3M79 A;  2ZD9 A;  2E87 A;  3RVZ A;  3SXM A;  2J0W A;  5TJ5 E;  2M4E A;  4B6I A;  1Q0F A;  1UG7 A;  4YL0 A;  4CIH A;  3U8V A;  3B0U X;  1TR2 A;  2IXM A;  1MNE A;  2YVK A;  3U2M A;  4JZA A;  4O6Y A;  1EI7 A;  5EK0 A;  5A6K A;  1XZQ A;  3EFO B;  3DJN B;  4JJF A;  3T6G B;  4CSA A;  2R7T A;  2IXP A;  3KYI A;  2YL7 A;  2YLI A;  1WN0 A;  2XLO A;  1GGQ A;  3HLZ A;  3IEE A;  2ZPA A;  4K1O A;  1KU2 A;  3FXH A;  3S27 A;  1TFK B;  3M15 A;  4YT5 A;  1OXB A;  3L1M A;  4OIN F; 
#chains in the Genus database with same CATH homology
 1YDI A;  2GDC A;  3H2V A;  2HSQ A;  4P9T A;  3RF3 A;  5FZT A;  4W8P A;  1DOV A;  4E18 A;  4PR9 A;  2B0H A;  4E17 A;  1RKE B;  3VF0 A;  4ONS A;  2IBF A;  1XWJ A;  2X0C A;  3MYI A;  3ZDL A;  5L0H A;  1RKE A;  5L0J A;  1TR2 A;  1ZVZ A;  3S90 A;  1H6G A;  1ZW3 A;  1DOW A;  3TJ6 A;  5L0D A;  1ZW2 A;  1T01 A;  1SYQ A;  3T6G B;  5L0I A;  5L0F A;  4IGG A;  1U6H A;  2LQG A;  5L0C A;  1U89 A;  1QKR A;  4K1O A;  3H2U A;  1L7C A;  1ST6 A;  4EHP A;  3TJ5 A;  2GWW A;  5L0G A;  4DJ9 A;  1RKC A;  2L7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...