1ZW2A

Vinculin head (0-258) in complex with the talin rod residues 2345-2369
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
251
structure length
251
Chain Sequence
b'MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 105
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw2A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw2A01
3VF0A 4E18A 1L7CA 1YDIA 4ONSA 3H2VA 4EHPA 1H6GA 1ZW2A 1U6HA 1DOWA 5L0FA 2GWWA 2L7AA 1QKRA 3TJ5A 1ZVZA 1XWJA 4P9TA 1RKEB 4IGGA 5L0IA 1TR2A 2B0HA 3S90A 4E17A 2GDCA 1DOVA 2HSQA 2LQGA 3T6GB 5L0JA 1ST6A 1RKCA 5FZTA 3H2UA 2X0CA 4K1OA 5L0HA 1ZW3A 1RKEA 1U89A 3TJ6A 5L0DA 3MYIA 3RF3A 2IBFA 1T01A 5L0GA 4PR9A 1SYQA 4W8PA 3ZDLA 5L0CA 4DJ9A
chains in the Genus database with same CATH superfamily
4E18A 3FOPA 5B1AC 2XLWA 5CI8A 3U8PA 3AQCA 4BJ5A 4LDRA 1EA8A 3O10A 3SXYA 2WZGA 2Y3BA 4EUKB 5JRAA 3KKBA 1TKNA 4E0IA 3DE9A 4Q7CA 2ZXPA 2A6EF 2D5RB 1Q0FA 3CSKA 5A6AA 1XZQA 2Q9CA 1G4WR 3AG3C 4PJNA 1H9TA 4I3MA 4DRHB 1LI7A 2YHSA 1BR1A 4NC3A 5BQIA 3POVA 4CS9C 3TJ6A 2HMZA 1AUEA 3HNIA 1VMAA 2PP4A 3M1CB 2J9UA 2YLGA 2J45A 2Q4FA 4C3EA 1VLSA 2ICWG 1LI5A 1LVKA 1HE9A 3IQ5A 3JSEO 3EFOA 4EWCA 1NZEA 1H6GA 4MTFA 3RFYA 5T3TA 1U6HA 3AQBA 4I1OB 2BE5F 5KYUB 3LUTB 1EI7A 2R7SA 3RQFA 2HKVA 4NY3A 3Q6NA 3ZWIA 4BEJA 1XWJA 3FHDA 4MVOA 5COFA 2AVKA 4QDLA 4ULWA 5EK0A 3MX3A 3G4ZA 4LLCA 1F1MA 1NG1A 1QQ3A 2GDCA 4FX5A 1MNEA 5COMA 3CQZA 3RVZA 5JUAA 3JTLO 5FZTA 4KI2A 2IXNA 3T9OA 5L0HA 3W4YA 2Q9AA 4OIRF 4YL0A 3UGOA 1I4YA 3RF3A 2KGOA 1O5HA 1O3UA 1ZHYA 3HKKA 1GM5A 1SYQA 2RD9A 4K0DA 2E87A 2J0XA 2OU6A 3N2ZB 1TFOB 4PJMA 3VF0A 3EHNA 4DJ9A 2PNOA 2B0JA 5AC4A 1TWGA 5B3IA 2G62A 3ZIBA 1JPNA 3TULA 1TWHA 1UG7A 1U0BB 2HJ3A 1BR2A 2GFHA 1V54C 3HLZA 4YL1A 3DMDA 1JAFA 2J46A 2OKUA 3ABLC 3E9VA 2A0UA 3JSZA 3SEOA 3U3FA 3NDBB 3DZAA 1A7DA 5KYXB 3IPMO 4YT5A 5JT4A 3SNHA 2YL0A 1DOVA 4XEKA 2XXAA 5KYWA 1VLTA 3EFOB 2RSEB 5KYYA 4IARA 4Z9JA 3TD7A 4DVZA 1Z63A 4C7OB 3TQOA 2OQMA 4CJGA 1Y6DA 5CIVA 1RCPA 4JJGA 3ZC4A 2WVOA 2ZPAA 1LS1A 1KU2A 2DI3A 5D91A 1PV3A 4CDVA 3NKDA 3OWTA 2CW0F 1FMWA 3M4BA 2KYHA 4IB4A 1MNDA 4XPYA 1YDIA 1Z5ZA 2IXOA 1TQGA 1OKKD 4I44A 4PFPA 1RJ9A 5B1BC 3U9MA 4BJ6A 4MVRA 4MW3A 2HFIA 3KMIA 3M79A 4HFFB 4FAPB 2L7AA 3U5SA 2VH3A 3TK0A 2W4BA 3TJ5A 1YA7O 2Q00A 1QZXA 3H65A 1Z3IX 3LNRA 2OCCC 2H7VC 3DI5A 2HV7A 4O6NA 4MVSA 4E17A 4U5CE 1MMDA 2R7WA 2VB6A 4ANJA 3W8IA 2LQGA 2V26A 1MMGA 4UDVA 1LS4A 2XLVA 2HJMA 4NQFA 3X2QC 3HTKC 4K1OA 4DOZA 2ZXRA 1RKEA 2A1DD 4JC7A 3ZQVA 2LFFA 2IOQA 4XPWA 2XL8A 4PJLA 3B0VC 3EPVA 1E85A 2YL3A 3ATPA 2FFHA 1OXKA 1LPEA 2OEVA 3RH3A 4A2NB 4P6IC 1M56C 4IAQA 4G78A 4N6HA 2EIMC 4O7GA 3FAPB 3DJNB 2NG1A 3MBGA 3S84A 5JLIA 1RMVA 1NBBA 2XS1A 3DKAA 1ZVZA 1ZHXA 3EH2A 4GEHA 1TR2A 2Y3GA 1Q0GA 2MWQA 1C17M 2Q7RA 4YT8A 3U9JA 1HW2A 5BQHA 2J7PA 5AC5A 2BC5A 1M2VA 2LP4A 4W8KA 3RIPA 1PCXA 1RJ9B 1A7EA 5BUOA 4NTFA 1JRAA 4G7ZF 3K33A 1QPUA 2HUJA 1WGWA 4PACA 3W8HA 1BDJB 1OW6A 1W2WA 3QMKA 1NFOA 2A0BA 1WATA 1KNYA 3AG2C 1BR4A 1N1CA 2D4UA 2IYLD 2KJGA 3MLGA 4MVMA 3CZ6A 5TJ5E 1OCOC 1K04A 2CGEA 3UR3C 3K1HA 4ER9A 3FOOA 3I5PA 5A69A 1JPJA 4N6CA 1ZW2A 2A6HF 5E2QA 1OCCC 3V7OA 4DBRA 2ETSA 3DE8A 4U9DA 3DD7A 3EJNA 3QZCA 2EPKX 2J8WA 4IWBA 4ULVA 4EIYA 2M4EA 2OJED 2QE9A 2XS8A 4JCZA 1HY5A 3GWLA 5HV9A 2R7OA 3NG1A 3C18A 5L3QA 1ZHZA 5CI9A 3GEIA 1OCZC 1YYXA 3QVZA 4JTDB 4NTBA 3GWNA 3Q6MA 4U5BE 5AGFA 3UMKA 3VYWA 4E0HA 4CSAC 1NU9C 1ZU4A 2Y69C 4KC9A 4OIQF 4XPXA 3DWWA 4MTOA 4GQHA 4P9FA 3EG9A 4YJWA 2NUPA 1T6QA 2H7BA 1WN0A 3ZSUA 4JURI 3QTHA 3C8ZA 1PD1A 3RQEA 1H7IA 3NMJA 1MMNA 2ASRA 2NUTA 4CDYA 4R32A 2Q9BA 1K40A 1H9GA 1FTSA 3ABKC 3TOMA 4B6IA 3B9QA 4JTAB 1YAUO 2O9XA 3RYLA 4G7OF 4BJ5C 2OG2A 2OOCA 2XSEA 4MS2A 4CJOA 4KNVA 3HNJA 3WODF 2HMQA 3IEEA 5F5HA 1OR3A 3ABMC 3E70C 3GM1A 2C04A 3NMKA 3SXMA 1LE2A 1ST6A 2XM4A 1M6TA 2YLDA 2XLDA 2R7XA 1VTMP 4EBBA 1R4TA 2MHRA 2J0WA 1U89A 4JRZA 3ZTZA 4PJJA 1ZHWA 5JP7A 5E3CA 2A68F 1A7VA 1AVOB 256BA 1LM3B 2I15A 2WZLA 3C63A 3M15A 3C62A 3S28A 4EKWA 5EGYA 5HSWA 3J06A 3PDMP 2LFDA 4JEBA 5DS4A 3L8IA 5DS6A 4J7TA 2LD6A 1Q0DA 4YK5A 4OIOF 2W9YA 5K0IA 1R5ID 3JZ0A 3L8JA 2ZD9A 3VAYA 3B0UX 3JT1A 5A6BA 4DBQA 4G7HF 2XL6A 3UMIA 2EPNA 2PX0A 3LNMB 2UUIA 4F4BA 5L0IA 2MYSA 3A9CA 3R7CA 3S90A 5EHHA 4AK9A 2YZSA 5IY5C 4BPMA 3T6GB 3UNGC 2QNLA 4U5DE 3W2VA 3NMIA 3G4XA 4E7ZA 1G8XA 2R03A 2NUTB 1GS9A 4YL3A 2VASA 3JCUQ 3SZRA 4CS8A 1FNTc 4WABA 1ZYRF 2AU5A 1TWCA 4MNDA 2YKZA 2GAQA 2J7PD 3T6JA 1ORSC 2W4MA 5DQTA 1ZHTA 1FR0A 3LEVA 1BZ4A 2WL8A 2XLMA 2XLEA 3B0PA 1T5OA 2V3CC 4MTGA 4ONSA 5T1DB 3H2VA 1OR2A 3ZQYA 4OD4A 1RXQA 1SR2A 3AGUA 3HNKA 2EILC 2LSEA 5L0FA 4AE4A 2M64A 2YL7A 4MVZA 4O79A 2W45A 2R25A 4P9TA 1J8YF 1V74B 3FMSA 3EZIA 5B3SC 2CDQA 3O55A 4IAOA 3K7DA 4YWQA 3U2MA 2WZFA 2CCYA 1V4AA 1FAPB 4XLNF 1IW7F 1V55C 1VB5A 2Q3TA 4CX9A 3S27A 1VK5A 4E7SA 4YT4A 4XEVA 1OW8A 1YA9A 4W8PA 4I1MA 3KYIA 2IXMA 3AG1C 3TOLA 3IQCA 4M63A 4ZLDA 1ORJA 3I4UA 1DOWA 3DM9B 1SMYF 3SYNA 4QI0A 2XXAB 3K6BA 5KYWB 2L6HA 1MMAA 3F46A 5A6JA 3K1IA 3EQLF 5KYYB 4BJ6C 3GEHA 3V5XA 4C3DA 3WAQA 1D0XA 1FFTC 3LESA 4BEMJ 4ZLCA 3N24A 2AWYA 1Z6AA 3ASNC 2CYDA 2J9VA 3VRCA 2DGJA 3FXHA 1D0YA 3N0TA 1S7ZA 2L81A 3L34A 1XZPA 3DAFA 4JIOA 2DB4A 1OW7A 1SF8A 3S9OA 1LKXA 1GQAA 2WVQA 3AG4C 3DXJF 3KL4A 1G5ZA 3EHMA 3EZHA 4XEFA 3ZDLA 1JR8A 1CGOA 1SZIA 1WTYA 4RD9A 3PCVA 4WGZA 3S29A 4XQ1A 2R02A 5JS5A 1CGNA 3ZVRA 1KTMA 4CIHA 1YZCA 3DAGA 4HEAJ 4N06A 4O6YA 4DRIB 4JEAA 2QTVA 4L6RA 4BJ1A 3NYMA 3U2LA 4KNWA 4MVQA 4H54A 4JKVA 2Y3HA 4OD5A 1LE4A 1RKEB 2YL1A 4H4KC 3V5ZA 3FDQA 2EINC 1E84A 2VCAA 5KYNA 1JOGA 2EPLX 1NLXA 1VYKA 1Q0KA 5KYUA 2ZXOA 3MYFA 5A6BD 4BJTA 2XM0A 3C8GD 3ZTMA 4A4AA 3KPHA 2CNWA 5L0DA 3G50A 2JX0A 2PBEA 1BBHA 3K66A 3Q7GA 1AEPA 1VOMA 3FVYA 3R2PA 1ZZPA 2QUPA 3JRTA 2Y39A 2OEXA 4JJFA 4LERA 5D92A 2VCCA 3ITFA 4EBKA 2F22A 2G3VA 5E33A 3CAXA 4N4WA 5BQGA 3JYHA 4CBEA 1IZMA 4JVSA 4J30B 3LLKA 4G0HA 4IRUA 1TWAA 4JE9A 3NKEA 2NSGA 4O6MA 2DYSC 5JSLA 1M2VB 3UMHA 1WASA 1YARO 2GWWA 4YN0B 2WB7A 4AL1A 3ECSA 2KNHA 2P7VA 2I8BA 4K7BA 4Z9IA 2P6VA 3F47A 4EBJA 2VC9A 4NTAA 4PFOA 1TFKB 4HE8D 3DJUB 3S0XA 2YWAA 4DVYP 4MW8A 1RKCA 4JCHA 4RDAA 2X0CA 3WHNA 2FGYA 2ZXWC 4JW1A 4Z9HA 1ZW3A 3VM6A 4GYTA 5JVEA 5DS5A 1T9KA 4JZAA 5KYXA 1CPRA 1T01A 2KSFA 2AWCA 2L9JA 2PFDA 2XRHA 2IXPA 3PMRA 4HFKB 4PR9A 2R7RA 2H8AA 2R7UA 2KQ9A 2PX3A 5L0CA 4JTCB 3LLIA 3LS0A 2LIGA 2R7QA 1M2OA 4IJJA 4C7OA 2NPUA 3W2WA 2YLIA 3CEXA 4D4XA 5F5FA 2IM8A 4D4NA 4QI2A 4U5GA 4LDQA 2HS5A 3T6BA 3UGPA 3U0CA 3C7JA 1QVXA 2QY9A 3OEOA 2QLAA 3C8GA 2UUHA 4IGGA 1C02A 4MVUA 4PK4A 1FMVA 2AP3A 3EG9B 4BG0A 2NUPB 2P0NA 1T6UA 4WJ0A 5FCLA 5L0JA 1GGQA 3KH2A 3L0IA 3H2UA 2GA0A 1E83A 2P1AA 2EPMX 1PD0A 2XLHA 4WGYA 4X0RA 4C3BA 3EGDA 3MYIA 1APCA 1I5NA 3IQTA 4YT2A 2IBFA 1O87A 2HV6A 5L0GA 3MFNA 3DM5A 3A11A 1Y4CA 3BEHA 3B71A 5F28E 2XLOA 3JYYA 2J9BA 1UFBA 3KYJA 1HMOA 4EHPA 3GODA 1A41A 2KK1A 2JPUA 1YVIA 1QSPA 1M57C 2DYRC 2LCHA 3NYJA 3AJMA 3JRMO 4CDAA 1EKYA 3LAYA 2C03A 1QKRA 1QLEC 2EIJC 2XL4A 2VCBA 3HNLA 3BRJA 3L1MA 4J7YA 1HE1A 2B0HA 4U5FE 1Z7Qc 1NSGB 3QVYA 2R7VA 3B29A 1YJGA 2HSQA 4U5EE 4DXWA 1CGME 1OXBA 3FAJA 2P61A 4FESA 1JMWA 4OINF 2A69F 3LS1A 3AGTA 3SXKA 3GORA 1WOLA 1OCRC 3EGXA 2R05A 2X51A 3GEEA 3HJCA 3IQ6A 4CS8C 3C8GB 2R9RB 5A6KA 1HMDA 1I4ZA 2CNWD 4CS7A 1L7CA 1WWPA 2NSFA 3NRHA 1E86A 3GM2A 1C03A 1CPQA 2H7OA 3OA1A 3RQGA 3SXZA 4CIPA 5DVWA 4RBNA 1Z23A 3US6A 2BL2A 4LLEA 4U5HA 1D1BA 2FAPB 4Q4ZF 3EGDB 2G3KA 2YQYA 1EQ1A 2Y3DA 3ASOC 3SP1A 1G4US 4XLPF 1T6IA 5L3VA 3U3BA 4KBLA 5T3WA 1J8MF 4AL0A 1K05A 1OQCA 2EPOA 2YEVA 4Q5SF 4FWVA 4MQ9F 3NYLA 4LDKA 4AE4B 1YLMA 3LJBA 1NU7D 1YYJA 1MQVA 2YVKA 5DQZA 1Q0MA 3AOUA 1B68A 3I5QA 3GM3A 2WVNA 5E3AA 2TMVP 3WG7C 3Q7LA 4OIPF 2HSBA 3IHUA 2KC3A 1LIHA 4DRJB 3GANA 4U9EA 4LACB 3T4RA 2L6FA 3X1OA 1HW1A 2HZ8A 2OJQA 3EGXB 3O6XA 2LK4A 3V5YA 1ORYA 1E2XA 4XWJA 3RW0A 1FFHA 2KW3C 3LEOA 5DLJA 1S05A 4CSAA 2R7TA 2L6GA 1A0BA 2PF4E 3K1IC 3EH1A 3PHF2 3QW0A 5COGA 4CS9A 2EIKC 1YZAA 2YRFA 1D0ZA 4NCQA 3ZG1A 1NFNA 4XTKA 3RVYA 1D1CA 1OKKA 3QW1A 1VYIA 1L3PA 2Z15A 4J32B 2J9WA 5GPGB 1D1AA 2JD3A 3O39A 3M4CA 3RKOF 4AX2A 1ZU5A 3U8VA
chains in the Genus database with same CATH topology
3VF0A 4E18A 1L7CA 1YDIA 4ONSA 3H2VA 4EHPA 1H6GA 1ZW2A 1U6HA 1DOWA 5L0FA 2GWWA 2L7AA 1QKRA 3TJ5A 1ZVZA 1XWJA 4P9TA 1RKEB 4IGGA 5L0IA 1TR2A 2B0HA 3S90A 4E17A 2GDCA 1DOVA 2HSQA 2LQGA 3T6GB 5L0JA 1ST6A 1RKCA 5FZTA 3H2UA 2X0CA 4K1OA 5L0HA 1ZW3A 1RKEA 1U89A 3TJ6A 5L0DA 3MYIA 3RF3A 2IBFA 1T01A 5L0GA 4PR9A 1SYQA 4W8PA 3ZDLA 5L0CA 4DJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VF0 A;  4E18 A;  1L7C A;  1YDI A;  4ONS A;  3H2V A;  4EHP A;  1H6G A;  1ZW2 A;  1U6H A;  1DOW A;  5L0F A;  2GWW A;  2L7A A;  1QKR A;  3TJ5 A;  1ZVZ A;  1XWJ A;  4P9T A;  1RKE B;  4IGG A;  5L0I A;  1TR2 A;  2B0H A;  3S90 A;  4E17 A;  2GDC A;  1DOV A;  2HSQ A;  2LQG A;  3T6G B;  5L0J A;  1ST6 A;  1RKC A;  5FZT A;  3H2U A;  2X0C A;  4K1O A;  5L0H A;  1ZW3 A;  1RKE A;  1U89 A;  3TJ6 A;  5L0D A;  3MYI A;  3RF3 A;  2IBF A;  1T01 A;  5L0G A;  4PR9 A;  1SYQ A;  4W8P A;  3ZDL A;  5L0C A;  4DJ9 A; 
#chains in the Genus database with same CATH topology
 4E18 A;  3FOP A;  5B1A C;  2XLW A;  5CI8 A;  3U8P A;  3AQC A;  4BJ5 A;  4LDR A;  1EA8 A;  3O10 A;  3SXY A;  2WZG A;  2Y3B A;  4EUK B;  5JRA A;  3KKB A;  1TKN A;  4E0I A;  3DE9 A;  4Q7C A;  2ZXP A;  2A6E F;  2D5R B;  1Q0F A;  3CSK A;  5A6A A;  1XZQ A;  2Q9C A;  1G4W R;  3AG3 C;  4PJN A;  1H9T A;  4I3M A;  4DRH B;  1LI7 A;  2YHS A;  1BR1 A;  4NC3 A;  5BQI A;  3POV A;  4CS9 C;  3TJ6 A;  2HMZ A;  1AUE A;  3HNI A;  1VMA A;  2PP4 A;  3M1C B;  2J9U A;  2YLG A;  2J45 A;  2Q4F A;  4C3E A;  1VLS A;  2ICW G;  1LI5 A;  1LVK A;  1HE9 A;  3IQ5 A;  3JSE O;  3EFO A;  4EWC A;  1NZE A;  1H6G A;  4MTF A;  3RFY A;  5T3T A;  1U6H A;  3AQB A;  4I1O B;  2BE5 F;  5KYU B;  3LUT B;  1EI7 A;  2R7S A;  3RQF A;  2HKV A;  4NY3 A;  3Q6N A;  3ZWI A;  4BEJ A;  1XWJ A;  3FHD A;  4MVO A;  5COF A;  2AVK A;  4QDL A;  4ULW A;  5EK0 A;  3MX3 A;  3G4Z A;  4LLC A;  1F1M A;  1NG1 A;  1QQ3 A;  2GDC A;  4FX5 A;  1MNE A;  5COM A;  3CQZ A;  3RVZ A;  5JUA A;  3JTL O;  5FZT A;  4KI2 A;  2IXN A;  3T9O A;  5L0H A;  3W4Y A;  2Q9A A;  4OIR F;  4YL0 A;  3UGO A;  1I4Y A;  3RF3 A;  2KGO A;  1O5H A;  1O3U A;  1ZHY A;  3HKK A;  1GM5 A;  1SYQ A;  2RD9 A;  4K0D A;  2E87 A;  2J0X A;  2OU6 A;  3N2Z B;  1TFO B;  4PJM A;  3VF0 A;  3EHN A;  4DJ9 A;  2PNO A;  2B0J A;  5AC4 A;  1TWG A;  5B3I A;  2G62 A;  3ZIB A;  1JPN A;  3TUL A;  1TWH A;  1UG7 A;  1U0B B;  2HJ3 A;  1BR2 A;  2GFH A;  1V54 C;  3HLZ A;  4YL1 A;  3DMD A;  1JAF A;  2J46 A;  2OKU A;  3ABL C;  3E9V A;  2A0U A;  3JSZ A;  3SEO A;  3U3F A;  3NDB B;  3DZA A;  1A7D A;  5KYX B;  3IPM O;  4YT5 A;  5JT4 A;  3SNH A;  2YL0 A;  1DOV A;  4XEK A;  2XXA A;  5KYW A;  1VLT A;  3EFO B;  2RSE B;  5KYY A;  4IAR A;  4Z9J A;  3TD7 A;  4DVZ A;  1Z63 A;  4C7O B;  3TQO A;  2OQM A;  4CJG A;  1Y6D A;  5CIV A;  1RCP A;  4JJG A;  3ZC4 A;  2WVO A;  2ZPA A;  1LS1 A;  1KU2 A;  2DI3 A;  5D91 A;  1PV3 A;  4CDV A;  3NKD A;  3OWT A;  2CW0 F;  1FMW A;  3M4B A;  2KYH A;  4IB4 A;  1MND A;  4XPY A;  1YDI A;  1Z5Z A;  2IXO A;  1TQG A;  1OKK D;  4I44 A;  4PFP A;  1RJ9 A;  5B1B C;  3U9M A;  4BJ6 A;  4MVR A;  4MW3 A;  2HFI A;  3KMI A;  3M79 A;  4HFF B;  4FAP B;  2L7A A;  3U5S A;  2VH3 A;  3TK0 A;  2W4B A;  3TJ5 A;  1YA7 O;  2Q00 A;  1QZX A;  3H65 A;  1Z3I X;  3LNR A;  2OCC C;  2H7V C;  3DI5 A;  2HV7 A;  4O6N A;  4MVS A;  4E17 A;  4U5C E;  1MMD A;  2R7W A;  2VB6 A;  4ANJ A;  3W8I A;  2LQG A;  2V26 A;  1MMG A;  4UDV A;  1LS4 A;  2XLV A;  2HJM A;  4NQF A;  3X2Q C;  3HTK C;  4K1O A;  4DOZ A;  2ZXR A;  1RKE A;  2A1D D;  4JC7 A;  3ZQV A;  2LFF A;  2IOQ A;  4XPW A;  2XL8 A;  4PJL A;  3B0V C;  3EPV A;  1E85 A;  2YL3 A;  3ATP A;  2FFH A;  1OXK A;  1LPE A;  2OEV A;  3RH3 A;  4A2N B;  4P6I C;  1M56 C;  4IAQ A;  4G78 A;  4N6H A;  2EIM C;  4O7G A;  3FAP B;  3DJN B;  2NG1 A;  3MBG A;  3S84 A;  5JLI A;  1RMV A;  1NBB A;  2XS1 A;  3DKA A;  1ZVZ A;  1ZHX A;  3EH2 A;  4GEH A;  1TR2 A;  2Y3G A;  1Q0G A;  2MWQ A;  1C17 M;  2Q7R A;  4YT8 A;  3U9J A;  1HW2 A;  5BQH A;  2J7P A;  5AC5 A;  2BC5 A;  1M2V A;  2LP4 A;  4W8K A;  3RIP A;  1PCX A;  1RJ9 B;  1A7E A;  5BUO A;  4NTF A;  1JRA A;  4G7Z F;  3K33 A;  1QPU A;  2HUJ A;  1WGW A;  4PAC A;  3W8H A;  1BDJ B;  1OW6 A;  1W2W A;  3QMK A;  1NFO A;  2A0B A;  1WAT A;  1KNY A;  3AG2 C;  1BR4 A;  1N1C A;  2D4U A;  2IYL D;  2KJG A;  3MLG A;  4MVM A;  3CZ6 A;  5TJ5 E;  1OCO C;  1K04 A;  2CGE A;  3UR3 C;  3K1H A;  4ER9 A;  3FOO A;  3I5P A;  5A69 A;  1JPJ A;  4N6C A;  1ZW2 A;  2A6H F;  5E2Q A;  1OCC C;  3V7O A;  4DBR A;  2ETS A;  3DE8 A;  4U9D A;  3DD7 A;  3EJN A;  3QZC A;  2EPK X;  2J8W A;  4IWB A;  4ULV A;  4EIY A;  2M4E A;  2OJE D;  2QE9 A;  2XS8 A;  4JCZ A;  1HY5 A;  3GWL A;  5HV9 A;  2R7O A;  3NG1 A;  3C18 A;  5L3Q A;  1ZHZ A;  5CI9 A;  3GEI A;  1OCZ C;  1YYX A;  3QVZ A;  4JTD B;  4NTB A;  3GWN A;  3Q6M A;  4U5B E;  5AGF A;  3UMK A;  3VYW A;  4E0H A;  4CSA C;  1NU9 C;  1ZU4 A;  2Y69 C;  4KC9 A;  4OIQ F;  4XPX A;  3DWW A;  4MTO A;  4GQH A;  4P9F A;  3EG9 A;  4YJW A;  2NUP A;  1T6Q A;  2H7B A;  1WN0 A;  3ZSU A;  4JUR I;  3QTH A;  3C8Z A;  1PD1 A;  3RQE A;  1H7I A;  3NMJ A;  1MMN A;  2ASR A;  2NUT A;  4CDY A;  4R32 A;  2Q9B A;  1K40 A;  1H9G A;  1FTS A;  3ABK C;  3TOM A;  4B6I A;  3B9Q A;  4JTA B;  1YAU O;  2O9X A;  3RYL A;  4G7O F;  4BJ5 C;  2OG2 A;  2OOC A;  2XSE A;  4MS2 A;  4CJO A;  4KNV A;  3HNJ A;  3WOD F;  2HMQ A;  3IEE A;  5F5H A;  1OR3 A;  3ABM C;  3E70 C;  3GM1 A;  2C04 A;  3NMK A;  3SXM A;  1LE2 A;  1ST6 A;  2XM4 A;  1M6T A;  2YLD A;  2XLD A;  2R7X A;  1VTM P;  4EBB A;  1R4T A;  2MHR A;  2J0W A;  1U89 A;  4JRZ A;  3ZTZ A;  4PJJ A;  1ZHW A;  5JP7 A;  5E3C A;  2A68 F;  1A7V A;  1AVO B;  256B A;  1LM3 B;  2I15 A;  2WZL A;  3C63 A;  3M15 A;  3C62 A;  3S28 A;  4EKW A;  5EGY A;  5HSW A;  3J06 A;  3PDM P;  2LFD A;  4JEB A;  5DS4 A;  3L8I A;  5DS6 A;  4J7T A;  2LD6 A;  1Q0D A;  4YK5 A;  4OIO F;  2W9Y A;  5K0I A;  1R5I D;  3JZ0 A;  3L8J A;  2ZD9 A;  3VAY A;  3B0U X;  3JT1 A;  5A6B A;  4DBQ A;  4G7H F;  2XL6 A;  3UMI A;  2EPN A;  2PX0 A;  3LNM B;  2UUI A;  4F4B A;  5L0I A;  2MYS A;  3A9C A;  3R7C A;  3S90 A;  5EHH A;  4AK9 A;  2YZS A;  5IY5 C;  4BPM A;  3T6G B;  3UNG C;  2QNL A;  4U5D E;  3W2V A;  3NMI A;  3G4X A;  4E7Z A;  1G8X A;  2R03 A;  2NUT B;  1GS9 A;  4YL3 A;  2VAS A;  3JCU Q;  3SZR A;  4CS8 A;  1FNT c;  4WAB A;  1ZYR F;  2AU5 A;  1TWC A;  4MND A;  2YKZ A;  2GAQ A;  2J7P D;  3T6J A;  1ORS C;  2W4M A;  5DQT A;  1ZHT A;  1FR0 A;  3LEV A;  1BZ4 A;  2WL8 A;  2XLM A;  2XLE A;  3B0P A;  1T5O A;  2V3C C;  4MTG A;  4ONS A;  5T1D B;  3H2V A;  1OR2 A;  3ZQY A;  4OD4 A;  1RXQ A;  1SR2 A;  3AGU A;  3HNK A;  2EIL C;  2LSE A;  5L0F A;  4AE4 A;  2M64 A;  2YL7 A;  4MVZ A;  4O79 A;  2W45 A;  2R25 A;  4P9T A;  1J8Y F;  1V74 B;  3FMS A;  3EZI A;  5B3S C;  2CDQ A;  3O55 A;  4IAO A;  3K7D A;  4YWQ A;  3U2M A;  2WZF A;  2CCY A;  1V4A A;  1FAP B;  4XLN F;  1IW7 F;  1V55 C;  1VB5 A;  2Q3T A;  4CX9 A;  3S27 A;  1VK5 A;  4E7S A;  4YT4 A;  4XEV A;  1OW8 A;  1YA9 A;  4W8P A;  4I1M A;  3KYI A;  2IXM A;  3AG1 C;  3TOL A;  3IQC A;  4M63 A;  4ZLD A;  1ORJ A;  3I4U A;  1DOW A;  3DM9 B;  1SMY F;  3SYN A;  4QI0 A;  2XXA B;  3K6B A;  5KYW B;  2L6H A;  1MMA A;  3F46 A;  5A6J A;  3K1I A;  3EQL F;  5KYY B;  4BJ6 C;  3GEH A;  3V5X A;  4C3D A;  3WAQ A;  1D0X A;  1FFT C;  3LES A;  4BEM J;  4ZLC A;  3N24 A;  2AWY A;  1Z6A A;  3ASN C;  2CYD A;  2J9V A;  3VRC A;  2DGJ A;  3FXH A;  1D0Y A;  3N0T A;  1S7Z A;  2L81 A;  3L34 A;  1XZP A;  3DAF A;  4JIO A;  2DB4 A;  1OW7 A;  1SF8 A;  3S9O A;  1LKX A;  1GQA A;  2WVQ A;  3AG4 C;  3DXJ F;  3KL4 A;  1G5Z A;  3EHM A;  3EZH A;  4XEF A;  3ZDL A;  1JR8 A;  1CGO A;  1SZI A;  1WTY A;  4RD9 A;  3PCV A;  4WGZ A;  3S29 A;  4XQ1 A;  2R02 A;  5JS5 A;  1CGN A;  3ZVR A;  1KTM A;  4CIH A;  1YZC A;  3DAG A;  4HEA J;  4N06 A;  4O6Y A;  4DRI B;  4JEA A;  2QTV A;  4L6R A;  4BJ1 A;  3NYM A;  3U2L A;  4KNW A;  4MVQ A;  4H54 A;  4JKV A;  2Y3H A;  4OD5 A;  1LE4 A;  1RKE B;  2YL1 A;  4H4K C;  3V5Z A;  3FDQ A;  2EIN C;  1E84 A;  2VCA A;  5KYN A;  1JOG A;  2EPL X;  1NLX A;  1VYK A;  1Q0K A;  5KYU A;  2ZXO A;  3MYF A;  5A6B D;  4BJT A;  2XM0 A;  3C8G D;  3ZTM A;  4A4A A;  3KPH A;  2CNW A;  5L0D A;  3G50 A;  2JX0 A;  2PBE A;  1BBH A;  3K66 A;  3Q7G A;  1AEP A;  1VOM A;  3FVY A;  3R2P A;  1ZZP A;  2QUP A;  3JRT A;  2Y39 A;  2OEX A;  4JJF A;  4LER A;  5D92 A;  2VCC A;  3ITF A;  4EBK A;  2F22 A;  2G3V A;  5E33 A;  3CAX A;  4N4W A;  5BQG A;  3JYH A;  4CBE A;  1IZM A;  4JVS A;  4J30 B;  3LLK A;  4G0H A;  4IRU A;  1TWA A;  4JE9 A;  3NKE A;  2NSG A;  4O6M A;  2DYS C;  5JSL A;  1M2V B;  3UMH A;  1WAS A;  1YAR O;  2GWW A;  4YN0 B;  2WB7 A;  4AL1 A;  3ECS A;  2KNH A;  2P7V A;  2I8B A;  4K7B A;  4Z9I A;  2P6V A;  3F47 A;  4EBJ A;  2VC9 A;  4NTA A;  4PFO A;  1TFK B;  4HE8 D;  3DJU B;  3S0X A;  2YWA A;  4DVY P;  4MW8 A;  1RKC A;  4JCH A;  4RDA A;  2X0C A;  3WHN A;  2FGY A;  2ZXW C;  4JW1 A;  4Z9H A;  1ZW3 A;  3VM6 A;  4GYT A;  5JVE A;  5DS5 A;  1T9K A;  4JZA A;  5KYX A;  1CPR A;  1T01 A;  2KSF A;  2AWC A;  2L9J A;  2PFD A;  2XRH A;  2IXP A;  3PMR A;  4HFK B;  4PR9 A;  2R7R A;  2H8A A;  2R7U A;  2KQ9 A;  2PX3 A;  5L0C A;  4JTC B;  3LLI A;  3LS0 A;  2LIG A;  2R7Q A;  1M2O A;  4IJJ A;  4C7O A;  2NPU A;  3W2W A;  2YLI A;  3CEX A;  4D4X A;  5F5F A;  2IM8 A;  4D4N A;  4QI2 A;  4U5G A;  4LDQ A;  2HS5 A;  3T6B A;  3UGP A;  3U0C A;  3C7J A;  1QVX A;  2QY9 A;  3OEO A;  2QLA A;  3C8G A;  2UUH A;  4IGG A;  1C02 A;  4MVU A;  4PK4 A;  1FMV A;  2AP3 A;  3EG9 B;  4BG0 A;  2NUP B;  2P0N A;  1T6U A;  4WJ0 A;  5FCL A;  5L0J A;  1GGQ A;  3KH2 A;  3L0I A;  3H2U A;  2GA0 A;  1E83 A;  2P1A A;  2EPM X;  1PD0 A;  2XLH A;  4WGY A;  4X0R A;  4C3B A;  3EGD A;  3MYI A;  1APC A;  1I5N A;  3IQT A;  4YT2 A;  2IBF A;  1O87 A;  2HV6 A;  5L0G A;  3MFN A;  3DM5 A;  3A11 A;  1Y4C A;  3BEH A;  3B71 A;  5F28 E;  2XLO A;  3JYY A;  2J9B A;  1UFB A;  3KYJ A;  1HMO A;  4EHP A;  3GOD A;  1A41 A;  2KK1 A;  2JPU A;  1YVI A;  1QSP A;  1M57 C;  2DYR C;  2LCH A;  3NYJ A;  3AJM A;  3JRM O;  4CDA A;  1EKY A;  3LAY A;  2C03 A;  1QKR A;  1QLE C;  2EIJ C;  2XL4 A;  2VCB A;  3HNL A;  3BRJ A;  3L1M A;  4J7Y A;  1HE1 A;  2B0H A;  4U5F E;  1Z7Q c;  1NSG B;  3QVY A;  2R7V A;  3B29 A;  1YJG A;  2HSQ A;  4U5E E;  4DXW A;  1CGM E;  1OXB A;  3FAJ A;  2P61 A;  4FES A;  1JMW A;  4OIN F;  2A69 F;  3LS1 A;  3AGT A;  3SXK A;  3GOR A;  1WOL A;  1OCR C;  3EGX A;  2R05 A;  2X51 A;  3GEE A;  3HJC A;  3IQ6 A;  4CS8 C;  3C8G B;  2R9R B;  5A6K A;  1HMD A;  1I4Z A;  2CNW D;  4CS7 A;  1L7C A;  1WWP A;  2NSF A;  3NRH A;  1E86 A;  3GM2 A;  1C03 A;  1CPQ A;  2H7O A;  3OA1 A;  3RQG A;  3SXZ A;  4CIP A;  5DVW A;  4RBN A;  1Z23 A;  3US6 A;  2BL2 A;  4LLE A;  4U5H A;  1D1B A;  2FAP B;  4Q4Z F;  3EGD B;  2G3K A;  2YQY A;  1EQ1 A;  2Y3D A;  3ASO C;  3SP1 A;  1G4U S;  4XLP F;  1T6I A;  5L3V A;  3U3B A;  4KBL A;  5T3W A;  1J8M F;  4AL0 A;  1K05 A;  1OQC A;  2EPO A;  2YEV A;  4Q5S F;  4FWV A;  4MQ9 F;  3NYL A;  4LDK A;  4AE4 B;  1YLM A;  3LJB A;  1NU7 D;  1YYJ A;  1MQV A;  2YVK A;  5DQZ A;  1Q0M A;  3AOU A;  1B68 A;  3I5Q A;  3GM3 A;  2WVN A;  5E3A A;  2TMV P;  3WG7 C;  3Q7L A;  4OIP F;  2HSB A;  3IHU A;  2KC3 A;  1LIH A;  4DRJ B;  3GAN A;  4U9E A;  4LAC B;  3T4R A;  2L6F A;  3X1O A;  1HW1 A;  2HZ8 A;  2OJQ A;  3EGX B;  3O6X A;  2LK4 A;  3V5Y A;  1ORY A;  1E2X A;  4XWJ A;  3RW0 A;  1FFH A;  2KW3 C;  3LEO A;  5DLJ A;  1S05 A;  4CSA A;  2R7T A;  2L6G A;  1A0B A;  2PF4 E;  3K1I C;  3EH1 A;  3PHF 2;  3QW0 A;  5COG A;  4CS9 A;  2EIK C;  1YZA A;  2YRF A;  1D0Z A;  4NCQ A;  3ZG1 A;  1NFN A;  4XTK A;  3RVY A;  1D1C A;  1OKK A;  3QW1 A;  1VYI A;  1L3P A;  2Z15 A;  4J32 B;  2J9W A;  5GPG B;  1D1A A;  2JD3 A;  3O39 A;  3M4C A;  3RKO F;  4AX2 A;  1ZU5 A;  3U8V A; 
#chains in the Genus database with same CATH homology
 3VF0 A;  4E18 A;  1L7C A;  1YDI A;  4ONS A;  3H2V A;  4EHP A;  1H6G A;  1ZW2 A;  1U6H A;  1DOW A;  5L0F A;  2GWW A;  2L7A A;  1QKR A;  3TJ5 A;  1ZVZ A;  1XWJ A;  4P9T A;  1RKE B;  4IGG A;  5L0I A;  1TR2 A;  2B0H A;  3S90 A;  4E17 A;  2GDC A;  1DOV A;  2HSQ A;  2LQG A;  3T6G B;  5L0J A;  1ST6 A;  1RKC A;  5FZT A;  3H2U A;  2X0C A;  4K1O A;  5L0H A;  1ZW3 A;  1RKE A;  1U89 A;  3TJ6 A;  5L0D A;  3MYI A;  3RF3 A;  2IBF A;  1T01 A;  5L0G A;  4PR9 A;  1SYQ A;  4W8P A;  3ZDL A;  5L0C A;  4DJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...