1ZW2A

Vinculin head (0-258) in complex with the talin rod residues 2345-2369
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
251
structure length
251
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 105
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw2A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw2A01
3TJ6A 2GDCA 1RKEA 3TJ5A 2X0CA 1DOWA 1TR2A 5L0FA 2B0HA 3MYIA 1H6GA 4K1OA 1ZW2A 3VF0A 4E18A 4P9TA 1XWJA 5FZTA 5L0JA 3H2VA 1ZW3A 5L0DA 1QKRA 5L0HA 5L0GA 2L7AA 4EHPA 1RKEB 3T6GB 3S90A 1RKCA 2LQGA 4IGGA 1DOVA 2GWWA 2IBFA 4ONSA 1YDIA 2HSQA 1T01A 5L0CA 1SYQA 5L0IA 4W8PA 4PR9A 1U6HA 1ST6A 4DJ9A 4E17A 1ZVZA 3RF3A 3ZDLA 1L7CA 3H2UA 1U89A
chains in the Genus database with same CATH superfamily
1XZPA 2D5RB 2HMZA 4EUKB 1FMVA 2P1AA 2IXMA 3GWNA 3LLKA 3U8VA 4AL0A 2ZXWC 5COMA 3K1HA 1TQGA 2XLVA 4O6YA 4WGYA 2J8WA 4MVMA 4EBBA 5FCLA 1TWHA 2J46A 1AEPA 3DWWA 3GEHA 4BEMJ 2P6VA 4MQ9F 4OIRF 2EIMC 3M4CA 1BZ4A 5COFA 4E0HA 3HNKA 1OW7A 1Q0GA 1WN0A 4MTOA 4QI2A 2L9JA 1QQ3A 3R7CA 3RQGA 4LDQA 3CZ6A 1I4ZA 2EILC 5TJ5E 4AL1A 4AX2A 4XPWA 1ZHYA 3CAXA 3FOPA 1I4YA 1RJ9B 2XLWA 3AOUA 3EZHA 3M1CB 3SZRA 3DAFA 3JT1A 4CS9C 1VTMP 1U6HA 2IXPA 1NBBA 1HMDA 1ZVZA 4G7HF 1L7CA 2M64A 3NKDA 4YT2A 2J9BA 2JX0A 3G50A 5DQTA 3UGPA 4J30B 2A6HF 3M79A 1FFTC 4IWBA 3SXYA 3GWLA 3ZQVA 3I5PA 2ZXPA 4EBKA 1NSGB 4ZLCA 4CDVA 2E87A 1NLXA 2CYDA 5EHHA 4IAOA 1LS1A 3KH2A 3QW1A 3U2MA 1M57C 3SNHA 2RSEB 4XLPF 3PMRA 4JVSA 2OJQA 5AC5A 1VLSA 5CIVA 4NY3A 1VOMA 4MW3A 4Z9IA 2EIKC 5L0IA 3L0IA 2BL2A 3EHMA 1FNTc 1Z3IX 2J0XA 4XEVA 4RD9A 3K66A 3NMIA 1RCPA 2Q9BA 4JRZA 3C18A 1TWGA 1VK5A 4Q7CA 1QSPA 2G62A 4EKWA 3EH1A 3N0TA 4P9TA 1S05A 2XLHA 3IQCA 1NFNA 4PJJA 2QLAA 4JJGA 3Q7GA 2PX3A 4XTKA 1NU9C 2ZD9A 4DVYP 2HV6A 1ORJA 2YVKA 3UNGC 2G3VA 2OEXA 2R7QA 2XRHA 3DXJF 4D4XA 1V54C 2LQGA 4XEFA 3DD7A 4PJNA 1E84A 2NSFA 4OIPF 5DS5A 1NFOA 1ORSC 2V3CC 2R05A 1YARO 4CIPA 3KYJA 1H9TA 3CEXA 4DRIB 5HSWA 2R9RB 2KNHA 5T3WA 1Y4CA 3V5ZA 1T6IA 3ASOC 3EHNA 3K1IC 1NZEA 2R7XA 2YLIA 3N24A 4NTFA 2AWYA 1UG7A 1J8YF 2KQ9A 3MYIA 5A6BA 3M15A 3NYJA 4G78A 3UMHA 4DXWA 1MMAA 2DGJA 5DS4A 2LCHA 4CSAA 2O9XA 2AWCA 3O6XA 4JEAA 2NPUA 2TMVP 2A0UA 3QVZA 1LPEA 3EGDA 2J7PD 4JIOA 3U0CA 2A68F 1I5NA 1ZHWA 4JJFA 5L0GA 3POVA 3JZ0A 3T6JA 2YRFA 3AG2C 2ZXOA 4PACA 4BPMA 4JCZA 3ZWIA 5DS6A 5KYUB 4FX5A 1F1MA 3TOMA 1S7ZA 3FMSA 1SYQA 2DI3A 3AQBA 2BC5A 1K05A 3B71A 4YWQA 1PCXA 3HNIA 3RVZA 3WODF 2HS5A 3AG4C 1A7VA 4JE9A 1VB5A 1MMNA 2KSFA 2Z15A 4ULWA 3A11A 1JRAA 2EPNA 2EPOA 1RKEA 3TJ6A 1V4AA 1ZHTA 5KYWA 1H9GA 1XZQA 4WABA 3KL4A 5GPGB 1M6TA 3W2WA 1T9KA 1ZYRF 4R32A 3SYNA 1YJGA 3DAGA 3RIPA 3MYFA 2WZFA 3JCUQ 2AVKA 2Y3DA 3C8GA 2L6FA 3TQOA 5CI8A 3WAQA 1HMOA 2R03A 1VLTA 3FAPB 3U9JA 3H65A 2DYSC 5L0HA 2Y69C 1EKYA 2QNLA 2NUTA 5EK0A 1RXQA 1CPRA 1A7DA 1CGNA 1RKCA 3B0PA 3CQZA 3SEOA 4P9FA 2J7PA 3ECSA 3L1MA 4LDRA 2ZPAA 4YJWA 1E85A 4I3MA 5BQGA 1HY5A 5DLJA 1EI7A 5A6KA 4CSAC 2J45A 3ABKC 4MVOA 2AU5A 3IHUA 3EGDB 2Q4FA 3N2ZB 2X0CA 3DJUB 3LUTB 3T6BA 1JR8A 4GYTA 4JURI 2DYRC 2YKZA 3WHNA 1Q0DA 2OCCC 3FVYA 4YT5A 2WL8A 4QDLA 4YL3A 1SZIA 3EZIA 5KYUA 2CDQA 3VF0A 4E18A 5EGYA 1OCRC 4Q4ZF 2J0WA 2P61A 2XLMA 3IEEA 3K7DA 1VMAA 1C03A 1FFHA 2CW0F 2VC9A 2FGYA 4U5DE 1FR0A 3Q6NA 5KYWB 4PJMA 1RKEB 1OW8A 4YT8A 1G5ZA 2J9VA 3V5XA 3L34A 4MNDA 4XLNF 4DBRA 1CPQA 2WB7A 4I44A 3EH2A 4OD4A 1K40A 3C8GB 5E33A 3LEVA 3GEEA 2P0NA 1LKXA 1TFOB 1Z7Qc 2AP3A 4X0RA 3U8PA 3ZDLA 4C3BA 2PX0A 3DZAA 2W4MA 2PP4A 1O87A 3DJNB 2YL1A 4HFKB 4MS2A 5JSLA 4K7BA 2NUTB 4FAPB 2B0HA 3LNRA 3TD7A 4XQ1A 2R25A 2UUHA 1M2VB 2YWAA 3ATPA 4D4NA 1YYXA 3EGXA 3ZTMA 4G7ZF 2A0BA 1NG1A 4N4WA 2WZGA 1OKKD 1BR2A 4KC9A 3KPHA 3QW0A 4U9DA 2LFDA 3ITFA 3RH3A 3WG7C 2B0JA 1D1AA 256BA 2WVNA 4QI0A 2HFIA 2IYLD 3X1OA 5JT4A 2IM8A 1ZU4A 3DM9B 3EFOA 3AGUA 3UMIA 1VYKA 3T9OA 1QPUA 1Z23A 1MNDA 1TFKB 1ZU5A 1A7EA 1OQCA 2YLDA 3JYYA 4IJJA 4OD5A 5BQHA 5L3VA 2CCYA 2KK1A 3DM5A 4P6IC 2EINC 5AGFA 1JPNA 1LE2A 2PFDA 3RW0A 4MVZA 3LEOA 3OWTA 3U3BA 1D0YA 3F47A 1MMGA 2HSBA 3IQTA 4WJ0A 2Q9AA 1PV3A 2P7VA 2CNWD 3QVYA 1E86A 1LI5A 2YEVA 3NYMA 3C8ZA 2JD3A 2QUPA 3GM3A 3NYLA 4MVSA 3C62A 3IQ5A 4CX9A 3I4UA 2XS1A 5KYNA 3W2VA 4C7OA 3EG9A 1CGME 5L0JA 3J06A 2ICWG 4GEHA 3O55A 2KJGA 3DKAA 3MLGA 2R7SA 1JMWA 1RMVA 2EPLX 1TKNA 1OXKA 2VCBA 3G4XA 2MHRA 4PJLA 4O79A 4L6RA 1EA8A 2GWWA 3KMIA 2XL8A 4CDYA 2W45A 2Q3TA 1Z6AA 3HNLA 1T01A 2R7OA 3EGXB 2ZXRA 4WGZA 2WVQA 5DQZA 5JVEA 4KI2A 1ST6A 2X51A 2IXNA 2IOQA 3QZCA 5CI9A 3ZSUA 4DVZA 3MX3A 5T3TA 2GAQA 1T5OA 3EFOB 1FAPB 1C17M 4LDKA 5JLIA 4H54A 1MQVA 4IB4A 1A0BA 1C02A 4Z9HA 3HLZA 1SMYF 1V55C 2OEVA 4YL0A 5K0IA 3ASNC 2XS8A 2XL6A 3TULA 1QZXA 1U0BB 3SP1A 4ULVA 2J9UA 4J7YA 4YK5A 1Q0FA 3TOLA 2YHSA 3US6A 4EHPA 2VASA 1LE4A 4OINF 2R7WA 1APCA 2G3KA 3TK0A 4JKVA 3OEOA 4G7OF 1IZMA 2A1DD 2YLGA 3C7JA 5JUAA 2VB6A 4LLCA 4XPYA 4C7OB 3EG9B 1O3UA 2HZ8A 2I8BA 3V5YA 4CJGA 3FXHA 3O39A 1H7IA 2QTVA 3PDMP 3S84A 2L6HA 1QVXA 1KU2A 3JRTA 1UFBA 1WWPA 3DI5A 4JTAB 3ZIBA 3G4ZA 4U5CE 2C03A 1E83A 3RQEA 1GM5A 4N6CA 4RBNA 1E2XA 3AG1C 1FMWA 3KYIA 2VCCA 2V26A 3ZQYA 3JYHA 2LP4A 4NC3A 1HE9A 2I15A 3MFNA 2HKVA 5DVWA 3SXKA 3B0VC 3W8IA 4CBEA 3T6GB 4U5FE 4EWCA 3LNMB 5IY5C 3LESA 4U5EE 2YQYA 1TWAA 3S29A 2XLDA 4AK9A 2R7TA 5BUOA 2Y3GA 5JP7A 2LSEA 3LS1A 3VRCA 1GGQA 3HJCA 4NCQA 5KYXA 4Z9JA 2BE5F 3H2UA 3HTKC 5JS5A 4LACB 1MMDA 2XXAA 2GDCA 2DB4A 2OQMA 3GM1A 3Q7LA 1DOWA 3UMKA 1TR2A 3LAYA 1Z5ZA 2Y3BA 5T1DB 3K33A 4MVUA 1ZW2A 3DE9A 4F4BA 4E7ZA 3NKEA 3ZC4A 1G8XA 1CGOA 3OA1A 2LFFA 3I5QA 1XWJA 4PK4A 4LLEA 4DOZA 3GORA 4B6IA 4I1MA 2WZLA 3BEHA 1J8MF 2D4UA 3RQFA 2EPKX 5E3AA 4N06A 4A2NB 4E0IA 2RD9A 2FFHA 3ABLC 4J7TA 1DOVA 4C3DA 1BDJB 1YDIA 5E2QA 2OJED 3VAYA 4EIYA 4AE4A 5L3QA 2HJ3A 2NUPA 3GEIA 4MW8A 4BG0A 1WASA 4U9EA 2OG2A 2M4EA 2HV7A 3JRMO 1ZHZA 2KYHA 4IAQA 4N6HA 2PF4E 4CJOA 1ORYA 1R5ID 1WGWA 3RFYA 2IXOA 2YL7A 1H6GA 2VCAA 1KNYA 2HMQA 4CS8A 4NQFA 3SXMA 5F28E 3V7OA 1LIHA 2ETSA 3ABMC 3EQLF 3NMKA 2VH3A 4JCHA 1D1CA 3LS0A 4LERA 2XLOA 3AGTA 3DMDA 2HJMA 4YL1A 1AUEA 4YT4A 1K04A 5KYXB 2OU6A 2H8AA 5KYYA 2XXAB 2HUJA 2Y3HA 4BJTA 1ZHXA 3FHDA 3QMKA 2XLEA 4J32B 3E9VA 1BBHA 3C63A 3T4RA 4IGGA 4OIOF 1A41A 4ONSA 2OOCA 2R02A 4JC7A 4GQHA 4BJ1A 1Y6DA 2MYSA 3JSZA 3UR3C 2XM4A 3JTLO 1R4TA 3S9OA 1HE1A 5BQIA 2LIGA 4RDAA 3AJMA 2H7BA 4MTGA 1OW6A 4XWJA 3FDQA 5L0FA 2OKUA 3AG3C 5HV9A 5F5FA 3A9CA 1G4WR 5F5HA 1OXBA 4FESA 3VM6A 4ZLDA 3IPMO 1KTMA 3JSEO 4AE4B 2NUPB 3K1IA 3RYLA 1BR4A 1G4US 1LS4A 1NU7D 3O10A 1JPJA 2CGEA 3S27A 1PD1A 4K0DA 1OR3A 3H2VA 2XL4A 4MVQA 3RKOF 3ZVRA 2KGOA 4KNWA 4NTBA 3NDBB 2QE9A 1LI7A 4OIQF 1YA7O 3L8JA 1OKKA 1SF8A 5B1AC 2EPMX 1BR1A 2Q9CA 2XM0A 4KBLA 2HSQA 3AQCA 5L0CA 1O5HA 3L8IA 4IARA 4W8PA 4CS8C 3BRJA 3FOOA 4XPXA 5A6BD 4BJ6A 2C04A 4FWVA 5A6AA 3HNJA 4ANJA 4M63A 4U5HA 2NSGA 1QLEC 3PCVA 5KYYB 5D91A 3B9QA 5B3SC 1VYIA 3GODA 1OCOC 3VYWA 2Q7RA 1TWCA 3SXZA 3NG1A 1JOGA 1OCCC 1EQ1A 1ZZPA 3CSKA 4NTAA 2CNWA 1HW1A 5B3IA 1JAFA 4DBQA 4O7GA 5FZTA 4BJ5C 4BEJA 4C3EA 2R7UA 2A69F 4EBJA 2GFHA 2YL0A 3E70C 2UUIA 4JTCB 3NMJA 4YN0B 2KW3C 3GM2A 1Q0KA 2MWQA 4CS7A 3B29A 1B68A 2KC3A 4O6MA 4PR9A 5AC4A 1D0ZA 3R2PA 3S0XA 4JTDB 2WVOA 2YL3A 2H7VC 3C8GD 1YVIA 4CDAA 3F46A 1T6QA 3K6BA 1OCZC 3U9MA 1V74B 4U5BE 4K1OA 2Q00A 1YYJA 4JEBA 2QY9A 3FAJA 3HKKA 5D92A 1YA9A 3EJNA 5A69A 4JW1A 3EPVA 2R7VA 1HW2A 1GQAA 2W4BA 4JZAA 1WOLA 3U5SA 1WATA 2W9YA 4BJ6C 1L3PA 1PD0A 4PFPA 3B0UX 1QKRA 3S28A 1SR2A 2L7AA 3KKBA 4A4AA 2GA0A 3LJBA 3IQ6A 4E7SA 4XEKA 4UDVA 2PNOA 3QTHA 3ZTZA 2PBEA 4DRJB 4DRHB 4KNVA 3X2QC 1D1BA 1AVOB 3ZG1A 3NRHA 4ER9A 1LM3B 2F22A 3LLIA 5E3CA 1OR2A 3RF3A 1T6UA 4I1OB 2J9WA 1FTSA 4U5GA 2H7OA 3TJ5A 1LVKA 3W8HA 1M2OA 1W2WA 3Q6MA 1MNEA 1M56C 1N1CA 2Y39A 2YZSA 1YZAA 3M4BA 1RJ9A 3GANA 4HE8D 4IRUA 1YLMA 4CS9A 2EIJC 1D0XA 2L6GA 2L81A 3RVYA 4H4KC 3W4YA 3PHF2 5A6JA 3DE8A 2R7RA 1ZW3A 2FAPB 5L0DA 3U3FA 4BJ5A 1WTYA 1M2VA 2NG1A 3S90A 4Q5SF 4CIHA 1IW7F 4HFFB 1Z63A 1GS9A 2IBFA 2LK4A 3UGOA 2LD6A 2ASRA 5JRAA 1YZCA 3MBGA 4PFOA 5B1BC 1Q0MA 1YAUO 5COGA 3U2LA 2A6EF 4DJ9A 4MVRA 4MTFA 4E17A 2XSEA 4HEAJ 4G0HA 4O6NA 2JPUA 4W8KA 1U89A
chains in the Genus database with same CATH topology
3TJ6A 2GDCA 1RKEA 3TJ5A 2X0CA 1DOWA 1TR2A 5L0FA 2B0HA 3MYIA 1H6GA 4K1OA 1ZW2A 3VF0A 4E18A 4P9TA 1XWJA 5FZTA 5L0JA 3H2VA 1ZW3A 5L0DA 1QKRA 5L0HA 5L0GA 2L7AA 4EHPA 1RKEB 3T6GB 3S90A 1RKCA 2LQGA 4IGGA 1DOVA 2GWWA 2IBFA 4ONSA 1YDIA 2HSQA 1T01A 5L0CA 1SYQA 5L0IA 4W8PA 4PR9A 1U6HA 1ST6A 4DJ9A 4E17A 1ZVZA 3RF3A 3ZDLA 1L7CA 3H2UA 1U89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJ6 A;  2GDC A;  1RKE A;  3TJ5 A;  2X0C A;  1DOW A;  1TR2 A;  5L0F A;  2B0H A;  3MYI A;  1H6G A;  4K1O A;  1ZW2 A;  3VF0 A;  4E18 A;  4P9T A;  1XWJ A;  5FZT A;  5L0J A;  3H2V A;  1ZW3 A;  5L0D A;  1QKR A;  5L0H A;  5L0G A;  2L7A A;  4EHP A;  1RKE B;  3T6G B;  3S90 A;  1RKC A;  2LQG A;  4IGG A;  1DOV A;  2GWW A;  2IBF A;  4ONS A;  1YDI A;  2HSQ A;  1T01 A;  5L0C A;  1SYQ A;  5L0I A;  4W8P A;  4PR9 A;  1U6H A;  1ST6 A;  4DJ9 A;  4E17 A;  1ZVZ A;  3RF3 A;  3ZDL A;  1L7C A;  3H2U A;  1U89 A; 
#chains in the Genus database with same CATH topology
 1XZP A;  2D5R B;  2HMZ A;  4EUK B;  1FMV A;  2P1A A;  2IXM A;  3GWN A;  3LLK A;  3U8V A;  4AL0 A;  2ZXW C;  5COM A;  3K1H A;  1TQG A;  2XLV A;  4O6Y A;  4WGY A;  2J8W A;  4MVM A;  4EBB A;  5FCL A;  1TWH A;  2J46 A;  1AEP A;  3DWW A;  3GEH A;  4BEM J;  2P6V A;  4MQ9 F;  4OIR F;  2EIM C;  3M4C A;  1BZ4 A;  5COF A;  4E0H A;  3HNK A;  1OW7 A;  1Q0G A;  1WN0 A;  4MTO A;  4QI2 A;  2L9J A;  1QQ3 A;  3R7C A;  3RQG A;  4LDQ A;  3CZ6 A;  1I4Z A;  2EIL C;  5TJ5 E;  4AL1 A;  4AX2 A;  4XPW A;  1ZHY A;  3CAX A;  3FOP A;  1I4Y A;  1RJ9 B;  2XLW A;  3AOU A;  3EZH A;  3M1C B;  3SZR A;  3DAF A;  3JT1 A;  4CS9 C;  1VTM P;  1U6H A;  2IXP A;  1NBB A;  1HMD A;  1ZVZ A;  4G7H F;  1L7C A;  2M64 A;  3NKD A;  4YT2 A;  2J9B A;  2JX0 A;  3G50 A;  5DQT A;  3UGP A;  4J30 B;  2A6H F;  3M79 A;  1FFT C;  4IWB A;  3SXY A;  3GWL A;  3ZQV A;  3I5P A;  2ZXP A;  4EBK A;  1NSG B;  4ZLC A;  4CDV A;  2E87 A;  1NLX A;  2CYD A;  5EHH A;  4IAO A;  1LS1 A;  3KH2 A;  3QW1 A;  3U2M A;  1M57 C;  3SNH A;  2RSE B;  4XLP F;  3PMR A;  4JVS A;  2OJQ A;  5AC5 A;  1VLS A;  5CIV A;  4NY3 A;  1VOM A;  4MW3 A;  4Z9I A;  2EIK C;  5L0I A;  3L0I A;  2BL2 A;  3EHM A;  1FNT c;  1Z3I X;  2J0X A;  4XEV A;  4RD9 A;  3K66 A;  3NMI A;  1RCP A;  2Q9B A;  4JRZ A;  3C18 A;  1TWG A;  1VK5 A;  4Q7C A;  1QSP A;  2G62 A;  4EKW A;  3EH1 A;  3N0T A;  4P9T A;  1S05 A;  2XLH A;  3IQC A;  1NFN A;  4PJJ A;  2QLA A;  4JJG A;  3Q7G A;  2PX3 A;  4XTK A;  1NU9 C;  2ZD9 A;  4DVY P;  2HV6 A;  1ORJ A;  2YVK A;  3UNG C;  2G3V A;  2OEX A;  2R7Q A;  2XRH A;  3DXJ F;  4D4X A;  1V54 C;  2LQG A;  4XEF A;  3DD7 A;  4PJN A;  1E84 A;  2NSF A;  4OIP F;  5DS5 A;  1NFO A;  1ORS C;  2V3C C;  2R05 A;  1YAR O;  4CIP A;  3KYJ A;  1H9T A;  3CEX A;  4DRI B;  5HSW A;  2R9R B;  2KNH A;  5T3W A;  1Y4C A;  3V5Z A;  1T6I A;  3ASO C;  3EHN A;  3K1I C;  1NZE A;  2R7X A;  2YLI A;  3N24 A;  4NTF A;  2AWY A;  1UG7 A;  1J8Y F;  2KQ9 A;  3MYI A;  5A6B A;  3M15 A;  3NYJ A;  4G78 A;  3UMH A;  4DXW A;  1MMA A;  2DGJ A;  5DS4 A;  2LCH A;  4CSA A;  2O9X A;  2AWC A;  3O6X A;  4JEA A;  2NPU A;  2TMV P;  2A0U A;  3QVZ A;  1LPE A;  3EGD A;  2J7P D;  4JIO A;  3U0C A;  2A68 F;  1I5N A;  1ZHW A;  4JJF A;  5L0G A;  3POV A;  3JZ0 A;  3T6J A;  2YRF A;  3AG2 C;  2ZXO A;  4PAC A;  4BPM A;  4JCZ A;  3ZWI A;  5DS6 A;  5KYU B;  4FX5 A;  1F1M A;  3TOM A;  1S7Z A;  3FMS A;  1SYQ A;  2DI3 A;  3AQB A;  2BC5 A;  1K05 A;  3B71 A;  4YWQ A;  1PCX A;  3HNI A;  3RVZ A;  3WOD F;  2HS5 A;  3AG4 C;  1A7V A;  4JE9 A;  1VB5 A;  1MMN A;  2KSF A;  2Z15 A;  4ULW A;  3A11 A;  1JRA A;  2EPN A;  2EPO A;  1RKE A;  3TJ6 A;  1V4A A;  1ZHT A;  5KYW A;  1H9G A;  1XZQ A;  4WAB A;  3KL4 A;  5GPG B;  1M6T A;  3W2W A;  1T9K A;  1ZYR F;  4R32 A;  3SYN A;  1YJG A;  3DAG A;  3RIP A;  3MYF A;  2WZF A;  3JCU Q;  2AVK A;  2Y3D A;  3C8G A;  2L6F A;  3TQO A;  5CI8 A;  3WAQ A;  1HMO A;  2R03 A;  1VLT A;  3FAP B;  3U9J A;  3H65 A;  2DYS C;  5L0H A;  2Y69 C;  1EKY A;  2QNL A;  2NUT A;  5EK0 A;  1RXQ A;  1CPR A;  1A7D A;  1CGN A;  1RKC A;  3B0P A;  3CQZ A;  3SEO A;  4P9F A;  2J7P A;  3ECS A;  3L1M A;  4LDR A;  2ZPA A;  4YJW A;  1E85 A;  4I3M A;  5BQG A;  1HY5 A;  5DLJ A;  1EI7 A;  5A6K A;  4CSA C;  2J45 A;  3ABK C;  4MVO A;  2AU5 A;  3IHU A;  3EGD B;  2Q4F A;  3N2Z B;  2X0C A;  3DJU B;  3LUT B;  3T6B A;  1JR8 A;  4GYT A;  4JUR I;  2DYR C;  2YKZ A;  3WHN A;  1Q0D A;  2OCC C;  3FVY A;  4YT5 A;  2WL8 A;  4QDL A;  4YL3 A;  1SZI A;  3EZI A;  5KYU A;  2CDQ A;  3VF0 A;  4E18 A;  5EGY A;  1OCR C;  4Q4Z F;  2J0W A;  2P61 A;  2XLM A;  3IEE A;  3K7D A;  1VMA A;  1C03 A;  1FFH A;  2CW0 F;  2VC9 A;  2FGY A;  4U5D E;  1FR0 A;  3Q6N A;  5KYW B;  4PJM A;  1RKE B;  1OW8 A;  4YT8 A;  1G5Z A;  2J9V A;  3V5X A;  3L34 A;  4MND A;  4XLN F;  4DBR A;  1CPQ A;  2WB7 A;  4I44 A;  3EH2 A;  4OD4 A;  1K40 A;  3C8G B;  5E33 A;  3LEV A;  3GEE A;  2P0N A;  1LKX A;  1TFO B;  1Z7Q c;  2AP3 A;  4X0R A;  3U8P A;  3ZDL A;  4C3B A;  2PX0 A;  3DZA A;  2W4M A;  2PP4 A;  1O87 A;  3DJN B;  2YL1 A;  4HFK B;  4MS2 A;  5JSL A;  4K7B A;  2NUT B;  4FAP B;  2B0H A;  3LNR A;  3TD7 A;  4XQ1 A;  2R25 A;  2UUH A;  1M2V B;  2YWA A;  3ATP A;  4D4N A;  1YYX A;  3EGX A;  3ZTM A;  4G7Z F;  2A0B A;  1NG1 A;  4N4W A;  2WZG A;  1OKK D;  1BR2 A;  4KC9 A;  3KPH A;  3QW0 A;  4U9D A;  2LFD A;  3ITF A;  3RH3 A;  3WG7 C;  2B0J A;  1D1A A;  256B A;  2WVN A;  4QI0 A;  2HFI A;  2IYL D;  3X1O A;  5JT4 A;  2IM8 A;  1ZU4 A;  3DM9 B;  3EFO A;  3AGU A;  3UMI A;  1VYK A;  3T9O A;  1QPU A;  1Z23 A;  1MND A;  1TFK B;  1ZU5 A;  1A7E A;  1OQC A;  2YLD A;  3JYY A;  4IJJ A;  4OD5 A;  5BQH A;  5L3V A;  2CCY A;  2KK1 A;  3DM5 A;  4P6I C;  2EIN C;  5AGF A;  1JPN A;  1LE2 A;  2PFD A;  3RW0 A;  4MVZ A;  3LEO A;  3OWT A;  3U3B A;  1D0Y A;  3F47 A;  1MMG A;  2HSB A;  3IQT A;  4WJ0 A;  2Q9A A;  1PV3 A;  2P7V A;  2CNW D;  3QVY A;  1E86 A;  1LI5 A;  2YEV A;  3NYM A;  3C8Z A;  2JD3 A;  2QUP A;  3GM3 A;  3NYL A;  4MVS A;  3C62 A;  3IQ5 A;  4CX9 A;  3I4U A;  2XS1 A;  5KYN A;  3W2V A;  4C7O A;  3EG9 A;  1CGM E;  5L0J A;  3J06 A;  2ICW G;  4GEH A;  3O55 A;  2KJG A;  3DKA A;  3MLG A;  2R7S A;  1JMW A;  1RMV A;  2EPL X;  1TKN A;  1OXK A;  2VCB A;  3G4X A;  2MHR A;  4PJL A;  4O79 A;  4L6R A;  1EA8 A;  2GWW A;  3KMI A;  2XL8 A;  4CDY A;  2W45 A;  2Q3T A;  1Z6A A;  3HNL A;  1T01 A;  2R7O A;  3EGX B;  2ZXR A;  4WGZ A;  2WVQ A;  5DQZ A;  5JVE A;  4KI2 A;  1ST6 A;  2X51 A;  2IXN A;  2IOQ A;  3QZC A;  5CI9 A;  3ZSU A;  4DVZ A;  3MX3 A;  5T3T A;  2GAQ A;  1T5O A;  3EFO B;  1FAP B;  1C17 M;  4LDK A;  5JLI A;  4H54 A;  1MQV A;  4IB4 A;  1A0B A;  1C02 A;  4Z9H A;  3HLZ A;  1SMY F;  1V55 C;  2OEV A;  4YL0 A;  5K0I A;  3ASN C;  2XS8 A;  2XL6 A;  3TUL A;  1QZX A;  1U0B B;  3SP1 A;  4ULV A;  2J9U A;  4J7Y A;  4YK5 A;  1Q0F A;  3TOL A;  2YHS A;  3US6 A;  4EHP A;  2VAS A;  1LE4 A;  4OIN F;  2R7W A;  1APC A;  2G3K A;  3TK0 A;  4JKV A;  3OEO A;  4G7O F;  1IZM A;  2A1D D;  2YLG A;  3C7J A;  5JUA A;  2VB6 A;  4LLC A;  4XPY A;  4C7O B;  3EG9 B;  1O3U A;  2HZ8 A;  2I8B A;  3V5Y A;  4CJG A;  3FXH A;  3O39 A;  1H7I A;  2QTV A;  3PDM P;  3S84 A;  2L6H A;  1QVX A;  1KU2 A;  3JRT A;  1UFB A;  1WWP A;  3DI5 A;  4JTA B;  3ZIB A;  3G4Z A;  4U5C E;  2C03 A;  1E83 A;  3RQE A;  1GM5 A;  4N6C A;  4RBN A;  1E2X A;  3AG1 C;  1FMW A;  3KYI A;  2VCC A;  2V26 A;  3ZQY A;  3JYH A;  2LP4 A;  4NC3 A;  1HE9 A;  2I15 A;  3MFN A;  2HKV A;  5DVW A;  3SXK A;  3B0V C;  3W8I A;  4CBE A;  3T6G B;  4U5F E;  4EWC A;  3LNM B;  5IY5 C;  3LES A;  4U5E E;  2YQY A;  1TWA A;  3S29 A;  2XLD A;  4AK9 A;  2R7T A;  5BUO A;  2Y3G A;  5JP7 A;  2LSE A;  3LS1 A;  3VRC A;  1GGQ A;  3HJC A;  4NCQ A;  5KYX A;  4Z9J A;  2BE5 F;  3H2U A;  3HTK C;  5JS5 A;  4LAC B;  1MMD A;  2XXA A;  2GDC A;  2DB4 A;  2OQM A;  3GM1 A;  3Q7L A;  1DOW A;  3UMK A;  1TR2 A;  3LAY A;  1Z5Z A;  2Y3B A;  5T1D B;  3K33 A;  4MVU A;  1ZW2 A;  3DE9 A;  4F4B A;  4E7Z A;  3NKE A;  3ZC4 A;  1G8X A;  1CGO A;  3OA1 A;  2LFF A;  3I5Q A;  1XWJ A;  4PK4 A;  4LLE A;  4DOZ A;  3GOR A;  4B6I A;  4I1M A;  2WZL A;  3BEH A;  1J8M F;  2D4U A;  3RQF A;  2EPK X;  5E3A A;  4N06 A;  4A2N B;  4E0I A;  2RD9 A;  2FFH A;  3ABL C;  4J7T A;  1DOV A;  4C3D A;  1BDJ B;  1YDI A;  5E2Q A;  2OJE D;  3VAY A;  4EIY A;  4AE4 A;  5L3Q A;  2HJ3 A;  2NUP A;  3GEI A;  4MW8 A;  4BG0 A;  1WAS A;  4U9E A;  2OG2 A;  2M4E A;  2HV7 A;  3JRM O;  1ZHZ A;  2KYH A;  4IAQ A;  4N6H A;  2PF4 E;  4CJO A;  1ORY A;  1R5I D;  1WGW A;  3RFY A;  2IXO A;  2YL7 A;  1H6G A;  2VCA A;  1KNY A;  2HMQ A;  4CS8 A;  4NQF A;  3SXM A;  5F28 E;  3V7O A;  1LIH A;  2ETS A;  3ABM C;  3EQL F;  3NMK A;  2VH3 A;  4JCH A;  1D1C A;  3LS0 A;  4LER A;  2XLO A;  3AGT A;  3DMD A;  2HJM A;  4YL1 A;  1AUE A;  4YT4 A;  1K04 A;  5KYX B;  2OU6 A;  2H8A A;  5KYY A;  2XXA B;  2HUJ A;  2Y3H A;  4BJT A;  1ZHX A;  3FHD A;  3QMK A;  2XLE A;  4J32 B;  3E9V A;  1BBH A;  3C63 A;  3T4R A;  4IGG A;  4OIO F;  1A41 A;  4ONS A;  2OOC A;  2R02 A;  4JC7 A;  4GQH A;  4BJ1 A;  1Y6D A;  2MYS A;  3JSZ A;  3UR3 C;  2XM4 A;  3JTL O;  1R4T A;  3S9O A;  1HE1 A;  5BQI A;  2LIG A;  4RDA A;  3AJM A;  2H7B A;  4MTG A;  1OW6 A;  4XWJ A;  3FDQ A;  5L0F A;  2OKU A;  3AG3 C;  5HV9 A;  5F5F A;  3A9C A;  1G4W R;  5F5H A;  1OXB A;  4FES A;  3VM6 A;  4ZLD A;  3IPM O;  1KTM A;  3JSE O;  4AE4 B;  2NUP B;  3K1I A;  3RYL A;  1BR4 A;  1G4U S;  1LS4 A;  1NU7 D;  3O10 A;  1JPJ A;  2CGE A;  3S27 A;  1PD1 A;  4K0D A;  1OR3 A;  3H2V A;  2XL4 A;  4MVQ A;  3RKO F;  3ZVR A;  2KGO A;  4KNW A;  4NTB A;  3NDB B;  2QE9 A;  1LI7 A;  4OIQ F;  1YA7 O;  3L8J A;  1OKK A;  1SF8 A;  5B1A C;  2EPM X;  1BR1 A;  2Q9C A;  2XM0 A;  4KBL A;  2HSQ A;  3AQC A;  5L0C A;  1O5H A;  3L8I A;  4IAR A;  4W8P A;  4CS8 C;  3BRJ A;  3FOO A;  4XPX A;  5A6B D;  4BJ6 A;  2C04 A;  4FWV A;  5A6A A;  3HNJ A;  4ANJ A;  4M63 A;  4U5H A;  2NSG A;  1QLE C;  3PCV A;  5KYY B;  5D91 A;  3B9Q A;  5B3S C;  1VYI A;  3GOD A;  1OCO C;  3VYW A;  2Q7R A;  1TWC A;  3SXZ A;  3NG1 A;  1JOG A;  1OCC C;  1EQ1 A;  1ZZP A;  3CSK A;  4NTA A;  2CNW A;  1HW1 A;  5B3I A;  1JAF A;  4DBQ A;  4O7G A;  5FZT A;  4BJ5 C;  4BEJ A;  4C3E A;  2R7U A;  2A69 F;  4EBJ A;  2GFH A;  2YL0 A;  3E70 C;  2UUI A;  4JTC B;  3NMJ A;  4YN0 B;  2KW3 C;  3GM2 A;  1Q0K A;  2MWQ A;  4CS7 A;  3B29 A;  1B68 A;  2KC3 A;  4O6M A;  4PR9 A;  5AC4 A;  1D0Z A;  3R2P A;  3S0X A;  4JTD B;  2WVO A;  2YL3 A;  2H7V C;  3C8G D;  1YVI A;  4CDA A;  3F46 A;  1T6Q A;  3K6B A;  1OCZ C;  3U9M A;  1V74 B;  4U5B E;  4K1O A;  2Q00 A;  1YYJ A;  4JEB A;  2QY9 A;  3FAJ A;  3HKK A;  5D92 A;  1YA9 A;  3EJN A;  5A69 A;  4JW1 A;  3EPV A;  2R7V A;  1HW2 A;  1GQA A;  2W4B A;  4JZA A;  1WOL A;  3U5S A;  1WAT A;  2W9Y A;  4BJ6 C;  1L3P A;  1PD0 A;  4PFP A;  3B0U X;  1QKR A;  3S28 A;  1SR2 A;  2L7A A;  3KKB A;  4A4A A;  2GA0 A;  3LJB A;  3IQ6 A;  4E7S A;  4XEK A;  4UDV A;  2PNO A;  3QTH A;  3ZTZ A;  2PBE A;  4DRJ B;  4DRH B;  4KNV A;  3X2Q C;  1D1B A;  1AVO B;  3ZG1 A;  3NRH A;  4ER9 A;  1LM3 B;  2F22 A;  3LLI A;  5E3C A;  1OR2 A;  3RF3 A;  1T6U A;  4I1O B;  2J9W A;  1FTS A;  4U5G A;  2H7O A;  3TJ5 A;  1LVK A;  3W8H A;  1M2O A;  1W2W A;  3Q6M A;  1MNE A;  1M56 C;  1N1C A;  2Y39 A;  2YZS A;  1YZA A;  3M4B A;  1RJ9 A;  3GAN A;  4HE8 D;  4IRU A;  1YLM A;  4CS9 A;  2EIJ C;  1D0X A;  2L6G A;  2L81 A;  3RVY A;  4H4K C;  3W4Y A;  3PHF 2;  5A6J A;  3DE8 A;  2R7R A;  1ZW3 A;  2FAP B;  5L0D A;  3U3F A;  4BJ5 A;  1WTY A;  1M2V A;  2NG1 A;  3S90 A;  4Q5S F;  4CIH A;  1IW7 F;  4HFF B;  1Z63 A;  1GS9 A;  2IBF A;  2LK4 A;  3UGO A;  2LD6 A;  2ASR A;  5JRA A;  1YZC A;  3MBG A;  4PFO A;  5B1B C;  1Q0M A;  1YAU O;  5COG A;  3U2L A;  2A6E F;  4DJ9 A;  4MVR A;  4MTF A;  4E17 A;  2XSE A;  4HEA J;  4G0H A;  4O6N A;  2JPU A;  4W8K A;  1U89 A; 
#chains in the Genus database with same CATH homology
 3TJ6 A;  2GDC A;  1RKE A;  3TJ5 A;  2X0C A;  1DOW A;  1TR2 A;  5L0F A;  2B0H A;  3MYI A;  1H6G A;  4K1O A;  1ZW2 A;  3VF0 A;  4E18 A;  4P9T A;  1XWJ A;  5FZT A;  5L0J A;  3H2V A;  1ZW3 A;  5L0D A;  1QKR A;  5L0H A;  5L0G A;  2L7A A;  4EHP A;  1RKE B;  3T6G B;  3S90 A;  1RKC A;  2LQG A;  4IGG A;  1DOV A;  2GWW A;  2IBF A;  4ONS A;  1YDI A;  2HSQ A;  1T01 A;  5L0C A;  1SYQ A;  5L0I A;  4W8P A;  4PR9 A;  1U6H A;  1ST6 A;  4DJ9 A;  4E17 A;  1ZVZ A;  3RF3 A;  3ZDL A;  1L7C A;  3H2U A;  1U89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...