1ZW2A

Vinculin head (0-258) in complex with the talin rod residues 2345-2369
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
251
structure length
251
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Vinculin
total genus 105
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw2A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw2A01
1DOVA 1T01A 2GWWA 5L0FA 1ZW3A 3MYIA 4ONSA 3ZDLA 3S90A 4W8PA 1U89A 5FZTA 5L0HA 4PR9A 3TJ5A 2LQGA 4IGGA 2IBFA 3H2VA 2B0HA 4P9TA 5L0IA 1H6GA 2L7AA 1QKRA 2X0CA 3TJ6A 4E17A 1ZW2A 1DOWA 3VF0A 4DJ9A 3RF3A 4E18A 1TR2A 1YDIA 1SYQA 4EHPA 5L0CA 1L7CA 1ST6A 1XWJA 1RKEA 1RKEB 5L0DA 5L0GA 1RKCA 1ZVZA 3T6GB 5L0JA 2HSQA 2GDCA 1U6HA 3H2UA 4K1OA
chains in the Genus database with same CATH superfamily
2PP4A 1PD0A 5A6BA 1V74B 3U8PA 1Y4CA 2P1AA 4AE4B 4BEMJ 3MYIA 4C3EA 2XXAA 3V5YA 3ZDLA 4E0IA 3RKOF 4E0HA 4G7HF 1SF8A 4DBQA 3W8HA 4LDRA 1NZEA 2XS8A 3JSEO 5E33A 4AL1A 5AC5A 1ORSC 2CGEA 2CDQA 5GPGB 4EWCA 2EIMC 2Q9AA 1V55C 3UMIA 3WAQA 1MNDA 3DJNB 5A6JA 3KMIA 3IPMO 1PD1A 1G8XA 1YZAA 1ZZPA 3CEXA 4FX5A 3GEIA 2Q9CA 3B9QA 1OQCA 1RKEB 1VLSA 1J8MF 4I1OB 3IQ5A 1JR8A 2C03A 2KK1A 2DB4A 2GFHA 4U5BE 5HSWA 3DM9B 1JOGA 4JC7A 3VM6A 2Y3BA 3PHF2 4CIHA 1NSGB 3HNIA 3S27A 4EBBA 1Y6DA 1M2VB 2PNOA 4HFFB 4BJ6C 4A4AA 4ZLDA 3LAYA 4DBRA 1IZMA 1U89A 5JVEA 1N1CA 3E70C 1JMWA 3T6GB 5CI9A 3EH1A 3LNMB 3T6JA 3GWLA 3ZG1A 4W8KA 3RQGA 3SXZA 4CSAC 3FXHA 4YT4A 4AX2A 1AVOB 4Z9JA 3J06A 3ZC4A 4U5FE 3TK0A 4CS8C 2IXOA 2XLWA 1OKKD 3K66A 4IRUA 2XS1A 2HSBA 2NG1A 2VCAA 3U5SA 5TJ5E 2RD9A 2ASRA 1WN0A 1Q0FA 2NUPB 2OEVA 3AOUA 4AK9A 3KYJA 2WZGA 4YT5A 1RJ9B 3U3BA 3RW0A 1EA8A 2NSGA 3C8ZA 4P6IC 3MYFA 3JCUQ 4OIOF 4JRZA 1G5ZA 1Z6AA 2D5RB 1OCCC 2H7OA 3SXMA 3NG1A 1NLXA 2A1DD 1EQ1A 2LQGA 3B0UX 1NU9C 3DKAA 3MX3A 4Z9IA 1R5ID 4DRIB 1I5NA 2NSFA 5KYWB 3T9OA 2R7SA 4DJ9A 4QI0A 2HUJA 2YVKA 3RF3A 1LKXA 2YL0A 3VF0A 1FR0A 1OXKA 4D4XA 1S05A 3QVYA 4H54A 2EPNA 2MHRA 3LNRA 4OINF 1QLEC 2VASA 4N4WA 1ZU4A 1OCRC 1QQ3A 4MVOA 4PFOA 3U2LA 4AL0A 1E2XA 4O79A 1HY5A 3V5XA 1V4AA 3C7JA 2YLGA 2Y3HA 1Z3IX 4IJJA 3ZQYA 1LI5A 4GYTA 4K7BA 4DXWA 1LS1A 1VLTA 4ZLCA 2YQYA 1KTMA 3DE8A 1OXBA 4HEAJ 2XM0A 4XTKA 5D92A 3S28A 1LE2A 5DQZA 4JE9A 4CSAA 2Q9BA 1EI7A 2GA0A 1AUEA 1MNEA 1Q0GA 3QW1A 2EIKC 3NYLA 4XEVA 2FFHA 3HKKA 3U8VA 4UDVA 3EJNA 3DAFA 5JP7A 1PCXA 1ZW2A 4E18A 3U3FA 2Q00A 5L3QA 1O87A 4YWQA 1AEPA 1LE4A 1CGOA 4MVSA 3IQTA 5E3AA 3UGOA 2TMVP 2R7OA 3FVYA 3GORA 4HE8D 4ULVA 3T6BA 3I5QA 3SP1A 1YVIA 1PV3A 3ATPA 3VYWA 5KYNA 2QNLA 2VB6A 4FESA 4FWVA 1K04A 1NFNA 3JZ0A 1JPNA 4NC3A 1HMDA 2D4UA 2XM4A 2XRHA 3EH2A 4PJJA 3EPVA 2OCCC 3PDMP 2J9WA 3FAJA 3JSZA 2Y3GA 2ZD9A 3WHNA 3B0VC 1OCZC 2KYHA 2JX0A 1LI7A 1M56C 1YARO 1D1CA 2H7VC 4R32A 1APCA 1IW7F 1Z5ZA 2H8AA 2IYLD 2WL8A 2XLOA 4N6CA 4I1MA 5L0HA 1Q0MA 3FAPB 1YLMA 2BC5A 1T6UA 2HMQA 3AJMA 3M1CB 4ANJA 3UGPA 1QSPA 3JRMO 3LJBA 3KPHA 1H6GA 2L7AA 1RCPA 2LP4A 2MWQA 4MVRA 2X0CA 4ER9A 3TOMA 4G7OF 1BBHA 3ZWIA 4C7OB 1QVXA 4C7OA 3K33A 2V26A 1O5HA 2XLHA 4MNDA 3M4CA 3GEEA 4YL1A 1D0XA 2KQ9A 3U0CA 3N24A 5BUOA 1BR1A 2W4BA 4XEFA 2XLDA 2J0WA 3L34A 3FHDA 2NUTA 3W2VA 4BJ5A 3ABKC 4DVZA 2OKUA 4G0HA 4MS2A 5JRAA 3EQLF 3VAYA 1SR2A 2PBEA 2XLEA 2YKZA 1UG7A 3AG4C 1BDJB 3R2PA 4AE4A 5HV9A 1LIHA 2XXAB 2WZFA 1GQAA 1K40A 3C62A 4MVMA 4QI2A 3AQBA 2HKVA 5F5HA 5EHHA 3AQCA 1NFOA 1S7ZA 3H2VA 1OW6A 3EZHA 4U5HA 4E7ZA 5L0IA 1JAFA 1TWGA 4O6YA 1GGQA 2EPOA 4QDLA 3ZTMA 3C8GA 1ZHYA 2ZXPA 2WB7A 2IXMA 4O6NA 2YZSA 3C8GB 1TR2A 3EGDB 2AU5A 4RD9A 4ULWA 2A0BA 2A6HF 2Q4FA 3EFOB 1OR2A 2H7BA 2G62A 1T5OA 1RKEA 2AWYA 3EFOA 3DD7A 2YL7A 2LD6A 4XPYA 3RIPA 3S9OA 4FAPB 1A41A 1TFKB 1A7VA 1RKCA 3AG1C 4F4BA 1ZVZA 4XWJA 1Q0DA 5B3SC 2HFIA 2L6HA 3HNLA 4MTGA 2XL6A 3V5ZA 2OG2A 5D91A 3GEHA 3NKEA 4J7TA 5AGFA 1B68A 1YAUO 3MBGA 4MVQA 3MLGA 3R7CA 1OW8A 3SZRA 2YLDA 3GWNA 5T3TA 4XLNF 2F22A 4WABA 1QPUA 3TULA 2NPUA 5DS5A 4RDAA 1MMAA 1C17M 2I15A 3O10A 3NDBB 4PFPA 2B0HA 3ABMC 4J30B 2JPUA 3M4BA 4Q5SF 2QUPA 2CNWA 3EZIA 4O7GA 1WTYA 1Z23A 4JURI 2JD3A 3US6A 1XWJA 4CS8A 2R03A 1V54C 3IQCA 5L0GA 1VYIA 4BG0A 4JKVA 3B29A 3X1OA 1RJ9A 2L81A 1Q0KA 2LCHA 2X51A 3ZSUA 1XZPA 4LERA 2ZXOA 3S84A 3ECSA 1VTMP 4K1OA 2CNWD 1ZHXA 3A9CA 2CYDA 2R7RA 1GS9A 2DI3A 1FTSA 1MMDA 3U9JA 3JYHA 2DYSC 4IAQA 4NQFA 2FAPB 4N6HA 2J7PA 2R7UA 4K0DA 1MQVA 4IB4A 1T6IA 2Y3DA 5L3VA 5KYWA 2IXNA 4X0RA 4E17A 3I4UA 3LESA 3ASNC 3ABLC 4EUKB 4KC9A 2BE5F 1YDIA 4PJLA 3BRJA 2J46A 3RVZA 2P0NA 3W8IA 5JT4A 1D0YA 5F28E 1A7DA 2HJ3A 4JJGA 3KH2A 1F1MA 2L6GA 1KU2A 5K0IA 4CBEA 2M64A 4OIQF 1HW2A 1TWCA 2XLVA 3UMHA 4U5GA 1FFHA 1MMNA 2ICWG 1ZW3A 4JCZA 4YL3A 4BPMA 3DJUB 3DAGA 3Q7GA 1T9KA 4NY3A 4PR9A 5BQGA 3AG2C 3POVA 2ZXRA 1TWAA 4CJOA 4KNVA 4DOZA 4BJ5C 3L1MA 3S0XA 1TKNA 2QLAA 5A6KA 2V3CC 2VC9A 1QKRA 2HV7A 2R25A 1NU7D 2W9YA 1DOWA 1D1AA 2EPKX 3MFNA 3WG7C 3B71A 3L8JA 2VH3A 1NG1A 2OJQA 1CPQA 3RYLA 4P9FA 1ST6A 4J32B 1CGNA 2R9RB 2LFFA 3EG9A 4XLPF 2P6VA 4Q7CA 3EG9B 2Y69C 2P7VA 2LFDA 4IAOA 4O6MA 3Q7LA 3RVYA 4CJGA 4CS7A 4E7SA 4KI2A 4J7YA 1LM3B 1SYQA 3H2UA 1M2VA 4U5CE 4WGZA 1YZCA 2Q3TA 3U9MA 1VYKA 2WVNA 5DQTA 3EHMA 4ONSA 5A6AA 3S90A 4LDKA 1SZIA 1OR3A 1ZHTA 1R4TA 3IEEA 3Q6NA 1A0BA 1LPEA 1OW7A 3QTHA 3UR3C 3HJCA 4LDQA 5E2QA 1FNTc 2OJED 2ZPAA 2KSFA 3QMKA 5JSLA 5DVWA 3BEHA 2EPMX 3EGXA 1Z63A 2EILC 4CIPA 3EGXB 4BJ6A 3TD7A 3HTKC 3LUTB 5B3IA 3GANA 5KYUA 5BQIA 2VCCA 1OCOC 3TQOA 4CDYA 3RQEA 1TFOB 2W45A 4C3DA 2R05A 1BR2A 2YHSA 2YL1A 2DYRC 3U2MA 256BA 3SYNA 1YYJA 4L6RA 1NBBA 1BR4A 4MTOA 4YJWA 5B1BC 2R02A 1HE1A 2WVQA 3IQ6A 1BZ4A 2DGJA 2P61A 5JS5A 3NRHA 3NYMA 5L0JA 2IOQA 4JEAA 4Q4ZF 3NMKA 4P9TA 5COFA 5FCLA 3VRCA 3ZQVA 4EKWA 3EGDA 2L9JA 3DWWA 4DRHB 2ZXWC 4DVYP 4YT2A 2J8WA 2YLIA 4I44A 5EK0A 3DI5A 5L0CA 1G4WR 1E83A 5JUAA 2HMZA 3GODA 3JRTA 4MTFA 4JJFA 1TWHA 2YEVA 4MW8A 4PACA 4LACB 2KJGA 1YA9A 1RXQA 2A69F 3KKBA 1FAPB 5IY5C 5JLIA 3A11A 2J0XA 2LIGA 1C03A 1YYXA 4CS9A 2LK4A 1LS4A 4U5DE 4XEKA 5L0FA 1M57C 1HW1A 1XZQA 3O6XA 4NCQA 4YT8A 2OQMA 3SXKA 3LS1A 3NKDA 4EBKA 4BEJA 2OEXA 3F46A 3HLZA 3LLKA 3KYIA 4A2NB 2PF4E 3CSKA 4OD4A 4OIPF 5KYXA 3CZ6A 1M6TA 4LLEA 1Z7Qc 1GM5A 4JTDB 5T1DB 2J9BA 3S29A 3PMRA 1W2WA 2EIJC 2Z15A 1L7CA 4N06A 5DS4A 3GM1A 1UFBA 3C18A 2J9VA 1SMYF 1ZHZA 4C3BA 5L0DA 3W4YA 1RMVA 5COGA 2HZ8A 3AGTA 3GM3A 3LS0A 3L8IA 3L0IA 2CW0F 1OKKA 3G50A 3O39A 2Y39A 3OA1A 3OEOA 2PX3A 2LSEA 3EHNA 1WOLA 2OU6A 1I4YA 3FOPA 2A0UA 2AWCA 1ORYA 3F47A 3JTLO 5B1AC 4GQHA 5A69A 1KNYA 2UUIA 3SEOA 3TJ5A 3ZIBA 1ZU5A 4JIOA 1FFTC 1JPJA 1ZHWA 4LLCA 5E3CA 4EIYA 3E9VA 1C02A 3TOLA 1VMAA 2M4EA 3ZVRA 2YRFA 3NMJA 4YK5A 3SNHA 2KNHA 1FMVA 3QW0A 5KYUB 1EKYA 2KGOA 3DZAA 4CDAA 1FMWA 3JYYA 1VK5A 2NUPA 2RSEB 1WWPA 2NUTB 3LEOA 4YL0A 3V7OA 2A68F 5DS6A 4IARA 1U6HA 4RBNA 1VB5A 4HFKB 5COMA 4NTAA 1K05A 1T01A 1HE9A 1TQGA 2R7QA 3K7DA 5F5FA 2KC3A 2L6FA 4XPWA 4MVZA 4EBJA 4CS9C 4CX9A 1WGWA 2BL2A 1H7IA 2PX0A 4JTCB 3B0PA 2WVOA 4IGGA 3M15A 3C63A 4NTBA 4Z9HA 4U9DA 2IM8A 5A6BD 1WATA 3N2ZB 3DM5A 3TJ6A 3O55A 1YA7O 2QTVA 3OWTA 4B6IA 3NYJA 4D4NA 3FDQA 2FGYA 5CIVA 2Q7RA 3KL4A 4EHPA 5EGYA 1MMGA 3ITFA 5T3WA 5AC4A 1WASA 1I4ZA 4YN0B 1J8YF 2MYSA 3JT1A 2G3KA 3CAXA 1O3UA 4JW1A 2WZLA 4JTAB 3K1IA 3N0TA 4XQ1A 2XL8A 1E84A 2XL4A 2R7TA 3K1HA 2B0JA 4KBLA 4BJ1A 2YL3A 2J45A 3IHUA 4G78A 5DLJA 5BQHA 4W8PA 2EPLX 4OIRF 2J9UA 2J7PD 3K6BA 4H4KC 4WJ0A 1E85A 3QZCA 1HMOA 2R7WA 3UNGC 1YJGA 3CQZA 4BJTA 2KW3C 3AG3C 4JEBA 4PJNA 5KYXB 4KNWA 4MW3A 4JCHA 3GM2A 3DXJF 3NMIA 2GAQA 2OOCA 3AGUA 3PCVA 4G7ZF 2YWAA 2A6EF 2VCBA 3DE9A 4MQ9F 4OD5A 2E87A 2UUHA 4U9EA 2XLMA 4IWBA 1LVKA 4PK4A 3RQFA 1U0BB 1VOMA 2ETSA 2HJMA 1H9GA 3ASOC 2HSQA 4CDVA 1H9TA 3RH3A 3LLIA 3G4XA 3W2WA 3ZTZA 1DOVA 4JZAA 2GWWA 2HV6A 4GEHA 4PJMA 3WODF 2HS5A 2C04A 2EINC 1CPRA 3T4RA 1QZXA 4NTFA 4WGYA 5FZTA 2R7VA 2PFDA 4DRJB 4U5EE 3K1IC 2IBFA 2I8BA 1L3PA 1G4US 1D0ZA 1ORJA 3HNKA 3X2QC 4XPXA 2XSEA 3FOOA 3QVZA 4MVUA 1JRAA 3FMSA 3LEVA 4I3MA 2QE9A 5KYYA 1M2OA 2QY9A 3H65A 3SXYA 1E86A 5KYYB 3DMDA 4JVSA 2G3VA 2IXPA 3Q6MA 1A7EA 1T6QA 1D1BA 3HNJA 2W4MA 2AVKA 3M79A 2R7XA 2O9XA 4M63A 5CI8A 2CCYA 2AP3A 1ZYRF 3UMKA 3G4ZA 1CGME 2GDCA 3I5PA 3RFYA 3C8GD
chains in the Genus database with same CATH topology
1DOVA 1T01A 2GWWA 5L0FA 1ZW3A 3MYIA 4ONSA 3ZDLA 3S90A 4W8PA 1U89A 5FZTA 5L0HA 4PR9A 3TJ5A 2LQGA 4IGGA 2IBFA 3H2VA 2B0HA 4P9TA 5L0IA 1H6GA 2L7AA 1QKRA 2X0CA 3TJ6A 4E17A 1ZW2A 1DOWA 3VF0A 4DJ9A 3RF3A 4E18A 1TR2A 1YDIA 1SYQA 4EHPA 5L0CA 1L7CA 1ST6A 1XWJA 1RKEA 1RKEB 5L0DA 5L0GA 1RKCA 1ZVZA 3T6GB 5L0JA 2HSQA 2GDCA 1U6HA 3H2UA 4K1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOV A;  1T01 A;  2GWW A;  5L0F A;  1ZW3 A;  3MYI A;  4ONS A;  3ZDL A;  3S90 A;  4W8P A;  1U89 A;  5FZT A;  5L0H A;  4PR9 A;  3TJ5 A;  2LQG A;  4IGG A;  2IBF A;  3H2V A;  2B0H A;  4P9T A;  5L0I A;  1H6G A;  2L7A A;  1QKR A;  2X0C A;  3TJ6 A;  4E17 A;  1ZW2 A;  1DOW A;  3VF0 A;  4DJ9 A;  3RF3 A;  4E18 A;  1TR2 A;  1YDI A;  1SYQ A;  4EHP A;  5L0C A;  1L7C A;  1ST6 A;  1XWJ A;  1RKE A;  1RKE B;  5L0D A;  5L0G A;  1RKC A;  1ZVZ A;  3T6G B;  5L0J A;  2HSQ A;  2GDC A;  1U6H A;  3H2U A;  4K1O A; 
#chains in the Genus database with same CATH topology
 2PP4 A;  1PD0 A;  5A6B A;  1V74 B;  3U8P A;  1Y4C A;  2P1A A;  4AE4 B;  4BEM J;  3MYI A;  4C3E A;  2XXA A;  3V5Y A;  3ZDL A;  4E0I A;  3RKO F;  4E0H A;  4G7H F;  1SF8 A;  4DBQ A;  3W8H A;  4LDR A;  1NZE A;  2XS8 A;  3JSE O;  5E33 A;  4AL1 A;  5AC5 A;  1ORS C;  2CGE A;  2CDQ A;  5GPG B;  4EWC A;  2EIM C;  2Q9A A;  1V55 C;  3UMI A;  3WAQ A;  1MND A;  3DJN B;  5A6J A;  3KMI A;  3IPM O;  1PD1 A;  1G8X A;  1YZA A;  1ZZP A;  3CEX A;  4FX5 A;  3GEI A;  2Q9C A;  3B9Q A;  1OQC A;  1RKE B;  1VLS A;  1J8M F;  4I1O B;  3IQ5 A;  1JR8 A;  2C03 A;  2KK1 A;  2DB4 A;  2GFH A;  4U5B E;  5HSW A;  3DM9 B;  1JOG A;  4JC7 A;  3VM6 A;  2Y3B A;  3PHF 2;  4CIH A;  1NSG B;  3HNI A;  3S27 A;  4EBB A;  1Y6D A;  1M2V B;  2PNO A;  4HFF B;  4BJ6 C;  4A4A A;  4ZLD A;  3LAY A;  4DBR A;  1IZM A;  1U89 A;  5JVE A;  1N1C A;  3E70 C;  1JMW A;  3T6G B;  5CI9 A;  3EH1 A;  3LNM B;  3T6J A;  3GWL A;  3ZG1 A;  4W8K A;  3RQG A;  3SXZ A;  4CSA C;  3FXH A;  4YT4 A;  4AX2 A;  1AVO B;  4Z9J A;  3J06 A;  3ZC4 A;  4U5F E;  3TK0 A;  4CS8 C;  2IXO A;  2XLW A;  1OKK D;  3K66 A;  4IRU A;  2XS1 A;  2HSB A;  2NG1 A;  2VCA A;  3U5S A;  5TJ5 E;  2RD9 A;  2ASR A;  1WN0 A;  1Q0F A;  2NUP B;  2OEV A;  3AOU A;  4AK9 A;  3KYJ A;  2WZG A;  4YT5 A;  1RJ9 B;  3U3B A;  3RW0 A;  1EA8 A;  2NSG A;  3C8Z A;  4P6I C;  3MYF A;  3JCU Q;  4OIO F;  4JRZ A;  1G5Z A;  1Z6A A;  2D5R B;  1OCC C;  2H7O A;  3SXM A;  3NG1 A;  1NLX A;  2A1D D;  1EQ1 A;  2LQG A;  3B0U X;  1NU9 C;  3DKA A;  3MX3 A;  4Z9I A;  1R5I D;  4DRI B;  1I5N A;  2NSF A;  5KYW B;  3T9O A;  2R7S A;  4DJ9 A;  4QI0 A;  2HUJ A;  2YVK A;  3RF3 A;  1LKX A;  2YL0 A;  3VF0 A;  1FR0 A;  1OXK A;  4D4X A;  1S05 A;  3QVY A;  4H54 A;  2EPN A;  2MHR A;  3LNR A;  4OIN F;  1QLE C;  2VAS A;  4N4W A;  1ZU4 A;  1OCR C;  1QQ3 A;  4MVO A;  4PFO A;  3U2L A;  4AL0 A;  1E2X A;  4O79 A;  1HY5 A;  3V5X A;  1V4A A;  3C7J A;  2YLG A;  2Y3H A;  1Z3I X;  4IJJ A;  3ZQY A;  1LI5 A;  4GYT A;  4K7B A;  4DXW A;  1LS1 A;  1VLT A;  4ZLC A;  2YQY A;  1KTM A;  3DE8 A;  1OXB A;  4HEA J;  2XM0 A;  4XTK A;  5D92 A;  3S28 A;  1LE2 A;  5DQZ A;  4JE9 A;  4CSA A;  2Q9B A;  1EI7 A;  2GA0 A;  1AUE A;  1MNE A;  1Q0G A;  3QW1 A;  2EIK C;  3NYL A;  4XEV A;  2FFH A;  3HKK A;  3U8V A;  4UDV A;  3EJN A;  3DAF A;  5JP7 A;  1PCX A;  1ZW2 A;  4E18 A;  3U3F A;  2Q00 A;  5L3Q A;  1O87 A;  4YWQ A;  1AEP A;  1LE4 A;  1CGO A;  4MVS A;  3IQT A;  5E3A A;  3UGO A;  2TMV P;  2R7O A;  3FVY A;  3GOR A;  4HE8 D;  4ULV A;  3T6B A;  3I5Q A;  3SP1 A;  1YVI A;  1PV3 A;  3ATP A;  3VYW A;  5KYN A;  2QNL A;  2VB6 A;  4FES A;  4FWV A;  1K04 A;  1NFN A;  3JZ0 A;  1JPN A;  4NC3 A;  1HMD A;  2D4U A;  2XM4 A;  2XRH A;  3EH2 A;  4PJJ A;  3EPV A;  2OCC C;  3PDM P;  2J9W A;  3FAJ A;  3JSZ A;  2Y3G A;  2ZD9 A;  3WHN A;  3B0V C;  1OCZ C;  2KYH A;  2JX0 A;  1LI7 A;  1M56 C;  1YAR O;  1D1C A;  2H7V C;  4R32 A;  1APC A;  1IW7 F;  1Z5Z A;  2H8A A;  2IYL D;  2WL8 A;  2XLO A;  4N6C A;  4I1M A;  5L0H A;  1Q0M A;  3FAP B;  1YLM A;  2BC5 A;  1T6U A;  2HMQ A;  3AJM A;  3M1C B;  4ANJ A;  3UGP A;  1QSP A;  3JRM O;  3LJB A;  3KPH A;  1H6G A;  2L7A A;  1RCP A;  2LP4 A;  2MWQ A;  4MVR A;  2X0C A;  4ER9 A;  3TOM A;  4G7O F;  1BBH A;  3ZWI A;  4C7O B;  1QVX A;  4C7O A;  3K33 A;  2V26 A;  1O5H A;  2XLH A;  4MND A;  3M4C A;  3GEE A;  4YL1 A;  1D0X A;  2KQ9 A;  3U0C A;  3N24 A;  5BUO A;  1BR1 A;  2W4B A;  4XEF A;  2XLD A;  2J0W A;  3L34 A;  3FHD A;  2NUT A;  3W2V A;  4BJ5 A;  3ABK C;  4DVZ A;  2OKU A;  4G0H A;  4MS2 A;  5JRA A;  3EQL F;  3VAY A;  1SR2 A;  2PBE A;  2XLE A;  2YKZ A;  1UG7 A;  3AG4 C;  1BDJ B;  3R2P A;  4AE4 A;  5HV9 A;  1LIH A;  2XXA B;  2WZF A;  1GQA A;  1K40 A;  3C62 A;  4MVM A;  4QI2 A;  3AQB A;  2HKV A;  5F5H A;  5EHH A;  3AQC A;  1NFO A;  1S7Z A;  3H2V A;  1OW6 A;  3EZH A;  4U5H A;  4E7Z A;  5L0I A;  1JAF A;  1TWG A;  4O6Y A;  1GGQ A;  2EPO A;  4QDL A;  3ZTM A;  3C8G A;  1ZHY A;  2ZXP A;  2WB7 A;  2IXM A;  4O6N A;  2YZS A;  3C8G B;  1TR2 A;  3EGD B;  2AU5 A;  4RD9 A;  4ULW A;  2A0B A;  2A6H F;  2Q4F A;  3EFO B;  1OR2 A;  2H7B A;  2G62 A;  1T5O A;  1RKE A;  2AWY A;  3EFO A;  3DD7 A;  2YL7 A;  2LD6 A;  4XPY A;  3RIP A;  3S9O A;  4FAP B;  1A41 A;  1TFK B;  1A7V A;  1RKC A;  3AG1 C;  4F4B A;  1ZVZ A;  4XWJ A;  1Q0D A;  5B3S C;  2HFI A;  2L6H A;  3HNL A;  4MTG A;  2XL6 A;  3V5Z A;  2OG2 A;  5D91 A;  3GEH A;  3NKE A;  4J7T A;  5AGF A;  1B68 A;  1YAU O;  3MBG A;  4MVQ A;  3MLG A;  3R7C A;  1OW8 A;  3SZR A;  2YLD A;  3GWN A;  5T3T A;  4XLN F;  2F22 A;  4WAB A;  1QPU A;  3TUL A;  2NPU A;  5DS5 A;  4RDA A;  1MMA A;  1C17 M;  2I15 A;  3O10 A;  3NDB B;  4PFP A;  2B0H A;  3ABM C;  4J30 B;  2JPU A;  3M4B A;  4Q5S F;  2QUP A;  2CNW A;  3EZI A;  4O7G A;  1WTY A;  1Z23 A;  4JUR I;  2JD3 A;  3US6 A;  1XWJ A;  4CS8 A;  2R03 A;  1V54 C;  3IQC A;  5L0G A;  1VYI A;  4BG0 A;  4JKV A;  3B29 A;  3X1O A;  1RJ9 A;  2L81 A;  1Q0K A;  2LCH A;  2X51 A;  3ZSU A;  1XZP A;  4LER A;  2ZXO A;  3S84 A;  3ECS A;  1VTM P;  4K1O A;  2CNW D;  1ZHX A;  3A9C A;  2CYD A;  2R7R A;  1GS9 A;  2DI3 A;  1FTS A;  1MMD A;  3U9J A;  3JYH A;  2DYS C;  4IAQ A;  4NQF A;  2FAP B;  4N6H A;  2J7P A;  2R7U A;  4K0D A;  1MQV A;  4IB4 A;  1T6I A;  2Y3D A;  5L3V A;  5KYW A;  2IXN A;  4X0R A;  4E17 A;  3I4U A;  3LES A;  3ASN C;  3ABL C;  4EUK B;  4KC9 A;  2BE5 F;  1YDI A;  4PJL A;  3BRJ A;  2J46 A;  3RVZ A;  2P0N A;  3W8I A;  5JT4 A;  1D0Y A;  5F28 E;  1A7D A;  2HJ3 A;  4JJG A;  3KH2 A;  1F1M A;  2L6G A;  1KU2 A;  5K0I A;  4CBE A;  2M64 A;  4OIQ F;  1HW2 A;  1TWC A;  2XLV A;  3UMH A;  4U5G A;  1FFH A;  1MMN A;  2ICW G;  1ZW3 A;  4JCZ A;  4YL3 A;  4BPM A;  3DJU B;  3DAG A;  3Q7G A;  1T9K A;  4NY3 A;  4PR9 A;  5BQG A;  3AG2 C;  3POV A;  2ZXR A;  1TWA A;  4CJO A;  4KNV A;  4DOZ A;  4BJ5 C;  3L1M A;  3S0X A;  1TKN A;  2QLA A;  5A6K A;  2V3C C;  2VC9 A;  1QKR A;  2HV7 A;  2R25 A;  1NU7 D;  2W9Y A;  1DOW A;  1D1A A;  2EPK X;  3MFN A;  3WG7 C;  3B71 A;  3L8J A;  2VH3 A;  1NG1 A;  2OJQ A;  1CPQ A;  3RYL A;  4P9F A;  1ST6 A;  4J32 B;  1CGN A;  2R9R B;  2LFF A;  3EG9 A;  4XLP F;  2P6V A;  4Q7C A;  3EG9 B;  2Y69 C;  2P7V A;  2LFD A;  4IAO A;  4O6M A;  3Q7L A;  3RVY A;  4CJG A;  4CS7 A;  4E7S A;  4KI2 A;  4J7Y A;  1LM3 B;  1SYQ A;  3H2U A;  1M2V A;  4U5C E;  4WGZ A;  1YZC A;  2Q3T A;  3U9M A;  1VYK A;  2WVN A;  5DQT A;  3EHM A;  4ONS A;  5A6A A;  3S90 A;  4LDK A;  1SZI A;  1OR3 A;  1ZHT A;  1R4T A;  3IEE A;  3Q6N A;  1A0B A;  1LPE A;  1OW7 A;  3QTH A;  3UR3 C;  3HJC A;  4LDQ A;  5E2Q A;  1FNT c;  2OJE D;  2ZPA A;  2KSF A;  3QMK A;  5JSL A;  5DVW A;  3BEH A;  2EPM X;  3EGX A;  1Z63 A;  2EIL C;  4CIP A;  3EGX B;  4BJ6 A;  3TD7 A;  3HTK C;  3LUT B;  5B3I A;  3GAN A;  5KYU A;  5BQI A;  2VCC A;  1OCO C;  3TQO A;  4CDY A;  3RQE A;  1TFO B;  2W45 A;  4C3D A;  2R05 A;  1BR2 A;  2YHS A;  2YL1 A;  2DYR C;  3U2M A;  256B A;  3SYN A;  1YYJ A;  4L6R A;  1NBB A;  1BR4 A;  4MTO A;  4YJW A;  5B1B C;  2R02 A;  1HE1 A;  2WVQ A;  3IQ6 A;  1BZ4 A;  2DGJ A;  2P61 A;  5JS5 A;  3NRH A;  3NYM A;  5L0J A;  2IOQ A;  4JEA A;  4Q4Z F;  3NMK A;  4P9T A;  5COF A;  5FCL A;  3VRC A;  3ZQV A;  4EKW A;  3EGD A;  2L9J A;  3DWW A;  4DRH B;  2ZXW C;  4DVY P;  4YT2 A;  2J8W A;  2YLI A;  4I44 A;  5EK0 A;  3DI5 A;  5L0C A;  1G4W R;  1E83 A;  5JUA A;  2HMZ A;  3GOD A;  3JRT A;  4MTF A;  4JJF A;  1TWH A;  2YEV A;  4MW8 A;  4PAC A;  4LAC B;  2KJG A;  1YA9 A;  1RXQ A;  2A69 F;  3KKB A;  1FAP B;  5IY5 C;  5JLI A;  3A11 A;  2J0X A;  2LIG A;  1C03 A;  1YYX A;  4CS9 A;  2LK4 A;  1LS4 A;  4U5D E;  4XEK A;  5L0F A;  1M57 C;  1HW1 A;  1XZQ A;  3O6X A;  4NCQ A;  4YT8 A;  2OQM A;  3SXK A;  3LS1 A;  3NKD A;  4EBK A;  4BEJ A;  2OEX A;  3F46 A;  3HLZ A;  3LLK A;  3KYI A;  4A2N B;  2PF4 E;  3CSK A;  4OD4 A;  4OIP F;  5KYX A;  3CZ6 A;  1M6T A;  4LLE A;  1Z7Q c;  1GM5 A;  4JTD B;  5T1D B;  2J9B A;  3S29 A;  3PMR A;  1W2W A;  2EIJ C;  2Z15 A;  1L7C A;  4N06 A;  5DS4 A;  3GM1 A;  1UFB A;  3C18 A;  2J9V A;  1SMY F;  1ZHZ A;  4C3B A;  5L0D A;  3W4Y A;  1RMV A;  5COG A;  2HZ8 A;  3AGT A;  3GM3 A;  3LS0 A;  3L8I A;  3L0I A;  2CW0 F;  1OKK A;  3G50 A;  3O39 A;  2Y39 A;  3OA1 A;  3OEO A;  2PX3 A;  2LSE A;  3EHN A;  1WOL A;  2OU6 A;  1I4Y A;  3FOP A;  2A0U A;  2AWC A;  1ORY A;  3F47 A;  3JTL O;  5B1A C;  4GQH A;  5A69 A;  1KNY A;  2UUI A;  3SEO A;  3TJ5 A;  3ZIB A;  1ZU5 A;  4JIO A;  1FFT C;  1JPJ A;  1ZHW A;  4LLC A;  5E3C A;  4EIY A;  3E9V A;  1C02 A;  3TOL A;  1VMA A;  2M4E A;  3ZVR A;  2YRF A;  3NMJ A;  4YK5 A;  3SNH A;  2KNH A;  1FMV A;  3QW0 A;  5KYU B;  1EKY A;  2KGO A;  3DZA A;  4CDA A;  1FMW A;  3JYY A;  1VK5 A;  2NUP A;  2RSE B;  1WWP A;  2NUT B;  3LEO A;  4YL0 A;  3V7O A;  2A68 F;  5DS6 A;  4IAR A;  1U6H A;  4RBN A;  1VB5 A;  4HFK B;  5COM A;  4NTA A;  1K05 A;  1T01 A;  1HE9 A;  1TQG A;  2R7Q A;  3K7D A;  5F5F A;  2KC3 A;  2L6F A;  4XPW A;  4MVZ A;  4EBJ A;  4CS9 C;  4CX9 A;  1WGW A;  2BL2 A;  1H7I A;  2PX0 A;  4JTC B;  3B0P A;  2WVO A;  4IGG A;  3M15 A;  3C63 A;  4NTB A;  4Z9H A;  4U9D A;  2IM8 A;  5A6B D;  1WAT A;  3N2Z B;  3DM5 A;  3TJ6 A;  3O55 A;  1YA7 O;  2QTV A;  3OWT A;  4B6I A;  3NYJ A;  4D4N A;  3FDQ A;  2FGY A;  5CIV A;  2Q7R A;  3KL4 A;  4EHP A;  5EGY A;  1MMG A;  3ITF A;  5T3W A;  5AC4 A;  1WAS A;  1I4Z A;  4YN0 B;  1J8Y F;  2MYS A;  3JT1 A;  2G3K A;  3CAX A;  1O3U A;  4JW1 A;  2WZL A;  4JTA B;  3K1I A;  3N0T A;  4XQ1 A;  2XL8 A;  1E84 A;  2XL4 A;  2R7T A;  3K1H A;  2B0J A;  4KBL A;  4BJ1 A;  2YL3 A;  2J45 A;  3IHU A;  4G78 A;  5DLJ A;  5BQH A;  4W8P A;  2EPL X;  4OIR F;  2J9U A;  2J7P D;  3K6B A;  4H4K C;  4WJ0 A;  1E85 A;  3QZC A;  1HMO A;  2R7W A;  3UNG C;  1YJG A;  3CQZ A;  4BJT A;  2KW3 C;  3AG3 C;  4JEB A;  4PJN A;  5KYX B;  4KNW A;  4MW3 A;  4JCH A;  3GM2 A;  3DXJ F;  3NMI A;  2GAQ A;  2OOC A;  3AGU A;  3PCV A;  4G7Z F;  2YWA A;  2A6E F;  2VCB A;  3DE9 A;  4MQ9 F;  4OD5 A;  2E87 A;  2UUH A;  4U9E A;  2XLM A;  4IWB A;  1LVK A;  4PK4 A;  3RQF A;  1U0B B;  1VOM A;  2ETS A;  2HJM A;  1H9G A;  3ASO C;  2HSQ A;  4CDV A;  1H9T A;  3RH3 A;  3LLI A;  3G4X A;  3W2W A;  3ZTZ A;  1DOV A;  4JZA A;  2GWW A;  2HV6 A;  4GEH A;  4PJM A;  3WOD F;  2HS5 A;  2C04 A;  2EIN C;  1CPR A;  3T4R A;  1QZX A;  4NTF A;  4WGY A;  5FZT A;  2R7V A;  2PFD A;  4DRJ B;  4U5E E;  3K1I C;  2IBF A;  2I8B A;  1L3P A;  1G4U S;  1D0Z A;  1ORJ A;  3HNK A;  3X2Q C;  4XPX A;  2XSE A;  3FOO A;  3QVZ A;  4MVU A;  1JRA A;  3FMS A;  3LEV A;  4I3M A;  2QE9 A;  5KYY A;  1M2O A;  2QY9 A;  3H65 A;  3SXY A;  1E86 A;  5KYY B;  3DMD A;  4JVS A;  2G3V A;  2IXP A;  3Q6M A;  1A7E A;  1T6Q A;  1D1B A;  3HNJ A;  2W4M A;  2AVK A;  3M79 A;  2R7X A;  2O9X A;  4M63 A;  5CI8 A;  2CCY A;  2AP3 A;  1ZYR F;  3UMK A;  3G4Z A;  1CGM E;  2GDC A;  3I5P A;  3RFY A;  3C8G D; 
#chains in the Genus database with same CATH homology
 1DOV A;  1T01 A;  2GWW A;  5L0F A;  1ZW3 A;  3MYI A;  4ONS A;  3ZDL A;  3S90 A;  4W8P A;  1U89 A;  5FZT A;  5L0H A;  4PR9 A;  3TJ5 A;  2LQG A;  4IGG A;  2IBF A;  3H2V A;  2B0H A;  4P9T A;  5L0I A;  1H6G A;  2L7A A;  1QKR A;  2X0C A;  3TJ6 A;  4E17 A;  1ZW2 A;  1DOW A;  3VF0 A;  4DJ9 A;  3RF3 A;  4E18 A;  1TR2 A;  1YDI A;  1SYQ A;  4EHP A;  5L0C A;  1L7C A;  1ST6 A;  1XWJ A;  1RKE A;  1RKE B;  5L0D A;  5L0G A;  1RKC A;  1ZVZ A;  3T6G B;  5L0J A;  2HSQ A;  2GDC A;  1U6H A;  3H2U A;  4K1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...