2HKVA

Crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
b'GMTDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIKLDLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of conserved hypothetical protein RBL00553 (ZP_00537729.1) from EXIGUOBACTERIUM SP. 255-15 at 1.70 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Dna binding protein
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2hkvA01
5CIVA 2OQMA 2YQYA 3CEXA 2QNLA 2HKVA 1RXQA 3QTHA 2QE9A 4N6CA 5COGA 2F22A 2RD9A 3DKAA 2OU6A 5COFA 3DI5A 2NSGA 3GORA 5COMA 2NSFA 2P1AA
chains in the Genus database with same CATH superfamily
4AX2A 2DI3A 4FX5A 5KYUA 4AE4B 3HNKA 3U3FA 1WASA 4MVQA 3AQBA 4U5GA 3F46A 4OINF 2L6FA 4DXWA 2HMQA 3ECSA 3EGXA 2HSBA 4BEJA 3ZSUA 5A6BD 2Q9BA 2XLVA 3LJBA 3OEOA 3RF3A 1YJGA 1RMVA 5JSLA 1M2VA 2VCCA 3SZRA 3JT1A 4C3EA 1MMAA 2KK1A 3L1MA 4YT4A 5DS5A 3PMRA 4NY3A 5D91A 3ZVRA 4D4XA 2J9BA 3RQEA 2ICWG 1YARO 1QPUA 2J9VA 4MTOA 3C18A 2PF4E 2Y3GA 2HFIA 4QI0A 3ZTZA 2WZFA 3MBGA 2W45A 1CPQA 1L7CA 2CGEA 3S84A 3M79A 4RD9A 3K1HA 2ZPAA 5DVWA 1T6IA 2IOQA 4NC3A 2XXAA 2XL6A 3N2ZB 4JCZA 3TQOA 4FAPB 3B0VC 3UGOA 1MMDA 1HMDA 1RCPA 1ST6A 1A7VA 1ZYRF 2LFFA 2Q00A 2XLMA 3KYJA 4KBLA 5CIVA 3WHNA 5L0CA 2J7PD 4CBEA 2UUIA 3KYIA 2XM4A 4PJLA 5AC5A 1YYXA 4MVRA 1SF8A 4J32B 4JW1A 3ASOC 1C02A 2A0BA 1HE9A 1CGOA 3EQLF 4FESA 3A9CA 4MTGA 5B3IA 3EHMA 2D5RB 3DJNB 3EZIA 2LQGA 2HJMA 3IQ5A 3HNJA 1IW7F 2CNWA 2EINC 2FFHA 3Q6MA 1AUEA 2HV7A 3NYMA 4NTFA 3S0XA 3W2WA 3RFYA 3T4RA 2JX0A 5JLIA 1Q0FA 3JZ0A 1M56C 1QQ3A 1TFOB 4MVUA 5JUAA 3S27A 2LIGA 1LI5A 1MNDA 1Y6DA 2YL1A 1OW7A 3VRCA 4G0HA 2Q9AA 5DS4A 1YA7O 4E17A 1BZ4A 2R7TA 2YLIA 4ULWA 3L0IA 4MS2A 2EPLX 1FFTC 1PCXA 5B1BC 1A7DA 1E2XA 2A1DD 5AGFA 1ZZPA 2EIKC 4U9DA 2RSEB 3W4YA 4BJ6C 4J30B 2IXNA 3NKEA 1T6UA 5A69A 2HKVA 3F47A 4O6MA 3U8PA 3VF0A 4OD5A 2G62A 2ASRA 3QTHA 1VMAA 4JKVA 1LKXA 1GM5A 1M2OA 1VLTA 4DBQA 1EI7A 2IXMA 1YVIA 4O6YA 4YWQA 1OXBA 3I5PA 1YLMA 2BC5A 5COFA 4Z9HA 4DVZA 4JZAA 1LE2A 1XWJA 1Z23A 2B0HA 4XPWA 3FVYA 3TOMA 1ORJA 3K66A 4JTCB 1NU7D 2KQ9A 4JJGA 3RIPA 1QSPA 2NG1A 4U9EA 4XQ1A 2XLOA 3U9MA 5F5FA 3UNGC 4PJMA 3DE8A 4KNVA 1O87A 3GM1A 4UDVA 1Z63A 3HTKC 4G7ZF 4AL0A 3C8GA 2WZLA 1OW6A 3BEHA 3NMKA 4ULVA 5JRAA 1Q0MA 3RVYA 4YK5A 5A6KA 4P6IC 2H8AA 2C04A 2Q9CA 2ZXWC 2YLDA 3RYLA 2EIMC 2KGOA 2OU6A 3U2MA 4DOZA 2H7VC 3E9VA 4XLNF 3WAQA 1Z6AA 2NUPA 4NCQA 3M4CA 1G4WR 3MX3A 3VYWA 5A6BA 1UG7A 2YL7A 1TQGA 3V5XA 2L7AA 2OCCC 1TWGA 2CW0F 3ASNC 4H4KC 3U9JA 4CDAA 3RH3A 1XZPA 2DGJA 2LD6A 2QUPA 1OR2A 2Y69C 4E0IA 2QE9A 3HJCA 4NQFA 3H2VA 4PFOA 3FOPA 2P0NA 5CI8A 5EHHA 1HMOA 1FAPB 2HS5A 3EGXB 1KU2A 4O79A 4A2NB 1NBBA 5KYWB 2R05A 1U89A 5E3CA 2A0UA 4JE9A 4OIPF 1M2VB 4EBJA 2W4BA 3ZC4A 3ZDLA 1Y4CA 2MWQA 2J0WA 1J8YF 1SYQA 2D4UA 2J7PA 4I1MA 3RQGA 1SR2A 1D1CA 1O3UA 3FMSA 3TJ6A 5HSWA 2XRHA 4K7BA 3KMIA 4P9FA 1R5ID 4DJ9A 1EKYA 1PD1A 3PCVA 3HLZA 3TULA 3IPMO 4CS7A 1HE1A 1I4ZA 2XXAB 3U3BA 3C63A 3L34A 5BQHA 5IY5C 1BR2A 3ZIBA 4CSAC 3EZHA 3G50A 2XLEA 4W8KA 4Q5SF 2M4EA 1NU9C 4LDRA 4OIRF 2EILC 1T5OA 3G4XA 2EIJC 1D1AA 3DAFA 3DJUB 4MTFA 3QZCA 4JJFA 4RDAA 4XTKA 1JR8A 2PFDA 1I5NA 4CS9C 2R7VA 2PP4A 2DYSC 1QLEC 5L0DA 2R25A 2UUHA 1V4AA 3VM6A 2PNOA 1G5ZA 2YEVA 2PBEA 3JCUQ 2IYLD 3KH2A 4P9TA 1TR2A 3T6GB 4C7OB 5COMA 4BG0A 5KYWA 3NDBB 2DYRC 1VOMA 3CQZA 4CIPA 5JS5A 3W2VA 3L8JA 3S29A 2X51A 3DMDA 2R02A 3K1IC 5KYXA 2P1AA 3GANA 4C3DA 3B29A 4G78A 2WZGA 2YLGA 2AVKA 2OQMA 3AG4C 3O6XA 3S9OA 5B3SC 5BQIA 3LLKA 1TKNA 3LLIA 4JIOA 1WATA 3SXZA 3UMHA 3J06A 2HJ3A 2Y39A 1C17M 4OIQF 2XS1A 5BUOA 1A0BA 4JCHA 4CIHA 1C03A 5DQZA 5KYYA 4Z9IA 2FGYA 2Q4FA 2PX3A 2GA0A 1CGNA 2R03A 2YL0A 1OCCC 3OWTA 5TJ5E 4U5DE 4D4NA 2A69F 1TWAA 2QTVA 4LLCA 3MYIA 3AG3C 1MQVA 5E33A 4EKWA 1FNTc 2AU5A 1OCRC 4H54A 4WABA 3UMKA 1A7EA 1FTSA 4C7OA 3AGUA 5AC4A 2IM8A 2XM0A 1KTMA 2LSEA 4IRUA 5L3QA 2HV6A 3AJMA 1YYJA 2YWAA 2ZD9A 1Z3IX 2JD3A 1ZU5A 1Q0DA 2OJED 1HY5A 2AWYA 1V55C 3UMIA 4IWBA 4Z9JA 3B0UX 3ATPA 2HUJA 1AVOB 1VYKA 1OW8A 3JRMO 2CDQA 5FCLA 1GGQA 3OA1A 4L6RA 1BR1A 2A6HF 4IB4A 4YT2A 4XPXA 1D0ZA 4HEAJ 3VAYA 1RKEA 4EUKB 3AOUA 3IQCA 1ORYA 3O39A 3QVYA 3EFOB 2KJGA 3DKAA 2KYHA 1OCOC 2W9YA 3C8GB 4XEFA 3K1IA 3MFNA 4CDVA 4I44A 1YZCA 1ZW2A 4OD4A 5E2QA 1MMNA 2LK4A 3W8IA 3HNIA 3DI5A 1BDJB 4MW8A 4Q4ZF 2PX0A 2H7OA 2B0JA 2AWCA 2XSEA 1WWPA 256BA 3E70C 1S05A 2GAQA 3ITFA 3JYHA 4J7YA 1H9GA 4U5EE 2IXPA 1YA9A 1GS9A 3C8ZA 2NUPB 3RQFA 2R7SA 1ZHTA 1NG1A 1LI7A 1XZQA 2VB6A 2J9UA 3FOOA 4NTBA 1ZHWA 1LE4A 1GQAA 1S7ZA 2OJQA 2QY9A 3C62A 4I1OB 4Q7CA 3EFOA 1RKCA 3TOLA 4C3BA 2YL3A 2LFDA 3RVZA 2KSFA 2A6EF 3ZWIA 2WVQA 4K0DA 1KNYA 3X2QC 3O55A 4KC9A 2IBFA 3KL4A 3ZG1A 4MVMA 2V26A 2LCHA 2XLDA 4LLEA 4DRIB 2V3CC 5HV9A 4BJ6A 2L9JA 4U5CE 3TJ5A 3K6BA 3GWLA 3DD7A 2BL2A 3HNLA 4XEVA 1ZU4A 1A41A 1QKRA 1JAFA 2YZSA 4U5HA 3PDMP 1G8XA 1Q0KA 3K7DA 1I4YA 2GDCA 2ZXOA 4ZLCA 3DE9A 2VH3A 3KKBA 3GODA 3TK0A 3W8HA 2L81A 2XLWA 3NG1A 2NPUA 3ZQVA 3B9QA 4HE8D 4LERA 4U5BE 1M6TA 5DLJA 1OQCA 3FDQA 5L0HA 3LEVA 5A6AA 2F22A 4CJGA 1NFOA 5CI9A 3EG9B 3SXYA 3U5SA 1BBHA 4A4AA 2W4MA 2YHSA 4JVSA 5JVEA 4I3MA 1MNEA 4ER9A 3T6JA 2QLAA 3SP1A 1WOLA 3DXJF 3GORA 2L6GA 4PR9A 4AL1A 3JYYA 5JP7A 3H65A 5F5HA 2KC3A 3A11A 3T9OA 2CYDA 1K40A 4IJJA 4LDKA 3T6BA 3N24A 2X0CA 2YQYA 3LNMB 4LACB 3U8VA 2QNLA 5KYXB 5L0IA 1FFHA 1W2WA 3SNHA 3EG9A 1WTYA 3V5YA 3JTLO 5COGA 2EPMX 4EWCA 3AG1C 1APCA 1E86A 5DQTA 2KW3C 4KNWA 4XWJA 4OIOF 3ABMC 3Q7GA 1HW2A 4E7ZA 3SEOA 2EPKX 3NMIA 1J8MF 1T01A 4JTAB 3V7OA 2R7WA 5KYYB 4DBRA 4M63A 3WG7C 1AEPA 3RW0A 3B0PA 2DB4A 4BJ1A 4DRJB 2HSQA 1OR3A 1LPEA 3NMJA 3N0TA 2ETSA 2Z15A 1YZAA 1TWCA 3FXHA 1Z7Qc 4KI2A 1LIHA 2VASA 3IEEA 4MW3A 4BPMA 2J9WA 1VLSA 3LNRA 2NUTA 1F1MA 3EH1A 1QZXA 3IQ6A 2L6HA 1E84A 3S90A 1VTMP 4IGGA 1RJ9A 1VB5A 1ZHYA 1K05A 1M57C 1B68A 1BR4A 1ZHXA 2A68F 3GEIA 1EQ1A 1PD0A 1PV3A 2GFHA 2P7VA 1IZMA 1OKKD 2WVOA 4HFKB 5EK0A 2C03A 4F4BA 2R7XA 2JPUA 1SMYF 1FMWA 3LS1A 3FAPB 4YJWA 3V5ZA 4WGYA 1T9KA 1H9TA 2CCYA 3WODF 3MLGA 1RKEB 2YKZA 4HFFB 3ZQYA 2NSGA 2G3VA 2WL8A 3GM2A 4YL3A 1JMWA 5A6JA 4AE4A 4ZLDA 2H7BA 3U2LA 4CSAA 2Q3TA 4MVZA 4E0HA 1NZEA 2R7OA 2ZXPA 3RKOF 4B6IA 4DRHB 4IAOA 3IHUA 2G3KA 2Q7RA 4CS9A 3UGPA 3JRTA 3EPVA 3FAJA 5L0FA 2EPOA 3GEHA 1CPRA 1LM3B 1RXQA 3ABLC 2LP4A 3HKKA 4PK4A 4XPYA 4GEHA 3DZAA 4MNDA 1UFBA 5T3WA 5GPGB 5FZTA 4BJ5C 3MYFA 4CJOA 4CX9A 4YN0B 4N6HA 2VCAA 2TMVP 1ORSC 3L8IA 4CDYA 1VYIA 1E83A 1Z5ZA 3QW1A 3M15A 4YL0A 3R2PA 4JEBA 4MVSA 1WN0A 4O7GA 2OEXA 4CS8C 4J7TA 1LVKA 3JSEO 2XLHA 2J45A 4EBKA 3CSKA 2MHRA 2YVKA 3DWWA 1K04A 4K1OA 4MVOA 4XEKA 3M4BA 2I15A 1OXKA 5F28E 4R32A 4U5FE 2E87A 1U6HA 4QI2A 3QVZA 5L0JA 1DOWA 2OEVA 3CAXA 2Y3DA 4E18A 1MMGA 1V74B 4XLPF 3H2UA 1E85A 1Q0GA 3LUTB 3M1CB 3SYNA 2Y3HA 4N6CA 2VC9A 1JPNA 2EPNA 4PJJA 4BJTA 1EA8A 3LS0A 3EHNA 1JOGA 1O5HA 3CZ6A 4WGZA 2J46A 4G7HF 3KPHA 1WGWA 3UR3C 5K0IA 3LAYA 3NRHA 2KNHA 3EH2A 1NLXA 2XL4A 4N06A 5BQGA 4ANJA 5JT4A 3POVA 1U0BB 3X1OA 4YL1A 1VK5A 2P6VA 2BE5F 4FWVA 2FAPB 2CNWD 3C7JA 2I8BA 3GEEA 4O6NA 3SXKA 1T6QA 1NSGB 1YDIA 2WB7A 5EGYA 4BJ5A 4DVYP 4GQHA 2J0XA 3TD7A 2Y3BA 2R7QA 3S28A 3GWNA 2OKUA 4BEMJ 4EBBA 5L3VA 1CGME 4G7OF 3DM5A 5L0GA 4YT8A 1TFKB 4JEAA 2P61A 1H7IA 1HW1A 4IARA 2GWWA 1NFNA 2IXOA 4E7SA 1N1CA 3BRJA 4CS8A 3QW0A 4EHPA 4YT5A 5B1AC 2RD9A 3DAGA 3NYJA 3EGDB 1SZIA 3NYLA 3R7CA 1LS4A 1JPJA 3SXMA 3FHDA 3LESA 1ZW3A 3I4UA 4MQ9F 4RBNA 4JC7A 2OOCA 1L3PA 1ZVZA 3AGTA 3LEOA 5D92A 3AG2C 3I5QA 4X0RA 2HZ8A 3US6A 1QVXA 4WJ0A 3Q7LA 1H6GA 1OCZC 2OG2A 3NKDA 3O10A 4JTDB 2R7RA 3QMKA 2MYSA 4QDLA 3AQCA 1LS1A 1V54C 3ABKC 4PACA 2XL8A 1FR0A 1JRAA 3EJNA 3JSZA 2ZXRA 1OKKA 4ONSA 1DOVA 1G4US 1ZHZA 3G4ZA 2VCBA 3CEXA 2M64A 4AK9A 3EGDA 4N4WA 3ZTMA 2J8WA 2HMZA 5KYUB 4JRZA 5DS6A 4IAQA 2R7UA 4LDQA 2NUTB 1TWHA 2R9RB 5KYNA 3DM9B 3K33A 5E3AA 1YAUO 1RJ9B 5T1DB 4PJNA 5T3TA 4EIYA 4NTAA 1D1BA 3C8GD 2WVNA 3U0CA 3Q6NA 3IQTA 4W8PA 4GYTA 1R4TA 1FMVA 1D0XA 3PHF2 4PFPA 4JURI 2AP3A 1D0YA 2XS8A 2NSFA 3B71A 3GM3A 2YRFA 2O9XA
chains in the Genus database with same CATH topology
5CIVA 2OQMA 2YQYA 3CEXA 2QNLA 2HKVA 1RXQA 3QTHA 2QE9A 4N6CA 5COGA 2F22A 2RD9A 3DKAA 2OU6A 5COFA 3DI5A 2NSGA 3GORA 5COMA 2NSFA 2P1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CIV A;  2OQM A;  2YQY A;  3CEX A;  2QNL A;  2HKV A;  1RXQ A;  3QTH A;  2QE9 A;  4N6C A;  5COG A;  2F22 A;  2RD9 A;  3DKA A;  2OU6 A;  5COF A;  3DI5 A;  2NSG A;  3GOR A;  5COM A;  2NSF A;  2P1A A; 
#chains in the Genus database with same CATH topology
 4AX2 A;  2DI3 A;  4FX5 A;  5KYU A;  4AE4 B;  3HNK A;  3U3F A;  1WAS A;  4MVQ A;  3AQB A;  4U5G A;  3F46 A;  4OIN F;  2L6F A;  4DXW A;  2HMQ A;  3ECS A;  3EGX A;  2HSB A;  4BEJ A;  3ZSU A;  5A6B D;  2Q9B A;  2XLV A;  3LJB A;  3OEO A;  3RF3 A;  1YJG A;  1RMV A;  5JSL A;  1M2V A;  2VCC A;  3SZR A;  3JT1 A;  4C3E A;  1MMA A;  2KK1 A;  3L1M A;  4YT4 A;  5DS5 A;  3PMR A;  4NY3 A;  5D91 A;  3ZVR A;  4D4X A;  2J9B A;  3RQE A;  2ICW G;  1YAR O;  1QPU A;  2J9V A;  4MTO A;  3C18 A;  2PF4 E;  2Y3G A;  2HFI A;  4QI0 A;  3ZTZ A;  2WZF A;  3MBG A;  2W45 A;  1CPQ A;  1L7C A;  2CGE A;  3S84 A;  3M79 A;  4RD9 A;  3K1H A;  2ZPA A;  5DVW A;  1T6I A;  2IOQ A;  4NC3 A;  2XXA A;  2XL6 A;  3N2Z B;  4JCZ A;  3TQO A;  4FAP B;  3B0V C;  3UGO A;  1MMD A;  1HMD A;  1RCP A;  1ST6 A;  1A7V A;  1ZYR F;  2LFF A;  2Q00 A;  2XLM A;  3KYJ A;  4KBL A;  5CIV A;  3WHN A;  5L0C A;  2J7P D;  4CBE A;  2UUI A;  3KYI A;  2XM4 A;  4PJL A;  5AC5 A;  1YYX A;  4MVR A;  1SF8 A;  4J32 B;  4JW1 A;  3ASO C;  1C02 A;  2A0B A;  1HE9 A;  1CGO A;  3EQL F;  4FES A;  3A9C A;  4MTG A;  5B3I A;  3EHM A;  2D5R B;  3DJN B;  3EZI A;  2LQG A;  2HJM A;  3IQ5 A;  3HNJ A;  1IW7 F;  2CNW A;  2EIN C;  2FFH A;  3Q6M A;  1AUE A;  2HV7 A;  3NYM A;  4NTF A;  3S0X A;  3W2W A;  3RFY A;  3T4R A;  2JX0 A;  5JLI A;  1Q0F A;  3JZ0 A;  1M56 C;  1QQ3 A;  1TFO B;  4MVU A;  5JUA A;  3S27 A;  2LIG A;  1LI5 A;  1MND A;  1Y6D A;  2YL1 A;  1OW7 A;  3VRC A;  4G0H A;  2Q9A A;  5DS4 A;  1YA7 O;  4E17 A;  1BZ4 A;  2R7T A;  2YLI A;  4ULW A;  3L0I A;  4MS2 A;  2EPL X;  1FFT C;  1PCX A;  5B1B C;  1A7D A;  1E2X A;  2A1D D;  5AGF A;  1ZZP A;  2EIK C;  4U9D A;  2RSE B;  3W4Y A;  4BJ6 C;  4J30 B;  2IXN A;  3NKE A;  1T6U A;  5A69 A;  2HKV A;  3F47 A;  4O6M A;  3U8P A;  3VF0 A;  4OD5 A;  2G62 A;  2ASR A;  3QTH A;  1VMA A;  4JKV A;  1LKX A;  1GM5 A;  1M2O A;  1VLT A;  4DBQ A;  1EI7 A;  2IXM A;  1YVI A;  4O6Y A;  4YWQ A;  1OXB A;  3I5P A;  1YLM A;  2BC5 A;  5COF A;  4Z9H A;  4DVZ A;  4JZA A;  1LE2 A;  1XWJ A;  1Z23 A;  2B0H A;  4XPW A;  3FVY A;  3TOM A;  1ORJ A;  3K66 A;  4JTC B;  1NU7 D;  2KQ9 A;  4JJG A;  3RIP A;  1QSP A;  2NG1 A;  4U9E A;  4XQ1 A;  2XLO A;  3U9M A;  5F5F A;  3UNG C;  4PJM A;  3DE8 A;  4KNV A;  1O87 A;  3GM1 A;  4UDV A;  1Z63 A;  3HTK C;  4G7Z F;  4AL0 A;  3C8G A;  2WZL A;  1OW6 A;  3BEH A;  3NMK A;  4ULV A;  5JRA A;  1Q0M A;  3RVY A;  4YK5 A;  5A6K A;  4P6I C;  2H8A A;  2C04 A;  2Q9C A;  2ZXW C;  2YLD A;  3RYL A;  2EIM C;  2KGO A;  2OU6 A;  3U2M A;  4DOZ A;  2H7V C;  3E9V A;  4XLN F;  3WAQ A;  1Z6A A;  2NUP A;  4NCQ A;  3M4C A;  1G4W R;  3MX3 A;  3VYW A;  5A6B A;  1UG7 A;  2YL7 A;  1TQG A;  3V5X A;  2L7A A;  2OCC C;  1TWG A;  2CW0 F;  3ASN C;  4H4K C;  3U9J A;  4CDA A;  3RH3 A;  1XZP A;  2DGJ A;  2LD6 A;  2QUP A;  1OR2 A;  2Y69 C;  4E0I A;  2QE9 A;  3HJC A;  4NQF A;  3H2V A;  4PFO A;  3FOP A;  2P0N A;  5CI8 A;  5EHH A;  1HMO A;  1FAP B;  2HS5 A;  3EGX B;  1KU2 A;  4O79 A;  4A2N B;  1NBB A;  5KYW B;  2R05 A;  1U89 A;  5E3C A;  2A0U A;  4JE9 A;  4OIP F;  1M2V B;  4EBJ A;  2W4B A;  3ZC4 A;  3ZDL A;  1Y4C A;  2MWQ A;  2J0W A;  1J8Y F;  1SYQ A;  2D4U A;  2J7P A;  4I1M A;  3RQG A;  1SR2 A;  1D1C A;  1O3U A;  3FMS A;  3TJ6 A;  5HSW A;  2XRH A;  4K7B A;  3KMI A;  4P9F A;  1R5I D;  4DJ9 A;  1EKY A;  1PD1 A;  3PCV A;  3HLZ A;  3TUL A;  3IPM O;  4CS7 A;  1HE1 A;  1I4Z A;  2XXA B;  3U3B A;  3C63 A;  3L34 A;  5BQH A;  5IY5 C;  1BR2 A;  3ZIB A;  4CSA C;  3EZH A;  3G50 A;  2XLE A;  4W8K A;  4Q5S F;  2M4E A;  1NU9 C;  4LDR A;  4OIR F;  2EIL C;  1T5O A;  3G4X A;  2EIJ C;  1D1A A;  3DAF A;  3DJU B;  4MTF A;  3QZC A;  4JJF A;  4RDA A;  4XTK A;  1JR8 A;  2PFD A;  1I5N A;  4CS9 C;  2R7V A;  2PP4 A;  2DYS C;  1QLE C;  5L0D A;  2R25 A;  2UUH A;  1V4A A;  3VM6 A;  2PNO A;  1G5Z A;  2YEV A;  2PBE A;  3JCU Q;  2IYL D;  3KH2 A;  4P9T A;  1TR2 A;  3T6G B;  4C7O B;  5COM A;  4BG0 A;  5KYW A;  3NDB B;  2DYR C;  1VOM A;  3CQZ A;  4CIP A;  5JS5 A;  3W2V A;  3L8J A;  3S29 A;  2X51 A;  3DMD A;  2R02 A;  3K1I C;  5KYX A;  2P1A A;  3GAN A;  4C3D A;  3B29 A;  4G78 A;  2WZG A;  2YLG A;  2AVK A;  2OQM A;  3AG4 C;  3O6X A;  3S9O A;  5B3S C;  5BQI A;  3LLK A;  1TKN A;  3LLI A;  4JIO A;  1WAT A;  3SXZ A;  3UMH A;  3J06 A;  2HJ3 A;  2Y39 A;  1C17 M;  4OIQ F;  2XS1 A;  5BUO A;  1A0B A;  4JCH A;  4CIH A;  1C03 A;  5DQZ A;  5KYY A;  4Z9I A;  2FGY A;  2Q4F A;  2PX3 A;  2GA0 A;  1CGN A;  2R03 A;  2YL0 A;  1OCC C;  3OWT A;  5TJ5 E;  4U5D E;  4D4N A;  2A69 F;  1TWA A;  2QTV A;  4LLC A;  3MYI A;  3AG3 C;  1MQV A;  5E33 A;  4EKW A;  1FNT c;  2AU5 A;  1OCR C;  4H54 A;  4WAB A;  3UMK A;  1A7E A;  1FTS A;  4C7O A;  3AGU A;  5AC4 A;  2IM8 A;  2XM0 A;  1KTM A;  2LSE A;  4IRU A;  5L3Q A;  2HV6 A;  3AJM A;  1YYJ A;  2YWA A;  2ZD9 A;  1Z3I X;  2JD3 A;  1ZU5 A;  1Q0D A;  2OJE D;  1HY5 A;  2AWY A;  1V55 C;  3UMI A;  4IWB A;  4Z9J A;  3B0U X;  3ATP A;  2HUJ A;  1AVO B;  1VYK A;  1OW8 A;  3JRM O;  2CDQ A;  5FCL A;  1GGQ A;  3OA1 A;  4L6R A;  1BR1 A;  2A6H F;  4IB4 A;  4YT2 A;  4XPX A;  1D0Z A;  4HEA J;  3VAY A;  1RKE A;  4EUK B;  3AOU A;  3IQC A;  1ORY A;  3O39 A;  3QVY A;  3EFO B;  2KJG A;  3DKA A;  2KYH A;  1OCO C;  2W9Y A;  3C8G B;  4XEF A;  3K1I A;  3MFN A;  4CDV A;  4I44 A;  1YZC A;  1ZW2 A;  4OD4 A;  5E2Q A;  1MMN A;  2LK4 A;  3W8I A;  3HNI A;  3DI5 A;  1BDJ B;  4MW8 A;  4Q4Z F;  2PX0 A;  2H7O A;  2B0J A;  2AWC A;  2XSE A;  1WWP A;  256B A;  3E70 C;  1S05 A;  2GAQ A;  3ITF A;  3JYH A;  4J7Y A;  1H9G A;  4U5E E;  2IXP A;  1YA9 A;  1GS9 A;  3C8Z A;  2NUP B;  3RQF A;  2R7S A;  1ZHT A;  1NG1 A;  1LI7 A;  1XZQ A;  2VB6 A;  2J9U A;  3FOO A;  4NTB A;  1ZHW A;  1LE4 A;  1GQA A;  1S7Z A;  2OJQ A;  2QY9 A;  3C62 A;  4I1O B;  4Q7C A;  3EFO A;  1RKC A;  3TOL A;  4C3B A;  2YL3 A;  2LFD A;  3RVZ A;  2KSF A;  2A6E F;  3ZWI A;  2WVQ A;  4K0D A;  1KNY A;  3X2Q C;  3O55 A;  4KC9 A;  2IBF A;  3KL4 A;  3ZG1 A;  4MVM A;  2V26 A;  2LCH A;  2XLD A;  4LLE A;  4DRI B;  2V3C C;  5HV9 A;  4BJ6 A;  2L9J A;  4U5C E;  3TJ5 A;  3K6B A;  3GWL A;  3DD7 A;  2BL2 A;  3HNL A;  4XEV A;  1ZU4 A;  1A41 A;  1QKR A;  1JAF A;  2YZS A;  4U5H A;  3PDM P;  1G8X A;  1Q0K A;  3K7D A;  1I4Y A;  2GDC A;  2ZXO A;  4ZLC A;  3DE9 A;  2VH3 A;  3KKB A;  3GOD A;  3TK0 A;  3W8H A;  2L81 A;  2XLW A;  3NG1 A;  2NPU A;  3ZQV A;  3B9Q A;  4HE8 D;  4LER A;  4U5B E;  1M6T A;  5DLJ A;  1OQC A;  3FDQ A;  5L0H A;  3LEV A;  5A6A A;  2F22 A;  4CJG A;  1NFO A;  5CI9 A;  3EG9 B;  3SXY A;  3U5S A;  1BBH A;  4A4A A;  2W4M A;  2YHS A;  4JVS A;  5JVE A;  4I3M A;  1MNE A;  4ER9 A;  3T6J A;  2QLA A;  3SP1 A;  1WOL A;  3DXJ F;  3GOR A;  2L6G A;  4PR9 A;  4AL1 A;  3JYY A;  5JP7 A;  3H65 A;  5F5H A;  2KC3 A;  3A11 A;  3T9O A;  2CYD A;  1K40 A;  4IJJ A;  4LDK A;  3T6B A;  3N24 A;  2X0C A;  2YQY A;  3LNM B;  4LAC B;  3U8V A;  2QNL A;  5KYX B;  5L0I A;  1FFH A;  1W2W A;  3SNH A;  3EG9 A;  1WTY A;  3V5Y A;  3JTL O;  5COG A;  2EPM X;  4EWC A;  3AG1 C;  1APC A;  1E86 A;  5DQT A;  2KW3 C;  4KNW A;  4XWJ A;  4OIO F;  3ABM C;  3Q7G A;  1HW2 A;  4E7Z A;  3SEO A;  2EPK X;  3NMI A;  1J8M F;  1T01 A;  4JTA B;  3V7O A;  2R7W A;  5KYY B;  4DBR A;  4M63 A;  3WG7 C;  1AEP A;  3RW0 A;  3B0P A;  2DB4 A;  4BJ1 A;  4DRJ B;  2HSQ A;  1OR3 A;  1LPE A;  3NMJ A;  3N0T A;  2ETS A;  2Z15 A;  1YZA A;  1TWC A;  3FXH A;  1Z7Q c;  4KI2 A;  1LIH A;  2VAS A;  3IEE A;  4MW3 A;  4BPM A;  2J9W A;  1VLS A;  3LNR A;  2NUT A;  1F1M A;  3EH1 A;  1QZX A;  3IQ6 A;  2L6H A;  1E84 A;  3S90 A;  1VTM P;  4IGG A;  1RJ9 A;  1VB5 A;  1ZHY A;  1K05 A;  1M57 C;  1B68 A;  1BR4 A;  1ZHX A;  2A68 F;  3GEI A;  1EQ1 A;  1PD0 A;  1PV3 A;  2GFH A;  2P7V A;  1IZM A;  1OKK D;  2WVO A;  4HFK B;  5EK0 A;  2C03 A;  4F4B A;  2R7X A;  2JPU A;  1SMY F;  1FMW A;  3LS1 A;  3FAP B;  4YJW A;  3V5Z A;  4WGY A;  1T9K A;  1H9T A;  2CCY A;  3WOD F;  3MLG A;  1RKE B;  2YKZ A;  4HFF B;  3ZQY A;  2NSG A;  2G3V A;  2WL8 A;  3GM2 A;  4YL3 A;  1JMW A;  5A6J A;  4AE4 A;  4ZLD A;  2H7B A;  3U2L A;  4CSA A;  2Q3T A;  4MVZ A;  4E0H A;  1NZE A;  2R7O A;  2ZXP A;  3RKO F;  4B6I A;  4DRH B;  4IAO A;  3IHU A;  2G3K A;  2Q7R A;  4CS9 A;  3UGP A;  3JRT A;  3EPV A;  3FAJ A;  5L0F A;  2EPO A;  3GEH A;  1CPR A;  1LM3 B;  1RXQ A;  3ABL C;  2LP4 A;  3HKK A;  4PK4 A;  4XPY A;  4GEH A;  3DZA A;  4MND A;  1UFB A;  5T3W A;  5GPG B;  5FZT A;  4BJ5 C;  3MYF A;  4CJO A;  4CX9 A;  4YN0 B;  4N6H A;  2VCA A;  2TMV P;  1ORS C;  3L8I A;  4CDY A;  1VYI A;  1E83 A;  1Z5Z A;  3QW1 A;  3M15 A;  4YL0 A;  3R2P A;  4JEB A;  4MVS A;  1WN0 A;  4O7G A;  2OEX A;  4CS8 C;  4J7T A;  1LVK A;  3JSE O;  2XLH A;  2J45 A;  4EBK A;  3CSK A;  2MHR A;  2YVK A;  3DWW A;  1K04 A;  4K1O A;  4MVO A;  4XEK A;  3M4B A;  2I15 A;  1OXK A;  5F28 E;  4R32 A;  4U5F E;  2E87 A;  1U6H A;  4QI2 A;  3QVZ A;  5L0J A;  1DOW A;  2OEV A;  3CAX A;  2Y3D A;  4E18 A;  1MMG A;  1V74 B;  4XLP F;  3H2U A;  1E85 A;  1Q0G A;  3LUT B;  3M1C B;  3SYN A;  2Y3H A;  4N6C A;  2VC9 A;  1JPN A;  2EPN A;  4PJJ A;  4BJT A;  1EA8 A;  3LS0 A;  3EHN A;  1JOG A;  1O5H A;  3CZ6 A;  4WGZ A;  2J46 A;  4G7H F;  3KPH A;  1WGW A;  3UR3 C;  5K0I A;  3LAY A;  3NRH A;  2KNH A;  3EH2 A;  1NLX A;  2XL4 A;  4N06 A;  5BQG A;  4ANJ A;  5JT4 A;  3POV A;  1U0B B;  3X1O A;  4YL1 A;  1VK5 A;  2P6V A;  2BE5 F;  4FWV A;  2FAP B;  2CNW D;  3C7J A;  2I8B A;  3GEE A;  4O6N A;  3SXK A;  1T6Q A;  1NSG B;  1YDI A;  2WB7 A;  5EGY A;  4BJ5 A;  4DVY P;  4GQH A;  2J0X A;  3TD7 A;  2Y3B A;  2R7Q A;  3S28 A;  3GWN A;  2OKU A;  4BEM J;  4EBB A;  5L3V A;  1CGM E;  4G7O F;  3DM5 A;  5L0G A;  4YT8 A;  1TFK B;  4JEA A;  2P61 A;  1H7I A;  1HW1 A;  4IAR A;  2GWW A;  1NFN A;  2IXO A;  4E7S A;  1N1C A;  3BRJ A;  4CS8 A;  3QW0 A;  4EHP A;  4YT5 A;  5B1A C;  2RD9 A;  3DAG A;  3NYJ A;  3EGD B;  1SZI A;  3NYL A;  3R7C A;  1LS4 A;  1JPJ A;  3SXM A;  3FHD A;  3LES A;  1ZW3 A;  3I4U A;  4MQ9 F;  4RBN A;  4JC7 A;  2OOC A;  1L3P A;  1ZVZ A;  3AGT A;  3LEO A;  5D92 A;  3AG2 C;  3I5Q A;  4X0R A;  2HZ8 A;  3US6 A;  1QVX A;  4WJ0 A;  3Q7L A;  1H6G A;  1OCZ C;  2OG2 A;  3NKD A;  3O10 A;  4JTD B;  2R7R A;  3QMK A;  2MYS A;  4QDL A;  3AQC A;  1LS1 A;  1V54 C;  3ABK C;  4PAC A;  2XL8 A;  1FR0 A;  1JRA A;  3EJN A;  3JSZ A;  2ZXR A;  1OKK A;  4ONS A;  1DOV A;  1G4U S;  1ZHZ A;  3G4Z A;  2VCB A;  3CEX A;  2M64 A;  4AK9 A;  3EGD A;  4N4W A;  3ZTM A;  2J8W A;  2HMZ A;  5KYU B;  4JRZ A;  5DS6 A;  4IAQ A;  2R7U A;  4LDQ A;  2NUT B;  1TWH A;  2R9R B;  5KYN A;  3DM9 B;  3K33 A;  5E3A A;  1YAU O;  1RJ9 B;  5T1D B;  4PJN A;  5T3T A;  4EIY A;  4NTA A;  1D1B A;  3C8G D;  2WVN A;  3U0C A;  3Q6N A;  3IQT A;  4W8P A;  4GYT A;  1R4T A;  1FMV A;  1D0X A;  3PHF 2;  4PFP A;  4JUR I;  2AP3 A;  1D0Y A;  2XS8 A;  2NSF A;  3B71 A;  3GM3 A;  2YRF A;  2O9X A; 
#chains in the Genus database with same CATH homology
 5CIV A;  2OQM A;  2YQY A;  3CEX A;  2QNL A;  2HKV A;  1RXQ A;  3QTH A;  2QE9 A;  4N6C A;  5COG A;  2F22 A;  2RD9 A;  3DKA A;  2OU6 A;  5COF A;  3DI5 A;  2NSG A;  3GOR A;  5COM A;  2NSF A;  2P1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...