2HKVA

Crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
GMTDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIKLDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Hypothetical protein
publication title Crystal structure of conserved hypothetical protein RBL00553 (ZP_00537729.1) from EXIGUOBACTERIUM SP. 255-15 at 1.70 A resolution
rcsb
source organism Exiguobacterium sibiricum
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2hkvA01
2F22A 2YQYA 5COFA 5COGA 5COMA 3DI5A 1RXQA 2HKVA 2RD9A 2NSGA 3GORA 2QE9A 2NSFA 2OU6A 3QTHA 4N6CA 2P1AA 5CIVA 2OQMA 3DKAA 2QNLA 3CEXA
chains in the Genus database with same CATH superfamily
4ZLCA 1XZQA 1TWAA 2KQ9A 4FX5A 1RJ9B 1TWHA 4RBNA 1AUEA 1S05A 1Z7Qc 4FESA 2XLDA 1NZEA 3S29A 3T6BA 4BJTA 2A0UA 1ZHYA 4JJGA 3DE9A 1Q0GA 2B0JA 1RJ9A 2WVNA 4KNVA 4J7TA 3IEEA 5JS5A 3U5SA 2H7VC 1RXQA 3GEIA 1AVOB 3KYJA 3N24A 4NQFA 3SYNA 2PX0A 4MVUA 5L3QA 2WL8A 4J32B 2R9RB 3RQEA 3B9QA 3FDQA 2ZPAA 4GEHA 2Y39A 3C18A 5JT4A 2EPKX 1EQ1A 2IXMA 3VM6A 3FVYA 2BL2A 2MWQA 2XLVA 4N6CA 3DAFA 2VCAA 2EPMX 4XEFA 1OXBA 2AU5A 5BQIA 1WWPA 2GFHA 3JRMO 1PV3A 3EHMA 4EWCA 1OR3A 5GPGB 2LFDA 2XS1A 2L6FA 4G7ZF 3SXKA 1TWCA 3N2ZB 3G4ZA 3FHDA 4WGYA 1APCA 2GAQA 2KK1A 3QVYA 4P6IC 1KTMA 2IYLD 3AOUA 2H8AA 1V74B 5A6BD 5B1AC 2LD6A 2C04A 2G3KA 3K6BA 4O6YA 1NG1A 4Q4ZF 4IB4A 4BEJA 1QPUA 4BJ5C 2P0NA 2YWAA 3HNIA 3NRHA 3SP1A 2GDCA 4AE4B 1M6TA 4DRIB 4E7SA 1VLSA 4I3MA 3W4YA 4N4WA 4OINF 4AE4A 4YT8A 3K7DA 3ZVRA 2IXNA 3TULA 2W4MA 1LVKA 2CDQA 1M57C 2Y3GA 3ZTZA 1Q0DA 5L3VA 3AGTA 2R25A 3EZHA 1PD1A 4JZAA 4JKVA 1L3PA 2F22A 1Q0KA 2PFDA 2YVKA 4JTDB 4YK5A 2KSFA 3ZTMA 4CIHA 4G7HF 2GA0A 4ER9A 5E33A 2OKUA 1OQCA 3EH2A 1HMDA 3VAYA 1U6HA 3NMJA 3POVA 4IWBA 4L6RA 4Z9IA 1LIHA 4NCQA 3S28A 3H2UA 3M4CA 4ZLDA 2YL3A 3MYIA 2W45A 1VYKA 3TQOA 4DJ9A 2YHSA 4P9FA 3ZQVA 1NU7D 3GM2A 1E84A 2CW0F 2OEXA 1YJGA 3ASOC 3TJ5A 1W2WA 1WN0A 2QUPA 1T9KA 2FFHA 4EBKA 1FAPB 3EHNA 3JYHA 3L8JA 4PR9A 4XTKA 2IXOA 3K1IA 1ZVZA 1MMDA 2WZFA 2I8BA 3B71A 3RQFA 5B3SC 4CIPA 4NY3A 1RMVA 3SNHA 1FR0A 2L7AA 3IQCA 3M15A 4IGGA 2R7OA 3RVZA 1XWJA 2XLWA 4EBJA 2DI3A 3ABLC 3RKOF 3N0TA 3Q7GA 1OCOC 5BQGA 1H7IA 1OW7A 2DYSC 3RYLA 5DLJA 4F4BA 5EHHA 1G8XA 4Q5SF 1DOWA 2YL1A 4YT5A 1JR8A 1MMNA 4XLPF 1MNDA 4K0DA 3TOLA 2R05A 4W8KA 3FMSA 1Z63A 4JURI 5L0JA 3QW1A 4ONSA 1RKEB 3ITFA 3W2WA 4XQ1A 2VC9A 1R4TA 3T4RA 2XL4A 3ZG1A 4J7YA 2XXAA 1R5ID 3QW0A 5DVWA 1RKEA 2TMVP 4YT4A 3U0CA 1C17M 3V5YA 3EJNA 3B0UX 5B3IA 2XM4A 3AJMA 3BEHA 4E7ZA 1ZU4A 1SMYF 2UUHA 3B29A 1K05A 4NC3A 1M56C 1U89A 1D0XA 2QLAA 2NPUA 4U9DA 1OCZC 1WTYA 4R32A 4BG0A 1QZXA 2NG1A 4MVZA 1PD0A 1OCCC 3AG3C 2M4EA 4A4AA 1ZW3A 5HV9A 4MQ9F 1Q0FA 1T01A 4E0IA 1TWGA 3S84A 4U5HA 3CQZA 3C7JA 1T6UA 3CAXA 4U5GA 3W2VA 3WODF 1HW1A 1YLMA 2CYDA 3SZRA 1I4YA 1YA9A 2NUTB 3KPHA 2VCCA 1YYJA 1ZHXA 3F46A 1A7VA 2HS5A 3NMIA 2P7VA 3MYFA 4K7BA 4PFOA 3O55A 5TJ5E 3RH3A 2WVQA 2NUTA 1NLXA 1LI5A 3CEXA 2HUJA 2KGOA 3JYYA 3I4UA 4JVSA 2J45A 3RIPA 2Y3DA 5HSWA 1VOMA 1E83A 2J8WA 1VYIA 5JUAA 1KU2A 3EGDB 3FAPB 2O9XA 1D1AA 4MVOA 3OA1A 2G3VA 4I44A 1ZHTA 3KKBA 3DAGA 1LE4A 2P61A 1OW8A 2HKVA 3C8ZA 3EGDA 1JPJA 3NYMA 4WJ0A 2WVOA 1N1CA 3K66A 3TOMA 1E2XA 3J06A 4O79A 4OIQF 3U9MA 3G50A 4H4KC 1WASA 1JOGA 4DBQA 2RSEB 4MS2A 5CI8A 3PCVA 4K1OA 2EIJC 3SEOA 4M63A 4BJ6A 2X0CA 5A6AA 1BR1A 2EIMC 3LNMB 3U2MA 2LK4A 2R7TA 1QSPA 2KC3A 3WG7C 2H7OA 1RCPA 1Z3IX 4EHPA 2XLMA 3DD7A 2IM8A 3ATPA 3DZAA 4HEAJ 1CGOA 2G62A 2HZ8A 3LS1A 4OD5A 2AP3A 3EPVA 2AWCA 1Z5ZA 2XS8A 2OG2A 3HNJA 3SXYA 4G7OF 3MX3A 2DYRC 3Q6MA 5DS6A 1ZZPA 2VCBA 1YA7O 2CGEA 4N6HA 2R7UA 3EH1A 1M2VA 3SXZA 5E2QA 3GWLA 2HJ3A 5B1BC 1TFKB 1NU9C 1YVIA 2YKZA 3G4XA 4IJJA 5BUOA 4X0RA 1V4AA 2XL6A 1BDJB 2YLIA 4JW1A 2VB6A 3W8IA 4XEVA 3SXMA 5DS5A 3LEOA 3O39A 1YYXA 2NSFA 4XPYA 1SZIA 1K04A 3L8IA 4CS9A 3DE8A 3LNRA 3C8GB 5L0FA 2OQMA 4EBBA 2YL0A 4CS7A 4CDYA 3HNLA 4QI2A 2J0WA 4JC7A 2J7PA 3ABKC 1HY5A 1VB5A 5DQZA 3C8GA 4I1OB 1ZU5A 3T6GB 4DRHB 2YZSA 3AG1C 2PX3A 2EINC 3AG4C 3DI5A 5T3TA 3HJCA 4FWVA 4AK9A 3DJUB 2R7QA 4XPXA 4CSAA 4D4NA 3QVZA 2OJQA 2EPLX 5KYWB 1H6GA 4O6NA 3U3FA 3LJBA 256BA 2IBFA 3OEOA 4CDAA 1ORSC 2ZXWC 1SR2A 2KNHA 2HMQA 1VLTA 3L1MA 1HE1A 3ZQYA 3NKDA 5KYWA 1D1CA 2HV6A 4LACB 3RQGA 3AQCA 2Q3TA 1QLEC 4PJLA 3U3BA 3QTHA 4H54A 3KH2A 1JAFA 3HNKA 4O7GA 4JCZA 4MVQA 1V54C 4MNDA 4YN0B 4ANJA 1LE2A 1CGME 3FXHA 2BE5F 2QTVA 1UFBA 2HSQA 1MQVA 2Q9CA 2V26A 2WB7A 2YLGA 4HFFB 1TQGA 5AGFA 1MMAA 2XLEA 1YARO 2ZXPA 2J9VA 2PP4A 2WZLA 3I5PA 3NMKA 4CS8A 1NBBA 3AGUA 3CSKA 2DGJA 4E18A 3ZWIA 4KI2A 1L7CA 2OJED 3EFOB 2XLHA 4JIOA 3K1HA 3NYJA 4MTOA 2P6VA 3US6A 4DBRA 4DXWA 1C02A 3RW0A 3C63A 4WGZA 4E0HA 1GS9A 3EFOA 3DJNB 3PMRA 4XLNF 1XZPA 3JT1A 5AC5A 3NDBB 3S9OA 3OWTA 2LSEA 2OCCC 2Q9AA 3EG9B 3U9JA 4NTBA 4BPMA 3V5ZA 1VK5A 2XXAB 5KYUB 3MLGA 4GYTA 3EG9A 4DRJB 5CIVA 2PBEA 4JEBA 1FNTc 1WATA 1A0BA 5KYUA 1ORJA 4YT2A 2ZXRA 4XWJA 2HSBA 3UMKA 3V5XA 4QDLA 3GM1A 1RKCA 2XRHA 4MW3A 1CPQA 1FFHA 5A6KA 3GODA 3QMKA 4CJGA 4W8PA 1HMOA 1LI7A 4LDKA 4NTFA 4U5FE 2YEVA 4WABA 5JRAA 1IW7F 3UR3C 1OKKA 1F1MA 2L81A 2Q4FA 2AVKA 1EA8A 1EKYA 3ZSUA 3JSZA 4U5BE 4P9TA 1UG7A 1TR2A 5JLIA 4I1MA 3NG1A 5IY5C 1K40A 4PJMA 4HE8D 3TD7A 2J9BA 1QVXA 2CNWA 2Q9BA 4DOZA 3IPMO 1LM3B 3KL4A 1G4WR 3B0PA 2OEVA 2QE9A 2OU6A 1FTSA 3BRJA 2GWWA 2Y3HA 3A9CA 3CZ6A 3GM3A 5FCLA 1J8MF 4A2NB 1A41A 2J0XA 3UNGC 4JTAB 1O87A 3H2VA 2QNLA 3F47A 3JSEO 4PK4A 4RD9A 3ZC4A 3VYWA 4U5EE 4U9EA 2J9UA 4BJ5A 2Q7RA 2JPUA 3RVYA 3AG2C 1CPRA 4JCHA 4B6IA 5F28E 2R7WA 3JZ0A 1ZW2A 2BC5A 4DVYP 4OD4A 2R7SA 4LDRA 3K1IC 4OIRF 3MBGA 4AL1A 5DQTA 4Z9JA 4YL0A 3FAJA 4PACA 1VMAA 2J46A 2NSGA 3NYLA 5AC4A 4C3DA 3S90A 3QZCA 1TFOB 2WZGA 2A1DD 5KYYB 1NFNA 2LQGA 3GORA 3JRTA 3C62A 1SYQA 2A6EF 2B0HA 4Q7CA 1Y6DA 5FZTA 2MHRA 3EQLF 4PJJA 5KYYA 4OIOF 2R7XA 1NFOA 2ASRA 1JMWA 2D5RB 3LAYA 4KC9A 4KBLA 2M64A 4NTAA 3RF3A 2JD3A 5BQHA 3B0VC 1GGQA 3R7CA 4C3BA 2XL8A 4IAOA 5L0CA 5E3CA 4LLEA 1PCXA 4UDVA 4JEAA 1GM5A 3E9VA 1BR4A 2E87A 3X1OA 2KJGA 5COGA 1D0ZA 1FMVA 4ULWA 3ZIBA 1M2VB 2W9YA 3UGOA 3H65A 5F5FA 2LFFA 3UMHA 5K0IA 3GEHA 3L34A 4IARA 3RFYA 2J9WA 5F5HA 1I4ZA 4MTFA 5CI9A 1E86A 2Z15A 5EK0A 2J7PD 1HE9A 2OOCA 2A68F 3C8GD 3R2PA 5A69A 2KYHA 1D1BA 1LKXA 3JCUQ 4AX2A 5L0DA 1OW6A 5JSLA 3L0IA 3M79A 3WAQA 4MVMA 3IQ6A 3EGXB 2YLDA 5D92A 3KYIA 1KNYA 1LPEA 5A6JA 4MVRA 5EGYA 2D4UA 3HTKC 3EGXA 2ZD9A 3O6XA 2R03A 4JJFA 2JX0A 1WOLA 4XEKA 4BEMJ 3IHUA 4YWQA 5L0GA 4PFPA 4GQHA 5KYNA 3ZDLA 3FOPA 2RD9A 1AEPA 1T6IA 3M4BA 1A7EA 3V7OA 2X51A 3UMIA 3Q6NA 4E17A 4G0HA 4PJNA 2IOQA 4AL0A 2XLOA 3A11A 3DMDA 3GANA 5A6BA 4YJWA 1VTMP 1ORYA 3LESA 1LS1A 1YDIA 1H9GA 2ZXOA 3LEVA 2PF4E 2Y69C 3X2QC 2A69F 4EKWA 4QI0A 3JTLO 3DWWA 5KYXB 1BZ4A 4MVSA 4MTGA 4G78A 4BJ6C 1ZHWA 4XPWA 2R7RA 5D91A 1G4US 1WGWA 2YQYA 1S7ZA 5KYXA 3HLZA 1U0BB 2C03A 2L6GA 5COMA 2QY9A 3IQ5A 3IQTA 1A7DA 2KW3C 2XSEA 2CCYA 4IRUA 4U5CE 3U2LA 1GQAA 2W4BA 4D4XA 1IZMA 4CBEA 1O5HA 1OR2A 3KMIA 1SF8A 3LS0A 1CGNA 3S27A 5L0IA 3UGPA 1HW2A 1FFTC 2XM0A 3I5QA 1MMGA 2YRFA 5E3AA 3U8PA 2YL7A 2R7VA 3DM5A 4CX9A 2EIKC 1JRAA 3ASNC 3LLKA 5T3WA 4IAQA 4KNWA 1C03A 3EZIA 3MFNA 2HFIA 4BJ1A 4O6MA 2HV7A 1OKKD 2NUPB 1E85A 2V3CC 1Q0MA 1D0YA 1Z23A 4HFKB 3U8VA 1ZYRF 3DXJF 2EPOA 2NUPA 3GEEA 3W8HA 1M2OA 5COFA 4CS9C 4EUKB 1V55C 4EIYA 4JTCB 3PHF2 2CNWD 1JPNA 1Y4CA 3NKEA 3TJ6A 1TKNA 2PNOA 2MYSA 2I15A 3TK0A 1FMWA 4LERA 1MNEA 1YZAA 3WHNA 2DB4A 4N06A 2HJMA 1DOVA 3E70C 1T5OA 2H7BA 2FAPB 4U5DE 3ECSA 4YL1A 2EILC 4CSAC 2LP4A 4OIPF 2LIGA 2UUIA 1LS4A 3PDMP 1NSGB 3T6JA 2P1AA 1YZCA 3HKKA 3T9OA 1ZHZA 1BR2A 1OCRC 2R02A 1J8YF 3VRCA 1T6QA 5JVEA 4C7OB 1EI7A 1ST6A 2L9JA 4JE9A 4FAPB 1B68A 1BBHA 2EPNA 3AQBA 4MW8A 3LLIA 5T1DB 3FOOA 4C3EA 5JP7A 4LLCA 2HMZA 4J30B 4C7OA 2L6HA 2VASA 4JRZA 2FGYA 2ETSA 2AWYA 1G5ZA 1OXKA 2A0BA 3M1CB 1O3UA 3S0XA 3GWNA 1H9TA 2IXPA 2VH3A 4CS8C 4RDAA 2ICWG 4LDQA 2Y3BA 5DS4A 4ULVA 1Z6AA 3ABMC 4YL3A 1I5NA 2A6HF 2Q00A 4Z9HA 5L0HA 1YAUO 4DVZA 3K33A 3LUTB 3O10A 3VF0A 1QKRA 3DM9B 1QQ3A 4CJOA 3DKAA 4CDVA 3Q7LA 2LCHA
chains in the Genus database with same CATH topology
2F22A 2YQYA 5COFA 5COGA 5COMA 3DI5A 1RXQA 2HKVA 2RD9A 2NSGA 3GORA 2QE9A 2NSFA 2OU6A 3QTHA 4N6CA 2P1AA 5CIVA 2OQMA 3DKAA 2QNLA 3CEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F22 A;  2YQY A;  5COF A;  5COG A;  5COM A;  3DI5 A;  1RXQ A;  2HKV A;  2RD9 A;  2NSG A;  3GOR A;  2QE9 A;  2NSF A;  2OU6 A;  3QTH A;  4N6C A;  2P1A A;  5CIV A;  2OQM A;  3DKA A;  2QNL A;  3CEX A; 
#chains in the Genus database with same CATH topology
 4ZLC A;  1XZQ A;  1TWA A;  2KQ9 A;  4FX5 A;  1RJ9 B;  1TWH A;  4RBN A;  1AUE A;  1S05 A;  1Z7Q c;  4FES A;  2XLD A;  1NZE A;  3S29 A;  3T6B A;  4BJT A;  2A0U A;  1ZHY A;  4JJG A;  3DE9 A;  1Q0G A;  2B0J A;  1RJ9 A;  2WVN A;  4KNV A;  4J7T A;  3IEE A;  5JS5 A;  3U5S A;  2H7V C;  1RXQ A;  3GEI A;  1AVO B;  3KYJ A;  3N24 A;  4NQF A;  3SYN A;  2PX0 A;  4MVU A;  5L3Q A;  2WL8 A;  4J32 B;  2R9R B;  3RQE A;  3B9Q A;  3FDQ A;  2ZPA A;  4GEH A;  2Y39 A;  3C18 A;  5JT4 A;  2EPK X;  1EQ1 A;  2IXM A;  3VM6 A;  3FVY A;  2BL2 A;  2MWQ A;  2XLV A;  4N6C A;  3DAF A;  2VCA A;  2EPM X;  4XEF A;  1OXB A;  2AU5 A;  5BQI A;  1WWP A;  2GFH A;  3JRM O;  1PV3 A;  3EHM A;  4EWC A;  1OR3 A;  5GPG B;  2LFD A;  2XS1 A;  2L6F A;  4G7Z F;  3SXK A;  1TWC A;  3N2Z B;  3G4Z A;  3FHD A;  4WGY A;  1APC A;  2GAQ A;  2KK1 A;  3QVY A;  4P6I C;  1KTM A;  2IYL D;  3AOU A;  2H8A A;  1V74 B;  5A6B D;  5B1A C;  2LD6 A;  2C04 A;  2G3K A;  3K6B A;  4O6Y A;  1NG1 A;  4Q4Z F;  4IB4 A;  4BEJ A;  1QPU A;  4BJ5 C;  2P0N A;  2YWA A;  3HNI A;  3NRH A;  3SP1 A;  2GDC A;  4AE4 B;  1M6T A;  4DRI B;  4E7S A;  1VLS A;  4I3M A;  3W4Y A;  4N4W A;  4OIN F;  4AE4 A;  4YT8 A;  3K7D A;  3ZVR A;  2IXN A;  3TUL A;  2W4M A;  1LVK A;  2CDQ A;  1M57 C;  2Y3G A;  3ZTZ A;  1Q0D A;  5L3V A;  3AGT A;  2R25 A;  3EZH A;  1PD1 A;  4JZA A;  4JKV A;  1L3P A;  2F22 A;  1Q0K A;  2PFD A;  2YVK A;  4JTD B;  4YK5 A;  2KSF A;  3ZTM A;  4CIH A;  4G7H F;  2GA0 A;  4ER9 A;  5E33 A;  2OKU A;  1OQC A;  3EH2 A;  1HMD A;  3VAY A;  1U6H A;  3NMJ A;  3POV A;  4IWB A;  4L6R A;  4Z9I A;  1LIH A;  4NCQ A;  3S28 A;  3H2U A;  3M4C A;  4ZLD A;  2YL3 A;  3MYI A;  2W45 A;  1VYK A;  3TQO A;  4DJ9 A;  2YHS A;  4P9F A;  3ZQV A;  1NU7 D;  3GM2 A;  1E84 A;  2CW0 F;  2OEX A;  1YJG A;  3ASO C;  3TJ5 A;  1W2W A;  1WN0 A;  2QUP A;  1T9K A;  2FFH A;  4EBK A;  1FAP B;  3EHN A;  3JYH A;  3L8J A;  4PR9 A;  4XTK A;  2IXO A;  3K1I A;  1ZVZ A;  1MMD A;  2WZF A;  2I8B A;  3B71 A;  3RQF A;  5B3S C;  4CIP A;  4NY3 A;  1RMV A;  3SNH A;  1FR0 A;  2L7A A;  3IQC A;  3M15 A;  4IGG A;  2R7O A;  3RVZ A;  1XWJ A;  2XLW A;  4EBJ A;  2DI3 A;  3ABL C;  3RKO F;  3N0T A;  3Q7G A;  1OCO C;  5BQG A;  1H7I A;  1OW7 A;  2DYS C;  3RYL A;  5DLJ A;  4F4B A;  5EHH A;  1G8X A;  4Q5S F;  1DOW A;  2YL1 A;  4YT5 A;  1JR8 A;  1MMN A;  4XLP F;  1MND A;  4K0D A;  3TOL A;  2R05 A;  4W8K A;  3FMS A;  1Z63 A;  4JUR I;  5L0J A;  3QW1 A;  4ONS A;  1RKE B;  3ITF A;  3W2W A;  4XQ1 A;  2VC9 A;  1R4T A;  3T4R A;  2XL4 A;  3ZG1 A;  4J7Y A;  2XXA A;  1R5I D;  3QW0 A;  5DVW A;  1RKE A;  2TMV P;  4YT4 A;  3U0C A;  1C17 M;  3V5Y A;  3EJN A;  3B0U X;  5B3I A;  2XM4 A;  3AJM A;  3BEH A;  4E7Z A;  1ZU4 A;  1SMY F;  2UUH A;  3B29 A;  1K05 A;  4NC3 A;  1M56 C;  1U89 A;  1D0X A;  2QLA A;  2NPU A;  4U9D A;  1OCZ C;  1WTY A;  4R32 A;  4BG0 A;  1QZX A;  2NG1 A;  4MVZ A;  1PD0 A;  1OCC C;  3AG3 C;  2M4E A;  4A4A A;  1ZW3 A;  5HV9 A;  4MQ9 F;  1Q0F A;  1T01 A;  4E0I A;  1TWG A;  3S84 A;  4U5H A;  3CQZ A;  3C7J A;  1T6U A;  3CAX A;  4U5G A;  3W2V A;  3WOD F;  1HW1 A;  1YLM A;  2CYD A;  3SZR A;  1I4Y A;  1YA9 A;  2NUT B;  3KPH A;  2VCC A;  1YYJ A;  1ZHX A;  3F46 A;  1A7V A;  2HS5 A;  3NMI A;  2P7V A;  3MYF A;  4K7B A;  4PFO A;  3O55 A;  5TJ5 E;  3RH3 A;  2WVQ A;  2NUT A;  1NLX A;  1LI5 A;  3CEX A;  2HUJ A;  2KGO A;  3JYY A;  3I4U A;  4JVS A;  2J45 A;  3RIP A;  2Y3D A;  5HSW A;  1VOM A;  1E83 A;  2J8W A;  1VYI A;  5JUA A;  1KU2 A;  3EGD B;  3FAP B;  2O9X A;  1D1A A;  4MVO A;  3OA1 A;  2G3V A;  4I44 A;  1ZHT A;  3KKB A;  3DAG A;  1LE4 A;  2P61 A;  1OW8 A;  2HKV A;  3C8Z A;  3EGD A;  1JPJ A;  3NYM A;  4WJ0 A;  2WVO A;  1N1C A;  3K66 A;  3TOM A;  1E2X A;  3J06 A;  4O79 A;  4OIQ F;  3U9M A;  3G50 A;  4H4K C;  1WAS A;  1JOG A;  4DBQ A;  2RSE B;  4MS2 A;  5CI8 A;  3PCV A;  4K1O A;  2EIJ C;  3SEO A;  4M63 A;  4BJ6 A;  2X0C A;  5A6A A;  1BR1 A;  2EIM C;  3LNM B;  3U2M A;  2LK4 A;  2R7T A;  1QSP A;  2KC3 A;  3WG7 C;  2H7O A;  1RCP A;  1Z3I X;  4EHP A;  2XLM A;  3DD7 A;  2IM8 A;  3ATP A;  3DZA A;  4HEA J;  1CGO A;  2G62 A;  2HZ8 A;  3LS1 A;  4OD5 A;  2AP3 A;  3EPV A;  2AWC A;  1Z5Z A;  2XS8 A;  2OG2 A;  3HNJ A;  3SXY A;  4G7O F;  3MX3 A;  2DYR C;  3Q6M A;  5DS6 A;  1ZZP A;  2VCB A;  1YA7 O;  2CGE A;  4N6H A;  2R7U A;  3EH1 A;  1M2V A;  3SXZ A;  5E2Q A;  3GWL A;  2HJ3 A;  5B1B C;  1TFK B;  1NU9 C;  1YVI A;  2YKZ A;  3G4X A;  4IJJ A;  5BUO A;  4X0R A;  1V4A A;  2XL6 A;  1BDJ B;  2YLI A;  4JW1 A;  2VB6 A;  3W8I A;  4XEV A;  3SXM A;  5DS5 A;  3LEO A;  3O39 A;  1YYX A;  2NSF A;  4XPY A;  1SZI A;  1K04 A;  3L8I A;  4CS9 A;  3DE8 A;  3LNR A;  3C8G B;  5L0F A;  2OQM A;  4EBB A;  2YL0 A;  4CS7 A;  4CDY A;  3HNL A;  4QI2 A;  2J0W A;  4JC7 A;  2J7P A;  3ABK C;  1HY5 A;  1VB5 A;  5DQZ A;  3C8G A;  4I1O B;  1ZU5 A;  3T6G B;  4DRH B;  2YZS A;  3AG1 C;  2PX3 A;  2EIN C;  3AG4 C;  3DI5 A;  5T3T A;  3HJC A;  4FWV A;  4AK9 A;  3DJU B;  2R7Q A;  4XPX A;  4CSA A;  4D4N A;  3QVZ A;  2OJQ A;  2EPL X;  5KYW B;  1H6G A;  4O6N A;  3U3F A;  3LJB A;  256B A;  2IBF A;  3OEO A;  4CDA A;  1ORS C;  2ZXW C;  1SR2 A;  2KNH A;  2HMQ A;  1VLT A;  3L1M A;  1HE1 A;  3ZQY A;  3NKD A;  5KYW A;  1D1C A;  2HV6 A;  4LAC B;  3RQG A;  3AQC A;  2Q3T A;  1QLE C;  4PJL A;  3U3B A;  3QTH A;  4H54 A;  3KH2 A;  1JAF A;  3HNK A;  4O7G A;  4JCZ A;  4MVQ A;  1V54 C;  4MND A;  4YN0 B;  4ANJ A;  1LE2 A;  1CGM E;  3FXH A;  2BE5 F;  2QTV A;  1UFB A;  2HSQ A;  1MQV A;  2Q9C A;  2V26 A;  2WB7 A;  2YLG A;  4HFF B;  1TQG A;  5AGF A;  1MMA A;  2XLE A;  1YAR O;  2ZXP A;  2J9V A;  2PP4 A;  2WZL A;  3I5P A;  3NMK A;  4CS8 A;  1NBB A;  3AGU A;  3CSK A;  2DGJ A;  4E18 A;  3ZWI A;  4KI2 A;  1L7C A;  2OJE D;  3EFO B;  2XLH A;  4JIO A;  3K1H A;  3NYJ A;  4MTO A;  2P6V A;  3US6 A;  4DBR A;  4DXW A;  1C02 A;  3RW0 A;  3C63 A;  4WGZ A;  4E0H A;  1GS9 A;  3EFO A;  3DJN B;  3PMR A;  4XLN F;  1XZP A;  3JT1 A;  5AC5 A;  3NDB B;  3S9O A;  3OWT A;  2LSE A;  2OCC C;  2Q9A A;  3EG9 B;  3U9J A;  4NTB A;  4BPM A;  3V5Z A;  1VK5 A;  2XXA B;  5KYU B;  3MLG A;  4GYT A;  3EG9 A;  4DRJ B;  5CIV A;  2PBE A;  4JEB A;  1FNT c;  1WAT A;  1A0B A;  5KYU A;  1ORJ A;  4YT2 A;  2ZXR A;  4XWJ A;  2HSB A;  3UMK A;  3V5X A;  4QDL A;  3GM1 A;  1RKC A;  2XRH A;  4MW3 A;  1CPQ A;  1FFH A;  5A6K A;  3GOD A;  3QMK A;  4CJG A;  4W8P A;  1HMO A;  1LI7 A;  4LDK A;  4NTF A;  4U5F E;  2YEV A;  4WAB A;  5JRA A;  1IW7 F;  3UR3 C;  1OKK A;  1F1M A;  2L81 A;  2Q4F A;  2AVK A;  1EA8 A;  1EKY A;  3ZSU A;  3JSZ A;  4U5B E;  4P9T A;  1UG7 A;  1TR2 A;  5JLI A;  4I1M A;  3NG1 A;  5IY5 C;  1K40 A;  4PJM A;  4HE8 D;  3TD7 A;  2J9B A;  1QVX A;  2CNW A;  2Q9B A;  4DOZ A;  3IPM O;  1LM3 B;  3KL4 A;  1G4W R;  3B0P A;  2OEV A;  2QE9 A;  2OU6 A;  1FTS A;  3BRJ A;  2GWW A;  2Y3H A;  3A9C A;  3CZ6 A;  3GM3 A;  5FCL A;  1J8M F;  4A2N B;  1A41 A;  2J0X A;  3UNG C;  4JTA B;  1O87 A;  3H2V A;  2QNL A;  3F47 A;  3JSE O;  4PK4 A;  4RD9 A;  3ZC4 A;  3VYW A;  4U5E E;  4U9E A;  2J9U A;  4BJ5 A;  2Q7R A;  2JPU A;  3RVY A;  3AG2 C;  1CPR A;  4JCH A;  4B6I A;  5F28 E;  2R7W A;  3JZ0 A;  1ZW2 A;  2BC5 A;  4DVY P;  4OD4 A;  2R7S A;  4LDR A;  3K1I C;  4OIR F;  3MBG A;  4AL1 A;  5DQT A;  4Z9J A;  4YL0 A;  3FAJ A;  4PAC A;  1VMA A;  2J46 A;  2NSG A;  3NYL A;  5AC4 A;  4C3D A;  3S90 A;  3QZC A;  1TFO B;  2WZG A;  2A1D D;  5KYY B;  1NFN A;  2LQG A;  3GOR A;  3JRT A;  3C62 A;  1SYQ A;  2A6E F;  2B0H A;  4Q7C A;  1Y6D A;  5FZT A;  2MHR A;  3EQL F;  4PJJ A;  5KYY A;  4OIO F;  2R7X A;  1NFO A;  2ASR A;  1JMW A;  2D5R B;  3LAY A;  4KC9 A;  4KBL A;  2M64 A;  4NTA A;  3RF3 A;  2JD3 A;  5BQH A;  3B0V C;  1GGQ A;  3R7C A;  4C3B A;  2XL8 A;  4IAO A;  5L0C A;  5E3C A;  4LLE A;  1PCX A;  4UDV A;  4JEA A;  1GM5 A;  3E9V A;  1BR4 A;  2E87 A;  3X1O A;  2KJG A;  5COG A;  1D0Z A;  1FMV A;  4ULW A;  3ZIB A;  1M2V B;  2W9Y A;  3UGO A;  3H65 A;  5F5F A;  2LFF A;  3UMH A;  5K0I A;  3GEH A;  3L34 A;  4IAR A;  3RFY A;  2J9W A;  5F5H A;  1I4Z A;  4MTF A;  5CI9 A;  1E86 A;  2Z15 A;  5EK0 A;  2J7P D;  1HE9 A;  2OOC A;  2A68 F;  3C8G D;  3R2P A;  5A69 A;  2KYH A;  1D1B A;  1LKX A;  3JCU Q;  4AX2 A;  5L0D A;  1OW6 A;  5JSL A;  3L0I A;  3M79 A;  3WAQ A;  4MVM A;  3IQ6 A;  3EGX B;  2YLD A;  5D92 A;  3KYI A;  1KNY A;  1LPE A;  5A6J A;  4MVR A;  5EGY A;  2D4U A;  3HTK C;  3EGX A;  2ZD9 A;  3O6X A;  2R03 A;  4JJF A;  2JX0 A;  1WOL A;  4XEK A;  4BEM J;  3IHU A;  4YWQ A;  5L0G A;  4PFP A;  4GQH A;  5KYN A;  3ZDL A;  3FOP A;  2RD9 A;  1AEP A;  1T6I A;  3M4B A;  1A7E A;  3V7O A;  2X51 A;  3UMI A;  3Q6N A;  4E17 A;  4G0H A;  4PJN A;  2IOQ A;  4AL0 A;  2XLO A;  3A11 A;  3DMD A;  3GAN A;  5A6B A;  4YJW A;  1VTM P;  1ORY A;  3LES A;  1LS1 A;  1YDI A;  1H9G A;  2ZXO A;  3LEV A;  2PF4 E;  2Y69 C;  3X2Q C;  2A69 F;  4EKW A;  4QI0 A;  3JTL O;  3DWW A;  5KYX B;  1BZ4 A;  4MVS A;  4MTG A;  4G78 A;  4BJ6 C;  1ZHW A;  4XPW A;  2R7R A;  5D91 A;  1G4U S;  1WGW A;  2YQY A;  1S7Z A;  5KYX A;  3HLZ A;  1U0B B;  2C03 A;  2L6G A;  5COM A;  2QY9 A;  3IQ5 A;  3IQT A;  1A7D A;  2KW3 C;  2XSE A;  2CCY A;  4IRU A;  4U5C E;  3U2L A;  1GQA A;  2W4B A;  4D4X A;  1IZM A;  4CBE A;  1O5H A;  1OR2 A;  3KMI A;  1SF8 A;  3LS0 A;  1CGN A;  3S27 A;  5L0I A;  3UGP A;  1HW2 A;  1FFT C;  2XM0 A;  3I5Q A;  1MMG A;  2YRF A;  5E3A A;  3U8P A;  2YL7 A;  2R7V A;  3DM5 A;  4CX9 A;  2EIK C;  1JRA A;  3ASN C;  3LLK A;  5T3W A;  4IAQ A;  4KNW A;  1C03 A;  3EZI A;  3MFN A;  2HFI A;  4BJ1 A;  4O6M A;  2HV7 A;  1OKK D;  2NUP B;  1E85 A;  2V3C C;  1Q0M A;  1D0Y A;  1Z23 A;  4HFK B;  3U8V A;  1ZYR F;  3DXJ F;  2EPO A;  2NUP A;  3GEE A;  3W8H A;  1M2O A;  5COF A;  4CS9 C;  4EUK B;  1V55 C;  4EIY A;  4JTC B;  3PHF 2;  2CNW D;  1JPN A;  1Y4C A;  3NKE A;  3TJ6 A;  1TKN A;  2PNO A;  2MYS A;  2I15 A;  3TK0 A;  1FMW A;  4LER A;  1MNE A;  1YZA A;  3WHN A;  2DB4 A;  4N06 A;  2HJM A;  1DOV A;  3E70 C;  1T5O A;  2H7B A;  2FAP B;  4U5D E;  3ECS A;  4YL1 A;  2EIL C;  4CSA C;  2LP4 A;  4OIP F;  2LIG A;  2UUI A;  1LS4 A;  3PDM P;  1NSG B;  3T6J A;  2P1A A;  1YZC A;  3HKK A;  3T9O A;  1ZHZ A;  1BR2 A;  1OCR C;  2R02 A;  1J8Y F;  3VRC A;  1T6Q A;  5JVE A;  4C7O B;  1EI7 A;  1ST6 A;  2L9J A;  4JE9 A;  4FAP B;  1B68 A;  1BBH A;  2EPN A;  3AQB A;  4MW8 A;  3LLI A;  5T1D B;  3FOO A;  4C3E A;  5JP7 A;  4LLC A;  2HMZ A;  4J30 B;  4C7O A;  2L6H A;  2VAS A;  4JRZ A;  2FGY A;  2ETS A;  2AWY A;  1G5Z A;  1OXK A;  2A0B A;  3M1C B;  1O3U A;  3S0X A;  3GWN A;  1H9T A;  2IXP A;  2VH3 A;  4CS8 C;  4RDA A;  2ICW G;  4LDQ A;  2Y3B A;  5DS4 A;  4ULV A;  1Z6A A;  3ABM C;  4YL3 A;  1I5N A;  2A6H F;  2Q00 A;  4Z9H A;  5L0H A;  1YAU O;  4DVZ A;  3K33 A;  3LUT B;  3O10 A;  3VF0 A;  1QKR A;  3DM9 B;  1QQ3 A;  4CJO A;  3DKA A;  4CDV A;  3Q7L A;  2LCH A; 
#chains in the Genus database with same CATH homology
 2F22 A;  2YQY A;  5COF A;  5COG A;  5COM A;  3DI5 A;  1RXQ A;  2HKV A;  2RD9 A;  2NSG A;  3GOR A;  2QE9 A;  2NSF A;  2OU6 A;  3QTH A;  4N6C A;  2P1A A;  5CIV A;  2OQM A;  3DKA A;  2QNL A;  3CEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...