2HKVA

Crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
GMTDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIKLDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein RBL00553 (ZP_00537729.1) from EXIGUOBACTERIUM SP. 255-15 at 1.70 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Dna binding protein
molecule keywords Hypothetical protein
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2hkvA01
2QNLA 2OQMA 3DKAA 1RXQA 2NSFA 5COGA 2OU6A 5COMA 2NSGA 2P1AA 4N6CA 2HKVA 3QTHA 2RD9A 5CIVA 3DI5A 2QE9A 5COFA 3GORA 2F22A 3CEXA 2YQYA
chains in the Genus database with same CATH superfamily
2M64A 2OG2A 1YARO 3QW1A 2OQMA 1HE9A 2HZ8A 3IQTA 1WN0A 2NG1A 2GAQA 1BDJB 4AK9A 5BQHA 2XLVA 4JZAA 4G7ZF 1Z63A 2Q9AA 1VOMA 3PCVA 5COMA 3N0TA 4XTKA 1YAUO 3RQFA 5AC5A 3UGPA 4EBJA 4JIOA 1HE1A 3QTHA 3AJMA 4JEAA 3R2PA 3VRCA 1D1AA 2L6FA 2YL7A 3AQBA 3M79A 5D91A 3SXZA 1D0XA 1ZU4A 1BR1A 3K1IA 1L7CA 2YL1A 2R03A 2R7QA 3JZ0A 2VC9A 3K66A 1LIHA 2GWWA 1ZHWA 3FXHA 1M2OA 1QQ3A 2CNWD 2PX3A 4LDQA 4DVZA 4J7YA 2KK1A 4YN0B 4YL3A 4CSAC 3RYLA 3S90A 4JTAB 4RBNA 4G7HF 4EWCA 1DOWA 4IGGA 2ZD9A 2D4UA 4OIRF 4CS8A 3A11A 1NU9C 4LDKA 4XPWA 3E9VA 2EIMC 3M4BA 1I4YA 3KH2A 2L6HA 4MVRA 5KYWB 4U5HA 5KYUA 1K40A 4W8PA 5KYNA 2HMQA 3LNRA 1MNDA 3LESA 4BJ1A 1N1CA 4P9FA 5L3QA 3NG1A 4MTGA 2A68F 3EGXA 3KYJA 3SP1A 1E83A 3DZAA 3LLIA 3FAPB 3RVYA 4AE4A 1RJ9B 2HSBA 3K7DA 2QLAA 2EIJC 4PJLA 3S27A 2PBEA 3NRHA 4XEKA 1YA9A 4CDVA 1AUEA 1YZAA 2PNOA 3EG9A 2H7OA 3L0IA 4BEJA 2TMVP 1JR8A 2NUTA 4N06A 3RH3A 3AG4C 1OCOC 1YA7O 1YLMA 4JE9A 2R9RB 3SNHA 5DQZA 5L0DA 1V4AA 3AG3C 4P6IC 3UNGC 1VLTA 2H8AA 3QW0A 2W4MA 3A9CA 1HW2A 2YHSA 2ZPAA 4MVQA 1GQAA 3HKKA 3IQ5A 4JCHA 1MMDA 4YL0A 3VF0A 2C04A 2KW3C 2HV6A 1EI7A 4MQ9F 1MMAA 1NBBA 1Q0FA 2VASA 3QZCA 5L0IA 4D4XA 2QE9A 2WVNA 1ZHTA 4CX9A 1J8MF 5E2QA 4OD4A 3DM5A 4J7TA 1EA8A 2W9YA 1ZHZA 3OA1A 2P0NA 1IW7F 4MTOA 4JTCB 2JPUA 2YEVA 1VYIA 3IQ6A 4G0HA 1ORSC 2AWCA 3S29A 5JRAA 4GQHA 2IXPA 3W2WA 1M2VB 2OEXA 2ZXWC 1ST6A 1MMNA 4Z9HA 3IPMO 3T9OA 2R02A 1JMWA 1OR2A 4EBBA 4Q4ZF 3FOPA 3UMIA 4J30B 2J9BA 2YZSA 3KL4A 2OU6A 3N24A 2YLIA 2ZXPA 4JJGA 1QVXA 3S28A 2L7AA 4C7OB 3PDMP 2R25A 3B29A 1IZMA 2L9JA 4U5FE 3UMHA 5E3CA 2XLHA 4DRIB 1I5NA 4IAOA 4C3DA 2QTVA 4YJWA 1LVKA 2LFDA 4QI0A 2ETSA 2DYSC 3VYWA 3EGDB 4E7ZA 4LACB 3C8GB 3PHF2 4LLCA 4RDAA 4EHPA 2UUIA 4U5EE 1PCXA 3HLZA 2LIGA 3B0VC 3DD7A 3K6BA 5KYXB 5A69A 3U8PA 2XLDA 3H2UA 3K33A 3RFYA 1RCPA 3U3FA 1CPRA 2QNLA 3EJNA 3WG7C 2PP4A 2OKUA 1QZXA 1KU2A 2XL4A 2IXMA 5K0IA 4ULVA 3BRJA 2C03A 1F1MA 2PFDA 2YRFA 5COGA 1GS9A 1ZYRF 4ULWA 3TOMA 5A6AA 2LQGA 3GANA 2VCCA 3DM9B 1ORYA 1SYQA 1VMAA 5JS5A 3NYMA 4ZLCA 5JT4A 5JVEA 2IXOA 5KYUB 1E86A 1FTSA 3FMSA 3DAFA 3ZTZA 4NTBA 1JRAA 3ABMC 4CDYA 1AVOB 4O7GA 2XLWA 3EPVA 2RSEB 4PFOA 4OIQF 4JVSA 2KNHA 2A1DD 3K1IC 3EFOA 3IHUA 4IWBA 5L0JA 2HMZA 3ZG1A 4CSAA 3ASNC 2HJ3A 1UG7A 1Z3IX 4JTDB 1JPJA 2A0UA 2FAPB 5B3SC 4G7OF 1FAPB 4YT2A 4QDLA 5EK0A 2V3CC 2OJED 3K1HA 1G4WR 1NFOA 1D0YA 5F5HA 2XLOA 3U8VA 1V54C 4PJJA 4R32A 2R7SA 2OCCC 3S9OA 1OCCC 2Y69C 1Q0GA 1TWHA 2EINC 2R7TA 2R7XA 1ORJA 1WOLA 1GGQA 1NFNA 5L0GA 4I3MA 4K1OA 2R7RA 4OINF 3HNLA 2IOQA 4BPMA 2J8WA 4KI2A 3FAJA 2AU5A 1EQ1A 3UMKA 3POVA 1O3UA 1OKKA 1VK5A 1FFTC 5KYYA 5CI9A 5T3TA 4BJ5C 4E18A 4OIPF 3CAXA 3MLGA 3QVZA 3C18A 1E84A 1OW6A 5DQTA 1M6TA 1LE2A 2O9XA 2R7WA 3EGXB 4A4AA 3AG2C 2H7VC 5JP7A 1G4US 1TFKB 2LD6A 3U9MA 4EUKB 1KNYA 2P61A 3HJCA 1LE4A 5BUOA 1BZ4A 2WL8A 2Y3DA 1YZCA 1WASA 2J0XA 1FNTc 3V5ZA 1LKXA 1V74B 2CGEA 4HFFB 3TJ5A 1C03A 3O39A 3SZRA 2I8BA 4XLPF 4YT4A 4YWQA 2NUPB 3R7CA 1VYKA 2I15A 3ZVRA 4DRHB 1OCZC 5IY5C 1D1CA 3VAYA 2GDCA 1UFBA 2J9VA 2P6VA 5KYWA 1U0BB 2EILC 5EGYA 3SXKA 3Q6NA 3ZQYA 2WZLA 3QMKA 2WZFA 3GODA 4JJFA 4WJ0A 5TJ5E 3RQGA 1RMVA 1GM5A 3EQLF 2A6HF 4MS2A 4U9EA 1CGOA 2J0WA 2NSFA 1PD1A 1OKKD 2GFHA 2Q4FA 3W2VA 2DI3A 5DLJA 5BQIA 4QI2A 2A0BA 3KPHA 4BJ5A 4AL1A 4CDAA 1R5ID 2RD9A 5L0HA 1S7ZA 1H6GA 4MVZA 3B0UX 1SZIA 3F47A 3X2QC 3MYFA 2Z15A 3NMKA 1OXBA 3U0CA 2X0CA 2J45A 3U5SA 2F22A 4C3BA 4G78A 2A6EF 1NSGB 2KJGA 1Y4CA 3EFOB 2EIKC 3M1CB 3EZIA 3O10A 4NY3A 3AG1C 3UGOA 4JURI 4PR9A 2CW0F 3H2VA 1W2WA 2X51A 4YK5A 3O6XA 5BQGA 2DYRC 1T6QA 4U5CE 1U89A 3G4ZA 1V55C 4K0DA 1HW1A 1OCRC 2XSEA 3QVYA 1B68A 3G4XA 4LERA 5B1AC 3SEOA 3JYYA 2B0HA 3MYIA 2LCHA 5CI8A 1A7EA 3RIPA 3V5YA 1CGME 3N2ZB 2DB4A 3MFNA 4EKWA 4P9TA 2L6GA 1HMOA 5DS6A 2NPUA 5KYXA 1T9KA 2DGJA 1QSPA 4MVUA 3TULA 5E3AA 2E87A 3BEHA 3Q7LA 5T3WA 4XPXA 3DI5A 3B71A 2CCYA 3HTKC 4XQ1A 4MTFA 2EPOA 4UDVA 1Q0DA 5L0FA 4CS9A 4BEMJ 5AC4A 4YT5A 1FMVA 4BJ6C 4PJNA 5A6JA 1E85A 2R7OA 4ER9A 5B3IA 3OWTA 3Q7GA 3AGTA 4JC7A 2Y3GA 2Y3BA 1H9GA 2Q9CA 4XLNF 4CIPA 2XM4A 3ABKC 4LDRA 5HSWA 4U5GA 3DKAA 1WATA 4I44A 2HUJA 4CJGA 4U5DE 3C7JA 2XXAA 1RKCA 4Q7CA 1VB5A 2PF4E 4DBRA 1JAFA 4FX5A 4NTFA 1RKEB 2CNWA 4KBLA 3U9JA 1SF8A 1LI7A 2HKVA 4U9DA 3CZ6A 1H7IA 3LEVA 3I5QA 3E70C 1O87A 4JCZA 2XLEA 4CS7A 3LAYA 1JPNA 4FAPB 2XS8A 1Z5ZA 4CBEA 2Y39A 3DAGA 3JRTA 3VM6A 1VTMP 4GYTA 2CDQA 1TWCA 3T4RA 2OJQA 3NYJA 2YKZA 2IBFA 4Z9IA 4PACA 3KYIA 2ZXRA 4YT8A 4NTAA 2JX0A 1Q0MA 3SXYA 1XWJA 2BE5F 1HY5A 3JRMO 2XLMA 3V5XA 1AEPA 1WGWA 2J7PD 2YL3A 3FVYA 3DMDA 1NLXA 1T01A 4WGYA 2YLGA 3RKOF 3ZIBA 3AOUA 2GA0A 3AGUA 4JEBA 5JLIA 3JSEO 3ASOC 4YL1A 4ZLDA 2MYSA 1M56C 3KKBA 4BG0A 5CIVA 3EH1A 4GEHA 3RW0A 5JUAA 3DJUB 4ANJA 1Z23A 4RD9A 3PMRA 3NKDA 4M63A 4PJMA 2MWQA 2MHRA 4F4BA 2KYHA 5A6BD 1YDIA 5DS4A 3Q6MA 5AGFA 2B0JA 2IYLD 4MVMA 1JOGA 1Y6DA 2WVQA 1SR2A 3GWLA 1T6IA 3DE9A 1C17M 2EPLX 3EHNA 3O55A 1O5HA 2G3KA 4O79A 5B1BC 5F5FA 4PK4A 3J06A 3FDQA 2M4EA 2BC5A 2YWAA 4FWVA 2LK4A 4MVSA 3RVZA 3W8HA 1RXQA 2YVKA 4H54A 1TWAA 4A2NB 5L0CA 4WABA 3C8ZA 3G50A 1D1BA 3FOOA 3HNKA 3I4UA 3JCUQ 1ZU5A 3S84A 2JD3A 3KMIA 2J9WA 4MW8A 3TD7A 3B9QA 1VLSA 3C63A 2FFHA 3M15A 2XRHA 4HEAJ 1FMWA 4WGZA 1Z6AA 2R7UA 5FCLA 4XEFA 2XM0A 4O6MA 2D5RB 2EPKX 5DVWA 4U5BE 4E0HA 1Z7Qc 3DXJF 3WAQA 1TQGA 1ZHXA 1J8YF 1OR3A 3DE8A 5EHHA 3NMIA 2YQYA 2LFFA 4W8KA 2P7VA 2J46A 2FGYA 4IB4A 1C02A 1ZZPA 3JT1A 1K05A 4DVYP 4MVOA 1H9TA 2XL6A 4DRJB 1TFOB 4AL0A 3GEIA 2Q7RA 4DBQA 4CS8C 4D4NA 2NUPA 2W45A 1R4TA 4MW3A 2Q3TA 3LEOA 4HE8D 2R05A 2ZXOA 2YL0A 3L8JA 1LS4A 5JSLA 1EKYA 2IM8A 2CYDA 2L81A 2P1AA 2V26A 1TKNA 3I5PA 3NYLA 1RJ9A 3OEOA 3T6GB 3TK0A 4C3EA 3C62A 4H4KC 2J7PA 2OOCA 3V7OA 3NMJA 4NQFA 1I4ZA 3EHMA 3EG9B 3LNMB 4I1OB 3W4YA 1A0BA 2A69F 2VCBA 4C7OA 3AQCA 1K04A 1LS1A 3GM1A 1G5ZA 4DOZA 4BJ6A 5A6KA 3ZTMA 3IQCA 3CSKA 2XXAB 5L3VA 3CEXA 1MNEA 4KC9A 3L1MA 1YYXA 4E0IA 1OW7A 1XZPA 2H7BA 2AWYA 2ASRA 4O6NA 2IXNA 4O6YA 4OD5A 4BJTA 1QLEC 5KYYB 4EIYA 3MX3A 4L6RA 3TOLA 3X1OA 3ECSA 1A7VA 1OW8A 3WODF 3M4CA 1G8XA 1OXKA 3DWWA 4JW1A 3SYNA 1KTMA 3MBGA 2WB7A 4IJJA 1M57C 4PFPA 1APCA 3LJBA 1ZW2A 2NSGA 4JKVA 4N6HA 4AE4B 4N6CA 3ATPA 1U6HA 2J9UA 2PX0A 4MNDA 1MMGA 2BL2A 1LM3B 1PD0A 4E7SA 3F46A 4FESA 4HFKB 2XL8A 1M2VA 4JRZA 1WWPA 1S05A 3JSZA 3RF3A 1LPEA 3LS0A 3GEHA 1E2XA 5COFA 1HMDA 4KNVA 1A7DA 1WTYA 2AP3A 3L34A 1CPQA 2UUHA 3LS1A 4E17A 1BBHA 2KC3A 2G3VA 1YVIA 4OIOF 2LSEA 1D0ZA 3C8GD 3GWNA 2KQ9A 1FFHA 5GPGB 1YYJA 3ITFA 5F28E 2WZGA 1QPUA 2LP4A 2YLDA 2W4BA 3JYHA 2G62A 4NCQA 4Q5SF 1T6UA 1SMYF 4XEVA 1NG1A 1LI5A 3L8IA 3TQOA 3ZDLA 4Z9JA 2ICWG 2EPNA 1BR2A 3UR3C 1A41A 3TJ6A 2QY9A 3SXMA 1QKRA 3ZWIA 2Q9BA 3GEEA 2WVOA 2KGOA 5E33A 3U3BA 4DXWA 1L3PA 3GM3A 4X0RA 3U2LA 4AX2A 4CIHA 2HSQA 3T6JA 1BR4A 1Q0KA 3US6A 3H65A 3GORA 2R7VA 2HFIA 5HV9A 5DS5A 3JTLO 3NKEA 1RKEA 2HJMA 3B0PA 3U2MA 2AVKA 3EH2A 3ABLC 4DJ9A 2HV7A 2EPMX 1T5OA 5FZTA 4KNWA 4IRUA 3S0XA 3HNJA 1TR2A 1ZVZA 2VB6A 2NUTB 3EZHA 2VH3A 3EGDA 4CS9C 3CQZA 2Y3HA 4I1MA 3C8GA 4IARA 1PV3A 3ZQVA 3IEEA 3RQEA 3NDBB 4B6IA 2QUPA 1OQCA 1ZW3A 3LLKA 5D92A 2HS5A 1TWGA 1CGNA 3WHNA 4XWJA 4IAQA 3FHDA 1MQVA 4NC3A 4ONSA 3ZSUA 2KSFA 2Q00A 5T1DB 3ZC4A 1NU7D 1NZEA 3LUTB 3T6BA 5A6BA 4K7BA 4XPYA 3W8IA 3GM2A 4N4WA 3DJNB 2OEVA 4LLEA 1YJGA 1ZHYA 4CJOA 4J32B 1DOVA 1XZQA 256BA 2XS1A 3HNIA 1FR0A 2VCAA 4EBKA
chains in the Genus database with same CATH topology
2QNLA 2OQMA 3DKAA 1RXQA 2NSFA 5COGA 2OU6A 5COMA 2NSGA 2P1AA 4N6CA 2HKVA 3QTHA 2RD9A 5CIVA 3DI5A 2QE9A 5COFA 3GORA 2F22A 3CEXA 2YQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QNL A;  2OQM A;  3DKA A;  1RXQ A;  2NSF A;  5COG A;  2OU6 A;  5COM A;  2NSG A;  2P1A A;  4N6C A;  2HKV A;  3QTH A;  2RD9 A;  5CIV A;  3DI5 A;  2QE9 A;  5COF A;  3GOR A;  2F22 A;  3CEX A;  2YQY A; 
#chains in the Genus database with same CATH topology
 2M64 A;  2OG2 A;  1YAR O;  3QW1 A;  2OQM A;  1HE9 A;  2HZ8 A;  3IQT A;  1WN0 A;  2NG1 A;  2GAQ A;  1BDJ B;  4AK9 A;  5BQH A;  2XLV A;  4JZA A;  4G7Z F;  1Z63 A;  2Q9A A;  1VOM A;  3PCV A;  5COM A;  3N0T A;  4XTK A;  1YAU O;  3RQF A;  5AC5 A;  3UGP A;  4EBJ A;  4JIO A;  1HE1 A;  3QTH A;  3AJM A;  4JEA A;  3R2P A;  3VRC A;  1D1A A;  2L6F A;  2YL7 A;  3AQB A;  3M79 A;  5D91 A;  3SXZ A;  1D0X A;  1ZU4 A;  1BR1 A;  3K1I A;  1L7C A;  2YL1 A;  2R03 A;  2R7Q A;  3JZ0 A;  2VC9 A;  3K66 A;  1LIH A;  2GWW A;  1ZHW A;  3FXH A;  1M2O A;  1QQ3 A;  2CNW D;  2PX3 A;  4LDQ A;  4DVZ A;  4J7Y A;  2KK1 A;  4YN0 B;  4YL3 A;  4CSA C;  3RYL A;  3S90 A;  4JTA B;  4RBN A;  4G7H F;  4EWC A;  1DOW A;  4IGG A;  2ZD9 A;  2D4U A;  4OIR F;  4CS8 A;  3A11 A;  1NU9 C;  4LDK A;  4XPW A;  3E9V A;  2EIM C;  3M4B A;  1I4Y A;  3KH2 A;  2L6H A;  4MVR A;  5KYW B;  4U5H A;  5KYU A;  1K40 A;  4W8P A;  5KYN A;  2HMQ A;  3LNR A;  1MND A;  3LES A;  4BJ1 A;  1N1C A;  4P9F A;  5L3Q A;  3NG1 A;  4MTG A;  2A68 F;  3EGX A;  3KYJ A;  3SP1 A;  1E83 A;  3DZA A;  3LLI A;  3FAP B;  3RVY A;  4AE4 A;  1RJ9 B;  2HSB A;  3K7D A;  2QLA A;  2EIJ C;  4PJL A;  3S27 A;  2PBE A;  3NRH A;  4XEK A;  1YA9 A;  4CDV A;  1AUE A;  1YZA A;  2PNO A;  3EG9 A;  2H7O A;  3L0I A;  4BEJ A;  2TMV P;  1JR8 A;  2NUT A;  4N06 A;  3RH3 A;  3AG4 C;  1OCO C;  1YA7 O;  1YLM A;  4JE9 A;  2R9R B;  3SNH A;  5DQZ A;  5L0D A;  1V4A A;  3AG3 C;  4P6I C;  3UNG C;  1VLT A;  2H8A A;  3QW0 A;  2W4M A;  3A9C A;  1HW2 A;  2YHS A;  2ZPA A;  4MVQ A;  1GQA A;  3HKK A;  3IQ5 A;  4JCH A;  1MMD A;  4YL0 A;  3VF0 A;  2C04 A;  2KW3 C;  2HV6 A;  1EI7 A;  4MQ9 F;  1MMA A;  1NBB A;  1Q0F A;  2VAS A;  3QZC A;  5L0I A;  4D4X A;  2QE9 A;  2WVN A;  1ZHT A;  4CX9 A;  1J8M F;  5E2Q A;  4OD4 A;  3DM5 A;  4J7T A;  1EA8 A;  2W9Y A;  1ZHZ A;  3OA1 A;  2P0N A;  1IW7 F;  4MTO A;  4JTC B;  2JPU A;  2YEV A;  1VYI A;  3IQ6 A;  4G0H A;  1ORS C;  2AWC A;  3S29 A;  5JRA A;  4GQH A;  2IXP A;  3W2W A;  1M2V B;  2OEX A;  2ZXW C;  1ST6 A;  1MMN A;  4Z9H A;  3IPM O;  3T9O A;  2R02 A;  1JMW A;  1OR2 A;  4EBB A;  4Q4Z F;  3FOP A;  3UMI A;  4J30 B;  2J9B A;  2YZS A;  3KL4 A;  2OU6 A;  3N24 A;  2YLI A;  2ZXP A;  4JJG A;  1QVX A;  3S28 A;  2L7A A;  4C7O B;  3PDM P;  2R25 A;  3B29 A;  1IZM A;  2L9J A;  4U5F E;  3UMH A;  5E3C A;  2XLH A;  4DRI B;  1I5N A;  4IAO A;  4C3D A;  2QTV A;  4YJW A;  1LVK A;  2LFD A;  4QI0 A;  2ETS A;  2DYS C;  3VYW A;  3EGD B;  4E7Z A;  4LAC B;  3C8G B;  3PHF 2;  4LLC A;  4RDA A;  4EHP A;  2UUI A;  4U5E E;  1PCX A;  3HLZ A;  2LIG A;  3B0V C;  3DD7 A;  3K6B A;  5KYX B;  5A69 A;  3U8P A;  2XLD A;  3H2U A;  3K33 A;  3RFY A;  1RCP A;  3U3F A;  1CPR A;  2QNL A;  3EJN A;  3WG7 C;  2PP4 A;  2OKU A;  1QZX A;  1KU2 A;  2XL4 A;  2IXM A;  5K0I A;  4ULV A;  3BRJ A;  2C03 A;  1F1M A;  2PFD A;  2YRF A;  5COG A;  1GS9 A;  1ZYR F;  4ULW A;  3TOM A;  5A6A A;  2LQG A;  3GAN A;  2VCC A;  3DM9 B;  1ORY A;  1SYQ A;  1VMA A;  5JS5 A;  3NYM A;  4ZLC A;  5JT4 A;  5JVE A;  2IXO A;  5KYU B;  1E86 A;  1FTS A;  3FMS A;  3DAF A;  3ZTZ A;  4NTB A;  1JRA A;  3ABM C;  4CDY A;  1AVO B;  4O7G A;  2XLW A;  3EPV A;  2RSE B;  4PFO A;  4OIQ F;  4JVS A;  2KNH A;  2A1D D;  3K1I C;  3EFO A;  3IHU A;  4IWB A;  5L0J A;  2HMZ A;  3ZG1 A;  4CSA A;  3ASN C;  2HJ3 A;  1UG7 A;  1Z3I X;  4JTD B;  1JPJ A;  2A0U A;  2FAP B;  5B3S C;  4G7O F;  1FAP B;  4YT2 A;  4QDL A;  5EK0 A;  2V3C C;  2OJE D;  3K1H A;  1G4W R;  1NFO A;  1D0Y A;  5F5H A;  2XLO A;  3U8V A;  1V54 C;  4PJJ A;  4R32 A;  2R7S A;  2OCC C;  3S9O A;  1OCC C;  2Y69 C;  1Q0G A;  1TWH A;  2EIN C;  2R7T A;  2R7X A;  1ORJ A;  1WOL A;  1GGQ A;  1NFN A;  5L0G A;  4I3M A;  4K1O A;  2R7R A;  4OIN F;  3HNL A;  2IOQ A;  4BPM A;  2J8W A;  4KI2 A;  3FAJ A;  2AU5 A;  1EQ1 A;  3UMK A;  3POV A;  1O3U A;  1OKK A;  1VK5 A;  1FFT C;  5KYY A;  5CI9 A;  5T3T A;  4BJ5 C;  4E18 A;  4OIP F;  3CAX A;  3MLG A;  3QVZ A;  3C18 A;  1E84 A;  1OW6 A;  5DQT A;  1M6T A;  1LE2 A;  2O9X A;  2R7W A;  3EGX B;  4A4A A;  3AG2 C;  2H7V C;  5JP7 A;  1G4U S;  1TFK B;  2LD6 A;  3U9M A;  4EUK B;  1KNY A;  2P61 A;  3HJC A;  1LE4 A;  5BUO A;  1BZ4 A;  2WL8 A;  2Y3D A;  1YZC A;  1WAS A;  2J0X A;  1FNT c;  3V5Z A;  1LKX A;  1V74 B;  2CGE A;  4HFF B;  3TJ5 A;  1C03 A;  3O39 A;  3SZR A;  2I8B A;  4XLP F;  4YT4 A;  4YWQ A;  2NUP B;  3R7C A;  1VYK A;  2I15 A;  3ZVR A;  4DRH B;  1OCZ C;  5IY5 C;  1D1C A;  3VAY A;  2GDC A;  1UFB A;  2J9V A;  2P6V A;  5KYW A;  1U0B B;  2EIL C;  5EGY A;  3SXK A;  3Q6N A;  3ZQY A;  2WZL A;  3QMK A;  2WZF A;  3GOD A;  4JJF A;  4WJ0 A;  5TJ5 E;  3RQG A;  1RMV A;  1GM5 A;  3EQL F;  2A6H F;  4MS2 A;  4U9E A;  1CGO A;  2J0W A;  2NSF A;  1PD1 A;  1OKK D;  2GFH A;  2Q4F A;  3W2V A;  2DI3 A;  5DLJ A;  5BQI A;  4QI2 A;  2A0B A;  3KPH A;  4BJ5 A;  4AL1 A;  4CDA A;  1R5I D;  2RD9 A;  5L0H A;  1S7Z A;  1H6G A;  4MVZ A;  3B0U X;  1SZI A;  3F47 A;  3X2Q C;  3MYF A;  2Z15 A;  3NMK A;  1OXB A;  3U0C A;  2X0C A;  2J45 A;  3U5S A;  2F22 A;  4C3B A;  4G78 A;  2A6E F;  1NSG B;  2KJG A;  1Y4C A;  3EFO B;  2EIK C;  3M1C B;  3EZI A;  3O10 A;  4NY3 A;  3AG1 C;  3UGO A;  4JUR I;  4PR9 A;  2CW0 F;  3H2V A;  1W2W A;  2X51 A;  4YK5 A;  3O6X A;  5BQG A;  2DYR C;  1T6Q A;  4U5C E;  1U89 A;  3G4Z A;  1V55 C;  4K0D A;  1HW1 A;  1OCR C;  2XSE A;  3QVY A;  1B68 A;  3G4X A;  4LER A;  5B1A C;  3SEO A;  3JYY A;  2B0H A;  3MYI A;  2LCH A;  5CI8 A;  1A7E A;  3RIP A;  3V5Y A;  1CGM E;  3N2Z B;  2DB4 A;  3MFN A;  4EKW A;  4P9T A;  2L6G A;  1HMO A;  5DS6 A;  2NPU A;  5KYX A;  1T9K A;  2DGJ A;  1QSP A;  4MVU A;  3TUL A;  5E3A A;  2E87 A;  3BEH A;  3Q7L A;  5T3W A;  4XPX A;  3DI5 A;  3B71 A;  2CCY A;  3HTK C;  4XQ1 A;  4MTF A;  2EPO A;  4UDV A;  1Q0D A;  5L0F A;  4CS9 A;  4BEM J;  5AC4 A;  4YT5 A;  1FMV A;  4BJ6 C;  4PJN A;  5A6J A;  1E85 A;  2R7O A;  4ER9 A;  5B3I A;  3OWT A;  3Q7G A;  3AGT A;  4JC7 A;  2Y3G A;  2Y3B A;  1H9G A;  2Q9C A;  4XLN F;  4CIP A;  2XM4 A;  3ABK C;  4LDR A;  5HSW A;  4U5G A;  3DKA A;  1WAT A;  4I44 A;  2HUJ A;  4CJG A;  4U5D E;  3C7J A;  2XXA A;  1RKC A;  4Q7C A;  1VB5 A;  2PF4 E;  4DBR A;  1JAF A;  4FX5 A;  4NTF A;  1RKE B;  2CNW A;  4KBL A;  3U9J A;  1SF8 A;  1LI7 A;  2HKV A;  4U9D A;  3CZ6 A;  1H7I A;  3LEV A;  3I5Q A;  3E70 C;  1O87 A;  4JCZ A;  2XLE A;  4CS7 A;  3LAY A;  1JPN A;  4FAP B;  2XS8 A;  1Z5Z A;  4CBE A;  2Y39 A;  3DAG A;  3JRT A;  3VM6 A;  1VTM P;  4GYT A;  2CDQ A;  1TWC A;  3T4R A;  2OJQ A;  3NYJ A;  2YKZ A;  2IBF A;  4Z9I A;  4PAC A;  3KYI A;  2ZXR A;  4YT8 A;  4NTA A;  2JX0 A;  1Q0M A;  3SXY A;  1XWJ A;  2BE5 F;  1HY5 A;  3JRM O;  2XLM A;  3V5X A;  1AEP A;  1WGW A;  2J7P D;  2YL3 A;  3FVY A;  3DMD A;  1NLX A;  1T01 A;  4WGY A;  2YLG A;  3RKO F;  3ZIB A;  3AOU A;  2GA0 A;  3AGU A;  4JEB A;  5JLI A;  3JSE O;  3ASO C;  4YL1 A;  4ZLD A;  2MYS A;  1M56 C;  3KKB A;  4BG0 A;  5CIV A;  3EH1 A;  4GEH A;  3RW0 A;  5JUA A;  3DJU B;  4ANJ A;  1Z23 A;  4RD9 A;  3PMR A;  3NKD A;  4M63 A;  4PJM A;  2MWQ A;  2MHR A;  4F4B A;  2KYH A;  5A6B D;  1YDI A;  5DS4 A;  3Q6M A;  5AGF A;  2B0J A;  2IYL D;  4MVM A;  1JOG A;  1Y6D A;  2WVQ A;  1SR2 A;  3GWL A;  1T6I A;  3DE9 A;  1C17 M;  2EPL X;  3EHN A;  3O55 A;  1O5H A;  2G3K A;  4O79 A;  5B1B C;  5F5F A;  4PK4 A;  3J06 A;  3FDQ A;  2M4E A;  2BC5 A;  2YWA A;  4FWV A;  2LK4 A;  4MVS A;  3RVZ A;  3W8H A;  1RXQ A;  2YVK A;  4H54 A;  1TWA A;  4A2N B;  5L0C A;  4WAB A;  3C8Z A;  3G50 A;  1D1B A;  3FOO A;  3HNK A;  3I4U A;  3JCU Q;  1ZU5 A;  3S84 A;  2JD3 A;  3KMI A;  2J9W A;  4MW8 A;  3TD7 A;  3B9Q A;  1VLS A;  3C63 A;  2FFH A;  3M15 A;  2XRH A;  4HEA J;  1FMW A;  4WGZ A;  1Z6A A;  2R7U A;  5FCL A;  4XEF A;  2XM0 A;  4O6M A;  2D5R B;  2EPK X;  5DVW A;  4U5B E;  4E0H A;  1Z7Q c;  3DXJ F;  3WAQ A;  1TQG A;  1ZHX A;  1J8Y F;  1OR3 A;  3DE8 A;  5EHH A;  3NMI A;  2YQY A;  2LFF A;  4W8K A;  2P7V A;  2J46 A;  2FGY A;  4IB4 A;  1C02 A;  1ZZP A;  3JT1 A;  1K05 A;  4DVY P;  4MVO A;  1H9T A;  2XL6 A;  4DRJ B;  1TFO B;  4AL0 A;  3GEI A;  2Q7R A;  4DBQ A;  4CS8 C;  4D4N A;  2NUP A;  2W45 A;  1R4T A;  4MW3 A;  2Q3T A;  3LEO A;  4HE8 D;  2R05 A;  2ZXO A;  2YL0 A;  3L8J A;  1LS4 A;  5JSL A;  1EKY A;  2IM8 A;  2CYD A;  2L81 A;  2P1A A;  2V26 A;  1TKN A;  3I5P A;  3NYL A;  1RJ9 A;  3OEO A;  3T6G B;  3TK0 A;  4C3E A;  3C62 A;  4H4K C;  2J7P A;  2OOC A;  3V7O A;  3NMJ A;  4NQF A;  1I4Z A;  3EHM A;  3EG9 B;  3LNM B;  4I1O B;  3W4Y A;  1A0B A;  2A69 F;  2VCB A;  4C7O A;  3AQC A;  1K04 A;  1LS1 A;  3GM1 A;  1G5Z A;  4DOZ A;  4BJ6 A;  5A6K A;  3ZTM A;  3IQC A;  3CSK A;  2XXA B;  5L3V A;  3CEX A;  1MNE A;  4KC9 A;  3L1M A;  1YYX A;  4E0I A;  1OW7 A;  1XZP A;  2H7B A;  2AWY A;  2ASR A;  4O6N A;  2IXN A;  4O6Y A;  4OD5 A;  4BJT A;  1QLE C;  5KYY B;  4EIY A;  3MX3 A;  4L6R A;  3TOL A;  3X1O A;  3ECS A;  1A7V A;  1OW8 A;  3WOD F;  3M4C A;  1G8X A;  1OXK A;  3DWW A;  4JW1 A;  3SYN A;  1KTM A;  3MBG A;  2WB7 A;  4IJJ A;  1M57 C;  4PFP A;  1APC A;  3LJB A;  1ZW2 A;  2NSG A;  4JKV A;  4N6H A;  4AE4 B;  4N6C A;  3ATP A;  1U6H A;  2J9U A;  2PX0 A;  4MND A;  1MMG A;  2BL2 A;  1LM3 B;  1PD0 A;  4E7S A;  3F46 A;  4FES A;  4HFK B;  2XL8 A;  1M2V A;  4JRZ A;  1WWP A;  1S05 A;  3JSZ A;  3RF3 A;  1LPE A;  3LS0 A;  3GEH A;  1E2X A;  5COF A;  1HMD A;  4KNV A;  1A7D A;  1WTY A;  2AP3 A;  3L34 A;  1CPQ A;  2UUH A;  3LS1 A;  4E17 A;  1BBH A;  2KC3 A;  2G3V A;  1YVI A;  4OIO F;  2LSE A;  1D0Z A;  3C8G D;  3GWN A;  2KQ9 A;  1FFH A;  5GPG B;  1YYJ A;  3ITF A;  5F28 E;  2WZG A;  1QPU A;  2LP4 A;  2YLD A;  2W4B A;  3JYH A;  2G62 A;  4NCQ A;  4Q5S F;  1T6U A;  1SMY F;  4XEV A;  1NG1 A;  1LI5 A;  3L8I A;  3TQO A;  3ZDL A;  4Z9J A;  2ICW G;  2EPN A;  1BR2 A;  3UR3 C;  1A41 A;  3TJ6 A;  2QY9 A;  3SXM A;  1QKR A;  3ZWI A;  2Q9B A;  3GEE A;  2WVO A;  2KGO A;  5E33 A;  3U3B A;  4DXW A;  1L3P A;  3GM3 A;  4X0R A;  3U2L A;  4AX2 A;  4CIH A;  2HSQ A;  3T6J A;  1BR4 A;  1Q0K A;  3US6 A;  3H65 A;  3GOR A;  2R7V A;  2HFI A;  5HV9 A;  5DS5 A;  3JTL O;  3NKE A;  1RKE A;  2HJM A;  3B0P A;  3U2M A;  2AVK A;  3EH2 A;  3ABL C;  4DJ9 A;  2HV7 A;  2EPM X;  1T5O A;  5FZT A;  4KNW A;  4IRU A;  3S0X A;  3HNJ A;  1TR2 A;  1ZVZ A;  2VB6 A;  2NUT B;  3EZH A;  2VH3 A;  3EGD A;  4CS9 C;  3CQZ A;  2Y3H A;  4I1M A;  3C8G A;  4IAR A;  1PV3 A;  3ZQV A;  3IEE A;  3RQE A;  3NDB B;  4B6I A;  2QUP A;  1OQC A;  1ZW3 A;  3LLK A;  5D92 A;  2HS5 A;  1TWG A;  1CGN A;  3WHN A;  4XWJ A;  4IAQ A;  3FHD A;  1MQV A;  4NC3 A;  4ONS A;  3ZSU A;  2KSF A;  2Q00 A;  5T1D B;  3ZC4 A;  1NU7 D;  1NZE A;  3LUT B;  3T6B A;  5A6B A;  4K7B A;  4XPY A;  3W8I A;  3GM2 A;  4N4W A;  3DJN B;  2OEV A;  4LLE A;  1YJG A;  1ZHY A;  4CJO A;  4J32 B;  1DOV A;  1XZQ A;  256B A;  2XS1 A;  3HNI A;  1FR0 A;  2VCA A;  4EBK A; 
#chains in the Genus database with same CATH homology
 2QNL A;  2OQM A;  3DKA A;  1RXQ A;  2NSF A;  5COG A;  2OU6 A;  5COM A;  2NSG A;  2P1A A;  4N6C A;  2HKV A;  3QTH A;  2RD9 A;  5CIV A;  3DI5 A;  2QE9 A;  5COF A;  3GOR A;  2F22 A;  3CEX A;  2YQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...