2HKVA

Crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
GMTDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIKLDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein RBL00553 (ZP_00537729.1) from EXIGUOBACTERIUM SP. 255-15 at 1.70 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Dna binding protein
molecule keywords Hypothetical protein
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2hkvA01
1RXQA 3DKAA 2OU6A 2NSGA 2NSFA 5CIVA 4N6CA 2RD9A 2P1AA 5COFA 2QE9A 3GORA 3DI5A 2QNLA 2YQYA 5COGA 3CEXA 2F22A 2OQMA 5COMA 3QTHA 2HKVA
chains in the Genus database with same CATH superfamily
2Y3DA 5KYNA 4LDRA 1RXQA 2R25A 1UG7A 3QW1A 3IPMO 4GYTA 1WOLA 1LM3B 3O39A 1JR8A 5BQIA 4JVSA 1O3UA 2WL8A 4K1OA 2L9JA 3WODF 1QVXA 3GEIA 4EBJA 2QUPA 2TMVP 1YYXA 2LSEA 4XPXA 3EGXA 3EH1A 2NUPA 3W8IA 5DLJA 1I4YA 1YZAA 3KL4A 1M57C 4NTAA 4ANJA 3T4RA 3SXYA 1BDJB 5JSLA 4G7HF 5JT4A 1RKEA 2YEVA 2ZXPA 2P7VA 1XWJA 3JSZA 1Z23A 3L1MA 1OCCC 4LERA 2Y39A 1ORYA 3DAGA 1Q0GA 1YA9A 4NTBA 3NKDA 4OD5A 4EBBA 2JX0A 4FESA 4M63A 2AVKA 2HS5A 3FVYA 3LUTB 4YT2A 1MNDA 4RDAA 3M4CA 4BJ5A 3M79A 4I1MA 3C8GA 2HV6A 3NYJA 3U5SA 4CJOA 1VYKA 2LCHA 5B3SC 5L0DA 2GWWA 2IYLD 4P9TA 3GORA 4E0IA 4N6HA 1MNEA 3C62A 5AGFA 2YL7A 4XTKA 1E2XA 5FZTA 4OIPF 1RKEB 4MQ9F 4NC3A 4CX9A 4FX5A 4AK9A 2QTVA 1CGME 1ORSC 3EGDB 1HW1A 3LESA 3OWTA 3GM2A 4JTCB 3LS1A 3QMKA 4U5BE 4AX2A 4YL1A 3DD7A 3B0VC 2HKVA 1H9TA 3ZVRA 3RYLA 1D0ZA 2R7WA 2XXAA 2R02A 2Z15A 4QDLA 1GM5A 1NBBA 2GA0A 2MHRA 3ITFA 1YJGA 2AU5A 2VCAA 2LFDA 4CSAC 3ZTZA 3MBGA 2MWQA 4O6NA 5L0IA 2R05A 3FOOA 4YWQA 3AGUA 2XL6A 1HE1A 2OKUA 3TQOA 4BEJA 2B0JA 4DRJB 4EHPA 3MFNA 4G78A 2CDQA 4U5FE 4Z9IA 3S90A 5T3TA 5DS5A 2XSEA 2C03A 4MTOA 3JSEO 3CEXA 4HEAJ 1WWPA 3IQ5A 2W4BA 1IW7F 1D1BA 3EGDA 1QQ3A 3FXHA 1RMVA 1GGQA 3JRMO 3HTKC 4E7ZA 2P1AA 2IM8A 4IARA 1ZHWA 4JKVA 1MMNA 1FAPB 1QZXA 3NMJA 3Q6NA 3Q7LA 2XL8A 3BEHA 5DS6A 3NDBB 3CAXA 5B1AC 1HY5A 1EQ1A 3DMDA 1KTMA 1AVOB 2HV7A 1FR0A 3KKBA 2OOCA 1QSPA 1AEPA 1TWAA 2J46A 1N1CA 2A6EF 1VLTA 2NPUA 3NYLA 3O10A 2IXNA 4CS9A 5EGYA 3POVA 3BRJA 2UUIA 1NSGB 1K40A 4G0HA 4XPWA 4FAPB 1LE2A 3C63A 4C3BA 3TJ6A 3ZQVA 3S9OA 3KYJA 4I3MA 1VK5A 3KPHA 3AQCA 3FAPB 4RBNA 2ZD9A 3GM3A 3L34A 2BE5F 4JEAA 1DOVA 2D4UA 3QVYA 5JVEA 1T6IA 5HSWA 1ZW2A 3LNMB 4PR9A 3R7CA 1Y6DA 4WABA 3UNGC 4CDYA 5KYYB 3VM6A 3V5YA 2MYSA 1NG1A 5A6KA 1A7VA 1VTMP 3VRCA 4EIYA 3GWLA 5JRAA 1HMOA 1OCRC 1OXKA 1QKRA 4PJNA 3RQGA 2OU6A 4BEMJ 1RCPA 5TJ5E 1T6UA 3HLZA 4QI0A 3FHDA 3RFYA 3E70C 4RD9A 2CNWA 2V26A 3UMKA 1A0BA 1WATA 2QNLA 1T5OA 3NG1A 4MS2A 2WVNA 1YVIA 2A68F 2XXAB 2EILC 5BUOA 2Q00A 3DWWA 5D91A 2KW3C 2IXPA 1FMVA 3W8HA 4J32B 3HNKA 3AG3C 3H65A 3AGTA 1ZZPA 2YLDA 4KNWA 1JAFA 1Z6AA 2HJMA 1NU9C 1CGNA 2A0UA 2H7VC 1VOMA 3DE9A 4IWBA 1WTYA 3RVZA 2I8BA 2PX3A 2QY9A 4MVMA 3SZRA 1MQVA 1TFKB 4MW8A 4W8PA 1OCZC 3X2QC 3K1IC 1J8YF 2A6HF 5DVWA 3DAFA 1BZ4A 3EJNA 4JEBA 4LLEA 1O87A 5L0JA 2PF4E 1D0YA 1Q0DA 1U6HA 2KJGA 3KH2A 5JS5A 4JCZA 2KGOA 1LIHA 4UDVA 1CPRA 2M64A 2YHSA 2J8WA 3DM5A 2DB4A 3EQLF 1RKCA 4KI2A 1NFOA 1OXBA 4C7OA 3CSKA 2AP3A 4LDQA 4C7OB 3CZ6A 5L0HA 2WZGA 2YQYA 3K33A 4JJFA 3K66A 1FFHA 4NQFA 3V5XA 3U2MA 2F22A 3I5QA 2OJED 4BJTA 3ZG1A 3EG9B 3QZCA 3EG9A 4A4AA 5BQGA 1OW7A 3IQTA 4LLCA 4JTDB 1FNTc 2W4MA 3NRHA 1FMWA 5F28E 4DXWA 2L81A 4JJGA 4Z9HA 3DM9B 5IY5C 3LLIA 1NZEA 1D0XA 1BR4A 256BA 1M2VA 4YL3A 4JC7A 2G62A 5HV9A 3G4XA 3EZIA 3CQZA 4IGGA 1HE9A 4O6MA 1VB5A 4CS7A 2WZFA 4G7ZF 4YJWA 2R7OA 3IHUA 1TFOB 2NG1A 3U0CA 4DBQA 1EA8A 3S27A 3LAYA 5COGA 1JPJA 4O79A 1E84A 3FDQA 4U5EE 4WGZA 3X1OA 1MMGA 4MW3A 2J7PD 3F46A 4KBLA 4OINF 1L3PA 3EHNA 3T9OA 2WVQA 2OG2A 2XRHA 4J7TA 2EIKC 2XM0A 2XLVA 5AC5A 1JRAA 4BJ6C 4IJJA 1KNYA 2EINC 3LS0A 3QTHA 1FFTC 1WGWA 2P0NA 2WB7A 4YL0A 5JP7A 4JIOA 5T3WA 1XZQA 3AG2C 2HJ3A 5E3AA 5KYWB 4Q4ZF 1R5ID 2YL0A 3W4YA 1H9GA 2J7PA 3AG4C 5F5HA 4IAOA 1B68A 4XEVA 3GEEA 2VASA 3EH2A 4NTFA 4U5DE 2D5RB 4PFOA 2C04A 2O9XA 1U89A 2OCCC 3UR3C 3KYIA 1ZU5A 2B0HA 2WZLA 3I5PA 4P9FA 1U0BB 4L6RA 5L0CA 2Y3BA 2E87A 4JCHA 3U2LA 1ZHYA 2CW0F 2AWCA 1G4WR 4PJJA 1JMWA 2HMZA 3R2PA 4CDVA 2CYDA 5L0GA 3A9CA 2HSBA 4PFPA 4U9EA 1E85A 2CNWD 2Q4FA 1OW6A 4QI2A 3DJNB 2OEXA 2EIJC 5KYXB 2W45A 4JW1A 2EPMX 4YT5A 4N06A 3GWNA 3UGOA 1TKNA 2Y3HA 2R7TA 2JD3A 1SMYF 3JCUQ 5GPGB 2DI3A 4ONSA 4MTGA 1OQCA 4I44A 1WN0A 3TJ5A 3G50A 3N2ZB 5FCLA 2VC9A 5JUAA 2Q9CA 4MVSA 4U5CE 4AL0A 5F5FA 1M6TA 5KYUA 4N6CA 3ZWIA 1OW8A 5CI8A 3F47A 2CGEA 3RQEA 1EI7A 4MVOA 4EUKB 3J06A 1SYQA 1YAUO 4BJ6A 1S7ZA 1FTSA 3AQBA 4OIOF 3HNIA 3FAJA 3RKOF 4D4XA 4IB4A 2J0WA 1NFNA 3TK0A 2R9RB 4C3DA 5AC4A 1O5HA 1LKXA 2KYHA 1Z5ZA 2H8AA 3GODA 1RJ9B 2EPNA 2A69F 2HUJA 2Q9BA 4YN0B 4CS8C 5KYXA 1V55C 1A7EA 2ICWG 3EFOA 3EFOB 3S29A 3KMIA 3ZDLA 4N4WA 2L6GA 3L0IA 3B0PA 4D4NA 1YZCA 3QW0A 2NUTB 4I1OB 2VCCA 4PJMA 2LQGA 3ZIBA 2BL2A 3HKKA 3EHMA 1ZYRF 2DYSC 1TR2A 1OR3A 5L3QA 1MMAA 2XLOA 3AOUA 3B29A 1A41A 1CGOA 2XS8A 2ZXWC 3IEEA 1G8XA 3AJMA 4J7YA 4WJ0A 3WAQA 5KYYA 2R7RA 2L6HA 5A6BD 2VB6A 4XEKA 1ZU4A 3SXMA 3US6A 3RQFA 4U5GA 2X51A 1RJ9A 5E2QA 2J0XA 2LIGA 1D1CA 2OQMA 5A6BA 1H7IA 4DVZA 4E0HA 3LJBA 1LPEA 3U8VA 1OKKD 2OJQA 3NYMA 1LI5A 1VMAA 3ZSUA 4YT8A 1H6GA 4XLPF 2LK4A 1S05A 1V74B 3T6BA 2XLEA 4MVQA 4DOZA 3SXKA 2A0BA 2R7XA 2Q7RA 4CSAA 1UFBA 1M2VB 2VH3A 2PFDA 3IQCA 4CDAA 1Z7Qc 3K6BA 3PCVA 5A69A 3FMSA 1Q0KA 2LFFA 3K1IA 3C8GD 2L7AA 2ASRA 1F1MA 2GAQA 3ABLC 3RIPA 3RW0A 1T01A 1HMDA 1ZHXA 1BR2A 3DXJF 4W8KA 3DE8A 4DRIB 2IOQA 5A6JA 4E7SA 3EZHA 2G3VA 1JPNA 1ST6A 5DQZA 2V3CC 1EKYA 3MLGA 1LS1A 2RSEB 4MVUA 1XZPA 2EIMC 3PDMP 3DJUB 2BC5A 2LP4A 3UMHA 4XQ1A 3GEHA 3V5ZA 1WASA 2DGJA 3ABMC 1YARO 3MX3A 3O6XA 4JRZA 4WGYA 2KNHA 5COMA 2J9VA 1JOGA 4Z9JA 2YLGA 3SYNA 1NU7D 2VCBA 3ZTMA 3ASOC 4JURI 4O6YA 2YWAA 4R32A 3B9QA 3DKAA 3U3BA 4ER9A 5A6AA 5K0IA 2J9WA 3S84A 1C17M 4ULVA 3ZC4A 2XS1A 1GS9A 4E17A 1SF8A 2EPLX 3ZQYA 3U9MA 4YK5A 1TWCA 1PD0A 2HMQA 5D92A 4CBEA 3DI5A 3NMIA 4OIRF 2PX0A 3Q7GA 3S0XA 4G7OF 2R7VA 2PP4A 1QLEC 2YKZA 4DBRA 3VYWA 3UGPA 4XLNF 1VLSA 2Q9AA 2R03A 1APCA 4LDKA 2M4EA 4Q7CA 5L3VA 4A2NB 3M4BA 3LEOA 2ZXRA 3E9VA 2YVKA 4DJ9A 1C02A 1ZW3A 2QLAA 1K05A 3VF0A 3W2WA 1PV3A 2XLMA 2AWYA 2YL3A 3M1CB 3PMRA 2X0CA 1YA7O 1C03A 1CPQA 3C7JA 4GEHA 4IRUA 1DOWA 3MYFA 3TULA 2OEVA 1A7DA 3C8ZA 1LI7A 2NSFA 3ATPA 3NKEA 3NMKA 1YLMA 4C3EA 5KYUB 2RD9A 3HJCA 4U5HA 3I4UA 3TOMA 2YRFA 3JYYA 4MVZA 5COFA 1HW2A 2UUHA 2W9YA 5KYWA 2J9BA 1LE4A 1SZIA 2DYRC 2XLWA 3IQ6A 4MNDA 4X0RA 1TQGA 4EWCA 4XEFA 2LD6A 4CJGA 1M56C 1QPUA 2KK1A 3K7DA 1R4TA 4O7GA 3T6GB 4BJ5C 4BJ1A 4ZLCA 5EHHA 3B0UX 1E83A 3L8JA 1AUEA 3HNLA 4KC9A 4LACB 1ZHZA 2Y69C 2I15A 3Q6MA 2HZ8A 3N24A 4EKWA 4YT4A 4KNVA 1BBHA 1IZMA 4AE4A 3MYIA 4H54A 3K1HA 3C8GB 3OEOA 2H7BA 1Q0FA 2XLDA 2HFIA 1Z63A 1V54C 2IBFA 1TWGA 3GM1A 4HE8D 1LVKA 5CI9A 3UMIA 3GANA 5DS4A 1E86A 2Q3TA 4K0DA 1LS4A 1I5NA 2EPOA 2ZXOA 3RVYA 4Q5SF 2FAPB 3JRTA 4OD4A 2R7QA 3L8IA 1KU2A 4U9DA 2Y3GA 1MMDA 3U9JA 4CS9C 4EBKA 4HFFB 3QVZA 1ZVZA 1OKKA 2J45A 2YZSA 3DZAA 4HFKB 4J30B 2IXMA 5T1DB 3ECSA 2YL1A 3JYHA 4AL1A 2L6FA 4MTFA 3JZ0A 3SEOA 2J9UA 4BG0A 5E3CA 4ZLDA 3ABKC 5EK0A 4MVRA 1SR2A 1Y4CA 3ASNC 3WG7C 1L7CA 4K7BA 4B6IA 1K04A 3N0TA 3W2VA 4E18A 1PCXA 2FFHA 2ZPAA 1Z3IX 1YDIA 3T6JA 2A1DD 1Q0MA 1ORJA 3H2UA 3LEVA 4GQHA 5CIVA 2XM4A 4IAQA 1YYJA 3O55A 3A11A 1T6QA 3B71A 1I4ZA 3TOLA 2FGYA 3H2VA 4FWVA 3V7OA 1BR1A 1TWHA 2WVOA 5JLIA 3VAYA 2H7OA 2PBEA 2YLIA 2KSFA 2NUTA 1OR2A 3WHNA 4CS8A 3SNHA 3U3FA 5L0FA 3RH3A 1G5ZA 2XLHA 1J8MF 3FOPA 3M15A 3TD7A 4OIQF 5B3IA 4CIPA 1G4US 4ULWA 3S28A 1GQAA 2ETSA 3JT1A 4PACA 2XL4A 4JTAB 3EGXB 4P6IC 2EPKX 3C18A 2IXOA 4BPMA 2P6VA 4F4BA 2R7SA 1ZHTA 2NSGA 4NY3A 3U8PA 4CIHA 2R7UA 4PK4A 2G3KA 1W2WA 1PD1A 5B1BC 5BQHA 3OA1A 2JPUA 2HSQA 1OCOC 3G4ZA 4XWJA 2KQ9A 4JZAA 3SXZA 1NLXA 2GFHA 2QE9A 3SP1A 2NUPB 2KC3A 3EPVA 4AE4B 4JE9A 3LNRA 1VYIA 1M2OA 3PHF2 1T9KA 3LLKA 1V4AA 3HNJA 1D1AA 3JTLO 5E33A 4NCQA 4DVYP 2GDCA 2CCYA 2P61A 4H4KC 3RF3A 4DRHB 5DQTA 2PNOA 4PJLA 4XPYA 3AG1C
chains in the Genus database with same CATH topology
1RXQA 3DKAA 2OU6A 2NSGA 2NSFA 5CIVA 4N6CA 2RD9A 2P1AA 5COFA 2QE9A 3GORA 3DI5A 2QNLA 2YQYA 5COGA 3CEXA 2F22A 2OQMA 5COMA 3QTHA 2HKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXQ A;  3DKA A;  2OU6 A;  2NSG A;  2NSF A;  5CIV A;  4N6C A;  2RD9 A;  2P1A A;  5COF A;  2QE9 A;  3GOR A;  3DI5 A;  2QNL A;  2YQY A;  5COG A;  3CEX A;  2F22 A;  2OQM A;  5COM A;  3QTH A;  2HKV A; 
#chains in the Genus database with same CATH topology
 2Y3D A;  5KYN A;  4LDR A;  1RXQ A;  2R25 A;  1UG7 A;  3QW1 A;  3IPM O;  4GYT A;  1WOL A;  1LM3 B;  3O39 A;  1JR8 A;  5BQI A;  4JVS A;  1O3U A;  2WL8 A;  4K1O A;  2L9J A;  3WOD F;  1QVX A;  3GEI A;  4EBJ A;  2QUP A;  2TMV P;  1YYX A;  2LSE A;  4XPX A;  3EGX A;  3EH1 A;  2NUP A;  3W8I A;  5DLJ A;  1I4Y A;  1YZA A;  3KL4 A;  1M57 C;  4NTA A;  4ANJ A;  3T4R A;  3SXY A;  1BDJ B;  5JSL A;  4G7H F;  5JT4 A;  1RKE A;  2YEV A;  2ZXP A;  2P7V A;  1XWJ A;  3JSZ A;  1Z23 A;  3L1M A;  1OCC C;  4LER A;  2Y39 A;  1ORY A;  3DAG A;  1Q0G A;  1YA9 A;  4NTB A;  3NKD A;  4OD5 A;  4EBB A;  2JX0 A;  4FES A;  4M63 A;  2AVK A;  2HS5 A;  3FVY A;  3LUT B;  4YT2 A;  1MND A;  4RDA A;  3M4C A;  4BJ5 A;  3M79 A;  4I1M A;  3C8G A;  2HV6 A;  3NYJ A;  3U5S A;  4CJO A;  1VYK A;  2LCH A;  5B3S C;  5L0D A;  2GWW A;  2IYL D;  4P9T A;  3GOR A;  4E0I A;  4N6H A;  1MNE A;  3C62 A;  5AGF A;  2YL7 A;  4XTK A;  1E2X A;  5FZT A;  4OIP F;  1RKE B;  4MQ9 F;  4NC3 A;  4CX9 A;  4FX5 A;  4AK9 A;  2QTV A;  1CGM E;  1ORS C;  3EGD B;  1HW1 A;  3LES A;  3OWT A;  3GM2 A;  4JTC B;  3LS1 A;  3QMK A;  4U5B E;  4AX2 A;  4YL1 A;  3DD7 A;  3B0V C;  2HKV A;  1H9T A;  3ZVR A;  3RYL A;  1D0Z A;  2R7W A;  2XXA A;  2R02 A;  2Z15 A;  4QDL A;  1GM5 A;  1NBB A;  2GA0 A;  2MHR A;  3ITF A;  1YJG A;  2AU5 A;  2VCA A;  2LFD A;  4CSA C;  3ZTZ A;  3MBG A;  2MWQ A;  4O6N A;  5L0I A;  2R05 A;  3FOO A;  4YWQ A;  3AGU A;  2XL6 A;  1HE1 A;  2OKU A;  3TQO A;  4BEJ A;  2B0J A;  4DRJ B;  4EHP A;  3MFN A;  4G78 A;  2CDQ A;  4U5F E;  4Z9I A;  3S90 A;  5T3T A;  5DS5 A;  2XSE A;  2C03 A;  4MTO A;  3JSE O;  3CEX A;  4HEA J;  1WWP A;  3IQ5 A;  2W4B A;  1IW7 F;  1D1B A;  3EGD A;  1QQ3 A;  3FXH A;  1RMV A;  1GGQ A;  3JRM O;  3HTK C;  4E7Z A;  2P1A A;  2IM8 A;  4IAR A;  1ZHW A;  4JKV A;  1MMN A;  1FAP B;  1QZX A;  3NMJ A;  3Q6N A;  3Q7L A;  2XL8 A;  3BEH A;  5DS6 A;  3NDB B;  3CAX A;  5B1A C;  1HY5 A;  1EQ1 A;  3DMD A;  1KTM A;  1AVO B;  2HV7 A;  1FR0 A;  3KKB A;  2OOC A;  1QSP A;  1AEP A;  1TWA A;  2J46 A;  1N1C A;  2A6E F;  1VLT A;  2NPU A;  3NYL A;  3O10 A;  2IXN A;  4CS9 A;  5EGY A;  3POV A;  3BRJ A;  2UUI A;  1NSG B;  1K40 A;  4G0H A;  4XPW A;  4FAP B;  1LE2 A;  3C63 A;  4C3B A;  3TJ6 A;  3ZQV A;  3S9O A;  3KYJ A;  4I3M A;  1VK5 A;  3KPH A;  3AQC A;  3FAP B;  4RBN A;  2ZD9 A;  3GM3 A;  3L34 A;  2BE5 F;  4JEA A;  1DOV A;  2D4U A;  3QVY A;  5JVE A;  1T6I A;  5HSW A;  1ZW2 A;  3LNM B;  4PR9 A;  3R7C A;  1Y6D A;  4WAB A;  3UNG C;  4CDY A;  5KYY B;  3VM6 A;  3V5Y A;  2MYS A;  1NG1 A;  5A6K A;  1A7V A;  1VTM P;  3VRC A;  4EIY A;  3GWL A;  5JRA A;  1HMO A;  1OCR C;  1OXK A;  1QKR A;  4PJN A;  3RQG A;  2OU6 A;  4BEM J;  1RCP A;  5TJ5 E;  1T6U A;  3HLZ A;  4QI0 A;  3FHD A;  3RFY A;  3E70 C;  4RD9 A;  2CNW A;  2V26 A;  3UMK A;  1A0B A;  1WAT A;  2QNL A;  1T5O A;  3NG1 A;  4MS2 A;  2WVN A;  1YVI A;  2A68 F;  2XXA B;  2EIL C;  5BUO A;  2Q00 A;  3DWW A;  5D91 A;  2KW3 C;  2IXP A;  1FMV A;  3W8H A;  4J32 B;  3HNK A;  3AG3 C;  3H65 A;  3AGT A;  1ZZP A;  2YLD A;  4KNW A;  1JAF A;  1Z6A A;  2HJM A;  1NU9 C;  1CGN A;  2A0U A;  2H7V C;  1VOM A;  3DE9 A;  4IWB A;  1WTY A;  3RVZ A;  2I8B A;  2PX3 A;  2QY9 A;  4MVM A;  3SZR A;  1MQV A;  1TFK B;  4MW8 A;  4W8P A;  1OCZ C;  3X2Q C;  3K1I C;  1J8Y F;  2A6H F;  5DVW A;  3DAF A;  1BZ4 A;  3EJN A;  4JEB A;  4LLE A;  1O87 A;  5L0J A;  2PF4 E;  1D0Y A;  1Q0D A;  1U6H A;  2KJG A;  3KH2 A;  5JS5 A;  4JCZ A;  2KGO A;  1LIH A;  4UDV A;  1CPR A;  2M64 A;  2YHS A;  2J8W A;  3DM5 A;  2DB4 A;  3EQL F;  1RKC A;  4KI2 A;  1NFO A;  1OXB A;  4C7O A;  3CSK A;  2AP3 A;  4LDQ A;  4C7O B;  3CZ6 A;  5L0H A;  2WZG A;  2YQY A;  3K33 A;  4JJF A;  3K66 A;  1FFH A;  4NQF A;  3V5X A;  3U2M A;  2F22 A;  3I5Q A;  2OJE D;  4BJT A;  3ZG1 A;  3EG9 B;  3QZC A;  3EG9 A;  4A4A A;  5BQG A;  1OW7 A;  3IQT A;  4LLC A;  4JTD B;  1FNT c;  2W4M A;  3NRH A;  1FMW A;  5F28 E;  4DXW A;  2L81 A;  4JJG A;  4Z9H A;  3DM9 B;  5IY5 C;  3LLI A;  1NZE A;  1D0X A;  1BR4 A;  256B A;  1M2V A;  4YL3 A;  4JC7 A;  2G62 A;  5HV9 A;  3G4X A;  3EZI A;  3CQZ A;  4IGG A;  1HE9 A;  4O6M A;  1VB5 A;  4CS7 A;  2WZF A;  4G7Z F;  4YJW A;  2R7O A;  3IHU A;  1TFO B;  2NG1 A;  3U0C A;  4DBQ A;  1EA8 A;  3S27 A;  3LAY A;  5COG A;  1JPJ A;  4O79 A;  1E84 A;  3FDQ A;  4U5E E;  4WGZ A;  3X1O A;  1MMG A;  4MW3 A;  2J7P D;  3F46 A;  4KBL A;  4OIN F;  1L3P A;  3EHN A;  3T9O A;  2WVQ A;  2OG2 A;  2XRH A;  4J7T A;  2EIK C;  2XM0 A;  2XLV A;  5AC5 A;  1JRA A;  4BJ6 C;  4IJJ A;  1KNY A;  2EIN C;  3LS0 A;  3QTH A;  1FFT C;  1WGW A;  2P0N A;  2WB7 A;  4YL0 A;  5JP7 A;  4JIO A;  5T3W A;  1XZQ A;  3AG2 C;  2HJ3 A;  5E3A A;  5KYW B;  4Q4Z F;  1R5I D;  2YL0 A;  3W4Y A;  1H9G A;  2J7P A;  3AG4 C;  5F5H A;  4IAO A;  1B68 A;  4XEV A;  3GEE A;  2VAS A;  3EH2 A;  4NTF A;  4U5D E;  2D5R B;  4PFO A;  2C04 A;  2O9X A;  1U89 A;  2OCC C;  3UR3 C;  3KYI A;  1ZU5 A;  2B0H A;  2WZL A;  3I5P A;  4P9F A;  1U0B B;  4L6R A;  5L0C A;  2Y3B A;  2E87 A;  4JCH A;  3U2L A;  1ZHY A;  2CW0 F;  2AWC A;  1G4W R;  4PJJ A;  1JMW A;  2HMZ A;  3R2P A;  4CDV A;  2CYD A;  5L0G A;  3A9C A;  2HSB A;  4PFP A;  4U9E A;  1E85 A;  2CNW D;  2Q4F A;  1OW6 A;  4QI2 A;  3DJN B;  2OEX A;  2EIJ C;  5KYX B;  2W45 A;  4JW1 A;  2EPM X;  4YT5 A;  4N06 A;  3GWN A;  3UGO A;  1TKN A;  2Y3H A;  2R7T A;  2JD3 A;  1SMY F;  3JCU Q;  5GPG B;  2DI3 A;  4ONS A;  4MTG A;  1OQC A;  4I44 A;  1WN0 A;  3TJ5 A;  3G50 A;  3N2Z B;  5FCL A;  2VC9 A;  5JUA A;  2Q9C A;  4MVS A;  4U5C E;  4AL0 A;  5F5F A;  1M6T A;  5KYU A;  4N6C A;  3ZWI A;  1OW8 A;  5CI8 A;  3F47 A;  2CGE A;  3RQE A;  1EI7 A;  4MVO A;  4EUK B;  3J06 A;  1SYQ A;  1YAU O;  4BJ6 A;  1S7Z A;  1FTS A;  3AQB A;  4OIO F;  3HNI A;  3FAJ A;  3RKO F;  4D4X A;  4IB4 A;  2J0W A;  1NFN A;  3TK0 A;  2R9R B;  4C3D A;  5AC4 A;  1O5H A;  1LKX A;  2KYH A;  1Z5Z A;  2H8A A;  3GOD A;  1RJ9 B;  2EPN A;  2A69 F;  2HUJ A;  2Q9B A;  4YN0 B;  4CS8 C;  5KYX A;  1V55 C;  1A7E A;  2ICW G;  3EFO A;  3EFO B;  3S29 A;  3KMI A;  3ZDL A;  4N4W A;  2L6G A;  3L0I A;  3B0P A;  4D4N A;  1YZC A;  3QW0 A;  2NUT B;  4I1O B;  2VCC A;  4PJM A;  2LQG A;  3ZIB A;  2BL2 A;  3HKK A;  3EHM A;  1ZYR F;  2DYS C;  1TR2 A;  1OR3 A;  5L3Q A;  1MMA A;  2XLO A;  3AOU A;  3B29 A;  1A41 A;  1CGO A;  2XS8 A;  2ZXW C;  3IEE A;  1G8X A;  3AJM A;  4J7Y A;  4WJ0 A;  3WAQ A;  5KYY A;  2R7R A;  2L6H A;  5A6B D;  2VB6 A;  4XEK A;  1ZU4 A;  3SXM A;  3US6 A;  3RQF A;  4U5G A;  2X51 A;  1RJ9 A;  5E2Q A;  2J0X A;  2LIG A;  1D1C A;  2OQM A;  5A6B A;  1H7I A;  4DVZ A;  4E0H A;  3LJB A;  1LPE A;  3U8V A;  1OKK D;  2OJQ A;  3NYM A;  1LI5 A;  1VMA A;  3ZSU A;  4YT8 A;  1H6G A;  4XLP F;  2LK4 A;  1S05 A;  1V74 B;  3T6B A;  2XLE A;  4MVQ A;  4DOZ A;  3SXK A;  2A0B A;  2R7X A;  2Q7R A;  4CSA A;  1UFB A;  1M2V B;  2VH3 A;  2PFD A;  3IQC A;  4CDA A;  1Z7Q c;  3K6B A;  3PCV A;  5A69 A;  3FMS A;  1Q0K A;  2LFF A;  3K1I A;  3C8G D;  2L7A A;  2ASR A;  1F1M A;  2GAQ A;  3ABL C;  3RIP A;  3RW0 A;  1T01 A;  1HMD A;  1ZHX A;  1BR2 A;  3DXJ F;  4W8K A;  3DE8 A;  4DRI B;  2IOQ A;  5A6J A;  4E7S A;  3EZH A;  2G3V A;  1JPN A;  1ST6 A;  5DQZ A;  2V3C C;  1EKY A;  3MLG A;  1LS1 A;  2RSE B;  4MVU A;  1XZP A;  2EIM C;  3PDM P;  3DJU B;  2BC5 A;  2LP4 A;  3UMH A;  4XQ1 A;  3GEH A;  3V5Z A;  1WAS A;  2DGJ A;  3ABM C;  1YAR O;  3MX3 A;  3O6X A;  4JRZ A;  4WGY A;  2KNH A;  5COM A;  2J9V A;  1JOG A;  4Z9J A;  2YLG A;  3SYN A;  1NU7 D;  2VCB A;  3ZTM A;  3ASO C;  4JUR I;  4O6Y A;  2YWA A;  4R32 A;  3B9Q A;  3DKA A;  3U3B A;  4ER9 A;  5A6A A;  5K0I A;  2J9W A;  3S84 A;  1C17 M;  4ULV A;  3ZC4 A;  2XS1 A;  1GS9 A;  4E17 A;  1SF8 A;  2EPL X;  3ZQY A;  3U9M A;  4YK5 A;  1TWC A;  1PD0 A;  2HMQ A;  5D92 A;  4CBE A;  3DI5 A;  3NMI A;  4OIR F;  2PX0 A;  3Q7G A;  3S0X A;  4G7O F;  2R7V A;  2PP4 A;  1QLE C;  2YKZ A;  4DBR A;  3VYW A;  3UGP A;  4XLN F;  1VLS A;  2Q9A A;  2R03 A;  1APC A;  4LDK A;  2M4E A;  4Q7C A;  5L3V A;  4A2N B;  3M4B A;  3LEO A;  2ZXR A;  3E9V A;  2YVK A;  4DJ9 A;  1C02 A;  1ZW3 A;  2QLA A;  1K05 A;  3VF0 A;  3W2W A;  1PV3 A;  2XLM A;  2AWY A;  2YL3 A;  3M1C B;  3PMR A;  2X0C A;  1YA7 O;  1C03 A;  1CPQ A;  3C7J A;  4GEH A;  4IRU A;  1DOW A;  3MYF A;  3TUL A;  2OEV A;  1A7D A;  3C8Z A;  1LI7 A;  2NSF A;  3ATP A;  3NKE A;  3NMK A;  1YLM A;  4C3E A;  5KYU B;  2RD9 A;  3HJC A;  4U5H A;  3I4U A;  3TOM A;  2YRF A;  3JYY A;  4MVZ A;  5COF A;  1HW2 A;  2UUH A;  2W9Y A;  5KYW A;  2J9B A;  1LE4 A;  1SZI A;  2DYR C;  2XLW A;  3IQ6 A;  4MND A;  4X0R A;  1TQG A;  4EWC A;  4XEF A;  2LD6 A;  4CJG A;  1M56 C;  1QPU A;  2KK1 A;  3K7D A;  1R4T A;  4O7G A;  3T6G B;  4BJ5 C;  4BJ1 A;  4ZLC A;  5EHH A;  3B0U X;  1E83 A;  3L8J A;  1AUE A;  3HNL A;  4KC9 A;  4LAC B;  1ZHZ A;  2Y69 C;  2I15 A;  3Q6M A;  2HZ8 A;  3N24 A;  4EKW A;  4YT4 A;  4KNV A;  1BBH A;  1IZM A;  4AE4 A;  3MYI A;  4H54 A;  3K1H A;  3C8G B;  3OEO A;  2H7B A;  1Q0F A;  2XLD A;  2HFI A;  1Z63 A;  1V54 C;  2IBF A;  1TWG A;  3GM1 A;  4HE8 D;  1LVK A;  5CI9 A;  3UMI A;  3GAN A;  5DS4 A;  1E86 A;  2Q3T A;  4K0D A;  1LS4 A;  1I5N A;  2EPO A;  2ZXO A;  3RVY A;  4Q5S F;  2FAP B;  3JRT A;  4OD4 A;  2R7Q A;  3L8I A;  1KU2 A;  4U9D A;  2Y3G A;  1MMD A;  3U9J A;  4CS9 C;  4EBK A;  4HFF B;  3QVZ A;  1ZVZ A;  1OKK A;  2J45 A;  2YZS A;  3DZA A;  4HFK B;  4J30 B;  2IXM A;  5T1D B;  3ECS A;  2YL1 A;  3JYH A;  4AL1 A;  2L6F A;  4MTF A;  3JZ0 A;  3SEO A;  2J9U A;  4BG0 A;  5E3C A;  4ZLD A;  3ABK C;  5EK0 A;  4MVR A;  1SR2 A;  1Y4C A;  3ASN C;  3WG7 C;  1L7C A;  4K7B A;  4B6I A;  1K04 A;  3N0T A;  3W2V A;  4E18 A;  1PCX A;  2FFH A;  2ZPA A;  1Z3I X;  1YDI A;  3T6J A;  2A1D D;  1Q0M A;  1ORJ A;  3H2U A;  3LEV A;  4GQH A;  5CIV A;  2XM4 A;  4IAQ A;  1YYJ A;  3O55 A;  3A11 A;  1T6Q A;  3B71 A;  1I4Z A;  3TOL A;  2FGY A;  3H2V A;  4FWV A;  3V7O A;  1BR1 A;  1TWH A;  2WVO A;  5JLI A;  3VAY A;  2H7O A;  2PBE A;  2YLI A;  2KSF A;  2NUT A;  1OR2 A;  3WHN A;  4CS8 A;  3SNH A;  3U3F A;  5L0F A;  3RH3 A;  1G5Z A;  2XLH A;  1J8M F;  3FOP A;  3M15 A;  3TD7 A;  4OIQ F;  5B3I A;  4CIP A;  1G4U S;  4ULW A;  3S28 A;  1GQA A;  2ETS A;  3JT1 A;  4PAC A;  2XL4 A;  4JTA B;  3EGX B;  4P6I C;  2EPK X;  3C18 A;  2IXO A;  4BPM A;  2P6V A;  4F4B A;  2R7S A;  1ZHT A;  2NSG A;  4NY3 A;  3U8P A;  4CIH A;  2R7U A;  4PK4 A;  2G3K A;  1W2W A;  1PD1 A;  5B1B C;  5BQH A;  3OA1 A;  2JPU A;  2HSQ A;  1OCO C;  3G4Z A;  4XWJ A;  2KQ9 A;  4JZA A;  3SXZ A;  1NLX A;  2GFH A;  2QE9 A;  3SP1 A;  2NUP B;  2KC3 A;  3EPV A;  4AE4 B;  4JE9 A;  3LNR A;  1VYI A;  1M2O A;  3PHF 2;  1T9K A;  3LLK A;  1V4A A;  3HNJ A;  1D1A A;  3JTL O;  5E33 A;  4NCQ A;  4DVY P;  2GDC A;  2CCY A;  2P61 A;  4H4K C;  3RF3 A;  4DRH B;  5DQT A;  2PNO A;  4PJL A;  4XPY A;  3AG1 C; 
#chains in the Genus database with same CATH homology
 1RXQ A;  3DKA A;  2OU6 A;  2NSG A;  2NSF A;  5CIV A;  4N6C A;  2RD9 A;  2P1A A;  5COF A;  2QE9 A;  3GOR A;  3DI5 A;  2QNL A;  2YQY A;  5COG A;  3CEX A;  2F22 A;  2OQM A;  5COM A;  3QTH A;  2HKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...