1XWJA

Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
253
structure length
253
Chain Sequence
MMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/protein binding
molecule keywords Vinculin
publication title Structural and Dynamic Characterization of a Vinculin Binding Site in the Talin Rod
pubmed doi rcsb
source organism Gallus gallus
total genus 105
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2004-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1xwjA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1xwjA01
3S90A 4EHPA 3MYIA 1TR2A 4IGGA 2LQGA 2IBFA 4ONSA 2HSQA 1ZW2A 1L7CA 3H2UA 1YDIA 1DOVA 4K1OA 5L0DA 5L0FA 5L0GA 4W8PA 1H6GA 1DOWA 1RKEB 2GDCA 5FZTA 2X0CA 1T01A 2L7AA 4E17A 3RF3A 3T6GB 1QKRA 1U89A 1ST6A 5L0HA 1SYQA 3TJ5A 4DJ9A 4E18A 1RKEA 3TJ6A 5L0CA 2GWWA 3ZDLA 1ZW3A 4PR9A 1U6HA 3H2VA 1ZVZA 2B0HA 5L0IA 1XWJA 4P9TA 5L0JA 3VF0A 1RKCA
chains in the Genus database with same CATH superfamily
3LNRA 3ABKC 2OU6A 4IAQA 5KYWB 3KYJA 3X1OA 1ORYA 1E84A 3H2UA 1DOVA 2LIGA 1DOWA 1LE2A 2OKUA 4LACB 1QLEC 2ICWG 3DXJF 3J06A 2OJED 2QTVA 5A69A 5DS5A 2H8AA 4IRUA 1S7ZA 4QDLA 1O3UA 2XM0A 2YKZA 3PMRA 1FMWA 4RD9A 3V5XA 1I4ZA 4LLEA 3T6BA 2YLIA 3EG9A 3CSKA 2O9XA 2YRFA 3TK0A 1MMAA 2YL1A 3NYJA 3DJNB 1YYJA 1OW6A 1NFOA 2Q00A 4U5EE 3V5YA 5L3QA 4LDKA 3Q7GA 3GODA 3WAQA 4AE4A 4JW1A 4CSAA 2B0HA 1L3PA 3LUTB 1JAFA 4OIPF 5BQIA 4XPXA 1OR2A 3GWLA 1RJ9A 4FWVA 1RCPA 4CJOA 4EHPA 2VCAA 1YA7O 4MW8A 1MQVA 3NYLA 4I1OB 5KYUA 4CS8A 1GQAA 1FR0A 2LSEA 1JOGA 4MTOA 2J7PA 2WL8A 3G4XA 3GORA 5CIVA 2HUJA 1T6QA 3O10A 3GM1A 3IEEA 2XLEA 2R03A 4EBKA 1FFHA 1OQCA 2NUPB 3EGXA 2R7RA 4XTKA 1OCCC 2PBEA 3DAFA 1JPNA 3CQZA 4UDVA 3ATPA 1K40A 4DJ9A 2IYLD 5A6JA 1G4US 2GWWA 4JC7A 3DM5A 4YT5A 1Q0KA 3W8HA 1Y6DA 1HW1A 2R7VA 4Q7CA 1LVKA 2Z15A 4N06A 3GEHA 3VM6A 1NZEA 4W8KA 3M15A 3LLIA 2DI3A 2EPMX 2CW0F 1HE1A 4XPYA 4CIPA 1QZXA 3C18A 3MFNA 3MYIA 4YL1A 5COMA 3U2LA 2MYSA 5JSLA 2XS1A 5A6BD 2MWQA 1HMDA 2R7OA 4FX5A 5A6KA 1VOMA 2CNWA 4PFPA 5GPGB 3ASNC 3B29A 4DRIB 2KYHA 1TFOB 3RKOF 2E87A 2Q3TA 4XEVA 5JUAA 1E85A 3B0VC 1T6UA 4YT4A 1WATA 4JVSA 3WG7C 2HV7A 2NUTA 3LLKA 4A4AA 1Z5ZA 3NMJA 4BEJA 5CI8A 5JLIA 3LEVA 2EILC 1SZIA 2VH3A 1WN0A 2WVQA 3GM2A 3HKKA 4DVZA 1NBBA 4NY3A 4E18A 3FDQA 4PJNA 4DRHB 4LLCA 1NU7D 3BEHA 3IQ6A 2KSFA 2OQMA 4JTAB 5B1BC 1XZQA 3IQ5A 2HV6A 3V7OA 3GM3A 4JRZA 3TULA 2Q9AA 1AUEA 4P9FA 4WJ0A 5CI9A 2HMZA 3RQGA 2J9VA 4E7ZA 1BR1A 2XS8A 1OCOC 4IJJA 4M63A 1TR2A 2HJMA 1WTYA 3C8GB 4GYTA 1Q0GA 5COGA 2JPUA 1OXBA 2OCCC 4WABA 3PCVA 1OCRC 4BJ5C 4U5DE 1CPRA 2CGEA 4JKVA 1WGWA 2IXOA 3EH2A 4AK9A 1FMVA 4U5GA 2UUHA 1CPQA 5JT4A 1Z6AA 2OEXA 2YL0A 3RYLA 3U5SA 2NSFA 3W2WA 5L0HA 3AOUA 3LESA 2R7UA 2WZGA 3L34A 2L81A 2YEVA 3R2PA 4JTCB 4HEAJ 3RIPA 1LI5A 2BC5A 2LD6A 2R9RB 2W4MA 1BR4A 3B9QA 3QW1A 3W8IA 3W2VA 3M79A 3NMKA 4I1MA 4U5CE 4YL3A 2CCYA 3FOOA 1MMDA 4N4WA 3UR3C 1J8MF 3FXHA 5IY5C 3L0IA 3AG3C 2L6GA 1TQGA 4XLNF 2ZXRA 1CGNA 3M4CA 5EK0A 2Y3BA 3V5ZA 3HJCA 2PX0A 4Z9JA 2WZFA 4NTAA 1LM3B 1OKKA 3SNHA 3OA1A 4P6IC 3UMKA 1ORJA 1D1AA 4C7OB 2KK1A 3EFOA 3AG2C 4K7BA 4NCQA 5E2QA 4E0HA 3B0UX 3FAPB 3TJ5A 2A0BA 1ZHXA 3DI5A 1G8XA 5JP7A 3C8ZA 3ZQVA 2LCHA 2YL7A 4NQFA 4PJLA 4G7OF 1PCXA 1H9GA 3NKDA 1VLSA 1VYIA 2QNLA 3PDMP 1KTMA 3AQBA 2VASA 1R5ID 2G62A 4NC3A 5D92A 1NG1A 1RKCA 1C03A 1EKYA 4CDYA 2XLVA 4OD5A 2XLDA 3HLZA 3ZC4A 1TWAA 4FAPB 4XPWA 1TKNA 5L0FA 3EG9B 3UMHA 2HKVA 4YT8A 2J0WA 2DGJA 2J46A 4YJWA 2PP4A 3N2ZB 3DAGA 4ZLDA 4JURI 5JS5A 1K04A 2WVOA 1IZMA 2YHSA 3DZAA 3EGDA 4AE4B 5AC4A 3G4ZA 4CDAA 1RKEA 3RVZA 1RJ9B 1WASA 5KYUB 3JSEO 4KNVA 4Z9HA 3F46A 1MMNA 1WOLA 4GQHA 1VB5A 4DVYP 1YJGA 4ANJA 1Q0DA 1B68A 1V55C 3ZVRA 4BJ5A 2VB6A 1VTMP 2AWYA 4BJ1A 1JR8A 4EBBA 2XSEA 4I44A 2EIMC 2HZ8A 1C17M 1D0YA 3EGXB 4RDAA 3C62A 4YK5A 5B3SC 4IARA 2KNHA 1OR3A 4N6CA 3T6JA 3WODF 3K7DA 4HFKB 4CBEA 2A6EF 5A6AA 5KYWA 3S0XA 4KI2A 3O6XA 2R7SA 3KYIA 4MVQA 1PD0A 4CX9A 2KQ9A 2LK4A 1D1CA 2D4UA 4AL0A 4C3DA 5KYYA 2VCCA 1AEPA 1V4AA 1ZW3A 4BEMJ 2P1AA 1A0BA 4PR9A 1YVIA 3L1MA 1S05A 2L6HA 4JCZA 3B0PA 4JJFA 4MVZA 1A7EA 2C04A 2HMQA 4P9TA 2XLHA 2M64A 1YA9A 3LJBA 4FESA 4J7YA 1NSGB 4XEFA 3S90A 3KH2A 3QZCA 5D91A 2NUTB 3RW0A 2IBFA 4O6MA 3TOMA 2H7OA 1N1CA 4OIQF 4EIYA 3AG4C 1APCA 1FAPB 1H6GA 3EH1A 3UMIA 2W4BA 1R4TA 2VC9A 1GS9A 2P0NA 2KJGA 2DYRC 2I15A 3HNIA 4X0RA 1ZHZA 3Q7LA 3O55A 3CEXA 4IAOA 4U5HA 1U0BB 1EA8A 3CAXA 1W2WA 5A6BA 2HS5A 2A1DD 5T1DB 1VLTA 4C3EA 2J9UA 4BJ6C 3K6BA 4J32B 5KYXA 1ZHTA 3KL4A 3UNGC 2Y39A 3PHF2 1UG7A 3KPHA 5E33A 4BJTA 3NYMA 1TWHA 2H7BA 2J45A 3VYWA 1T5OA 4C3BA 5L0JA 3GWNA 2XXAA 5DS4A 1A7DA 2KC3A 3AGTA 3NKEA 1NLXA 1LE4A 1CGOA 3U3BA 4XEKA 5B3IA 4QI2A 2IXPA 5HSWA 1ZHYA 4Q5SF 3K66A 3U2MA 4DRJB 3DM9B 1LKXA 2X0CA 3EJNA 4MS2A 4WGZA 1BDJB 2XLMA 1JRAA 3MLGA 4MTFA 1NU9C 2ASRA 1SYQA 2Y69C 3EZHA 1V74B 3AQCA 3JRMO 2YWAA 4KBLA 4LDQA 1ZU5A 1NFNA 3ZDLA 1MMGA 1CGME 3DD7A 1VMAA 3C7JA 4JJGA 2ZXOA 1M6TA 2LFDA 3DJUB 5FCLA 3H2VA 1HE9A 3IPMO 1ZZPA 2IXNA 3U8PA 4CJGA 4E7SA 2ETSA 1E2XA 2JX0A 3C8GD 2PX3A 1FFTC 1OXKA 4EUKB 2DB4A 4AL1A 3Q6NA 2QE9A 2XL8A 3GEEA 2LQGA 4MTGA 4R32A 3EFOB 2XLOA 1AVOB 1SF8A 4K0DA 4ONSA 4G7ZF 3EQLF 1BZ4A 5JRAA 1LI7A 1YAUO 2OJQA 3A11A 3NRHA 3QTHA 1LPEA 5B1AC 4W8PA 3U9JA 1JPJA 3ABMC 1Q0FA 3S28A 1KU2A 4CS8C 3NDBB 2L7AA 2YQYA 4ULWA 4F4BA 2C03A 3Q6MA 4MQ9F 4AX2A 3FAJA 1VYKA 4JCHA 1TWGA 2IXMA 2H7VC 2KGOA 2WB7A 5BQHA 1M56C 4MVSA 2UUIA 2PF4E 3JRTA 4O6NA 5T3WA 2HJ3A 2R05A 1PD1A 4JEAA 4RBNA 2EPNA 2R25A 3U8VA 1HMOA 5TJ5E 3EHNA 4PACA 2J9WA 2R7QA 5EGYA 4HFFB 2GA0A 3U9MA 1I4YA 3JYYA 1QVXA 3US6A 3C63A 4U9DA 4B6IA 2M4EA 2FGYA 3SZRA 1FNTc 4JE9A 4MVOA 1LS4A 2X51A 3KMIA 3EGDB 3NG1A 1RKEB 1V54C 2IM8A 3EZIA 1T01A 3M1CB 2P6VA 3SXYA 4PFOA 5DVWA 3G50A 2Y3HA 4BJ6A 2MHRA 4XLPF 4JIOA 1A41A 1K05A 3HTKC 1G5ZA 3LNMB 4CIHA 3I5QA 1M2VA 2EPOA 3IQTA 1Z23A 3GEIA 2ZD9A 2EPKX 2NSGA 4C7OA 2XL4A 3ZTZA 5BUOA 4NTFA 2WVNA 5L3VA 1LIHA 5KYNA 4G7HF 5AC5A 4DBRA 1ZVZA 4O7GA 4H54A 2G3KA 4CDVA 3SP1A 4DOZA 5FZTA 1SR2A 3K1IC 3F47A 3U3FA 1HY5A 2L9JA 4YL0A 2IOQA 4J7TA 4OINF 1KNYA 1QQ3A 3T9OA 5T3TA 3ZWIA 2A69F 5KYYB 3ECSA 2Q9CA 4G0HA 2A68F 2R02A 3EPVA 2TMVP 4U5BE 1RMVA 1BR2A 3S9OA 256BA 2CYDA 2J0XA 2I8BA 3ABLC 3FOPA 3LS0A 1M57C 1WWPA 4IB4A 1ZHWA 2VCBA 1QPUA 3ASOC 4CS9C 3BRJA 4XQ1A 3JTLO 5COFA 3RH3A 1H9TA 2JD3A 2J7PD 1JMWA 1EI7A 2F22A 5DLJA 4D4XA 3M4BA 1BBHA 3RFYA 4CS7A 3TOLA 1E86A 4JEBA 2J9BA 3LEOA 3VAYA 5L0IA 3IHUA 3QVYA 3VF0A 3I5PA 3GANA 2L6FA 1D0XA 1C02A 4N6HA 4OIRF 3MYFA 4IGGA 4U5FE 4ULVA 5F5HA 2XM4A 3VRCA 3UGPA 4EKWA 2OOCA 4NTBA 3LS1A 1MNDA 2GAQA 2WZLA 4I3MA 3TD7A 4OIOF 1O5HA 5K0IA 3A9CA 3RF3A 1IW7F 1YLMA 1A7VA 1YYXA 3RVYA 1OW8A 3T4RA 1FTSA 1TWCA 2Y3GA 5KYXB 4MW3A 2KW3C 2EPLX 1J8YF 1TFKB 2AP3A 2RD9A 3H65A 2J8WA 1Q0MA 2Q9BA 3L8JA 4DXWA 1HW2A 3ITFA 4E0IA 3JT1A 1D0ZA 2CNWD 1GGQA 2Y3DA 3AGUA 2QY9A 2NUPA 4H4KC 2G3VA 4EBJA 5JVEA 2QLAA 2YLDA 2V3CC 2XXAB 3S84A 5DS6A 1Z7Qc 1F1MA 1PV3A 4PJJA 3QMKA 4MNDA 2P61A 1I5NA 3JYHA 2V26A 5F28E 2XLWA 1ORSC 2XL6A 3EHMA 1YARO 4BPMA 2EIKC 3HNJA 2GFHA 2BL2A 3DE9A 3S29A 3UGOA 3W4YA 1Y4CA 4O79A 1EQ1A 4BG0A 2ZPAA 3ZIBA 3IQCA 4Q4ZF 3L8IA 4EWCA 3FHDA 2NPUA 4XWJA 1YZCA 2LFFA 4ER9A 3AG1C 1U89A 1ST6A 1Z63A 3OEOA 3O39A 3HNKA 2Q7RA 4JZAA 2YLGA 2NG1A 3RQEA 3CZ6A 3K1IA 2EINC 3SEOA 4MVRA 4OD4A 2P7VA 3N0TA 3DWWA 1YZAA 1M2OA 5E3CA 1OW7A 3K1HA 1D1BA 2FAPB 3LAYA 3QVZA 2HSBA 2YVKA 3K33A 4CSAC 2QUPA 1UFBA 3E70C 1ZW2A 4O6YA 1QSPA 1YDIA 5L0DA 2FFHA 4L6RA 3KKBA 3MBGA 5BQGA 2PNOA 3AJMA 3HNLA 4CS9A 3SXMA 1E83A 4Z9IA 1OCZC 3T6GB 3C8GA 1MNEA 4DBQA 4PK4A 2EIJC 1H7IA 2XRHA 4IWBA 2ZXPA 5AGFA 3ZG1A 1RXQA 2A0UA 3SYNA 4MVUA 4A2NB 1ZYRF 1T6IA 3FMSA 4GEHA 1LS1A 4QI0A 4LDRA 3SXZA 5F5FA 3MX3A 3ZTMA 2BE5F 1U6HA 4PJMA 1Z3IX 2PFDA 1G4WR 1VK5A 2RSEB 1OKKD 4U9EA 5DQZA 3TQOA 4D4NA 2Q4FA 1SMYF 2AVKA 2B0JA 3ZQYA 3JZ0A 4YN0B 1XWJA 2OG2A 5L0CA 3U0CA 2R7WA 1GM5A 4LERA 4KNWA 3X2QC 4G78A 2DYSC 2R7XA 3JSZA 2A6HF 3RQFA 1T9KA 2W45A 3B71A 3DMDA 1L7CA 2W9YA 3E9VA 4K1OA 4YWQA 1M2VB 5L0GA 5HV9A 2GDCA 2LP4A 3DKAA 4JTDB 5E3AA 4E17A 2R7TA 2AWCA 3JCUQ 3S27A 4HE8D 4J30B 4KC9A 4WGYA 3POVA 1QKRA 2AU5A 3FVYA 1ZU4A 2CDQA 1O87A 3WHNA 3TJ6A 2HFIA 5DQTA 3QW0A 1XZPA 3SXKA 4MVMA 2D5RB 3N24A 3OWTA 4YT2A 3I4UA 3NMIA 4ZLCA 3ZSUA 3DE8A 2YL3A 2ZXWC 2OEVA 2YZSA 3R7CA 2HSQA 5EHHA
chains in the Genus database with same CATH topology
3S90A 4EHPA 3MYIA 1TR2A 4IGGA 2LQGA 2IBFA 4ONSA 2HSQA 1ZW2A 1L7CA 3H2UA 1YDIA 1DOVA 4K1OA 5L0DA 5L0FA 5L0GA 4W8PA 1H6GA 1DOWA 1RKEB 2GDCA 5FZTA 2X0CA 1T01A 2L7AA 4E17A 3RF3A 3T6GB 1QKRA 1U89A 1ST6A 5L0HA 1SYQA 3TJ5A 4DJ9A 4E18A 1RKEA 3TJ6A 5L0CA 2GWWA 3ZDLA 1ZW3A 4PR9A 1U6HA 3H2VA 1ZVZA 2B0HA 5L0IA 1XWJA 4P9TA 5L0JA 3VF0A 1RKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S90 A;  4EHP A;  3MYI A;  1TR2 A;  4IGG A;  2LQG A;  2IBF A;  4ONS A;  2HSQ A;  1ZW2 A;  1L7C A;  3H2U A;  1YDI A;  1DOV A;  4K1O A;  5L0D A;  5L0F A;  5L0G A;  4W8P A;  1H6G A;  1DOW A;  1RKE B;  2GDC A;  5FZT A;  2X0C A;  1T01 A;  2L7A A;  4E17 A;  3RF3 A;  3T6G B;  1QKR A;  1U89 A;  1ST6 A;  5L0H A;  1SYQ A;  3TJ5 A;  4DJ9 A;  4E18 A;  1RKE A;  3TJ6 A;  5L0C A;  2GWW A;  3ZDL A;  1ZW3 A;  4PR9 A;  1U6H A;  3H2V A;  1ZVZ A;  2B0H A;  5L0I A;  1XWJ A;  4P9T A;  5L0J A;  3VF0 A;  1RKC A; 
#chains in the Genus database with same CATH topology
 3LNR A;  3ABK C;  2OU6 A;  4IAQ A;  5KYW B;  3KYJ A;  3X1O A;  1ORY A;  1E84 A;  3H2U A;  1DOV A;  2LIG A;  1DOW A;  1LE2 A;  2OKU A;  4LAC B;  1QLE C;  2ICW G;  3DXJ F;  3J06 A;  2OJE D;  2QTV A;  5A69 A;  5DS5 A;  2H8A A;  4IRU A;  1S7Z A;  4QDL A;  1O3U A;  2XM0 A;  2YKZ A;  3PMR A;  1FMW A;  4RD9 A;  3V5X A;  1I4Z A;  4LLE A;  3T6B A;  2YLI A;  3EG9 A;  3CSK A;  2O9X A;  2YRF A;  3TK0 A;  1MMA A;  2YL1 A;  3NYJ A;  3DJN B;  1YYJ A;  1OW6 A;  1NFO A;  2Q00 A;  4U5E E;  3V5Y A;  5L3Q A;  4LDK A;  3Q7G A;  3GOD A;  3WAQ A;  4AE4 A;  4JW1 A;  4CSA A;  2B0H A;  1L3P A;  3LUT B;  1JAF A;  4OIP F;  5BQI A;  4XPX A;  1OR2 A;  3GWL A;  1RJ9 A;  4FWV A;  1RCP A;  4CJO A;  4EHP A;  2VCA A;  1YA7 O;  4MW8 A;  1MQV A;  3NYL A;  4I1O B;  5KYU A;  4CS8 A;  1GQA A;  1FR0 A;  2LSE A;  1JOG A;  4MTO A;  2J7P A;  2WL8 A;  3G4X A;  3GOR A;  5CIV A;  2HUJ A;  1T6Q A;  3O10 A;  3GM1 A;  3IEE A;  2XLE A;  2R03 A;  4EBK A;  1FFH A;  1OQC A;  2NUP B;  3EGX A;  2R7R A;  4XTK A;  1OCC C;  2PBE A;  3DAF A;  1JPN A;  3CQZ A;  4UDV A;  3ATP A;  1K40 A;  4DJ9 A;  2IYL D;  5A6J A;  1G4U S;  2GWW A;  4JC7 A;  3DM5 A;  4YT5 A;  1Q0K A;  3W8H A;  1Y6D A;  1HW1 A;  2R7V A;  4Q7C A;  1LVK A;  2Z15 A;  4N06 A;  3GEH A;  3VM6 A;  1NZE A;  4W8K A;  3M15 A;  3LLI A;  2DI3 A;  2EPM X;  2CW0 F;  1HE1 A;  4XPY A;  4CIP A;  1QZX A;  3C18 A;  3MFN A;  3MYI A;  4YL1 A;  5COM A;  3U2L A;  2MYS A;  5JSL A;  2XS1 A;  5A6B D;  2MWQ A;  1HMD A;  2R7O A;  4FX5 A;  5A6K A;  1VOM A;  2CNW A;  4PFP A;  5GPG B;  3ASN C;  3B29 A;  4DRI B;  2KYH A;  1TFO B;  3RKO F;  2E87 A;  2Q3T A;  4XEV A;  5JUA A;  1E85 A;  3B0V C;  1T6U A;  4YT4 A;  1WAT A;  4JVS A;  3WG7 C;  2HV7 A;  2NUT A;  3LLK A;  4A4A A;  1Z5Z A;  3NMJ A;  4BEJ A;  5CI8 A;  5JLI A;  3LEV A;  2EIL C;  1SZI A;  2VH3 A;  1WN0 A;  2WVQ A;  3GM2 A;  3HKK A;  4DVZ A;  1NBB A;  4NY3 A;  4E18 A;  3FDQ A;  4PJN A;  4DRH B;  4LLC A;  1NU7 D;  3BEH A;  3IQ6 A;  2KSF A;  2OQM A;  4JTA B;  5B1B C;  1XZQ A;  3IQ5 A;  2HV6 A;  3V7O A;  3GM3 A;  4JRZ A;  3TUL A;  2Q9A A;  1AUE A;  4P9F A;  4WJ0 A;  5CI9 A;  2HMZ A;  3RQG A;  2J9V A;  4E7Z A;  1BR1 A;  2XS8 A;  1OCO C;  4IJJ A;  4M63 A;  1TR2 A;  2HJM A;  1WTY A;  3C8G B;  4GYT A;  1Q0G A;  5COG A;  2JPU A;  1OXB A;  2OCC C;  4WAB A;  3PCV A;  1OCR C;  4BJ5 C;  4U5D E;  1CPR A;  2CGE A;  4JKV A;  1WGW A;  2IXO A;  3EH2 A;  4AK9 A;  1FMV A;  4U5G A;  2UUH A;  1CPQ A;  5JT4 A;  1Z6A A;  2OEX A;  2YL0 A;  3RYL A;  3U5S A;  2NSF A;  3W2W A;  5L0H A;  3AOU A;  3LES A;  2R7U A;  2WZG A;  3L34 A;  2L81 A;  2YEV A;  3R2P A;  4JTC B;  4HEA J;  3RIP A;  1LI5 A;  2BC5 A;  2LD6 A;  2R9R B;  2W4M A;  1BR4 A;  3B9Q A;  3QW1 A;  3W8I A;  3W2V A;  3M79 A;  3NMK A;  4I1M A;  4U5C E;  4YL3 A;  2CCY A;  3FOO A;  1MMD A;  4N4W A;  3UR3 C;  1J8M F;  3FXH A;  5IY5 C;  3L0I A;  3AG3 C;  2L6G A;  1TQG A;  4XLN F;  2ZXR A;  1CGN A;  3M4C A;  5EK0 A;  2Y3B A;  3V5Z A;  3HJC A;  2PX0 A;  4Z9J A;  2WZF A;  4NTA A;  1LM3 B;  1OKK A;  3SNH A;  3OA1 A;  4P6I C;  3UMK A;  1ORJ A;  1D1A A;  4C7O B;  2KK1 A;  3EFO A;  3AG2 C;  4K7B A;  4NCQ A;  5E2Q A;  4E0H A;  3B0U X;  3FAP B;  3TJ5 A;  2A0B A;  1ZHX A;  3DI5 A;  1G8X A;  5JP7 A;  3C8Z A;  3ZQV A;  2LCH A;  2YL7 A;  4NQF A;  4PJL A;  4G7O F;  1PCX A;  1H9G A;  3NKD A;  1VLS A;  1VYI A;  2QNL A;  3PDM P;  1KTM A;  3AQB A;  2VAS A;  1R5I D;  2G62 A;  4NC3 A;  5D92 A;  1NG1 A;  1RKC A;  1C03 A;  1EKY A;  4CDY A;  2XLV A;  4OD5 A;  2XLD A;  3HLZ A;  3ZC4 A;  1TWA A;  4FAP B;  4XPW A;  1TKN A;  5L0F A;  3EG9 B;  3UMH A;  2HKV A;  4YT8 A;  2J0W A;  2DGJ A;  2J46 A;  4YJW A;  2PP4 A;  3N2Z B;  3DAG A;  4ZLD A;  4JUR I;  5JS5 A;  1K04 A;  2WVO A;  1IZM A;  2YHS A;  3DZA A;  3EGD A;  4AE4 B;  5AC4 A;  3G4Z A;  4CDA A;  1RKE A;  3RVZ A;  1RJ9 B;  1WAS A;  5KYU B;  3JSE O;  4KNV A;  4Z9H A;  3F46 A;  1MMN A;  1WOL A;  4GQH A;  1VB5 A;  4DVY P;  1YJG A;  4ANJ A;  1Q0D A;  1B68 A;  1V55 C;  3ZVR A;  4BJ5 A;  2VB6 A;  1VTM P;  2AWY A;  4BJ1 A;  1JR8 A;  4EBB A;  2XSE A;  4I44 A;  2EIM C;  2HZ8 A;  1C17 M;  1D0Y A;  3EGX B;  4RDA A;  3C62 A;  4YK5 A;  5B3S C;  4IAR A;  2KNH A;  1OR3 A;  4N6C A;  3T6J A;  3WOD F;  3K7D A;  4HFK B;  4CBE A;  2A6E F;  5A6A A;  5KYW A;  3S0X A;  4KI2 A;  3O6X A;  2R7S A;  3KYI A;  4MVQ A;  1PD0 A;  4CX9 A;  2KQ9 A;  2LK4 A;  1D1C A;  2D4U A;  4AL0 A;  4C3D A;  5KYY A;  2VCC A;  1AEP A;  1V4A A;  1ZW3 A;  4BEM J;  2P1A A;  1A0B A;  4PR9 A;  1YVI A;  3L1M A;  1S05 A;  2L6H A;  4JCZ A;  3B0P A;  4JJF A;  4MVZ A;  1A7E A;  2C04 A;  2HMQ A;  4P9T A;  2XLH A;  2M64 A;  1YA9 A;  3LJB A;  4FES A;  4J7Y A;  1NSG B;  4XEF A;  3S90 A;  3KH2 A;  3QZC A;  5D91 A;  2NUT B;  3RW0 A;  2IBF A;  4O6M A;  3TOM A;  2H7O A;  1N1C A;  4OIQ F;  4EIY A;  3AG4 C;  1APC A;  1FAP B;  1H6G A;  3EH1 A;  3UMI A;  2W4B A;  1R4T A;  2VC9 A;  1GS9 A;  2P0N A;  2KJG A;  2DYR C;  2I15 A;  3HNI A;  4X0R A;  1ZHZ A;  3Q7L A;  3O55 A;  3CEX A;  4IAO A;  4U5H A;  1U0B B;  1EA8 A;  3CAX A;  1W2W A;  5A6B A;  2HS5 A;  2A1D D;  5T1D B;  1VLT A;  4C3E A;  2J9U A;  4BJ6 C;  3K6B A;  4J32 B;  5KYX A;  1ZHT A;  3KL4 A;  3UNG C;  2Y39 A;  3PHF 2;  1UG7 A;  3KPH A;  5E33 A;  4BJT A;  3NYM A;  1TWH A;  2H7B A;  2J45 A;  3VYW A;  1T5O A;  4C3B A;  5L0J A;  3GWN A;  2XXA A;  5DS4 A;  1A7D A;  2KC3 A;  3AGT A;  3NKE A;  1NLX A;  1LE4 A;  1CGO A;  3U3B A;  4XEK A;  5B3I A;  4QI2 A;  2IXP A;  5HSW A;  1ZHY A;  4Q5S F;  3K66 A;  3U2M A;  4DRJ B;  3DM9 B;  1LKX A;  2X0C A;  3EJN A;  4MS2 A;  4WGZ A;  1BDJ B;  2XLM A;  1JRA A;  3MLG A;  4MTF A;  1NU9 C;  2ASR A;  1SYQ A;  2Y69 C;  3EZH A;  1V74 B;  3AQC A;  3JRM O;  2YWA A;  4KBL A;  4LDQ A;  1ZU5 A;  1NFN A;  3ZDL A;  1MMG A;  1CGM E;  3DD7 A;  1VMA A;  3C7J A;  4JJG A;  2ZXO A;  1M6T A;  2LFD A;  3DJU B;  5FCL A;  3H2V A;  1HE9 A;  3IPM O;  1ZZP A;  2IXN A;  3U8P A;  4CJG A;  4E7S A;  2ETS A;  1E2X A;  2JX0 A;  3C8G D;  2PX3 A;  1FFT C;  1OXK A;  4EUK B;  2DB4 A;  4AL1 A;  3Q6N A;  2QE9 A;  2XL8 A;  3GEE A;  2LQG A;  4MTG A;  4R32 A;  3EFO B;  2XLO A;  1AVO B;  1SF8 A;  4K0D A;  4ONS A;  4G7Z F;  3EQL F;  1BZ4 A;  5JRA A;  1LI7 A;  1YAU O;  2OJQ A;  3A11 A;  3NRH A;  3QTH A;  1LPE A;  5B1A C;  4W8P A;  3U9J A;  1JPJ A;  3ABM C;  1Q0F A;  3S28 A;  1KU2 A;  4CS8 C;  3NDB B;  2L7A A;  2YQY A;  4ULW A;  4F4B A;  2C03 A;  3Q6M A;  4MQ9 F;  4AX2 A;  3FAJ A;  1VYK A;  4JCH A;  1TWG A;  2IXM A;  2H7V C;  2KGO A;  2WB7 A;  5BQH A;  1M56 C;  4MVS A;  2UUI A;  2PF4 E;  3JRT A;  4O6N A;  5T3W A;  2HJ3 A;  2R05 A;  1PD1 A;  4JEA A;  4RBN A;  2EPN A;  2R25 A;  3U8V A;  1HMO A;  5TJ5 E;  3EHN A;  4PAC A;  2J9W A;  2R7Q A;  5EGY A;  4HFF B;  2GA0 A;  3U9M A;  1I4Y A;  3JYY A;  1QVX A;  3US6 A;  3C63 A;  4U9D A;  4B6I A;  2M4E A;  2FGY A;  3SZR A;  1FNT c;  4JE9 A;  4MVO A;  1LS4 A;  2X51 A;  3KMI A;  3EGD B;  3NG1 A;  1RKE B;  1V54 C;  2IM8 A;  3EZI A;  1T01 A;  3M1C B;  2P6V A;  3SXY A;  4PFO A;  5DVW A;  3G50 A;  2Y3H A;  4BJ6 A;  2MHR A;  4XLP F;  4JIO A;  1A41 A;  1K05 A;  3HTK C;  1G5Z A;  3LNM B;  4CIH A;  3I5Q A;  1M2V A;  2EPO A;  3IQT A;  1Z23 A;  3GEI A;  2ZD9 A;  2EPK X;  2NSG A;  4C7O A;  2XL4 A;  3ZTZ A;  5BUO A;  4NTF A;  2WVN A;  5L3V A;  1LIH A;  5KYN A;  4G7H F;  5AC5 A;  4DBR A;  1ZVZ A;  4O7G A;  4H54 A;  2G3K A;  4CDV A;  3SP1 A;  4DOZ A;  5FZT A;  1SR2 A;  3K1I C;  3F47 A;  3U3F A;  1HY5 A;  2L9J A;  4YL0 A;  2IOQ A;  4J7T A;  4OIN F;  1KNY A;  1QQ3 A;  3T9O A;  5T3T A;  3ZWI A;  2A69 F;  5KYY B;  3ECS A;  2Q9C A;  4G0H A;  2A68 F;  2R02 A;  3EPV A;  2TMV P;  4U5B E;  1RMV A;  1BR2 A;  3S9O A;  256B A;  2CYD A;  2J0X A;  2I8B A;  3ABL C;  3FOP A;  3LS0 A;  1M57 C;  1WWP A;  4IB4 A;  1ZHW A;  2VCB A;  1QPU A;  3ASO C;  4CS9 C;  3BRJ A;  4XQ1 A;  3JTL O;  5COF A;  3RH3 A;  1H9T A;  2JD3 A;  2J7P D;  1JMW A;  1EI7 A;  2F22 A;  5DLJ A;  4D4X A;  3M4B A;  1BBH A;  3RFY A;  4CS7 A;  3TOL A;  1E86 A;  4JEB A;  2J9B A;  3LEO A;  3VAY A;  5L0I A;  3IHU A;  3QVY A;  3VF0 A;  3I5P A;  3GAN A;  2L6F A;  1D0X A;  1C02 A;  4N6H A;  4OIR F;  3MYF A;  4IGG A;  4U5F E;  4ULV A;  5F5H A;  2XM4 A;  3VRC A;  3UGP A;  4EKW A;  2OOC A;  4NTB A;  3LS1 A;  1MND A;  2GAQ A;  2WZL A;  4I3M A;  3TD7 A;  4OIO F;  1O5H A;  5K0I A;  3A9C A;  3RF3 A;  1IW7 F;  1YLM A;  1A7V A;  1YYX A;  3RVY A;  1OW8 A;  3T4R A;  1FTS A;  1TWC A;  2Y3G A;  5KYX B;  4MW3 A;  2KW3 C;  2EPL X;  1J8Y F;  1TFK B;  2AP3 A;  2RD9 A;  3H65 A;  2J8W A;  1Q0M A;  2Q9B A;  3L8J A;  4DXW A;  1HW2 A;  3ITF A;  4E0I A;  3JT1 A;  1D0Z A;  2CNW D;  1GGQ A;  2Y3D A;  3AGU A;  2QY9 A;  2NUP A;  4H4K C;  2G3V A;  4EBJ A;  5JVE A;  2QLA A;  2YLD A;  2V3C C;  2XXA B;  3S84 A;  5DS6 A;  1Z7Q c;  1F1M A;  1PV3 A;  4PJJ A;  3QMK A;  4MND A;  2P61 A;  1I5N A;  3JYH A;  2V26 A;  5F28 E;  2XLW A;  1ORS C;  2XL6 A;  3EHM A;  1YAR O;  4BPM A;  2EIK C;  3HNJ A;  2GFH A;  2BL2 A;  3DE9 A;  3S29 A;  3UGO A;  3W4Y A;  1Y4C A;  4O79 A;  1EQ1 A;  4BG0 A;  2ZPA A;  3ZIB A;  3IQC A;  4Q4Z F;  3L8I A;  4EWC A;  3FHD A;  2NPU A;  4XWJ A;  1YZC A;  2LFF A;  4ER9 A;  3AG1 C;  1U89 A;  1ST6 A;  1Z63 A;  3OEO A;  3O39 A;  3HNK A;  2Q7R A;  4JZA A;  2YLG A;  2NG1 A;  3RQE A;  3CZ6 A;  3K1I A;  2EIN C;  3SEO A;  4MVR A;  4OD4 A;  2P7V A;  3N0T A;  3DWW A;  1YZA A;  1M2O A;  5E3C A;  1OW7 A;  3K1H A;  1D1B A;  2FAP B;  3LAY A;  3QVZ A;  2HSB A;  2YVK A;  3K33 A;  4CSA C;  2QUP A;  1UFB A;  3E70 C;  1ZW2 A;  4O6Y A;  1QSP A;  1YDI A;  5L0D A;  2FFH A;  4L6R A;  3KKB A;  3MBG A;  5BQG A;  2PNO A;  3AJM A;  3HNL A;  4CS9 A;  3SXM A;  1E83 A;  4Z9I A;  1OCZ C;  3T6G B;  3C8G A;  1MNE A;  4DBQ A;  4PK4 A;  2EIJ C;  1H7I A;  2XRH A;  4IWB A;  2ZXP A;  5AGF A;  3ZG1 A;  1RXQ A;  2A0U A;  3SYN A;  4MVU A;  4A2N B;  1ZYR F;  1T6I A;  3FMS A;  4GEH A;  1LS1 A;  4QI0 A;  4LDR A;  3SXZ A;  5F5F A;  3MX3 A;  3ZTM A;  2BE5 F;  1U6H A;  4PJM A;  1Z3I X;  2PFD A;  1G4W R;  1VK5 A;  2RSE B;  1OKK D;  4U9E A;  5DQZ A;  3TQO A;  4D4N A;  2Q4F A;  1SMY F;  2AVK A;  2B0J A;  3ZQY A;  3JZ0 A;  4YN0 B;  1XWJ A;  2OG2 A;  5L0C A;  3U0C A;  2R7W A;  1GM5 A;  4LER A;  4KNW A;  3X2Q C;  4G78 A;  2DYS C;  2R7X A;  3JSZ A;  2A6H F;  3RQF A;  1T9K A;  2W45 A;  3B71 A;  3DMD A;  1L7C A;  2W9Y A;  3E9V A;  4K1O A;  4YWQ A;  1M2V B;  5L0G A;  5HV9 A;  2GDC A;  2LP4 A;  3DKA A;  4JTD B;  5E3A A;  4E17 A;  2R7T A;  2AWC A;  3JCU Q;  3S27 A;  4HE8 D;  4J30 B;  4KC9 A;  4WGY A;  3POV A;  1QKR A;  2AU5 A;  3FVY A;  1ZU4 A;  2CDQ A;  1O87 A;  3WHN A;  3TJ6 A;  2HFI A;  5DQT A;  3QW0 A;  1XZP A;  3SXK A;  4MVM A;  2D5R B;  3N24 A;  3OWT A;  4YT2 A;  3I4U A;  3NMI A;  4ZLC A;  3ZSU A;  3DE8 A;  2YL3 A;  2ZXW C;  2OEV A;  2YZS A;  3R7C A;  2HSQ A;  5EHH A; 
#chains in the Genus database with same CATH homology
 3S90 A;  4EHP A;  3MYI A;  1TR2 A;  4IGG A;  2LQG A;  2IBF A;  4ONS A;  2HSQ A;  1ZW2 A;  1L7C A;  3H2U A;  1YDI A;  1DOV A;  4K1O A;  5L0D A;  5L0F A;  5L0G A;  4W8P A;  1H6G A;  1DOW A;  1RKE B;  2GDC A;  5FZT A;  2X0C A;  1T01 A;  2L7A A;  4E17 A;  3RF3 A;  3T6G B;  1QKR A;  1U89 A;  1ST6 A;  5L0H A;  1SYQ A;  3TJ5 A;  4DJ9 A;  4E18 A;  1RKE A;  3TJ6 A;  5L0C A;  2GWW A;  3ZDL A;  1ZW3 A;  4PR9 A;  1U6H A;  3H2V A;  1ZVZ A;  2B0H A;  5L0I A;  1XWJ A;  4P9T A;  5L0J A;  3VF0 A;  1RKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...