1XWJA

Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
253
structure length
253
Chain Sequence
MMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Structural and Dynamic Characterization of a Vinculin Binding Site in the Talin Rod
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion/protein binding
total genus 105
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2004-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1xwjA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1xwjA01
5L0DA 2GWWA 1DOWA 4EHPA 4DJ9A 2LQGA 1TR2A 1H6GA 5L0HA 1ZW2A 3RF3A 1RKEB 3VF0A 1SYQA 2X0CA 5L0IA 1RKEA 1YDIA 3MYIA 2L7AA 1U89A 4PR9A 2B0HA 3TJ6A 4IGGA 4W8PA 1RKCA 2HSQA 3TJ5A 1ZW3A 3H2UA 2IBFA 5L0JA 1ST6A 1ZVZA 4E18A 3H2VA 1U6HA 1DOVA 3ZDLA 4P9TA 1T01A 5L0CA 2GDCA 1L7CA 5L0FA 1XWJA 4ONSA 4E17A 3S90A 5L0GA 1QKRA 3T6GB 4K1OA 5FZTA
chains in the Genus database with same CATH superfamily
4U9EA 2Q4FA 2A1DD 3ASNC 3KL4A 1H9TA 1VMAA 4ULVA 4A4AA 2J9UA 1NU9C 3V7OA 3VAYA 2YWAA 3GM2A 4MVUA 2R05A 1Z23A 2QE9A 3IQTA 3Q6MA 3U8PA 1HY5A 4G78A 3MYIA 2XS1A 5A6BA 3TULA 5GPGB 4J7YA 4I1MA 1FMWA 2XLEA 3KPHA 3MFNA 4PR9A 5JP7A 1I4ZA 1XZPA 2NUPA 3HKKA 3WAQA 1FNTc 1ZZPA 3AG3C 4J7TA 3ABMC 2R03A 1NU7D 5AC5A 5A6AA 1H9GA 2YL7A 2NSGA 3DM5A 4LLCA 2AWCA 1LE4A 2XLDA 5COFA 3ZDLA 4J32B 3OWTA 1L7CA 1VYIA 4Q4ZF 4EWCA 1VTMP 4BJ6C 2HJMA 3T6GB 4CS9C 1EI7A 2R7UA 2GWWA 3A9CA 4N4WA 1XZQA 1A7VA 3MBGA 4PJJA 3U3FA 2KW3C 3K33A 4DJ9A 5JT4A 3NRHA 4DRIB 1OCZC 2EPLX 3TK0A 1D0XA 2R7OA 4AE4B 5IY5C 3R7CA 4D4NA 2VCAA 1Z6AA 3S28A 2JD3A 2J9WA 2CNWA 4IAQA 4YL0A 1YDIA 3PHF2 3HLZA 2V3CC 1WTYA 2W45A 3ASOC 4O6MA 3JSZA 3DJNB 3TJ6A 1UFBA 1VLSA 3DKAA 2HSQA 4XPYA 2WL8A 4XEVA 2W4BA 1HE1A 1K40A 5JLIA 1NG1A 2XM4A 3LS0A 4WABA 3UGOA 1ZU4A 1JOGA 1ZU5A 2AVKA 4YJWA 1HMOA 1E2XA 1Q0MA 1S05A 3AQBA 3C8GB 1S7ZA 5A6JA 1HW2A 3DD7A 2Q00A 4CX9A 2XLHA 4M63A 2LFDA 2NG1A 3K6BA 3RVYA 4WGZA 4WJ0A 1T6UA 2OG2A 2C03A 4LDQA 1KNYA 5COMA 1CPRA 3PCVA 3PDMP 1CGME 2KGOA 2D5RB 2XLOA 1A7EA 1OQCA 1H6GA 3EHNA 4E7SA 1ORJA 4EBJA 4MW3A 3NDBB 2YVKA 1SYQA 3U0CA 3DJUB 1RKEA 2KNHA 2HMZA 2WVQA 2YL0A 1Z5ZA 4KI2A 3T4RA 3SP1A 3VRCA 1U89A 5KYXB 3C62A 4P6IC 3LNMB 1Q0DA 3DM9B 1F1MA 3IEEA 2BC5A 4U5FE 3TJ5A 5BUOA 3DAGA 1GS9A 3H2UA 1LPEA 3K7DA 3LEVA 1Q0GA 3M4BA 4HEAJ 1JMWA 1YA9A 3IQCA 4JEBA 3GWNA 5JRAA 2L9JA 2Y3GA 3LS1A 3RIPA 2MYSA 1JRAA 2QUPA 4U5EE 3C63A 4G7HF 2J46A 1NLXA 3S90A 2EIMC 3EG9B 1JR8A 1QQ3A 1YVIA 3AJMA 4U5GA 4PJMA 1Q0KA 3SNHA 2OQMA 4EHPA 3DMDA 5E3CA 2LQGA 2Z15A 3TD7A 1I5NA 4IRUA 3EGXB 3QTHA 4JJGA 2KYHA 4XPXA 1V54C 3H65A 4JZAA 1HMDA 4BJ1A 3U2LA 1YA7O 3NMKA 1YARO 3WHNA 4QI0A 3NYJA 3ZTZA 2E87A 3EHMA 1BZ4A 2KK1A 4RDAA 4IWBA 4YWQA 3ZQYA 2XSEA 2LCHA 4BJ6A 4CIHA 2XL4A 4C7OA 2G62A 2HMQA 2QY9A 5B3IA 2A68F 1J8MF 5KYWB 2ZXRA 4JE9A 1TWCA 2YZSA 2OJQA 3GORA 3GWLA 4MS2A 4OD5A 4DRHB 5FZTA 5A69A 3E9VA 4Z9HA 3O55A 1DOWA 3POVA 1JPJA 4BJTA 3ZIBA 4ZLCA 5DVWA 2FGYA 2XXAA 2HZ8A 3VM6A 3QW0A 1EQ1A 2OEXA 1D1BA 5B3SC 5L0HA 1AVOB 3RF3A 2CDQA 3S9OA 2YL3A 3FAPB 1ZHTA 4LDKA 1MMAA 4XLNF 3ZVRA 3NMIA 5F28E 3W8IA 2R7RA 1A41A 2H7VC 2WVOA 3GEHA 3Q6NA 1SZIA 3QZCA 4BEMJ 3WG7C 3AG1C 1R4TA 2HKVA 4MVQA 5KYUB 4KC9A 4EBKA 4LACB 1IW7F 2NSFA 4X0RA 1PD1A 2P7VA 4B6IA 1PD0A 1WASA 2G3VA 2DGJA 3KYJA 2J7PD 4IARA 2LP4A 4E18A 1LS1A 3UMIA 2XS8A 2PNOA 3HTKC 1C17M 3DXJF 4E17A 2XRHA 4FESA 2UUIA 5BQGA 3JTLO 3QMKA 1MNDA 2V26A 4I44A 3SYNA 2Q3TA 3W2WA 3B9QA 1FTSA 1OCRC 3EFOB 2ICWG 3FMSA 2P61A 2QLAA 2PFDA 3ECSA 2GAQA 2VC9A 5JUAA 3NYMA 4DOZA 3TOMA 3EZIA 4CJOA 3U2MA 2OJED 1Y4CA 5A6BD 2AWYA 1A7DA 1QSPA 2Y69C 3Q7GA 4Z9IA 1G8XA 1Y6DA 4R32A 3JSEO 3JZ0A 1M57C 3JCUQ 3GEIA 1XWJA 4ONSA 3FVYA 4G0HA 2P0NA 4CS7A 2J8WA 2Y3BA 1LKXA 2AU5A 5DQTA 1VOMA 2I15A 4G7OF 2R7TA 1LVKA 1WATA 3GEEA 3EQLF 2J45A 3JYHA 4H54A 1RKEB 5CI8A 3RYLA 4CDVA 3LESA 1M56C 2IYLD 2EIKC 2LIGA 2PF4E 2OEVA 2L7AA 2LSEA 4YL3A 3L34A 4FAPB 4IGGA 1C03A 4DVYP 5BQIA 2G3KA 4AL0A 3O10A 2CNWD 3UNGC 5L0JA 3NKEA 1A0BA 2R7WA 1ST6A 4XPWA 3EGDB 5KYYA 4WGYA 4OIRF 4Q5SF 1M6TA 4W8KA 2YLGA 2P6VA 4XTKA 3SEOA 4DVZA 3AQCA 4CDAA 2BE5F 2R02A 1OW8A 1GGQA 4GQHA 4I3MA 1LS4A 4YN0B 2L81A 1E83A 4ZLDA 3M79A 1JAFA 1T9KA 3NKDA 1I4YA 2X51A 4EUKB 1YYXA 3N24A 4XEFA 4DRJB 5B1AC 2CCYA 5L0IA 5HSWA 1K05A 3ZSUA 3F47A 3GM3A 2VCCA 5DS4A 4JTAB 2DYSC 1YJGA 4J30B 2W9YA 3E70C 2F22A 2YHSA 3DZAA 3O39A 2PBEA 3B29A 1SF8A 3KYIA 4FWVA 4O79A 5T3WA 3LLKA 2VH3A 3EZHA 1MQVA 5A6KA 3C7JA 4PK4A 3VYWA 3ZQVA 4NY3A 4FX5A 4K0DA 2QNLA 1D0YA 5KYNA 1RMVA 3G50A 2EINC 2HV7A 1OR3A 3B71A 5E33A 3OA1A 2XXAB 4RBNA 3HNKA 1OXBA 4O6NA 3T9OA 3IHUA 1NBBA 2IXPA 4EBBA 2WVNA 2NUTB 1TWHA 1N1CA 4MVRA 3SXZA 2EPOA 2VCBA 4NTFA 1M2VA 4CSAC 2HV6A 2RD9A 1WOLA 3AOUA 4JJFA 1CGOA 1OKKA 2WZLA 2IXNA 5DLJA 4NC3A 4JW1A 3RQGA 1HE9A 2CW0F 1YLMA 3HNIA 4OIQF 1LM3B 2B0HA 3F46A 1G5ZA 4PJLA 1RKCA 2DYRC 2MHRA 2FFHA 3US6A 3GM1A 3K1IC 3EH2A 4GYTA 2P1AA 4CS9A 3RQFA 1ZHWA 2ASRA 4BEJA 4ULWA 4JEAA 3C8GA 4OD4A 1TFOB 2L6HA 1FAPB 4YT8A 3W2VA 4BJ5C 4E0IA 1TWGA 2WZFA 4MVZA 5AC4A 5CIVA 1TR2A 5BQHA 3S27A 1VLTA 3FAJA 5JS5A 3A11A 1ORSC 1K04A 4YT2A 2Q9CA 3AGUA 3IPMO 3MYFA 5EK0A 1V55C 2H7BA 4LLEA 3L0IA 1W2WA 2J9BA 2NUPB 4N6CA 5KYXA 4RD9A 3KH2A 4NQFA 1BDJB 3EJNA 4JTCB 5T1DB 4MTOA 4CBEA 1O3UA 1RCPA 4MVOA 4CDYA 2JPUA 1ZVZA 1C02A 2EPNA 4UDVA 3BRJA 1CPQA 3G4XA 3GODA 4CIPA 4JTDB 1NSGB 3CEXA 4IJJA 1LE2A 4PFOA 2AP3A 2FAPB 4KNWA 1PV3A 3B0UX 1KU2A 3SXKA 4GEHA 3HNLA 3K66A 2R7SA 2I8BA 1YZAA 3JYYA 2BL2A 3SZRA 4MW8A 1YZCA 1J8YF 3EH1A 4IAOA 3EGXA 4XLPF 2IOQA 2EPMX 3LJBA 5JSLA 1ZW2A 2R7VA 4EKWA 2TMVP 5DS5A 4F4BA 2EILC 3UGPA 3FXHA 3JRMO 1Z3IX 2HUJA 4JKVA 1NZEA 4U5BE 1QPUA 4BG0A 1AUEA 2NPUA 4MTGA 2JX0A 1LI5A 3FOOA 2YL1A 4W8PA 3TQOA 1OCCC 1ORYA 4YK5A 1HW1A 3ABKC 1FR0A 1H7IA 3X1OA 1V74B 2YKZA 1D0ZA 1EKYA 3O6XA 4OIOF 2Y3DA 2WB7A 3L1MA 2HSBA 1BR4A 2M64A 3BEHA 5KYWA 4K7BA 5L3QA 4OIPF 3EPVA 3N0TA 4PACA 1TFKB 4YL1A 1OW7A 1M2OA 1MNEA 3ABLC 2WZGA 3U8VA 3ZTMA 3AGTA 4CSAA 3IQ5A 5HV9A 3RFYA 5F5FA 4KBLA 4A2NB 2MWQA 3U9JA 1OW6A 1LI7A 4ER9A 2VB6A 3QVZA 2CYDA 3VF0A 2X0CA 2J9VA 1CGNA 3ATPA 5B1BC 5E3AA 1YAUO 2Q9AA 2DI3A 3IQ6A 3K1IA 5F5HA 4CS8C 2YQYA 1U0BB 3L8JA 2KJGA 3M4CA 3RQEA 1EA8A 1L3PA 2DB4A 4AK9A 4DBQA 1NFNA 5KYUA 3S0XA 1O5HA 3ITFA 4LDRA 4BJ5A 4G7ZF 3NMJA 1G4US 2A0BA 2J0XA 4XEKA 3FDQA 1KTMA 2ZXWC 3LAYA 2IM8A 3LUTB 5L0GA 1QKRA 2R9RB 3LNRA 4K1OA 4JCZA 3UMKA 3DWWA 4Q7CA 3FOPA 3B0VC 1LIHA 1RJ9A 5DS6A 4U5HA 1B68A 2RSEB 3V5ZA 1TQGA 4NCQA 4U9DA 1OXKA 2L6FA 4HFFB 3WODF 1FFHA 1M2VB 4QDLA 4MVMA 1MMDA 4JRZA 3SXYA 3EFOA 2A6HF 1OCOC 3KKBA 4N06A 1YYJA 2HJ3A 1IZMA 2YLIA 1Z7Qc 4QI2A 2M4EA 1RXQA 4BPMA 3UR3C 3W8HA 3T6BA 3T6JA 2PX0A 4U5CE 1ZW3A 1E86A 1V4AA 4C7OB 2ZD9A 3GANA 3B0PA 2HS5A 2R25A 3CQZA 5FCLA 2QTVA 1GM5A 3V5XA 3DAFA 2H7OA 2C04A 1U6HA 1WWPA 1UG7A 2GFHA 2J0WA 1WN0A 1TWAA 1FMVA 2KSFA 2YEVA 3I5QA 4P9TA 5TJ5E 5L0FA 1PCXA 3JT1A 4NTBA 5L0DA 2EIJC 4PFPA 4E0HA 5JVEA 1QZXA 4MVSA 2ZXPA 3RH3A 3ZG1A 1QVXA 3LLIA 2OCCC 2XLMA 3K1HA 2L6GA 3C8ZA 3DE9A 1VB5A 3M1CB 1MMGA 2CGEA 3PMRA 4OINF 4AE4A 1JPNA 2EPKX 3C18A 3HNJA 4D4XA 4H4KC 1D1CA 3U3BA 3QW1A 4ANJA 3X2QC 3U5SA 3CAXA 3W4YA 5K0IA 1Q0FA 2Q7RA 2ZXOA 1OKKD 1R5ID 1D1AA 4HFKB 3OEOA 3AG2C 1ZHZA 3Q7LA 4MTFA 4P9FA 1E84A 5L3VA 2LK4A 1T6QA 5D92A 1DOVA 3EGDA 4JURI 2GDCA 5D91A 3QVYA 2KC3A 3RKOF 4YT4A 1Z63A 2VASA 3J06A 1SMYF 2W4MA 1MMNA 4C3BA 3SXMA 2B0JA 2H8AA 3I4UA 2Y3HA 4I1OB 2OKUA 2OOCA 1ZHYA 3AG4C 3C8GD 2XL6A 3MLGA 3N2ZB 4CS8A 3CSKA 1BBHA 1WGWA 3L8IA 2D4UA 4AX2A 1TKNA 3M15A 1VYKA 1SR2A 3RVZA 5DQZA 4CJGA 4AL1A 1VK5A 5COGA 4JC7A 4U5DE 4MQ9F 2LD6A 4KNVA 4MNDA 4JCHA 4YT5A 3MX3A 1FFTC 4LERA 4C3DA 2HFIA 1OR2A 1QLEC 2IBFA 3I5PA 4C3EA 2PP4A 2IXOA 3S29A 2PX3A 3CZ6A 4DXWA 2A0UA 2KQ9A 5L0CA 2OU6A 2XL8A 1T01A 2A6EF 3LEOA 4N6HA 5CI9A 3S84A 3R2PA 5AGFA 4NTAA 2YRFA 1NFOA 1APCA 4DBRA 256BA 3DI5A 3EG9A 1BR2A 4PJNA 2R7QA 2XLWA 2ETSA 2O9XA 2A69F 2GA0A 1T6IA 3TOLA 2ZPAA 3U9MA 5EHHA 1ZYRF 2NUTA 2IXMA 4L6RA 3NYLA 4EIYA 2XM0A 4Z9JA 3KMIA 3RW0A 3ZC4A 5E2QA 3G4ZA 1O87A 4HE8D 4O6YA 1GQAA 2J7PA 1G4WR 1T5OA 2LFFA 2UUHA 2Y39A 3DE8A 2R7XA 4XQ1A 3NG1A 2XLVA 1ZHXA 2Q9BA 3FHDA 4IB4A 2YLDA 4JIOA 3JRTA 5KYYB 3H2VA 1BR1A 3V5YA 3HJCA 5EGYA 4XWJA 5T3TA 4JVSA 4O7GA 1E85A 1AEPA 3UMHA 3ZWIA 4E7ZA 1RJ9B
chains in the Genus database with same CATH topology
5L0DA 2GWWA 1DOWA 4EHPA 4DJ9A 2LQGA 1TR2A 1H6GA 5L0HA 1ZW2A 3RF3A 1RKEB 3VF0A 1SYQA 2X0CA 5L0IA 1RKEA 1YDIA 3MYIA 2L7AA 1U89A 4PR9A 2B0HA 3TJ6A 4IGGA 4W8PA 1RKCA 2HSQA 3TJ5A 1ZW3A 3H2UA 2IBFA 5L0JA 1ST6A 1ZVZA 4E18A 3H2VA 1U6HA 1DOVA 3ZDLA 4P9TA 1T01A 5L0CA 2GDCA 1L7CA 5L0FA 1XWJA 4ONSA 4E17A 3S90A 5L0GA 1QKRA 3T6GB 4K1OA 5FZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0D A;  2GWW A;  1DOW A;  4EHP A;  4DJ9 A;  2LQG A;  1TR2 A;  1H6G A;  5L0H A;  1ZW2 A;  3RF3 A;  1RKE B;  3VF0 A;  1SYQ A;  2X0C A;  5L0I A;  1RKE A;  1YDI A;  3MYI A;  2L7A A;  1U89 A;  4PR9 A;  2B0H A;  3TJ6 A;  4IGG A;  4W8P A;  1RKC A;  2HSQ A;  3TJ5 A;  1ZW3 A;  3H2U A;  2IBF A;  5L0J A;  1ST6 A;  1ZVZ A;  4E18 A;  3H2V A;  1U6H A;  1DOV A;  3ZDL A;  4P9T A;  1T01 A;  5L0C A;  2GDC A;  1L7C A;  5L0F A;  1XWJ A;  4ONS A;  4E17 A;  3S90 A;  5L0G A;  1QKR A;  3T6G B;  4K1O A;  5FZT A; 
#chains in the Genus database with same CATH topology
 4U9E A;  2Q4F A;  2A1D D;  3ASN C;  3KL4 A;  1H9T A;  1VMA A;  4ULV A;  4A4A A;  2J9U A;  1NU9 C;  3V7O A;  3VAY A;  2YWA A;  3GM2 A;  4MVU A;  2R05 A;  1Z23 A;  2QE9 A;  3IQT A;  3Q6M A;  3U8P A;  1HY5 A;  4G78 A;  3MYI A;  2XS1 A;  5A6B A;  3TUL A;  5GPG B;  4J7Y A;  4I1M A;  1FMW A;  2XLE A;  3KPH A;  3MFN A;  4PR9 A;  5JP7 A;  1I4Z A;  1XZP A;  2NUP A;  3HKK A;  3WAQ A;  1FNT c;  1ZZP A;  3AG3 C;  4J7T A;  3ABM C;  2R03 A;  1NU7 D;  5AC5 A;  5A6A A;  1H9G A;  2YL7 A;  2NSG A;  3DM5 A;  4LLC A;  2AWC A;  1LE4 A;  2XLD A;  5COF A;  3ZDL A;  4J32 B;  3OWT A;  1L7C A;  1VYI A;  4Q4Z F;  4EWC A;  1VTM P;  4BJ6 C;  2HJM A;  3T6G B;  4CS9 C;  1EI7 A;  2R7U A;  2GWW A;  3A9C A;  4N4W A;  1XZQ A;  1A7V A;  3MBG A;  4PJJ A;  3U3F A;  2KW3 C;  3K33 A;  4DJ9 A;  5JT4 A;  3NRH A;  4DRI B;  1OCZ C;  2EPL X;  3TK0 A;  1D0X A;  2R7O A;  4AE4 B;  5IY5 C;  3R7C A;  4D4N A;  2VCA A;  1Z6A A;  3S28 A;  2JD3 A;  2J9W A;  2CNW A;  4IAQ A;  4YL0 A;  1YDI A;  3PHF 2;  3HLZ A;  2V3C C;  1WTY A;  2W45 A;  3ASO C;  4O6M A;  3JSZ A;  3DJN B;  3TJ6 A;  1UFB A;  1VLS A;  3DKA A;  2HSQ A;  4XPY A;  2WL8 A;  4XEV A;  2W4B A;  1HE1 A;  1K40 A;  5JLI A;  1NG1 A;  2XM4 A;  3LS0 A;  4WAB A;  3UGO A;  1ZU4 A;  1JOG A;  1ZU5 A;  2AVK A;  4YJW A;  1HMO A;  1E2X A;  1Q0M A;  1S05 A;  3AQB A;  3C8G B;  1S7Z A;  5A6J A;  1HW2 A;  3DD7 A;  2Q00 A;  4CX9 A;  2XLH A;  4M63 A;  2LFD A;  2NG1 A;  3K6B A;  3RVY A;  4WGZ A;  4WJ0 A;  1T6U A;  2OG2 A;  2C03 A;  4LDQ A;  1KNY A;  5COM A;  1CPR A;  3PCV A;  3PDM P;  1CGM E;  2KGO A;  2D5R B;  2XLO A;  1A7E A;  1OQC A;  1H6G A;  3EHN A;  4E7S A;  1ORJ A;  4EBJ A;  4MW3 A;  3NDB B;  2YVK A;  1SYQ A;  3U0C A;  3DJU B;  1RKE A;  2KNH A;  2HMZ A;  2WVQ A;  2YL0 A;  1Z5Z A;  4KI2 A;  3T4R A;  3SP1 A;  3VRC A;  1U89 A;  5KYX B;  3C62 A;  4P6I C;  3LNM B;  1Q0D A;  3DM9 B;  1F1M A;  3IEE A;  2BC5 A;  4U5F E;  3TJ5 A;  5BUO A;  3DAG A;  1GS9 A;  3H2U A;  1LPE A;  3K7D A;  3LEV A;  1Q0G A;  3M4B A;  4HEA J;  1JMW A;  1YA9 A;  3IQC A;  4JEB A;  3GWN A;  5JRA A;  2L9J A;  2Y3G A;  3LS1 A;  3RIP A;  2MYS A;  1JRA A;  2QUP A;  4U5E E;  3C63 A;  4G7H F;  2J46 A;  1NLX A;  3S90 A;  2EIM C;  3EG9 B;  1JR8 A;  1QQ3 A;  1YVI A;  3AJM A;  4U5G A;  4PJM A;  1Q0K A;  3SNH A;  2OQM A;  4EHP A;  3DMD A;  5E3C A;  2LQG A;  2Z15 A;  3TD7 A;  1I5N A;  4IRU A;  3EGX B;  3QTH A;  4JJG A;  2KYH A;  4XPX A;  1V54 C;  3H65 A;  4JZA A;  1HMD A;  4BJ1 A;  3U2L A;  1YA7 O;  3NMK A;  1YAR O;  3WHN A;  4QI0 A;  3NYJ A;  3ZTZ A;  2E87 A;  3EHM A;  1BZ4 A;  2KK1 A;  4RDA A;  4IWB A;  4YWQ A;  3ZQY A;  2XSE A;  2LCH A;  4BJ6 A;  4CIH A;  2XL4 A;  4C7O A;  2G62 A;  2HMQ A;  2QY9 A;  5B3I A;  2A68 F;  1J8M F;  5KYW B;  2ZXR A;  4JE9 A;  1TWC A;  2YZS A;  2OJQ A;  3GOR A;  3GWL A;  4MS2 A;  4OD5 A;  4DRH B;  5FZT A;  5A69 A;  3E9V A;  4Z9H A;  3O55 A;  1DOW A;  3POV A;  1JPJ A;  4BJT A;  3ZIB A;  4ZLC A;  5DVW A;  2FGY A;  2XXA A;  2HZ8 A;  3VM6 A;  3QW0 A;  1EQ1 A;  2OEX A;  1D1B A;  5B3S C;  5L0H A;  1AVO B;  3RF3 A;  2CDQ A;  3S9O A;  2YL3 A;  3FAP B;  1ZHT A;  4LDK A;  1MMA A;  4XLN F;  3ZVR A;  3NMI A;  5F28 E;  3W8I A;  2R7R A;  1A41 A;  2H7V C;  2WVO A;  3GEH A;  3Q6N A;  1SZI A;  3QZC A;  4BEM J;  3WG7 C;  3AG1 C;  1R4T A;  2HKV A;  4MVQ A;  5KYU B;  4KC9 A;  4EBK A;  4LAC B;  1IW7 F;  2NSF A;  4X0R A;  1PD1 A;  2P7V A;  4B6I A;  1PD0 A;  1WAS A;  2G3V A;  2DGJ A;  3KYJ A;  2J7P D;  4IAR A;  2LP4 A;  4E18 A;  1LS1 A;  3UMI A;  2XS8 A;  2PNO A;  3HTK C;  1C17 M;  3DXJ F;  4E17 A;  2XRH A;  4FES A;  2UUI A;  5BQG A;  3JTL O;  3QMK A;  1MND A;  2V26 A;  4I44 A;  3SYN A;  2Q3T A;  3W2W A;  3B9Q A;  1FTS A;  1OCR C;  3EFO B;  2ICW G;  3FMS A;  2P61 A;  2QLA A;  2PFD A;  3ECS A;  2GAQ A;  2VC9 A;  5JUA A;  3NYM A;  4DOZ A;  3TOM A;  3EZI A;  4CJO A;  3U2M A;  2OJE D;  1Y4C A;  5A6B D;  2AWY A;  1A7D A;  1QSP A;  2Y69 C;  3Q7G A;  4Z9I A;  1G8X A;  1Y6D A;  4R32 A;  3JSE O;  3JZ0 A;  1M57 C;  3JCU Q;  3GEI A;  1XWJ A;  4ONS A;  3FVY A;  4G0H A;  2P0N A;  4CS7 A;  2J8W A;  2Y3B A;  1LKX A;  2AU5 A;  5DQT A;  1VOM A;  2I15 A;  4G7O F;  2R7T A;  1LVK A;  1WAT A;  3GEE A;  3EQL F;  2J45 A;  3JYH A;  4H54 A;  1RKE B;  5CI8 A;  3RYL A;  4CDV A;  3LES A;  1M56 C;  2IYL D;  2EIK C;  2LIG A;  2PF4 E;  2OEV A;  2L7A A;  2LSE A;  4YL3 A;  3L34 A;  4FAP B;  4IGG A;  1C03 A;  4DVY P;  5BQI A;  2G3K A;  4AL0 A;  3O10 A;  2CNW D;  3UNG C;  5L0J A;  3NKE A;  1A0B A;  2R7W A;  1ST6 A;  4XPW A;  3EGD B;  5KYY A;  4WGY A;  4OIR F;  4Q5S F;  1M6T A;  4W8K A;  2YLG A;  2P6V A;  4XTK A;  3SEO A;  4DVZ A;  3AQC A;  4CDA A;  2BE5 F;  2R02 A;  1OW8 A;  1GGQ A;  4GQH A;  4I3M A;  1LS4 A;  4YN0 B;  2L81 A;  1E83 A;  4ZLD A;  3M79 A;  1JAF A;  1T9K A;  3NKD A;  1I4Y A;  2X51 A;  4EUK B;  1YYX A;  3N24 A;  4XEF A;  4DRJ B;  5B1A C;  2CCY A;  5L0I A;  5HSW A;  1K05 A;  3ZSU A;  3F47 A;  3GM3 A;  2VCC A;  5DS4 A;  4JTA B;  2DYS C;  1YJG A;  4J30 B;  2W9Y A;  3E70 C;  2F22 A;  2YHS A;  3DZA A;  3O39 A;  2PBE A;  3B29 A;  1SF8 A;  3KYI A;  4FWV A;  4O79 A;  5T3W A;  3LLK A;  2VH3 A;  3EZH A;  1MQV A;  5A6K A;  3C7J A;  4PK4 A;  3VYW A;  3ZQV A;  4NY3 A;  4FX5 A;  4K0D A;  2QNL A;  1D0Y A;  5KYN A;  1RMV A;  3G50 A;  2EIN C;  2HV7 A;  1OR3 A;  3B71 A;  5E33 A;  3OA1 A;  2XXA B;  4RBN A;  3HNK A;  1OXB A;  4O6N A;  3T9O A;  3IHU A;  1NBB A;  2IXP A;  4EBB A;  2WVN A;  2NUT B;  1TWH A;  1N1C A;  4MVR A;  3SXZ A;  2EPO A;  2VCB A;  4NTF A;  1M2V A;  4CSA C;  2HV6 A;  2RD9 A;  1WOL A;  3AOU A;  4JJF A;  1CGO A;  1OKK A;  2WZL A;  2IXN A;  5DLJ A;  4NC3 A;  4JW1 A;  3RQG A;  1HE9 A;  2CW0 F;  1YLM A;  3HNI A;  4OIQ F;  1LM3 B;  2B0H A;  3F46 A;  1G5Z A;  4PJL A;  1RKC A;  2DYR C;  2MHR A;  2FFH A;  3US6 A;  3GM1 A;  3K1I C;  3EH2 A;  4GYT A;  2P1A A;  4CS9 A;  3RQF A;  1ZHW A;  2ASR A;  4BEJ A;  4ULW A;  4JEA A;  3C8G A;  4OD4 A;  1TFO B;  2L6H A;  1FAP B;  4YT8 A;  3W2V A;  4BJ5 C;  4E0I A;  1TWG A;  2WZF A;  4MVZ A;  5AC4 A;  5CIV A;  1TR2 A;  5BQH A;  3S27 A;  1VLT A;  3FAJ A;  5JS5 A;  3A11 A;  1ORS C;  1K04 A;  4YT2 A;  2Q9C A;  3AGU A;  3IPM O;  3MYF A;  5EK0 A;  1V55 C;  2H7B A;  4LLE A;  3L0I A;  1W2W A;  2J9B A;  2NUP B;  4N6C A;  5KYX A;  4RD9 A;  3KH2 A;  4NQF A;  1BDJ B;  3EJN A;  4JTC B;  5T1D B;  4MTO A;  4CBE A;  1O3U A;  1RCP A;  4MVO A;  4CDY A;  2JPU A;  1ZVZ A;  1C02 A;  2EPN A;  4UDV A;  3BRJ A;  1CPQ A;  3G4X A;  3GOD A;  4CIP A;  4JTD B;  1NSG B;  3CEX A;  4IJJ A;  1LE2 A;  4PFO A;  2AP3 A;  2FAP B;  4KNW A;  1PV3 A;  3B0U X;  1KU2 A;  3SXK A;  4GEH A;  3HNL A;  3K66 A;  2R7S A;  2I8B A;  1YZA A;  3JYY A;  2BL2 A;  3SZR A;  4MW8 A;  1YZC A;  1J8Y F;  3EH1 A;  4IAO A;  3EGX A;  4XLP F;  2IOQ A;  2EPM X;  3LJB A;  5JSL A;  1ZW2 A;  2R7V A;  4EKW A;  2TMV P;  5DS5 A;  4F4B A;  2EIL C;  3UGP A;  3FXH A;  3JRM O;  1Z3I X;  2HUJ A;  4JKV A;  1NZE A;  4U5B E;  1QPU A;  4BG0 A;  1AUE A;  2NPU A;  4MTG A;  2JX0 A;  1LI5 A;  3FOO A;  2YL1 A;  4W8P A;  3TQO A;  1OCC C;  1ORY A;  4YK5 A;  1HW1 A;  3ABK C;  1FR0 A;  1H7I A;  3X1O A;  1V74 B;  2YKZ A;  1D0Z A;  1EKY A;  3O6X A;  4OIO F;  2Y3D A;  2WB7 A;  3L1M A;  2HSB A;  1BR4 A;  2M64 A;  3BEH A;  5KYW A;  4K7B A;  5L3Q A;  4OIP F;  3EPV A;  3N0T A;  4PAC A;  1TFK B;  4YL1 A;  1OW7 A;  1M2O A;  1MNE A;  3ABL C;  2WZG A;  3U8V A;  3ZTM A;  3AGT A;  4CSA A;  3IQ5 A;  5HV9 A;  3RFY A;  5F5F A;  4KBL A;  4A2N B;  2MWQ A;  3U9J A;  1OW6 A;  1LI7 A;  4ER9 A;  2VB6 A;  3QVZ A;  2CYD A;  3VF0 A;  2X0C A;  2J9V A;  1CGN A;  3ATP A;  5B1B C;  5E3A A;  1YAU O;  2Q9A A;  2DI3 A;  3IQ6 A;  3K1I A;  5F5H A;  4CS8 C;  2YQY A;  1U0B B;  3L8J A;  2KJG A;  3M4C A;  3RQE A;  1EA8 A;  1L3P A;  2DB4 A;  4AK9 A;  4DBQ A;  1NFN A;  5KYU A;  3S0X A;  1O5H A;  3ITF A;  4LDR A;  4BJ5 A;  4G7Z F;  3NMJ A;  1G4U S;  2A0B A;  2J0X A;  4XEK A;  3FDQ A;  1KTM A;  2ZXW C;  3LAY A;  2IM8 A;  3LUT B;  5L0G A;  1QKR A;  2R9R B;  3LNR A;  4K1O A;  4JCZ A;  3UMK A;  3DWW A;  4Q7C A;  3FOP A;  3B0V C;  1LIH A;  1RJ9 A;  5DS6 A;  4U5H A;  1B68 A;  2RSE B;  3V5Z A;  1TQG A;  4NCQ A;  4U9D A;  1OXK A;  2L6F A;  4HFF B;  3WOD F;  1FFH A;  1M2V B;  4QDL A;  4MVM A;  1MMD A;  4JRZ A;  3SXY A;  3EFO A;  2A6H F;  1OCO C;  3KKB A;  4N06 A;  1YYJ A;  2HJ3 A;  1IZM A;  2YLI A;  1Z7Q c;  4QI2 A;  2M4E A;  1RXQ A;  4BPM A;  3UR3 C;  3W8H A;  3T6B A;  3T6J A;  2PX0 A;  4U5C E;  1ZW3 A;  1E86 A;  1V4A A;  4C7O B;  2ZD9 A;  3GAN A;  3B0P A;  2HS5 A;  2R25 A;  3CQZ A;  5FCL A;  2QTV A;  1GM5 A;  3V5X A;  3DAF A;  2H7O A;  2C04 A;  1U6H A;  1WWP A;  1UG7 A;  2GFH A;  2J0W A;  1WN0 A;  1TWA A;  1FMV A;  2KSF A;  2YEV A;  3I5Q A;  4P9T A;  5TJ5 E;  5L0F A;  1PCX A;  3JT1 A;  4NTB A;  5L0D A;  2EIJ C;  4PFP A;  4E0H A;  5JVE A;  1QZX A;  4MVS A;  2ZXP A;  3RH3 A;  3ZG1 A;  1QVX A;  3LLI A;  2OCC C;  2XLM A;  3K1H A;  2L6G A;  3C8Z A;  3DE9 A;  1VB5 A;  3M1C B;  1MMG A;  2CGE A;  3PMR A;  4OIN F;  4AE4 A;  1JPN A;  2EPK X;  3C18 A;  3HNJ A;  4D4X A;  4H4K C;  1D1C A;  3U3B A;  3QW1 A;  4ANJ A;  3X2Q C;  3U5S A;  3CAX A;  3W4Y A;  5K0I A;  1Q0F A;  2Q7R A;  2ZXO A;  1OKK D;  1R5I D;  1D1A A;  4HFK B;  3OEO A;  3AG2 C;  1ZHZ A;  3Q7L A;  4MTF A;  4P9F A;  1E84 A;  5L3V A;  2LK4 A;  1T6Q A;  5D92 A;  1DOV A;  3EGD A;  4JUR I;  2GDC A;  5D91 A;  3QVY A;  2KC3 A;  3RKO F;  4YT4 A;  1Z63 A;  2VAS A;  3J06 A;  1SMY F;  2W4M A;  1MMN A;  4C3B A;  3SXM A;  2B0J A;  2H8A A;  3I4U A;  2Y3H A;  4I1O B;  2OKU A;  2OOC A;  1ZHY A;  3AG4 C;  3C8G D;  2XL6 A;  3MLG A;  3N2Z B;  4CS8 A;  3CSK A;  1BBH A;  1WGW A;  3L8I A;  2D4U A;  4AX2 A;  1TKN A;  3M15 A;  1VYK A;  1SR2 A;  3RVZ A;  5DQZ A;  4CJG A;  4AL1 A;  1VK5 A;  5COG A;  4JC7 A;  4U5D E;  4MQ9 F;  2LD6 A;  4KNV A;  4MND A;  4JCH A;  4YT5 A;  3MX3 A;  1FFT C;  4LER A;  4C3D A;  2HFI A;  1OR2 A;  1QLE C;  2IBF A;  3I5P A;  4C3E A;  2PP4 A;  2IXO A;  3S29 A;  2PX3 A;  3CZ6 A;  4DXW A;  2A0U A;  2KQ9 A;  5L0C A;  2OU6 A;  2XL8 A;  1T01 A;  2A6E F;  3LEO A;  4N6H A;  5CI9 A;  3S84 A;  3R2P A;  5AGF A;  4NTA A;  2YRF A;  1NFO A;  1APC A;  4DBR A;  256B A;  3DI5 A;  3EG9 A;  1BR2 A;  4PJN A;  2R7Q A;  2XLW A;  2ETS A;  2O9X A;  2A69 F;  2GA0 A;  1T6I A;  3TOL A;  2ZPA A;  3U9M A;  5EHH A;  1ZYR F;  2NUT A;  2IXM A;  4L6R A;  3NYL A;  4EIY A;  2XM0 A;  4Z9J A;  3KMI A;  3RW0 A;  3ZC4 A;  5E2Q A;  3G4Z A;  1O87 A;  4HE8 D;  4O6Y A;  1GQA A;  2J7P A;  1G4W R;  1T5O A;  2LFF A;  2UUH A;  2Y39 A;  3DE8 A;  2R7X A;  4XQ1 A;  3NG1 A;  2XLV A;  1ZHX A;  2Q9B A;  3FHD A;  4IB4 A;  2YLD A;  4JIO A;  3JRT A;  5KYY B;  3H2V A;  1BR1 A;  3V5Y A;  3HJC A;  5EGY A;  4XWJ A;  5T3T A;  4JVS A;  4O7G A;  1E85 A;  1AEP A;  3UMH A;  3ZWI A;  4E7Z A;  1RJ9 B; 
#chains in the Genus database with same CATH homology
 5L0D A;  2GWW A;  1DOW A;  4EHP A;  4DJ9 A;  2LQG A;  1TR2 A;  1H6G A;  5L0H A;  1ZW2 A;  3RF3 A;  1RKE B;  3VF0 A;  1SYQ A;  2X0C A;  5L0I A;  1RKE A;  1YDI A;  3MYI A;  2L7A A;  1U89 A;  4PR9 A;  2B0H A;  3TJ6 A;  4IGG A;  4W8P A;  1RKC A;  2HSQ A;  3TJ5 A;  1ZW3 A;  3H2U A;  2IBF A;  5L0J A;  1ST6 A;  1ZVZ A;  4E18 A;  3H2V A;  1U6H A;  1DOV A;  3ZDL A;  4P9T A;  1T01 A;  5L0C A;  2GDC A;  1L7C A;  5L0F A;  1XWJ A;  4ONS A;  4E17 A;  3S90 A;  5L0G A;  1QKR A;  3T6G B;  4K1O A;  5FZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...