3GWNA

Crystal structure of the fad binding domain from mimivirus sulfhydryl oxidase r596
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
113
structure length
113
Chain Sequence
b'ANGLITKIWGTAGWTFNHAVTFGYPLNPTSDDKRRYKNYFISLGDVLPCRLCRESYKKFITTGKTALTNEVLRNRHTLTKWFYDVHNAVNNKLEVDYGLSYEDVVNKYESFRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable FAD-linked sulfhydryl oxidase R596
molecule tags Oxidoreductase
source organism Acanthamoeba polyphaga mimivirus
publication title Dimer interface migration in a viral sulfhydryl oxidase
pubmed doi rcsb
total genus 46
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3gwnA00
3U2MA 4LDKA 3GWNA 1JRAA 3R7CA 3O55A 2HJ3A 3LLKA 4E0HA 3GWLA 3TD7A 3U2LA 3MBGA 1OQCA 3TK0A 4E0IA 3W4YA 3LLIA 1JR8A 3U5SA
chains in the Genus database with same CATH superfamily
1RCPA 1O3UA 2HZ8A 3A11A 1L7CA 1LVKA 4CIHA 2XLOA 2WZLA 3UGOA 1EA8A 4UDVA 3ZSUA 1JOGA 3EGDB 3MLGA 4D4NA 1LE2A 4Q5SF 4A4AA 1T6IA 2L9JA 3JTLO 3VM6A 3RH3A 5L0CA 1RJ9B 1Z5ZA 256BA 1OCOC 1XWJA 4PK4A 3B0UX 4G7OF 3BEHA 5E3AA 4MVSA 3SNHA 3V5XA 5A69A 1I5NA 3LS0A 1Z7Qc 3V5ZA 1M56C 3KYJA 1JMWA 1ZU5A 2CNWA 2Y39A 4JURI 4K7BA 4LLEA 4MVUA 1ZU4A 3MYIA 2EPNA 5L0HA 3M1CB 5BQHA 3O55A 1H9TA 3MX3A 5B1BC 3DE8A 2WVNA 3U3FA 1OR2A 2XLEA 3ZTZA 5DVWA 4RBNA 2I15A 1UG7A 1SMYF 2OCCC 2Q9CA 4X0RA 1O87A 2HJ3A 3GWLA 4PR9A 2G3KA 3BRJA 1APCA 1ZW3A 1J8YF 2H7VC 3AJMA 3DJNB 1L3PA 2C04A 2VB6A 4JJFA 3J06A 1A0BA 2KC3A 4QI0A 5L0GA 1EKYA 3QMKA 3Q7LA 2R7RA 4PACA 3MFNA 3O10A 4BPMA 2W4BA 4IGGA 4WABA 1FFTC 3EPVA 1CGNA 1D1CA 1Z6AA 3EH1A 4XEFA 1D0ZA 3K7DA 2KNHA 2YKZA 4NC3A 5DQTA 2YQYA 3DE9A 2J46A 3R2PA 3RF3A 3TK0A 1NFNA 3C8GA 4RD9A 1T01A 2A0BA 1RKCA 3K6BA 4G0HA 4OINF 2R02A 2XM4A 3GEEA 4GEHA 4YT4A 5CIVA 1NG1A 3B0VC 3NRHA 4H54A 3VAYA 3VRCA 2L81A 2FGYA 2Q9AA 1M6TA 2W4MA 2CDQA 1HE1A 2GAQA 4C3BA 3JRTA 1MMAA 2P0NA 2QNLA 2Z15A 5A6KA 1WOLA 4ULVA 1BDJB 1TWGA 4OIOF 2VH3A 4OD5A 4WGZA 1BZ4A 2XLDA 2Y69C 1Q0MA 3UR3C 5KYWA 3W8IA 3IEEA 2XS8A 1M2OA 2EINC 3KPHA 2A68F 3QW0A 1FMWA 4JJGA 3PHF2 1YZAA 1LE4A 1NSGB 2Q4FA 2UUHA 5AGFA 2OG2A 5A6BD 3SZRA 2B0JA 2OU6A 1WATA 3ABKC 2J0XA 4U5EE 2LFFA 2J9VA 2NPUA 5EK0A 4XQ1A 5KYXB 2NUPA 4ER9A 4EBJA 3B9QA 3VF0A 1VTMP 2H8AA 3EG9B 3Q7GA 4M63A 3S28A 2CGEA 3DXJF 4AL1A 1QPUA 3ABMC 2KK1A 4DRHB 3S90A 4MVMA 1A41A 3DZAA 5JP7A 1B68A 2A6HF 1Q0FA 1YA9A 1ZHYA 1N1CA 3AOUA 3EJNA 3IQCA 4HFFB 4E0IA 3GM1A 4CIPA 2X0CA 3EGXB 1I4YA 1LKXA 1T6QA 2VCBA 4KNVA 3DM9B 3EHMA 2YRFA 2PBEA 2ZXOA 2HJMA 1ST6A 3DJUB 5CI8A 3EZHA 2DYSC 2HSQA 2G62A 3U9JA 2IOQA 4DVYP 4D4XA 4ZLDA 4WGYA 3POVA 4JTDB 1HW1A 4NTAA 3PMRA 3H2VA 3LESA 2P1AA 1RKEA 3T6GB 3L8IA 3HNLA 1CGOA 1YA7O 1VMAA 1FR0A 4FWVA 4K0DA 2L6HA 3C63A 1C02A 1OKKD 2CW0F 4JIOA 1EI7A 2QUPA 4GQHA 4NTBA 1Q0KA 4XPYA 1AVOB 1XZQA 1TR2A 1TWHA 3FOPA 1YDIA 3JT1A 4BJ5A 1WASA 1I4ZA 4FESA 5D91A 4J7TA 4AE4B 3AG2C 1KNYA 4CS9C 2LK4A 3Q6MA 1E2XA 3U3BA 1NBBA 3WG7C 3DKAA 4ONSA 2QTVA 2MYSA 2OEVA 4YL0A 4OD4A 3U2LA 1OQCA 5L3VA 3AG1C 2D4UA 2P6VA 3CEXA 1HW2A 2OJED 1QLEC 4N4WA 2J0WA 4O7GA 2OOCA 3ZC4A 2I8BA 1OCZC 1SF8A 3UMKA 2J9BA 4C7OB 1JPNA 1E84A 2L6GA 4YT5A 3RFYA 2NSGA 3S29A 2R7QA 2KYHA 4XLNF 2YL0A 4QI2A 3ASNC 4DBQA 4YL3A 2CYDA 2KGOA 3EZIA 3QW1A 4LDQA 1M57C 1FFHA 1VYKA 4C7OA 3SXZA 2OEXA 3V7OA 4JCZA 2BL2A 5DS5A 3NKDA 1FTSA 1GM5A 1FAPB 1Z23A 1M2VB 2GA0A 2KW3C 2XLWA 2YEVA 1CPQA 2YL3A 5JT4A 2DB4A 2C03A 3AGUA 2XXAA 4OIPF 3GWNA 3LNRA 4W8PA 1Z63A 2FAPB 3TULA 2R25A 5JUAA 5AC4A 2R7OA 3M79A 4LLCA 1TWAA 2E87A 3H2UA 1OW7A 4NTFA 2DI3A 4ULWA 3LEVA 3X2QC 5JSLA 2W9YA 1S05A 4DVZA 3SXKA 4XWJA 5A6JA 1YARO 1QVXA 2R05A 2GDCA 1UFBA 1VLTA 3DI5A 3B0PA 1RXQA 2WVOA 4YN0B 1QZXA 2G3VA 4AL0A 4EUKB 1KTMA 1G8XA 1E85A 2X51A 5L0IA 2PX3A 4FAPB 5COFA 5COGA 2A0UA 1TQGA 1TKNA 2DYRC 1G4WR 4YJWA 3DD7A 3AQCA 2MHRA 3EFOA 1U89A 4EHPA 2W45A 4MQ9F 4DRJB 3ATPA 2XS1A 3TD7A 1CGME 3KMIA 2IYLD 2Q9BA 2V26A 3AQBA 1K04A 3B29A 3G4ZA 1T9KA 3QTHA 3FOOA 2WL8A 4I1OB 4E17A 3T4RA 4I3MA 2YLGA 5FZTA 3E70C 3U9MA 3O6XA 2HUJA 4QDLA 1IZMA 2JPUA 1VLSA 3QVZA 4U9DA 1ZHZA 2PP4A 1QKRA 2WZGA 4JW1A 4G7ZF 4Z9IA 1KU2A 1YAUO 1HE9A 1YLMA 2ZD9A 4OIRF 3UGPA 1U0BB 3TOLA 2XLHA 3TOMA 3HKKA 4MVZA 2A6EF 3U2MA 1OR3A 2EPLX 4EBKA 1ZHWA 2YL7A 1LM3B 3I4UA 1XZPA 2YWAA 4JEBA 1YVIA 2HS5A 3L8JA 2NUTA 5JVEA 1D0YA 2HMQA 4XTKA 3RW0A 1MNEA 4BJ6A 5BUOA 4C3EA 1BR4A 4AE4A 2LP4A 2R7XA 2IXOA 1K05A 4IWBA 5IY5C 3GEHA 4AK9A 3M15A 2NG1A 1NZEA 4DXWA 1FNTc 3LNMB 3FAJA 3NMIA 1C03A 1VB5A 3C7JA 4OIQF 2J9WA 1YJGA 2RD9A 4YT2A 2Y3BA 4FX5A 3GM2A 1GGQA 3JZ0A 2OQMA 2Y3DA 2TMVP 1OW6A 4B6IA 5KYYA 2BE5F 5T3TA 3LLIA 2KQ9A 3C62A 3U8VA 4CS8C 4CX9A 3GANA 2WZFA 4IARA 3WODF 5B1AC 2IXNA 5JS5A 4G78A 2O9XA 4LACB 1IW7F 4JTCB 4YWQA 2QLAA 4P6IC 4ANJA 2IXPA 2XXAB 3IQ5A 2Q7RA 4P9FA 4EBBA 3GORA 2VASA 4JRZA 5B3SC 4R32A 2LCHA 4YK5A 2XM0A 3US6A 4EIYA 1M2VA 3PCVA 4CDAA 3KL4A 3N2ZB 4KC9A 3EG9A 4DRIB 5HSWA 4N6HA 4RDAA 5KYUB 5L3QA 3QZCA 2J7PA 4DJ9A 3K1IA 4MS2A 2R7WA 5AC5A 2B0HA 3Q6NA 5D92A 1YZCA 2Y3HA 2M64A 4F4BA 3K1HA 3FMSA 2YZSA 3U0CA 1RMVA 2MWQA 3G50A 4NY3A 3K66A 4E7ZA 5JRAA 3NDBB 3OWTA 2PX0A 2CNWD 2J8WA 2JX0A 3JSZA 3C8GD 4L6RA 1U6HA 3AG4C 2LIGA 1OCCC 3NYJA 4IAQA 4LDRA 5K0IA 2AU5A 3JSEO 1CPRA 4J32B 3S84A 1ORYA 1D1BA 3TJ6A 5EGYA 1WTYA 2GFHA 3S27A 1VOMA 4CJGA 5DQZA 1LIHA 3RKOF 4U5BE 1BBHA 4U9EA 1GS9A 1A7DA 3NMJA 1GQAA 3CZ6A 5E2QA 2LD6A 1MMGA 4ZLCA 3IHUA 4BJ5C 1LPEA 3HLZA 5COMA 1JRAA 3C8GB 3HNJA 4N6CA 4C3DA 2V3CC 5KYUA 4GYTA 3LAYA 3W8HA 2P61A 2A69F 3K33A 5F28E 3ZWIA 1JAFA 3FAPB 2Q00A 4MVRA 3RQGA 3EH2A 3PDMP 4I1MA 3JRMO 2R7VA 1C17M 3TJ5A 2IXMA 3NMKA 1RKEB 3ZG1A 4YT8A 1HMOA 3T6BA 2LFDA 3LUTB 2A1DD 3KYIA 4Z9JA 1LS4A 3ASOC 5E3CA 1DOVA 1NFOA 1YYJA 4PFPA 1V55C 1PV3A 3C18A 4PJLA 4PJNA 1EQ1A 2EIKC 3V5YA 1JR8A 1PCXA 2EIJC 2IM8A 5JLIA 3EHNA 2R7TA 4O6MA 4KBLA 4JTAB 5T1DB 4HFKB 1O5HA 2LSEA 2R7UA 2ICWG 4IJJA 1PD0A 1WWPA 3LS1A 4CDVA 1G4US 2ASRA 3IPMO 4DOZA 1SZIA 1Q0DA 1D1AA 3TQOA 3KKBA 5DLJA 3RVZA 4G7HF 5KYNA 2QE9A 4LDKA 3N0TA 4U5GA 2AVKA 2EILC 3SXMA 3L0IA 4KI2A 4HEAJ 1MMDA 3ZQYA 4IAOA 2J9UA 4CDYA 4MTOA 1NU9C 1V74B 2YVKA 1MNDA 4IB4A 4JKVA 4J7YA 2L6FA 5FCLA 1OXBA 2AP3A 2D5RB 4N06A 3W2WA 3CQZA 4Q4ZF 3JYYA 2AWCA 1BR1A 4JE9A 4XPXA 1AUEA 4JCHA 1VYIA 2NUTB 4BG0A 1S7ZA 1Y6DA 2XRHA 3K1IC 2KJGA 4JVSA 3T9OA 5DS6A 5BQIA 4O6YA 2WVQA 1W2WA 5L0JA 3R7CA 4BEJA 1NU7D 2HV6A 2XL6A 5F5FA 2HV7A 5A6AA 2F22A 2YHSA 3FHDA 3IQTA 2PF4E 2QY9A 3G4XA 3HNKA 3RQEA 2HMZA 2NUPB 3OEOA 1OW8A 2YL1A 1Q0GA 3SEOA 3SYNA 4BJ1A 3EQLF 2ETSA 3JYHA 5E33A 1WGWA 2HSBA 3RVYA 1T5OA 1WN0A 1QQ3A 4CJOA 4WJ0A 3UMIA 4Q7CA 4KNWA 3MYFA 3M4BA 3RYLA 3ZDLA 5KYWB 3S0XA 2HKVA 1ORJA 3EFOB 2LQGA 2DGJA 2XSEA 3VYWA 4MW3A 2VC9A 4CSAC 5A6BA 4MTFA 2ZXRA 3C8ZA 4NCQA 3DAFA 3KH2A 4MVOA 1HY5A 3JCUQ 3FDQA 2Q3TA 1Y4CA 3NG1A 2H7OA 2IBFA 3ITFA 1T6UA 3DM5A 4W8KA 2XLMA 3DAGA 4CSAA 2YLDA 1FMVA 1ZVZA 1AEPA 1LS1A 3CAXA 5CI9A 5DS4A 1JPJA 3ECSA 3NYMA 3ABLC 2KSFA 3RQFA 1BR2A 2R9RB 4MNDA 3GM3A 3F47A 2FFHA 2ZPAA 2ZXWC 2GWWA 3OA1A 4BJ6C 4MTGA 2OKUA 3LJBA 4E7SA 1HMDA 2PFDA 4EWCA 1A7VA 3U8PA 2WB7A 3MBGA 4U5HA 3W4YA 1TFOB 2VCAA 4P9TA 3RIPA 1RJ9A 4NQFA 1ZHXA 4CBEA 3T6JA 2CCYA 2Y3GA 3F46A 3EGDA 3NKEA 2JD3A 4K1OA 5GPGB 3ZVRA 4BJTA 4MW8A 3B71A 4YL1A 1LI5A 4MVQA 3CSKA 4EKWA 2EIMC 4CS8A 4U5CE 3SXYA 1TWCA 2AWYA 1OKKA 3N24A 1R4TA 4XPWA 3AG3C 5TJ5E 4E18A 4JZAA 2J45A 1H9GA 4JEAA 3LEOA 1H7IA 4I44A 2PNOA 4XEKA 4DBRA 1V54C 2NSFA 4H4KC 1E83A 3H65A 3HTKC 3QVYA 5BQGA 3ZTMA 3HNIA 2ZXPA 1H6GA 3FVYA 3ZIBA 3WAQA 5F5HA 5L0FA 1A7EA 1D0XA 1NLXA 4XEVA 1SR2A 1ZZPA 3HJCA 3UMHA 4CS7A 1F1MA 2EPKX 1V4AA 2VCCA 1Z3IX 4AX2A 3A9CA 2BC5A 3M4CA 5KYYB 1OXKA 2XL8A 3NYLA 3O39A 1MMNA 2J7PD 1ZYRF 3DWWA 2EPOA 4J30B 1R5ID 4U5FE 3ZQVA 2OJQA 4PJMA 1DOWA 3I5QA 4BEMJ 3DMDA 3X1OA 4U5DE 1ORSC 1VK5A 4PFOA 1G5ZA 4PJJA 4Z9HA 1SYQA 4A2NB 2RSEB 2XL4A 2XLVA 3GEIA 4O79A 1E86A 1YYXA 2R7SA 4JC7A 3U5SA 1MQVA 3FXHA 3L34A 3WHNA 1PD1A 5EHHA 5B3IA 4LERA 3AGTA 4HE8D 3SP1A 1J8MF 1OCRC 2EPMX 2HFIA 3EGXA 4XLPF 3LLKA 1ZHTA 3I5PA 2L7AA 2YLIA 3UNGC 2M4EA 3IQ6A 1K40A 3S9OA 4CS9A 3W2VA 5L0DA 2H7BA 1QSPA 3E9VA 2R03A 3L1MA 4O6NA 2P7VA 4IRUA 1TFKB 4E0HA 1LI7A 5KYXA 5T3WA 5HV9A 1ZW2A 3GODA 2UUIA
chains in the Genus database with same CATH topology
3U2MA 4LDKA 3GWNA 1JRAA 3R7CA 3O55A 2HJ3A 3LLKA 4E0HA 3GWLA 3TD7A 3U2LA 3MBGA 1OQCA 3TK0A 4E0IA 3W4YA 3LLIA 1JR8A 3U5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2M A;  4LDK A;  3GWN A;  1JRA A;  3R7C A;  3O55 A;  2HJ3 A;  3LLK A;  4E0H A;  3GWL A;  3TD7 A;  3U2L A;  3MBG A;  1OQC A;  3TK0 A;  4E0I A;  3W4Y A;  3LLI A;  1JR8 A;  3U5S A; 
#chains in the Genus database with same CATH topology
 1RCP A;  1O3U A;  2HZ8 A;  3A11 A;  1L7C A;  1LVK A;  4CIH A;  2XLO A;  2WZL A;  3UGO A;  1EA8 A;  4UDV A;  3ZSU A;  1JOG A;  3EGD B;  3MLG A;  4D4N A;  1LE2 A;  4Q5S F;  4A4A A;  1T6I A;  2L9J A;  3JTL O;  3VM6 A;  3RH3 A;  5L0C A;  1RJ9 B;  1Z5Z A;  256B A;  1OCO C;  1XWJ A;  4PK4 A;  3B0U X;  4G7O F;  3BEH A;  5E3A A;  4MVS A;  3SNH A;  3V5X A;  5A69 A;  1I5N A;  3LS0 A;  1Z7Q c;  3V5Z A;  1M56 C;  3KYJ A;  1JMW A;  1ZU5 A;  2CNW A;  2Y39 A;  4JUR I;  4K7B A;  4LLE A;  4MVU A;  1ZU4 A;  3MYI A;  2EPN A;  5L0H A;  3M1C B;  5BQH A;  3O55 A;  1H9T A;  3MX3 A;  5B1B C;  3DE8 A;  2WVN A;  3U3F A;  1OR2 A;  2XLE A;  3ZTZ A;  5DVW A;  4RBN A;  2I15 A;  1UG7 A;  1SMY F;  2OCC C;  2Q9C A;  4X0R A;  1O87 A;  2HJ3 A;  3GWL A;  4PR9 A;  2G3K A;  3BRJ A;  1APC A;  1ZW3 A;  1J8Y F;  2H7V C;  3AJM A;  3DJN B;  1L3P A;  2C04 A;  2VB6 A;  4JJF A;  3J06 A;  1A0B A;  2KC3 A;  4QI0 A;  5L0G A;  1EKY A;  3QMK A;  3Q7L A;  2R7R A;  4PAC A;  3MFN A;  3O10 A;  4BPM A;  2W4B A;  4IGG A;  4WAB A;  1FFT C;  3EPV A;  1CGN A;  1D1C A;  1Z6A A;  3EH1 A;  4XEF A;  1D0Z A;  3K7D A;  2KNH A;  2YKZ A;  4NC3 A;  5DQT A;  2YQY A;  3DE9 A;  2J46 A;  3R2P A;  3RF3 A;  3TK0 A;  1NFN A;  3C8G A;  4RD9 A;  1T01 A;  2A0B A;  1RKC A;  3K6B A;  4G0H A;  4OIN F;  2R02 A;  2XM4 A;  3GEE A;  4GEH A;  4YT4 A;  5CIV A;  1NG1 A;  3B0V C;  3NRH A;  4H54 A;  3VAY A;  3VRC A;  2L81 A;  2FGY A;  2Q9A A;  1M6T A;  2W4M A;  2CDQ A;  1HE1 A;  2GAQ A;  4C3B A;  3JRT A;  1MMA A;  2P0N A;  2QNL A;  2Z15 A;  5A6K A;  1WOL A;  4ULV A;  1BDJ B;  1TWG A;  4OIO F;  2VH3 A;  4OD5 A;  4WGZ A;  1BZ4 A;  2XLD A;  2Y69 C;  1Q0M A;  3UR3 C;  5KYW A;  3W8I A;  3IEE A;  2XS8 A;  1M2O A;  2EIN C;  3KPH A;  2A68 F;  3QW0 A;  1FMW A;  4JJG A;  3PHF 2;  1YZA A;  1LE4 A;  1NSG B;  2Q4F A;  2UUH A;  5AGF A;  2OG2 A;  5A6B D;  3SZR A;  2B0J A;  2OU6 A;  1WAT A;  3ABK C;  2J0X A;  4U5E E;  2LFF A;  2J9V A;  2NPU A;  5EK0 A;  4XQ1 A;  5KYX B;  2NUP A;  4ER9 A;  4EBJ A;  3B9Q A;  3VF0 A;  1VTM P;  2H8A A;  3EG9 B;  3Q7G A;  4M63 A;  3S28 A;  2CGE A;  3DXJ F;  4AL1 A;  1QPU A;  3ABM C;  2KK1 A;  4DRH B;  3S90 A;  4MVM A;  1A41 A;  3DZA A;  5JP7 A;  1B68 A;  2A6H F;  1Q0F A;  1YA9 A;  1ZHY A;  1N1C A;  3AOU A;  3EJN A;  3IQC A;  4HFF B;  4E0I A;  3GM1 A;  4CIP A;  2X0C A;  3EGX B;  1I4Y A;  1LKX A;  1T6Q A;  2VCB A;  4KNV A;  3DM9 B;  3EHM A;  2YRF A;  2PBE A;  2ZXO A;  2HJM A;  1ST6 A;  3DJU B;  5CI8 A;  3EZH A;  2DYS C;  2HSQ A;  2G62 A;  3U9J A;  2IOQ A;  4DVY P;  4D4X A;  4ZLD A;  4WGY A;  3POV A;  4JTD B;  1HW1 A;  4NTA A;  3PMR A;  3H2V A;  3LES A;  2P1A A;  1RKE A;  3T6G B;  3L8I A;  3HNL A;  1CGO A;  1YA7 O;  1VMA A;  1FR0 A;  4FWV A;  4K0D A;  2L6H A;  3C63 A;  1C02 A;  1OKK D;  2CW0 F;  4JIO A;  1EI7 A;  2QUP A;  4GQH A;  4NTB A;  1Q0K A;  4XPY A;  1AVO B;  1XZQ A;  1TR2 A;  1TWH A;  3FOP A;  1YDI A;  3JT1 A;  4BJ5 A;  1WAS A;  1I4Z A;  4FES A;  5D91 A;  4J7T A;  4AE4 B;  3AG2 C;  1KNY A;  4CS9 C;  2LK4 A;  3Q6M A;  1E2X A;  3U3B A;  1NBB A;  3WG7 C;  3DKA A;  4ONS A;  2QTV A;  2MYS A;  2OEV A;  4YL0 A;  4OD4 A;  3U2L A;  1OQC A;  5L3V A;  3AG1 C;  2D4U A;  2P6V A;  3CEX A;  1HW2 A;  2OJE D;  1QLE C;  4N4W A;  2J0W A;  4O7G A;  2OOC A;  3ZC4 A;  2I8B A;  1OCZ C;  1SF8 A;  3UMK A;  2J9B A;  4C7O B;  1JPN A;  1E84 A;  2L6G A;  4YT5 A;  3RFY A;  2NSG A;  3S29 A;  2R7Q A;  2KYH A;  4XLN F;  2YL0 A;  4QI2 A;  3ASN C;  4DBQ A;  4YL3 A;  2CYD A;  2KGO A;  3EZI A;  3QW1 A;  4LDQ A;  1M57 C;  1FFH A;  1VYK A;  4C7O A;  3SXZ A;  2OEX A;  3V7O A;  4JCZ A;  2BL2 A;  5DS5 A;  3NKD A;  1FTS A;  1GM5 A;  1FAP B;  1Z23 A;  1M2V B;  2GA0 A;  2KW3 C;  2XLW A;  2YEV A;  1CPQ A;  2YL3 A;  5JT4 A;  2DB4 A;  2C03 A;  3AGU A;  2XXA A;  4OIP F;  3GWN A;  3LNR A;  4W8P A;  1Z63 A;  2FAP B;  3TUL A;  2R25 A;  5JUA A;  5AC4 A;  2R7O A;  3M79 A;  4LLC A;  1TWA A;  2E87 A;  3H2U A;  1OW7 A;  4NTF A;  2DI3 A;  4ULW A;  3LEV A;  3X2Q C;  5JSL A;  2W9Y A;  1S05 A;  4DVZ A;  3SXK A;  4XWJ A;  5A6J A;  1YAR O;  1QVX A;  2R05 A;  2GDC A;  1UFB A;  1VLT A;  3DI5 A;  3B0P A;  1RXQ A;  2WVO A;  4YN0 B;  1QZX A;  2G3V A;  4AL0 A;  4EUK B;  1KTM A;  1G8X A;  1E85 A;  2X51 A;  5L0I A;  2PX3 A;  4FAP B;  5COF A;  5COG A;  2A0U A;  1TQG A;  1TKN A;  2DYR C;  1G4W R;  4YJW A;  3DD7 A;  3AQC A;  2MHR A;  3EFO A;  1U89 A;  4EHP A;  2W45 A;  4MQ9 F;  4DRJ B;  3ATP A;  2XS1 A;  3TD7 A;  1CGM E;  3KMI A;  2IYL D;  2Q9B A;  2V26 A;  3AQB A;  1K04 A;  3B29 A;  3G4Z A;  1T9K A;  3QTH A;  3FOO A;  2WL8 A;  4I1O B;  4E17 A;  3T4R A;  4I3M A;  2YLG A;  5FZT A;  3E70 C;  3U9M A;  3O6X A;  2HUJ A;  4QDL A;  1IZM A;  2JPU A;  1VLS A;  3QVZ A;  4U9D A;  1ZHZ A;  2PP4 A;  1QKR A;  2WZG A;  4JW1 A;  4G7Z F;  4Z9I A;  1KU2 A;  1YAU O;  1HE9 A;  1YLM A;  2ZD9 A;  4OIR F;  3UGP A;  1U0B B;  3TOL A;  2XLH A;  3TOM A;  3HKK A;  4MVZ A;  2A6E F;  3U2M A;  1OR3 A;  2EPL X;  4EBK A;  1ZHW A;  2YL7 A;  1LM3 B;  3I4U A;  1XZP A;  2YWA A;  4JEB A;  1YVI A;  2HS5 A;  3L8J A;  2NUT A;  5JVE A;  1D0Y A;  2HMQ A;  4XTK A;  3RW0 A;  1MNE A;  4BJ6 A;  5BUO A;  4C3E A;  1BR4 A;  4AE4 A;  2LP4 A;  2R7X A;  2IXO A;  1K05 A;  4IWB A;  5IY5 C;  3GEH A;  4AK9 A;  3M15 A;  2NG1 A;  1NZE A;  4DXW A;  1FNT c;  3LNM B;  3FAJ A;  3NMI A;  1C03 A;  1VB5 A;  3C7J A;  4OIQ F;  2J9W A;  1YJG A;  2RD9 A;  4YT2 A;  2Y3B A;  4FX5 A;  3GM2 A;  1GGQ A;  3JZ0 A;  2OQM A;  2Y3D A;  2TMV P;  1OW6 A;  4B6I A;  5KYY A;  2BE5 F;  5T3T A;  3LLI A;  2KQ9 A;  3C62 A;  3U8V A;  4CS8 C;  4CX9 A;  3GAN A;  2WZF A;  4IAR A;  3WOD F;  5B1A C;  2IXN A;  5JS5 A;  4G78 A;  2O9X A;  4LAC B;  1IW7 F;  4JTC B;  4YWQ A;  2QLA A;  4P6I C;  4ANJ A;  2IXP A;  2XXA B;  3IQ5 A;  2Q7R A;  4P9F A;  4EBB A;  3GOR A;  2VAS A;  4JRZ A;  5B3S C;  4R32 A;  2LCH A;  4YK5 A;  2XM0 A;  3US6 A;  4EIY A;  1M2V A;  3PCV A;  4CDA A;  3KL4 A;  3N2Z B;  4KC9 A;  3EG9 A;  4DRI B;  5HSW A;  4N6H A;  4RDA A;  5KYU B;  5L3Q A;  3QZC A;  2J7P A;  4DJ9 A;  3K1I A;  4MS2 A;  2R7W A;  5AC5 A;  2B0H A;  3Q6N A;  5D92 A;  1YZC A;  2Y3H A;  2M64 A;  4F4B A;  3K1H A;  3FMS A;  2YZS A;  3U0C A;  1RMV A;  2MWQ A;  3G50 A;  4NY3 A;  3K66 A;  4E7Z A;  5JRA A;  3NDB B;  3OWT A;  2PX0 A;  2CNW D;  2J8W A;  2JX0 A;  3JSZ A;  3C8G D;  4L6R A;  1U6H A;  3AG4 C;  2LIG A;  1OCC C;  3NYJ A;  4IAQ A;  4LDR A;  5K0I A;  2AU5 A;  3JSE O;  1CPR A;  4J32 B;  3S84 A;  1ORY A;  1D1B A;  3TJ6 A;  5EGY A;  1WTY A;  2GFH A;  3S27 A;  1VOM A;  4CJG A;  5DQZ A;  1LIH A;  3RKO F;  4U5B E;  1BBH A;  4U9E A;  1GS9 A;  1A7D A;  3NMJ A;  1GQA A;  3CZ6 A;  5E2Q A;  2LD6 A;  1MMG A;  4ZLC A;  3IHU A;  4BJ5 C;  1LPE A;  3HLZ A;  5COM A;  1JRA A;  3C8G B;  3HNJ A;  4N6C A;  4C3D A;  2V3C C;  5KYU A;  4GYT A;  3LAY A;  3W8H A;  2P61 A;  2A69 F;  3K33 A;  5F28 E;  3ZWI A;  1JAF A;  3FAP B;  2Q00 A;  4MVR A;  3RQG A;  3EH2 A;  3PDM P;  4I1M A;  3JRM O;  2R7V A;  1C17 M;  3TJ5 A;  2IXM A;  3NMK A;  1RKE B;  3ZG1 A;  4YT8 A;  1HMO A;  3T6B A;  2LFD A;  3LUT B;  2A1D D;  3KYI A;  4Z9J A;  1LS4 A;  3ASO C;  5E3C A;  1DOV A;  1NFO A;  1YYJ A;  4PFP A;  1V55 C;  1PV3 A;  3C18 A;  4PJL A;  4PJN A;  1EQ1 A;  2EIK C;  3V5Y A;  1JR8 A;  1PCX A;  2EIJ C;  2IM8 A;  5JLI A;  3EHN A;  2R7T A;  4O6M A;  4KBL A;  4JTA B;  5T1D B;  4HFK B;  1O5H A;  2LSE A;  2R7U A;  2ICW G;  4IJJ A;  1PD0 A;  1WWP A;  3LS1 A;  4CDV A;  1G4U S;  2ASR A;  3IPM O;  4DOZ A;  1SZI A;  1Q0D A;  1D1A A;  3TQO A;  3KKB A;  5DLJ A;  3RVZ A;  4G7H F;  5KYN A;  2QE9 A;  4LDK A;  3N0T A;  4U5G A;  2AVK A;  2EIL C;  3SXM A;  3L0I A;  4KI2 A;  4HEA J;  1MMD A;  3ZQY A;  4IAO A;  2J9U A;  4CDY A;  4MTO A;  1NU9 C;  1V74 B;  2YVK A;  1MND A;  4IB4 A;  4JKV A;  4J7Y A;  2L6F A;  5FCL A;  1OXB A;  2AP3 A;  2D5R B;  4N06 A;  3W2W A;  3CQZ A;  4Q4Z F;  3JYY A;  2AWC A;  1BR1 A;  4JE9 A;  4XPX A;  1AUE A;  4JCH A;  1VYI A;  2NUT B;  4BG0 A;  1S7Z A;  1Y6D A;  2XRH A;  3K1I C;  2KJG A;  4JVS A;  3T9O A;  5DS6 A;  5BQI A;  4O6Y A;  2WVQ A;  1W2W A;  5L0J A;  3R7C A;  4BEJ A;  1NU7 D;  2HV6 A;  2XL6 A;  5F5F A;  2HV7 A;  5A6A A;  2F22 A;  2YHS A;  3FHD A;  3IQT A;  2PF4 E;  2QY9 A;  3G4X A;  3HNK A;  3RQE A;  2HMZ A;  2NUP B;  3OEO A;  1OW8 A;  2YL1 A;  1Q0G A;  3SEO A;  3SYN A;  4BJ1 A;  3EQL F;  2ETS A;  3JYH A;  5E33 A;  1WGW A;  2HSB A;  3RVY A;  1T5O A;  1WN0 A;  1QQ3 A;  4CJO A;  4WJ0 A;  3UMI A;  4Q7C A;  4KNW A;  3MYF A;  3M4B A;  3RYL A;  3ZDL A;  5KYW B;  3S0X A;  2HKV A;  1ORJ A;  3EFO B;  2LQG A;  2DGJ A;  2XSE A;  3VYW A;  4MW3 A;  2VC9 A;  4CSA C;  5A6B A;  4MTF A;  2ZXR A;  3C8Z A;  4NCQ A;  3DAF A;  3KH2 A;  4MVO A;  1HY5 A;  3JCU Q;  3FDQ A;  2Q3T A;  1Y4C A;  3NG1 A;  2H7O A;  2IBF A;  3ITF A;  1T6U A;  3DM5 A;  4W8K A;  2XLM A;  3DAG A;  4CSA A;  2YLD A;  1FMV A;  1ZVZ A;  1AEP A;  1LS1 A;  3CAX A;  5CI9 A;  5DS4 A;  1JPJ A;  3ECS A;  3NYM A;  3ABL C;  2KSF A;  3RQF A;  1BR2 A;  2R9R B;  4MND A;  3GM3 A;  3F47 A;  2FFH A;  2ZPA A;  2ZXW C;  2GWW A;  3OA1 A;  4BJ6 C;  4MTG A;  2OKU A;  3LJB A;  4E7S A;  1HMD A;  2PFD A;  4EWC A;  1A7V A;  3U8P A;  2WB7 A;  3MBG A;  4U5H A;  3W4Y A;  1TFO B;  2VCA A;  4P9T A;  3RIP A;  1RJ9 A;  4NQF A;  1ZHX A;  4CBE A;  3T6J A;  2CCY A;  2Y3G A;  3F46 A;  3EGD A;  3NKE A;  2JD3 A;  4K1O A;  5GPG B;  3ZVR A;  4BJT A;  4MW8 A;  3B71 A;  4YL1 A;  1LI5 A;  4MVQ A;  3CSK A;  4EKW A;  2EIM C;  4CS8 A;  4U5C E;  3SXY A;  1TWC A;  2AWY A;  1OKK A;  3N24 A;  1R4T A;  4XPW A;  3AG3 C;  5TJ5 E;  4E18 A;  4JZA A;  2J45 A;  1H9G A;  4JEA A;  3LEO A;  1H7I A;  4I44 A;  2PNO A;  4XEK A;  4DBR A;  1V54 C;  2NSF A;  4H4K C;  1E83 A;  3H65 A;  3HTK C;  3QVY A;  5BQG A;  3ZTM A;  3HNI A;  2ZXP A;  1H6G A;  3FVY A;  3ZIB A;  3WAQ A;  5F5H A;  5L0F A;  1A7E A;  1D0X A;  1NLX A;  4XEV A;  1SR2 A;  1ZZP A;  3HJC A;  3UMH A;  4CS7 A;  1F1M A;  2EPK X;  1V4A A;  2VCC A;  1Z3I X;  4AX2 A;  3A9C A;  2BC5 A;  3M4C A;  5KYY B;  1OXK A;  2XL8 A;  3NYL A;  3O39 A;  1MMN A;  2J7P D;  1ZYR F;  3DWW A;  2EPO A;  4J30 B;  1R5I D;  4U5F E;  3ZQV A;  2OJQ A;  4PJM A;  1DOW A;  3I5Q A;  4BEM J;  3DMD A;  3X1O A;  4U5D E;  1ORS C;  1VK5 A;  4PFO A;  1G5Z A;  4PJJ A;  4Z9H A;  1SYQ A;  4A2N B;  2RSE B;  2XL4 A;  2XLV A;  3GEI A;  4O79 A;  1E86 A;  1YYX A;  2R7S A;  4JC7 A;  3U5S A;  1MQV A;  3FXH A;  3L34 A;  3WHN A;  1PD1 A;  5EHH A;  5B3I A;  4LER A;  3AGT A;  4HE8 D;  3SP1 A;  1J8M F;  1OCR C;  2EPM X;  2HFI A;  3EGX A;  4XLP F;  3LLK A;  1ZHT A;  3I5P A;  2L7A A;  2YLI A;  3UNG C;  2M4E A;  3IQ6 A;  1K40 A;  3S9O A;  4CS9 A;  3W2V A;  5L0D A;  2H7B A;  1QSP A;  3E9V A;  2R03 A;  3L1M A;  4O6N A;  2P7V A;  4IRU A;  1TFK B;  4E0H A;  1LI7 A;  5KYX A;  5T3W A;  5HV9 A;  1ZW2 A;  3GOD A;  2UUI A; 
#chains in the Genus database with same CATH homology
 3U2M A;  4LDK A;  3GWN A;  1JRA A;  3R7C A;  3O55 A;  2HJ3 A;  3LLK A;  4E0H A;  3GWL A;  3TD7 A;  3U2L A;  3MBG A;  1OQC A;  3TK0 A;  4E0I A;  3W4Y A;  3LLI A;  1JR8 A;  3U5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...