3GWNA

Crystal structure of the fad binding domain from mimivirus sulfhydryl oxidase r596
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
113
structure length
113
Chain Sequence
ANGLITKIWGTAGWTFNHAVTFGYPLNPTSDDKRRYKNYFISLGDVLPCRLCRESYKKFITTGKTALTNEVLRNRHTLTKWFYDVHNAVNNKLEVDYGLSYEDVVNKYESFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable FAD-linked sulfhydryl oxidase R596
publication title Dimer interface migration in a viral sulfhydryl oxidase
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Oxidoreductase
total genus 46
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3gwnA00
3LLIA 3TK0A 1JRAA 4E0HA 3O55A 1OQCA 2HJ3A 3R7CA 3MBGA 3LLKA 3GWNA 3W4YA 3TD7A 3U2MA 3GWLA 3U2LA 4LDKA 1JR8A 3U5SA 4E0IA
chains in the Genus database with same CATH superfamily
1DOWA 5DQTA 1Z5ZA 4O6MA 3AQCA 5BUOA 2KC3A 4H4KC 2R7RA 2TMVP 3H2VA 1ZHTA 2H7VC 3RIPA 3GODA 4K7BA 3ZQVA 2GA0A 2NSFA 5L0GA 2X0CA 1TQGA 2XL8A 2Y3GA 3CAXA 3DAFA 4XWJA 5COGA 2KW3C 3ZQYA 5B3IA 2PFDA 4U9DA 5AC5A 1H6GA 3V5YA 4IGGA 3M15A 2PF4E 3TQOA 4OIRF 4G7HF 4JEAA 3HJCA 2EIJC 2UUHA 2QNLA 3L8JA 4I1MA 2AP3A 3F46A 3VRCA 5KYXA 4OIPF 3EGXB 2R7TA 1ZW3A 4NC3A 3AGUA 4JVSA 3B0PA 3EZIA 4IB4A 3TOLA 2ZXWC 3U5SA 2HJMA 2XSEA 4KC9A 2YVKA 4BJ6A 1RXQA 2IBFA 3IQ5A 1FMVA 1HMDA 2IOQA 2KYHA 1UFBA 2QTVA 2DGJA 3LESA 3OWTA 4U5GA 5E33A 3U9MA 5L0HA 1E84A 1D0YA 3S0XA 2BL2A 3QVZA 1B68A 4QI2A 3LLKA 1ZW2A 2R7XA 4YT4A 2O9XA 2UUIA 3I5PA 3TOMA 5EK0A 1GGQA 1NFNA 2OJQA 4DOZA 3ZVRA 3HNJA 4ULWA 5E3AA 1YZCA 2KQ9A 2VCBA 2C04A 3FOPA 4RD9A 2HKVA 3RKOF 4WGYA 4GYTA 3U2MA 1ZYRF 2B0HA 2EPKX 1T9KA 2G3KA 3H65A 5F5HA 5HSWA 2PBEA 3ABMC 4N6HA 2Y39A 3G4ZA 1G4WR 3B29A 4PJLA 1SF8A 4WJ0A 3MYFA 4YL0A 4E0IA 1JOGA 1JPNA 1ORJA 3HNLA 5D92A 4JZAA 2F22A 4H54A 4XTKA 5A69A 4MTOA 4D4NA 1V4AA 3Q7LA 4PJNA 1UG7A 4AL0A 2AWCA 2YL0A 1SMYF 3OEOA 4XQ1A 5KYUA 2LK4A 1CPQA 2LFFA 2R02A 4I44A 4YK5A 1FMWA 4BJ1A 2R05A 3O10A 4CBEA 3AG4C 3BEHA 2J9WA 3IQTA 4C3DA 4EKWA 4MVQA 1K04A 3LEOA 5COFA 1QVXA 2WB7A 3C18A 3TULA 2XLEA 4BEMJ 2M64A 4A4AA 1ZVZA 4IRUA 2A68F 2OG2A 3MFNA 4JJGA 4XPWA 1TFOB 4U5HA 4EIYA 2XS1A 3N2ZB 4K1OA 3C8GA 3ITFA 4MVOA 5E3CA 1WOLA 1PCXA 1FFTC 2P0NA 5T3WA 3FDQA 4O6YA 4NTAA 1WATA 1VYKA 3DAGA 2Q3TA 1LS1A 1OCOC 2YWAA 2JX0A 2D4UA 1ORSC 4MVUA 4EHPA 4PR9A 2CW0F 4U9EA 4YN0B 2R7QA 2J7PD 3SXZA 3ZWIA 2DYSC 2LD6A 2YQYA 2XLOA 4PJJA 2A0UA 4JJFA 4XLPF 3MYIA 1YJGA 2H7OA 3MX3A 2J9BA 5KYNA 4MTGA 1YYJA 5A6BD 3N0TA 1IZMA 1E85A 2YEVA 2QUPA 3DXJF 3DZAA 3FAPB 5FCLA 3HKKA 2L6GA 3EFOB 5T1DB 3JSZA 3WHNA 4AL1A 1Z23A 1ZZPA 4DRIB 1YARO 2KJGA 4C7OA 2A69F 2PNOA 1LM3B 2XLHA 4AK9A 1OXKA 4BG0A 4DJ9A 1WN0A 5AGFA 1E83A 4WABA 1Q0DA 3Q6MA 3FVYA 4KNVA 3C63A 3HTKC 2VASA 3KKBA 2R03A 2CYDA 2BE5F 3C8GB 3RFYA 1RMVA 2GAQA 2Y3DA 2Q9AA 1GM5A 1OKKD 3PMRA 3NMKA 1XZQA 5D91A 1V74B 3U3BA 3GM3A 3IQ6A 3GORA 4U5EE 3RVZA 4HFKB 1W2WA 3GEIA 1O5HA 3A9CA 3TJ6A 3LEVA 4MVZA 4CS9C 5L0CA 3RYLA 3TJ5A 4BJ6C 3UMKA 3T6JA 2KGOA 1YDIA 1NFOA 1YLMA 1ZHYA 2ZD9A 3AJMA 4MW8A 1M56C 2FGYA 5EHHA 1D0ZA 4EBJA 1BZ4A 2MHRA 5A6JA 3AQBA 1A41A 2H8AA 4E7SA 4FWVA 3U3FA 3Q6NA 4JKVA 3LNMB 5FZTA 4Z9IA 2IXNA 3W8IA 1YYXA 1BR4A 2Y3HA 4YL3A 1MQVA 1RJ9A 4J7YA 4JTCB 2OU6A 4W8KA 3NMJA 2L7AA 5DVWA 3QMKA 4LDQA 3S9OA 3SXMA 1TR2A 4CDYA 4B6IA 2Q00A 4YT2A 4ZLCA 3DE9A 3I5QA 1EA8A 4CDVA 4ONSA 3FAJA 2HV6A 4N06A 3M4CA 4NY3A 3GWLA 4C7OB 4AE4A 4MTFA 1MNDA 3T4RA 1FR0A 2G62A 1TFKB 4KNWA 4E7ZA 5K0IA 2J9VA 1MNEA 1JAFA 2G3VA 4JE9A 4HEAJ 4DXWA 4CS9A 1LE2A 1T5OA 3H2UA 1O3UA 2XL4A 1I5NA 3M4BA 4N4WA 2PX0A 1OW8A 3KYIA 3ZSUA 1ST6A 2J8WA 1WASA 3F47A 3LUTB 3NYLA 4NCQA 2AWYA 2HFIA 4IJJA 3S84A 2X51A 2CNWA 2W4MA 4NQFA 3NMIA 3KYJA 3W8HA 1BBHA 3EG9A 2YHSA 1R5ID 2V3CC 3ZIBA 2OEVA 3O6XA 2ETSA 3OA1A 3RQEA 3PCVA 2LFDA 4JW1A 3ZC4A 3DE8A 4PJMA 2Q7RA 4JC7A 1J8YF 3GM1A 2E87A 4R32A 5DS6A 1LIHA 2EIMC 1GS9A 2CGEA 5L0FA 3DJUB 1APCA 1GQAA 4ZLDA 1LI7A 1NSGB 1M2VA 1RJ9B 1VK5A 2ZXPA 4DRHB 2B0JA 4XPYA 2YL1A 4O6NA 4HE8D 1OW6A 3T9OA 2LCHA 1H9TA 2YLGA 2LIGA 2D5RB 1I4ZA 3QW0A 3PDMP 4CDAA 4JTAB 1PD1A 1VYIA 2W9YA 3JT1A 3GM2A 4CJOA 1OW7A 2J45A 2IXOA 4U5CE 5L0IA 1LS4A 5KYXB 5GPGB 2QE9A 1K05A 1ZHXA 3MLGA 5A6AA 3U0CA 1VLTA 3ASNC 3UGOA 2W45A 4P9TA 2KK1A 3X1OA 1XWJA 3RH3A 3EPVA 3JRTA 2IM8A 4P9FA 3S28A 3K33A 2P1AA 5JLIA 4BJ5C 3IQCA 3O39A 3ATPA 3M79A 3GEHA 1FNTc 5EGYA 2R7SA 1NU9C 2VCCA 5CI9A 3U8VA 1ZU5A 1OCZC 4BEJA 3G50A 5KYYA 2EPLX 2Q9BA 4UDVA 3IEEA 2HMQA 4LLCA 4MW3A 5JP7A 2XLWA 4JCZA 4JTDB 4NTBA 4XEKA 4LDRA 4BJTA 3EH1A 1JMWA 4CX9A 2EINC 1VLSA 2DI3A 5JUAA 2XLMA 2ASRA 3VAYA 4Z9JA 1Y4CA 1YVIA 5CI8A 2J7PA 4JRZA 4PK4A 4RDAA 1D1CA 5BQGA 4EUKB 4D4XA 3NRHA 2Q9CA 3FXHA 4LERA 4J32B 4OIOF 2LP4A 1G4US 3U2LA 2HZ8A 4MQ9F 1YZAA 2FAPB 3KH2A 3UNGC 4CS8A 5A6BA 1C17M 2L6HA 2YKZA 2RD9A 3KMIA 4BJ5A 3C8GD 3K1IA 3X2QC 4CIHA 3FOOA 1V55C 4OIQF 1NU7D 5KYUB 3JRMO 4N6CA 4J7TA 3DM5A 3V7OA 2R7UA 1IW7F 3O55A 5CIVA 2XRHA 2VC9A 5KYWA 2YLIA 2OEXA 3DD7A 2QY9A 3LS1A 4P6IC 2IYLD 1LVKA 3EH2A 4EWCA 1L3PA 1F1MA 2MYSA 4G78A 2CDQA 3K1HA 3NYMA 4K0DA 4Z9HA 1U0BB 3LS0A 1OR3A 1MMDA 3AG1C 2EIKC 3GWNA 3R2PA 2AVKA 1G8XA 5KYYB 4CSAC 1U6HA 1BDJB 3NYJA 4ULVA 4E17A 4OD4A 2IXMA 3C7JA 1ORYA 2HMZA 2HS5A 3IHUA 3QZCA 1LI5A 4XLNF 3SYNA 4BPMA 2A0BA 5DS5A 5JSLA 3GEEA 4AX2A 4E18A 3CZ6A 1YA9A 3EGDA 4EBKA 3JYYA 2VB6A 3SXKA 3LLIA 4QI0A 1T6IA 2OKUA 1Z6AA 3L1MA 3VM6A 2DB4A 1HW2A 1AVOB 3JCUQ 2NUTA 1TWHA 1OXBA 5DQZA 5A6KA 1OQCA 1PD0A 5B1BC 4FAPB 1WTYA 3QW1A 1Q0FA 2HJ3A 5L3VA 3ASOC 2YL7A 3SEOA 5L3QA 3EJNA 1RKEA 4KI2A 2XXAA 1Q0KA 1C02A 1NBBA 1TWCA 4O7GA 4Q4ZF 2XLVA 3Q7GA 1QZXA 1BR2A 4QDLA 4YT8A 3C62A 1QSPA 4CSAA 5B3SC 1QQ3A 3HNKA 2EILC 2W4BA 5KYWB 256BA 3S90A 3WG7C 1JR8A 3L8IA 1HY5A 2HSBA 2XLDA 5JRAA 4U5BE 3FHDA 5IY5C 4IAOA 3ECSA 1K40A 3S27A 3L0IA 5L0JA 3TK0A 3U8PA 3B0VC 3V5ZA 3ZTZA 1Z3IX 5F5FA 4OINF 2H7BA 3JYHA 2NPUA 2XM4A 3ABKC 1A7EA 1KTMA 2WZFA 1NZEA 3K66A 1YA7O 1G5ZA 1C03A 3R7CA 3ZDLA 2WVOA 2EPOA 1EKYA 2XM0A 2I8BA 2R7VA 2ZXRA 3M1CB 3SP1A 2LSEA 1VOMA 4LACB 3RQFA 4G0HA 3EGDB 2OQMA 3JZ0A 3KPHA 3U9JA 3T6GB 2VCAA 1D1BA 2J9UA 1HW1A 5BQIA 3RF3A 5HV9A 3S29A 1KNYA 4G7ZF 1T01A 1T6UA 2NUTB 2I15A 3DKAA 4I3MA 2V26A 4MVSA 1VMAA 2Q4FA 3RQGA 3ABLC 3SNHA 1RKEB 2AU5A 2XXAB 2FFHA 5L0DA 4FESA 4Q7CA 1SYQA 1JRAA 4J30B 1JPJA 4M63A 3A11A 5E2QA 3DI5A 1OCRC 1D0XA 3E70C 2R7WA 4OD5A 1ZHZA 2PX3A 4Q5SF 1VB5A 1BR1A 2DYRC 1M6TA 1A7VA 2CNWD 2NUPA 4XEVA 2KSFA 3MBGA 1A7DA 3NDBB 1HE1A 4AE4B 1MMAA 1AEPA 3NKDA 1O87A 3AGTA 1ZU4A 1FFHA 3IPMO 3T6BA 1DOVA 3SZRA 3G4XA 3TD7A 3B9QA 4DVZA 2R25A 4CS8C 1QPUA 2OCCC 4F4BA 1Y6DA 2NSGA 2NG1A 3EQLF 3NKEA 3QTHA 4LLEA 5B1AC 4A2NB 3PHF2 1T6QA 4IWBA 2R9RB 2P7VA 2A6EF 3K1IC 3HLZA 3KL4A 3LAYA 4U5DE 2Y3BA 4GEHA 4CJGA 1CGOA 4CIPA 2ZXOA 3EG9B 4MS2A 1OCCC 4EBBA 2WZGA 3FMSA 4E0HA 3W2VA 1NG1A 1NLXA 2JPUA 1V54C 3B0UX 2ZPAA 2JD3A 3VF0A 2J0XA 1D1AA 3WAQA 2YLDA 3CSKA 2RSEB 2R7OA 3EFOA 3DJNB 3LNRA 2YL3A 1S05A 4GQHA 1KU2A 3RW0A 4ER9A 1Z63A 1OR2A 3WODF 2EPMX 4I1OB 3N24A 4NTFA 3EHMA 4YT5A 3UMIA 3AOUA 1M2VB 1I4YA 2KNHA 3DM9B 4DBRA 2WL8A 2C03A 1S7ZA 3EHNA 2VH3A 3K6BA 1M57C 4JEBA 3UMHA 5AC4A 5DS4A 1FAPB 5TJ5E 3AG3C 1TWGA 1AUEA 1M2OA 2NUPB 2GDCA 2HV7A 3JSEO 4IARA 2Y69C 4JURI 4DVYP 3CEXA 2MWQA 2ICWG 1E86A 2XL6A 1QKRA 1MMNA 1ZHWA 4MVRA 2HUJA 2YRFA 3SXYA 5BQHA 2PP4A 2YZSA 3AG2C 4YJWA 2WVQA 1PV3A 3HNIA 3L34A 2J0WA 1XZPA 2A6HF 3US6A 3LJBA 3W2WA 4L6RA 3I4UA 3RVYA 5JS5A 1Q0GA 1L7CA 3K7DA 4DRJB 3VYWA 2LQGA 2P61A 4JIOA 4U5FE 4C3EA 2OOCA 4X0RA 2XS8A 1Z7Qc 1Q0MA 4PFPA 2EPNA 1SR2A 3J06A 3B71A 4XPXA 2Z15A 4YWQA 1CPRA 1MMGA 2A1DD 4FX5A 2QLAA 2L9JA 3W4YA 2P6VA 1HMOA 1OKKA 1RCPA 1SZIA 4JCHA 4MVMA 2WZLA 4IAQA 4RBNA 3C8ZA 3CQZA 4YL1A 1J8MF 5DLJA 1EQ1A 2L81A 1R4TA 3BRJA 2L6FA 2GFHA 1H9GA 3E9VA 4ANJA 3QVYA 3ZG1A 3DWWA 4C3BA 2J46A 3DMDA 3GANA 3UR3C 4WGZA 2CCYA 2HSQA 3EGXA 2OJED 3POVA 3ZTMA 1H7IA 1HE9A 4XEFA 4PFOA 1N1CA 2BC5A 1WGWA 4KBLA 4CS7A 1LPEA 3JTLO 3V5XA 1CGME 1VTMP 4HFFB 4PACA 4MNDA 1A0BA 1TWAA 2IXPA 1YAUO 1E2XA 2M4EA 1RKCA 4DBQA 4G7OF 4O79A 3UGPA 5JT4A 5T3TA 3NG1A 1WWPA 2WVNA 5COMA 4LDKA 1LE4A 1EI7A 1FTSA 1LKXA 1TKNA 5F28E 3EZHA 5JVEA 2GWWA 1QLEC 1CGNA 4W8PA 1U89A
chains in the Genus database with same CATH topology
3LLIA 3TK0A 1JRAA 4E0HA 3O55A 1OQCA 2HJ3A 3R7CA 3MBGA 3LLKA 3GWNA 3W4YA 3TD7A 3U2MA 3GWLA 3U2LA 4LDKA 1JR8A 3U5SA 4E0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLI A;  3TK0 A;  1JRA A;  4E0H A;  3O55 A;  1OQC A;  2HJ3 A;  3R7C A;  3MBG A;  3LLK A;  3GWN A;  3W4Y A;  3TD7 A;  3U2M A;  3GWL A;  3U2L A;  4LDK A;  1JR8 A;  3U5S A;  4E0I A; 
#chains in the Genus database with same CATH topology
 1DOW A;  5DQT A;  1Z5Z A;  4O6M A;  3AQC A;  5BUO A;  2KC3 A;  4H4K C;  2R7R A;  2TMV P;  3H2V A;  1ZHT A;  2H7V C;  3RIP A;  3GOD A;  4K7B A;  3ZQV A;  2GA0 A;  2NSF A;  5L0G A;  2X0C A;  1TQG A;  2XL8 A;  2Y3G A;  3CAX A;  3DAF A;  4XWJ A;  5COG A;  2KW3 C;  3ZQY A;  5B3I A;  2PFD A;  4U9D A;  5AC5 A;  1H6G A;  3V5Y A;  4IGG A;  3M15 A;  2PF4 E;  3TQO A;  4OIR F;  4G7H F;  4JEA A;  3HJC A;  2EIJ C;  2UUH A;  2QNL A;  3L8J A;  4I1M A;  2AP3 A;  3F46 A;  3VRC A;  5KYX A;  4OIP F;  3EGX B;  2R7T A;  1ZW3 A;  4NC3 A;  3AGU A;  4JVS A;  3B0P A;  3EZI A;  4IB4 A;  3TOL A;  2ZXW C;  3U5S A;  2HJM A;  2XSE A;  4KC9 A;  2YVK A;  4BJ6 A;  1RXQ A;  2IBF A;  3IQ5 A;  1FMV A;  1HMD A;  2IOQ A;  2KYH A;  1UFB A;  2QTV A;  2DGJ A;  3LES A;  3OWT A;  4U5G A;  5E33 A;  3U9M A;  5L0H A;  1E84 A;  1D0Y A;  3S0X A;  2BL2 A;  3QVZ A;  1B68 A;  4QI2 A;  3LLK A;  1ZW2 A;  2R7X A;  4YT4 A;  2O9X A;  2UUI A;  3I5P A;  3TOM A;  5EK0 A;  1GGQ A;  1NFN A;  2OJQ A;  4DOZ A;  3ZVR A;  3HNJ A;  4ULW A;  5E3A A;  1YZC A;  2KQ9 A;  2VCB A;  2C04 A;  3FOP A;  4RD9 A;  2HKV A;  3RKO F;  4WGY A;  4GYT A;  3U2M A;  1ZYR F;  2B0H A;  2EPK X;  1T9K A;  2G3K A;  3H65 A;  5F5H A;  5HSW A;  2PBE A;  3ABM C;  4N6H A;  2Y39 A;  3G4Z A;  1G4W R;  3B29 A;  4PJL A;  1SF8 A;  4WJ0 A;  3MYF A;  4YL0 A;  4E0I A;  1JOG A;  1JPN A;  1ORJ A;  3HNL A;  5D92 A;  4JZA A;  2F22 A;  4H54 A;  4XTK A;  5A69 A;  4MTO A;  4D4N A;  1V4A A;  3Q7L A;  4PJN A;  1UG7 A;  4AL0 A;  2AWC A;  2YL0 A;  1SMY F;  3OEO A;  4XQ1 A;  5KYU A;  2LK4 A;  1CPQ A;  2LFF A;  2R02 A;  4I44 A;  4YK5 A;  1FMW A;  4BJ1 A;  2R05 A;  3O10 A;  4CBE A;  3AG4 C;  3BEH A;  2J9W A;  3IQT A;  4C3D A;  4EKW A;  4MVQ A;  1K04 A;  3LEO A;  5COF A;  1QVX A;  2WB7 A;  3C18 A;  3TUL A;  2XLE A;  4BEM J;  2M64 A;  4A4A A;  1ZVZ A;  4IRU A;  2A68 F;  2OG2 A;  3MFN A;  4JJG A;  4XPW A;  1TFO B;  4U5H A;  4EIY A;  2XS1 A;  3N2Z B;  4K1O A;  3C8G A;  3ITF A;  4MVO A;  5E3C A;  1WOL A;  1PCX A;  1FFT C;  2P0N A;  5T3W A;  3FDQ A;  4O6Y A;  4NTA A;  1WAT A;  1VYK A;  3DAG A;  2Q3T A;  1LS1 A;  1OCO C;  2YWA A;  2JX0 A;  2D4U A;  1ORS C;  4MVU A;  4EHP A;  4PR9 A;  2CW0 F;  4U9E A;  4YN0 B;  2R7Q A;  2J7P D;  3SXZ A;  3ZWI A;  2DYS C;  2LD6 A;  2YQY A;  2XLO A;  4PJJ A;  2A0U A;  4JJF A;  4XLP F;  3MYI A;  1YJG A;  2H7O A;  3MX3 A;  2J9B A;  5KYN A;  4MTG A;  1YYJ A;  5A6B D;  3N0T A;  1IZM A;  1E85 A;  2YEV A;  2QUP A;  3DXJ F;  3DZA A;  3FAP B;  5FCL A;  3HKK A;  2L6G A;  3EFO B;  5T1D B;  3JSZ A;  3WHN A;  4AL1 A;  1Z23 A;  1ZZP A;  4DRI B;  1YAR O;  2KJG A;  4C7O A;  2A69 F;  2PNO A;  1LM3 B;  2XLH A;  4AK9 A;  1OXK A;  4BG0 A;  4DJ9 A;  1WN0 A;  5AGF A;  1E83 A;  4WAB A;  1Q0D A;  3Q6M A;  3FVY A;  4KNV A;  3C63 A;  3HTK C;  2VAS A;  3KKB A;  2R03 A;  2CYD A;  2BE5 F;  3C8G B;  3RFY A;  1RMV A;  2GAQ A;  2Y3D A;  2Q9A A;  1GM5 A;  1OKK D;  3PMR A;  3NMK A;  1XZQ A;  5D91 A;  1V74 B;  3U3B A;  3GM3 A;  3IQ6 A;  3GOR A;  4U5E E;  3RVZ A;  4HFK B;  1W2W A;  3GEI A;  1O5H A;  3A9C A;  3TJ6 A;  3LEV A;  4MVZ A;  4CS9 C;  5L0C A;  3RYL A;  3TJ5 A;  4BJ6 C;  3UMK A;  3T6J A;  2KGO A;  1YDI A;  1NFO A;  1YLM A;  1ZHY A;  2ZD9 A;  3AJM A;  4MW8 A;  1M56 C;  2FGY A;  5EHH A;  1D0Z A;  4EBJ A;  1BZ4 A;  2MHR A;  5A6J A;  3AQB A;  1A41 A;  2H8A A;  4E7S A;  4FWV A;  3U3F A;  3Q6N A;  4JKV A;  3LNM B;  5FZT A;  4Z9I A;  2IXN A;  3W8I A;  1YYX A;  1BR4 A;  2Y3H A;  4YL3 A;  1MQV A;  1RJ9 A;  4J7Y A;  4JTC B;  2OU6 A;  4W8K A;  3NMJ A;  2L7A A;  5DVW A;  3QMK A;  4LDQ A;  3S9O A;  3SXM A;  1TR2 A;  4CDY A;  4B6I A;  2Q00 A;  4YT2 A;  4ZLC A;  3DE9 A;  3I5Q A;  1EA8 A;  4CDV A;  4ONS A;  3FAJ A;  2HV6 A;  4N06 A;  3M4C A;  4NY3 A;  3GWL A;  4C7O B;  4AE4 A;  4MTF A;  1MND A;  3T4R A;  1FR0 A;  2G62 A;  1TFK B;  4KNW A;  4E7Z A;  5K0I A;  2J9V A;  1MNE A;  1JAF A;  2G3V A;  4JE9 A;  4HEA J;  4DXW A;  4CS9 A;  1LE2 A;  1T5O A;  3H2U A;  1O3U A;  2XL4 A;  1I5N A;  3M4B A;  4N4W A;  2PX0 A;  1OW8 A;  3KYI A;  3ZSU A;  1ST6 A;  2J8W A;  1WAS A;  3F47 A;  3LUT B;  3NYL A;  4NCQ A;  2AWY A;  2HFI A;  4IJJ A;  3S84 A;  2X51 A;  2CNW A;  2W4M A;  4NQF A;  3NMI A;  3KYJ A;  3W8H A;  1BBH A;  3EG9 A;  2YHS A;  1R5I D;  2V3C C;  3ZIB A;  2OEV A;  3O6X A;  2ETS A;  3OA1 A;  3RQE A;  3PCV A;  2LFD A;  4JW1 A;  3ZC4 A;  3DE8 A;  4PJM A;  2Q7R A;  4JC7 A;  1J8Y F;  3GM1 A;  2E87 A;  4R32 A;  5DS6 A;  1LIH A;  2EIM C;  1GS9 A;  2CGE A;  5L0F A;  3DJU B;  1APC A;  1GQA A;  4ZLD A;  1LI7 A;  1NSG B;  1M2V A;  1RJ9 B;  1VK5 A;  2ZXP A;  4DRH B;  2B0J A;  4XPY A;  2YL1 A;  4O6N A;  4HE8 D;  1OW6 A;  3T9O A;  2LCH A;  1H9T A;  2YLG A;  2LIG A;  2D5R B;  1I4Z A;  3QW0 A;  3PDM P;  4CDA A;  4JTA B;  1PD1 A;  1VYI A;  2W9Y A;  3JT1 A;  3GM2 A;  4CJO A;  1OW7 A;  2J45 A;  2IXO A;  4U5C E;  5L0I A;  1LS4 A;  5KYX B;  5GPG B;  2QE9 A;  1K05 A;  1ZHX A;  3MLG A;  5A6A A;  3U0C A;  1VLT A;  3ASN C;  3UGO A;  2W45 A;  4P9T A;  2KK1 A;  3X1O A;  1XWJ A;  3RH3 A;  3EPV A;  3JRT A;  2IM8 A;  4P9F A;  3S28 A;  3K33 A;  2P1A A;  5JLI A;  4BJ5 C;  3IQC A;  3O39 A;  3ATP A;  3M79 A;  3GEH A;  1FNT c;  5EGY A;  2R7S A;  1NU9 C;  2VCC A;  5CI9 A;  3U8V A;  1ZU5 A;  1OCZ C;  4BEJ A;  3G50 A;  5KYY A;  2EPL X;  2Q9B A;  4UDV A;  3IEE A;  2HMQ A;  4LLC A;  4MW3 A;  5JP7 A;  2XLW A;  4JCZ A;  4JTD B;  4NTB A;  4XEK A;  4LDR A;  4BJT A;  3EH1 A;  1JMW A;  4CX9 A;  2EIN C;  1VLS A;  2DI3 A;  5JUA A;  2XLM A;  2ASR A;  3VAY A;  4Z9J A;  1Y4C A;  1YVI A;  5CI8 A;  2J7P A;  4JRZ A;  4PK4 A;  4RDA A;  1D1C A;  5BQG A;  4EUK B;  4D4X A;  3NRH A;  2Q9C A;  3FXH A;  4LER A;  4J32 B;  4OIO F;  2LP4 A;  1G4U S;  3U2L A;  2HZ8 A;  4MQ9 F;  1YZA A;  2FAP B;  3KH2 A;  3UNG C;  4CS8 A;  5A6B A;  1C17 M;  2L6H A;  2YKZ A;  2RD9 A;  3KMI A;  4BJ5 A;  3C8G D;  3K1I A;  3X2Q C;  4CIH A;  3FOO A;  1V55 C;  4OIQ F;  1NU7 D;  5KYU B;  3JRM O;  4N6C A;  4J7T A;  3DM5 A;  3V7O A;  2R7U A;  1IW7 F;  3O55 A;  5CIV A;  2XRH A;  2VC9 A;  5KYW A;  2YLI A;  2OEX A;  3DD7 A;  2QY9 A;  3LS1 A;  4P6I C;  2IYL D;  1LVK A;  3EH2 A;  4EWC A;  1L3P A;  1F1M A;  2MYS A;  4G78 A;  2CDQ A;  3K1H A;  3NYM A;  4K0D A;  4Z9H A;  1U0B B;  3LS0 A;  1OR3 A;  1MMD A;  3AG1 C;  2EIK C;  3GWN A;  3R2P A;  2AVK A;  1G8X A;  5KYY B;  4CSA C;  1U6H A;  1BDJ B;  3NYJ A;  4ULV A;  4E17 A;  4OD4 A;  2IXM A;  3C7J A;  1ORY A;  2HMZ A;  2HS5 A;  3IHU A;  3QZC A;  1LI5 A;  4XLN F;  3SYN A;  4BPM A;  2A0B A;  5DS5 A;  5JSL A;  3GEE A;  4AX2 A;  4E18 A;  3CZ6 A;  1YA9 A;  3EGD A;  4EBK A;  3JYY A;  2VB6 A;  3SXK A;  3LLI A;  4QI0 A;  1T6I A;  2OKU A;  1Z6A A;  3L1M A;  3VM6 A;  2DB4 A;  1HW2 A;  1AVO B;  3JCU Q;  2NUT A;  1TWH A;  1OXB A;  5DQZ A;  5A6K A;  1OQC A;  1PD0 A;  5B1B C;  4FAP B;  1WTY A;  3QW1 A;  1Q0F A;  2HJ3 A;  5L3V A;  3ASO C;  2YL7 A;  3SEO A;  5L3Q A;  3EJN A;  1RKE A;  4KI2 A;  2XXA A;  1Q0K A;  1C02 A;  1NBB A;  1TWC A;  4O7G A;  4Q4Z F;  2XLV A;  3Q7G A;  1QZX A;  1BR2 A;  4QDL A;  4YT8 A;  3C62 A;  1QSP A;  4CSA A;  5B3S C;  1QQ3 A;  3HNK A;  2EIL C;  2W4B A;  5KYW B;  256B A;  3S90 A;  3WG7 C;  1JR8 A;  3L8I A;  1HY5 A;  2HSB A;  2XLD A;  5JRA A;  4U5B E;  3FHD A;  5IY5 C;  4IAO A;  3ECS A;  1K40 A;  3S27 A;  3L0I A;  5L0J A;  3TK0 A;  3U8P A;  3B0V C;  3V5Z A;  3ZTZ A;  1Z3I X;  5F5F A;  4OIN F;  2H7B A;  3JYH A;  2NPU A;  2XM4 A;  3ABK C;  1A7E A;  1KTM A;  2WZF A;  1NZE A;  3K66 A;  1YA7 O;  1G5Z A;  1C03 A;  3R7C A;  3ZDL A;  2WVO A;  2EPO A;  1EKY A;  2XM0 A;  2I8B A;  2R7V A;  2ZXR A;  3M1C B;  3SP1 A;  2LSE A;  1VOM A;  4LAC B;  3RQF A;  4G0H A;  3EGD B;  2OQM A;  3JZ0 A;  3KPH A;  3U9J A;  3T6G B;  2VCA A;  1D1B A;  2J9U A;  1HW1 A;  5BQI A;  3RF3 A;  5HV9 A;  3S29 A;  1KNY A;  4G7Z F;  1T01 A;  1T6U A;  2NUT B;  2I15 A;  3DKA A;  4I3M A;  2V26 A;  4MVS A;  1VMA A;  2Q4F A;  3RQG A;  3ABL C;  3SNH A;  1RKE B;  2AU5 A;  2XXA B;  2FFH A;  5L0D A;  4FES A;  4Q7C A;  1SYQ A;  1JRA A;  4J30 B;  1JPJ A;  4M63 A;  3A11 A;  5E2Q A;  3DI5 A;  1OCR C;  1D0X A;  3E70 C;  2R7W A;  4OD5 A;  1ZHZ A;  2PX3 A;  4Q5S F;  1VB5 A;  1BR1 A;  2DYR C;  1M6T A;  1A7V A;  2CNW D;  2NUP A;  4XEV A;  2KSF A;  3MBG A;  1A7D A;  3NDB B;  1HE1 A;  4AE4 B;  1MMA A;  1AEP A;  3NKD A;  1O87 A;  3AGT A;  1ZU4 A;  1FFH A;  3IPM O;  3T6B A;  1DOV A;  3SZR A;  3G4X A;  3TD7 A;  3B9Q A;  4DVZ A;  2R25 A;  4CS8 C;  1QPU A;  2OCC C;  4F4B A;  1Y6D A;  2NSG A;  2NG1 A;  3EQL F;  3NKE A;  3QTH A;  4LLE A;  5B1A C;  4A2N B;  3PHF 2;  1T6Q A;  4IWB A;  2R9R B;  2P7V A;  2A6E F;  3K1I C;  3HLZ A;  3KL4 A;  3LAY A;  4U5D E;  2Y3B A;  4GEH A;  4CJG A;  1CGO A;  4CIP A;  2ZXO A;  3EG9 B;  4MS2 A;  1OCC C;  4EBB A;  2WZG A;  3FMS A;  4E0H A;  3W2V A;  1NG1 A;  1NLX A;  2JPU A;  1V54 C;  3B0U X;  2ZPA A;  2JD3 A;  3VF0 A;  2J0X A;  1D1A A;  3WAQ A;  2YLD A;  3CSK A;  2RSE B;  2R7O A;  3EFO A;  3DJN B;  3LNR A;  2YL3 A;  1S05 A;  4GQH A;  1KU2 A;  3RW0 A;  4ER9 A;  1Z63 A;  1OR2 A;  3WOD F;  2EPM X;  4I1O B;  3N24 A;  4NTF A;  3EHM A;  4YT5 A;  3UMI A;  3AOU A;  1M2V B;  1I4Y A;  2KNH A;  3DM9 B;  4DBR A;  2WL8 A;  2C03 A;  1S7Z A;  3EHN A;  2VH3 A;  3K6B A;  1M57 C;  4JEB A;  3UMH A;  5AC4 A;  5DS4 A;  1FAP B;  5TJ5 E;  3AG3 C;  1TWG A;  1AUE A;  1M2O A;  2NUP B;  2GDC A;  2HV7 A;  3JSE O;  4IAR A;  2Y69 C;  4JUR I;  4DVY P;  3CEX A;  2MWQ A;  2ICW G;  1E86 A;  2XL6 A;  1QKR A;  1MMN A;  1ZHW A;  4MVR A;  2HUJ A;  2YRF A;  3SXY A;  5BQH A;  2PP4 A;  2YZS A;  3AG2 C;  4YJW A;  2WVQ A;  1PV3 A;  3HNI A;  3L34 A;  2J0W A;  1XZP A;  2A6H F;  3US6 A;  3LJB A;  3W2W A;  4L6R A;  3I4U A;  3RVY A;  5JS5 A;  1Q0G A;  1L7C A;  3K7D A;  4DRJ B;  3VYW A;  2LQG A;  2P61 A;  4JIO A;  4U5F E;  4C3E A;  2OOC A;  4X0R A;  2XS8 A;  1Z7Q c;  1Q0M A;  4PFP A;  2EPN A;  1SR2 A;  3J06 A;  3B71 A;  4XPX A;  2Z15 A;  4YWQ A;  1CPR A;  1MMG A;  2A1D D;  4FX5 A;  2QLA A;  2L9J A;  3W4Y A;  2P6V A;  1HMO A;  1OKK A;  1RCP A;  1SZI A;  4JCH A;  4MVM A;  2WZL A;  4IAQ A;  4RBN A;  3C8Z A;  3CQZ A;  4YL1 A;  1J8M F;  5DLJ A;  1EQ1 A;  2L81 A;  1R4T A;  3BRJ A;  2L6F A;  2GFH A;  1H9G A;  3E9V A;  4ANJ A;  3QVY A;  3ZG1 A;  3DWW A;  4C3B A;  2J46 A;  3DMD A;  3GAN A;  3UR3 C;  4WGZ A;  2CCY A;  2HSQ A;  3EGX A;  2OJE D;  3POV A;  3ZTM A;  1H7I A;  1HE9 A;  4XEF A;  4PFO A;  1N1C A;  2BC5 A;  1WGW A;  4KBL A;  4CS7 A;  1LPE A;  3JTL O;  3V5X A;  1CGM E;  1VTM P;  4HFF B;  4PAC A;  4MND A;  1A0B A;  1TWA A;  2IXP A;  1YAU O;  1E2X A;  2M4E A;  1RKC A;  4DBQ A;  4G7O F;  4O79 A;  3UGP A;  5JT4 A;  5T3T A;  3NG1 A;  1WWP A;  2WVN A;  5COM A;  4LDK A;  1LE4 A;  1EI7 A;  1FTS A;  1LKX A;  1TKN A;  5F28 E;  3EZH A;  5JVE A;  2GWW A;  1QLE C;  1CGN A;  4W8P A;  1U89 A; 
#chains in the Genus database with same CATH homology
 3LLI A;  3TK0 A;  1JRA A;  4E0H A;  3O55 A;  1OQC A;  2HJ3 A;  3R7C A;  3MBG A;  3LLK A;  3GWN A;  3W4Y A;  3TD7 A;  3U2M A;  3GWL A;  3U2L A;  4LDK A;  1JR8 A;  3U5S A;  4E0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...