3GWNA

Crystal structure of the fad binding domain from mimivirus sulfhydryl oxidase r596
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
113
structure length
113
Chain Sequence
ANGLITKIWGTAGWTFNHAVTFGYPLNPTSDDKRRYKNYFISLGDVLPCRLCRESYKKFITTGKTALTNEVLRNRHTLTKWFYDVHNAVNNKLEVDYGLSYEDVVNKYESFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimer interface migration in a viral sulfhydryl oxidase
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Oxidoreductase
molecule keywords Probable FAD-linked sulfhydryl oxidase R596
total genus 46
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3gwnA00
3GWNA 1JRAA 3LLKA 3U5SA 3W4YA 3GWLA 4E0IA 3TD7A 4E0HA 1JR8A 3MBGA 3R7CA 3U2LA 3O55A 3TK0A 3LLIA 2HJ3A 3U2MA 1OQCA 4LDKA
chains in the Genus database with same CATH superfamily
2GDCA 3H2UA 3DJNB 4I1OB 4Z9JA 1D0XA 2EPNA 2XL8A 1ORYA 1U6HA 2Z15A 1BZ4A 4GQHA 1OKKA 1C03A 1AUEA 4XPWA 5BUOA 3RF3A 2YL7A 2A68F 1E2XA 2OQMA 2XLMA 3ASNC 5COFA 5A69A 3ZDLA 2D4UA 1FMVA 4KI2A 2XLDA 2NG1A 3NMJA 1PD0A 1OW8A 3EQLF 3H2VA 4XEFA 1NG1A 3B0VC 1QLEC 2OJED 3F46A 1DOVA 4H54A 3WODF 5KYNA 3EJNA 2Q4FA 3HKKA 1EQ1A 5DVWA 4DXWA 3EG9B 5F28E 3EH2A 1JR8A 1M2VA 2L81A 3UR3C 1SMYF 3AQCA 2A1DD 4CBEA 3C18A 3TJ6A 1MMNA 1NFOA 2J0WA 3SYNA 2AP3A 1Z5ZA 3K7DA 5JVEA 1Y6DA 3C8ZA 4FX5A 5BQIA 2Y3DA 3UNGC 1ZYRF 1ORJA 2LIGA 3GEIA 4JRZA 3S29A 3AJMA 3JZ0A 2HS5A 3K1IC 3QMKA 4E17A 1M2VB 1SR2A 2LFDA 3LESA 3AOUA 3ZG1A 1E86A 1PD1A 4OIOF 2P6VA 1V74B 5DQTA 1TKNA 3IQ5A 2Q7RA 2BE5F 2YL3A 4AL1A 1OXKA 1GQAA 4YJWA 4CIPA 3DI5A 3T6JA 3DXJF 1M2OA 3GANA 3I5QA 3QVZA 3DAGA 5T1DB 1Y4CA 4E0IA 4IAQA 4DBRA 3IHUA 2H8AA 2PP4A 2XS1A 1FAPB 3L0IA 2P61A 5E3CA 4LACB 4CJGA 2OEXA 2XM0A 1OCRC 3EPVA 3S28A 1R5ID 2EIJC 2VCAA 3FVYA 4I3MA 4PJLA 4RDAA 3U5SA 1WWPA 2WVQA 3M15A 3WG7C 1SYQA 1VYIA 4U5CE 3ZQYA 4YT2A 2PX0A 2OCCC 3DE9A 2KK1A 3GORA 1YLMA 1OCOC 2QUPA 4HE8D 4JTAB 4O6MA 3W4YA 2NPUA 3J06A 4QI0A 2J46A 2IBFA 4LDRA 4YL1A 3M4BA 4U9EA 2RSEB 2LK4A 2OKUA 1G5ZA 2EPKX 2L7AA 3RH3A 3FDQA 4BJ6C 2IYLD 1RKEB 4IWBA 1A41A 1M6TA 2A6HF 1T6IA 1A7DA 2IXNA 4IGGA 3DAFA 4JJGA 4OD5A 3JT1A 3ZTZA 1I4YA 3KMIA 5KYUA 2HJ3A 2HSQA 1UFBA 3PCVA 1ZHTA 3N0TA 2KJGA 3LNRA 3V5YA 3GWLA 3RVZA 2ICWG 2P1AA 1IW7F 3GEEA 4O6NA 4YT4A 5JUAA 1BR4A 4OIPF 1EKYA 3NMIA 5EGYA 1RKEA 3JSEO 3C8GB 4KNWA 3CAXA 2W9YA 3F47A 1LS1A 2R02A 1XZQA 2M4EA 3VYWA 4WGZA 1TWCA 3B71A 2PNOA 3L34A 3Q7LA 3TD7A 3X1OA 3ZSUA 2XM4A 2YEVA 4C7OA 2IM8A 2KGOA 4JCHA 4LLEA 2HV6A 1CPQA 3WAQA 2NUPB 3I5PA 4GYTA 4MVMA 3S27A 2VASA 1H9GA 3KPHA 2X0CA 5TJ5E 3RIPA 2R7TA 3C8GA 1S7ZA 5L3QA 1MMAA 1T5OA 1VB5A 2XLWA 2LFFA 3C7JA 4MVZA 4QI2A 1R4TA 2KSFA 2ZPAA 2XLEA 4EBJA 1AEPA 1JRAA 4Q7CA 4NQFA 2DYRC 2YWAA 2W45A 1FMWA 3EGDA 3MYIA 2HUJA 1YARO 2CW0F 3ABLC 2NUTA 2LP4A 1NLXA 1OXBA 5KYWB 5CIVA 4P6IC 1LE4A 3E9VA 2GAQA 1HW2A 3SZRA 3FAJA 3L8IA 1YZAA 2WVOA 2B0JA 3EH1A 4EWCA 3PHF2 1ZZPA 1QSPA 4AX2A 4EIYA 4HFFB 3ABMC 2G62A 5F5HA 3GM2A 2Q9AA 2J9BA 5L0DA 2YLDA 3SEOA 4MTFA 1HMDA 3EGXB 5AGFA 3WHNA 3U8VA 4XWJA 2NUPA 1H7IA 1TQGA 2I8BA 4ULWA 1JAFA 1OKKD 3CEXA 5K0IA 1MNDA 3S84A 4CS8A 3VM6A 1NZEA 3UMIA 1T6QA 1BR2A 3IQTA 4L6RA 5EHHA 5L0HA 5F5FA 1MQVA 3S0XA 3MLGA 3MFNA 4ER9A 1D0YA 4PACA 1J8YF 3EG9A 2WB7A 3H65A 4CS7A 1DOWA 3FAPB 4RD9A 4CS9A 5KYYB 2WZFA 4YWQA 5T3WA 4AK9A 2PFDA 1YYXA 2R7QA 3RW0A 4EHPA 5DS4A 2YHSA 4MNDA 2XXAB 3NYJA 3T9OA 2J8WA 3LJBA 4CDAA 1ZU4A 4C3BA 2HV7A 1YA9A 3LS0A 2C03A 3G4ZA 4J32B 2VCBA 3W8IA 1HE1A 4DRIB 3U2MA 1H6GA 2NSFA 3NKEA 2EINC 4MQ9F 3QZCA 3SXKA 3UGPA 4YN0B 4ONSA 2LD6A 2OG2A 2MHRA 3ZVRA 1LPEA 2J0XA 2QNLA 2CNWD 3W8HA 1ZW3A 2C04A 4A2NB 3SNHA 2JD3A 1W2WA 3HNIA 3X2QC 4FAPB 5B3IA 3TULA 4MVSA 4AL0A 1YA7O 3KH2A 2VH3A 2X51A 2J7PD 2J45A 3T4RA 1HW1A 4JC7A 3EFOA 1Z63A 4AE4B 2YZSA 3DWWA 4LDQA 4N4WA 3A11A 2HZ8A 2QE9A 2XLOA 4JCZA 3B9QA 1YYJA 4NCQA 2XXAA 2H7BA 5GPGB 4XPYA 4OD4A 1K04A 1LVKA 3NYLA 4W8PA 1E83A 2P0NA 2V3CC 3VAYA 2G3VA 3L8JA 3HTKC 5B1AC 5L0IA 3CQZA 4OIQF 3DZAA 3V5XA 2ZXRA 2GA0A 2W4BA 3O39A 1A7EA 1WGWA 2GWWA 3TOMA 2J9WA 4XLNF 2L6HA 1SZIA 4J7YA 2TMVP 1C02A 2O9XA 3U3BA 5DQZA 3O55A 1MMDA 3O6XA 3QVYA 3CZ6A 2L6GA 2VCCA 1OR2A 2IXOA 3EZIA 4H4KC 1OW7A 3RQEA 2R7OA 4C3EA 4PFPA 2KYHA 1M57C 2WZLA 2YL0A 3U8PA 4U5GA 4R32A 5BQHA 4J7TA 4JTCB 4DRHB 3UGOA 1EA8A 2FAPB 3AG3C 2CYDA 2WVNA 4BG0A 4EBKA 3Q6MA 3EHMA 4JVSA 1TFKB 4DVYP 1NFNA 3CSKA 3LLIA 4G7ZF 3NG1A 5KYUB 2H7OA 4LLCA 1MMGA 3HNLA 5A6AA 2FGYA 2KQ9A 2DB4A 3JYYA 4JW1A 3AQBA 3MYFA 4NTAA 3RKOF 2J7PA 2B0HA 4PK4A 1BDJB 4WGYA 1E85A 4YL3A 3B0PA 3N2ZB 5JSLA 2CCYA 1JMWA 2AWYA 1XZPA 3LLKA 1TWGA 2RD9A 4E0HA 3PDMP 1VOMA 4K0DA 1O5HA 3E70C 2Q9CA 3US6A 3JCUQ 4EUKB 3GM3A 3ABKC 3KYJA 3T6BA 3ZC4A 1L3PA 4ANJA 4G7HF 1GM5A 1A7VA 1OW6A 3Q7GA 5KYXA 4M63A 1U89A 4MTOA 5D92A 5E33A 256BA 4NY3A 5AC5A 2YQYA 5HV9A 2HJMA 4MVUA 2DYSC 1PV3A 4BJ5C 2L6FA 1Q0MA 4XTKA 3MX3A 2IXMA 5A6KA 4FWVA 4MTGA 1CGNA 1VMAA 2IOQA 3ASOC 2G3KA 1LM3B 4JIOA 1ORSC 2WZGA 1HE9A 4E7ZA 1QVXA 3C8GD 1L7CA 2R7UA 4WJ0A 1H9TA 1TWAA 2E87A 2R25A 4BJ6A 5DS6A 5KYWA 1KU2A 1ZU5A 3EHNA 2Q00A 1FFTC 2D5RB 1WATA 3DM5A 1VLTA 1K40A 4PFOA 3KL4A 3LUTB 1Z3IX 3DM9B 5COMA 1OCCC 1FFHA 4IJJA 1WOLA 4AE4A 1Q0FA 2WL8A 2NSGA 3LAYA 1LS4A 3PMRA 3RQGA 5A6BA 1CGOA 1FTSA 2EIMC 1D1CA 3AGTA 3ITFA 2YRFA 2FFHA 2W4MA 1G4WR 2VC9A 4G78A 4EBBA 2BC5A 3K1IA 4P9TA 2EPMX 2I15A 3HNKA 1E84A 2R05A 2J9VA 1ZHZA 4K7BA 5CI9A 5COGA 3RVYA 1JPNA 1LIHA 3FMSA 1YVIA 2F22A 4E18A 1C17M 1O87A 4WABA 3U3FA 5EK0A 4QDLA 4IARA 2HMQA 2XLVA 4IAOA 5A6JA 3I4UA 3OWTA 2JPUA 3LEVA 4CSAA 2HSBA 2OU6A 3QTHA 4IRUA 2A69F 3ZWIA 1FR0A 5AC4A 4A4AA 3K1HA 4BJ5A 2IXPA 3BRJA 1CGME 2Y39A 4O7GA 4J30B 4N06A 4I44A 3KKBA 3QW1A 4U5BE 1MNEA 1G8XA 1YAUO 1YZCA 2BL2A 1J8MF 1VK5A 3U9MA 4U5FE 4DJ9A 4CIHA 1Q0KA 3BEHA 3G50A 3NYMA 2HFIA 4HFKB 5BQGA 4XEVA 4JJFA 2CGEA 2ZD9A 4MW3A 5CI8A 2ETSA 3B29A 4I1MA 1OQCA 4MVRA 1RMVA 3JTLO 5B3SC 1JPJA 1VLSA 2YL1A 3JRMO 3SP1A 1GGQA 2M64A 4Z9IA 1QQ3A 2KNHA 3N24A 4D4NA 1QPUA 1Q0DA 2V26A 1FNTc 4NTFA 1Z7Qc 2R7VA 3FOPA 5L3VA 4YT8A 4Q4ZF 4MS2A 1QZXA 2XL4A 2LCHA 4KBLA 5E3AA 4DOZA 1LKXA 1F1MA 3GEHA 3OA1A 2R7SA 2CDQA 1YDIA 3AGUA 1SF8A 2NUTB 3DKAA 3QW0A 3AG4C 4JKVA 1HMOA 4CJOA 3LNMB 3IPMO 3UMKA 4DVZA 4F4BA 3U9JA 1UG7A 2J9UA 1OR3A 3JRTA 3LS1A 3RYLA 2Q9BA 1GS9A 2A0BA 4LERA 4BJTA 1M56C 2XSEA 4CDYA 3B0UX 1T01A 2XL6A 4KC9A 3T6GB 1O3UA 4PJMA 1Z23A 1V55C 4K1OA 1ZW2A 3NKDA 1TFOB 1V54C 2AVKA 3U2LA 4BJ1A 1HY5A 3AG1C 3S9OA 5DLJA 1LE2A 4B6IA 2H7VC 3V5ZA 2EIKC 3NRHA 1YJGA 3TOLA 2EILC 4PJJA 1IZMA 4N6HA 4ZLDA 1NU9C 1LI5A 2YVKA 2OOCA 4D4XA 3HJCA 1AVOB 2EPLX 2UUHA 3VRCA 5A6BD 2ZXOA 3GWNA 5HSWA 1D1AA 1K05A 1QKRA 3NMKA 4N6CA 5B1BC 5IY5C 1EI7A 2MYSA 1PCXA 4FESA 3U0CA 3IQ6A 3JYHA 1I4ZA 1NSGB 2Y3HA 2HMZA 3IQCA 4MW8A 3SXZA 2CNWA 3O10A 5FZTA 3C63A 1U0BB 4C3DA 5JS5A 1N1CA 1S05A 4EKWA 2R7WA 2YLGA 2A0UA 2QLAA 4JEBA 4U5HA 1T6UA 2OEVA 1D0ZA 2R03A 3DJUB 3HNJA 3M4CA 3MBGA 3ZIBA 1NBBA 1RXQA 2XLHA 2DGJA 4GEHA 2YLIA 2AWCA 1VTMP 4YT5A 1KTMA 3TQOA 4XQ1A 4G7OF 1WN0A 4MVQA 3GODA 4XEKA 3OEOA 1ZVZA 3K6BA 3SXYA 3ECSA 3V7OA 3EGXA 1ZHYA 2UUIA 1WTYA 4IB4A 3R7CA 2YKZA 2PF4E 3TK0A 2Y69C 2L9JA 5T3TA 4CS9C 4XPXA 3DMDA 4U9DA 4UDVA 2Y3GA 3JSZA 5L0CA 2KW3C 3K33A 2MWQA 1A0BA 1G4US 1LI7A 4JTDB 4BPMA 1RJ9B 3DE8A 4G0HA 4OINF 3W2WA 2QY9A 3HLZA 1ST6A 2VB6A 2ZXWC 2Q3TA 5L0JA 3ATPA 5E2QA 1TR2A 2XRHA 5DS5A 3EGDB 3RFYA 4U5DE 4CS8C 5L0FA 4Z9HA 4E7SA 3A9CA 4O6YA 4JURI 4BEJA 2LSEA 4W8KA 4YL0A 1XWJA 5FCLA 4XLPF 3GM1A 4Q5SF 4ULVA 3UMHA 1OCZC 3FHDA 1RCPA 1NU7D 1V4AA 1Z6AA 4NTBA 3SXMA 3K66A 3W2VA 5JRAA 1ZHXA 2GFHA 4CSAC 4YK5A 2R7RA 1APCA 3FOOA 4KNVA 5KYXB 5JLIA 3C62A 3FXHA 4MVOA 4RBNA 4CX9A 4C7OB 3POVA 1TWHA 2AU5A 4HEAJ 3R2PA 5JP7A 4OIRF 4LDKA 4DBQA 1VYKA 3LEOA 4BEMJ 2A6EF 2ZXPA 3S90A 3DD7A 4CDVA 1Q0GA 5L0GA 3ZTMA 2P7VA 3L1MA 2EPOA 2HKVA 4PR9A 3RQFA 1D1BA 4NC3A 3Q6NA 1WASA 1T9KA 3M79A 3TJ5A 1B68A 2R9RB 4DRJB 2PBEA 4ZLCA 3G4XA 4O79A 2DI3A 2LQGA 3IEEA 4PJNA 5D91A 3AG2C 3VF0A 5JT4A 1BBHA 5KYYA 1ZHWA 3NDBB 1BR1A 4JE9A 2KC3A 1RJ9A 1I5NA 2ASRA 2JX0A 4JZAA 2PX3A 1KNYA 2QTVA 2Y3BA 3KYIA 4U5EE 4X0RA 2R7XA 2XS8A 3EZHA 4JEAA 3ZQVA 1RKCA 2OJQA 1CPRA 4P9FA 3M1CB 3EFOB 1JOGA
chains in the Genus database with same CATH topology
3GWNA 1JRAA 3LLKA 3U5SA 3W4YA 3GWLA 4E0IA 3TD7A 4E0HA 1JR8A 3MBGA 3R7CA 3U2LA 3O55A 3TK0A 3LLIA 2HJ3A 3U2MA 1OQCA 4LDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWN A;  1JRA A;  3LLK A;  3U5S A;  3W4Y A;  3GWL A;  4E0I A;  3TD7 A;  4E0H A;  1JR8 A;  3MBG A;  3R7C A;  3U2L A;  3O55 A;  3TK0 A;  3LLI A;  2HJ3 A;  3U2M A;  1OQC A;  4LDK A; 
#chains in the Genus database with same CATH topology
 2GDC A;  3H2U A;  3DJN B;  4I1O B;  4Z9J A;  1D0X A;  2EPN A;  2XL8 A;  1ORY A;  1U6H A;  2Z15 A;  1BZ4 A;  4GQH A;  1OKK A;  1C03 A;  1AUE A;  4XPW A;  5BUO A;  3RF3 A;  2YL7 A;  2A68 F;  1E2X A;  2OQM A;  2XLM A;  3ASN C;  5COF A;  5A69 A;  3ZDL A;  2D4U A;  1FMV A;  4KI2 A;  2XLD A;  2NG1 A;  3NMJ A;  1PD0 A;  1OW8 A;  3EQL F;  3H2V A;  4XEF A;  1NG1 A;  3B0V C;  1QLE C;  2OJE D;  3F46 A;  1DOV A;  4H54 A;  3WOD F;  5KYN A;  3EJN A;  2Q4F A;  3HKK A;  1EQ1 A;  5DVW A;  4DXW A;  3EG9 B;  5F28 E;  3EH2 A;  1JR8 A;  1M2V A;  2L81 A;  3UR3 C;  1SMY F;  3AQC A;  2A1D D;  4CBE A;  3C18 A;  3TJ6 A;  1MMN A;  1NFO A;  2J0W A;  3SYN A;  2AP3 A;  1Z5Z A;  3K7D A;  5JVE A;  1Y6D A;  3C8Z A;  4FX5 A;  5BQI A;  2Y3D A;  3UNG C;  1ZYR F;  1ORJ A;  2LIG A;  3GEI A;  4JRZ A;  3S29 A;  3AJM A;  3JZ0 A;  2HS5 A;  3K1I C;  3QMK A;  4E17 A;  1M2V B;  1SR2 A;  2LFD A;  3LES A;  3AOU A;  3ZG1 A;  1E86 A;  1PD1 A;  4OIO F;  2P6V A;  1V74 B;  5DQT A;  1TKN A;  3IQ5 A;  2Q7R A;  2BE5 F;  2YL3 A;  4AL1 A;  1OXK A;  1GQA A;  4YJW A;  4CIP A;  3DI5 A;  3T6J A;  3DXJ F;  1M2O A;  3GAN A;  3I5Q A;  3QVZ A;  3DAG A;  5T1D B;  1Y4C A;  4E0I A;  4IAQ A;  4DBR A;  3IHU A;  2H8A A;  2PP4 A;  2XS1 A;  1FAP B;  3L0I A;  2P61 A;  5E3C A;  4LAC B;  4CJG A;  2OEX A;  2XM0 A;  1OCR C;  3EPV A;  3S28 A;  1R5I D;  2EIJ C;  2VCA A;  3FVY A;  4I3M A;  4PJL A;  4RDA A;  3U5S A;  1WWP A;  2WVQ A;  3M15 A;  3WG7 C;  1SYQ A;  1VYI A;  4U5C E;  3ZQY A;  4YT2 A;  2PX0 A;  2OCC C;  3DE9 A;  2KK1 A;  3GOR A;  1YLM A;  1OCO C;  2QUP A;  4HE8 D;  4JTA B;  4O6M A;  3W4Y A;  2NPU A;  3J06 A;  4QI0 A;  2J46 A;  2IBF A;  4LDR A;  4YL1 A;  3M4B A;  4U9E A;  2RSE B;  2LK4 A;  2OKU A;  1G5Z A;  2EPK X;  2L7A A;  3RH3 A;  3FDQ A;  4BJ6 C;  2IYL D;  1RKE B;  4IWB A;  1A41 A;  1M6T A;  2A6H F;  1T6I A;  1A7D A;  2IXN A;  4IGG A;  3DAF A;  4JJG A;  4OD5 A;  3JT1 A;  3ZTZ A;  1I4Y A;  3KMI A;  5KYU A;  2HJ3 A;  2HSQ A;  1UFB A;  3PCV A;  1ZHT A;  3N0T A;  2KJG A;  3LNR A;  3V5Y A;  3GWL A;  3RVZ A;  2ICW G;  2P1A A;  1IW7 F;  3GEE A;  4O6N A;  4YT4 A;  5JUA A;  1BR4 A;  4OIP F;  1EKY A;  3NMI A;  5EGY A;  1RKE A;  3JSE O;  3C8G B;  4KNW A;  3CAX A;  2W9Y A;  3F47 A;  1LS1 A;  2R02 A;  1XZQ A;  2M4E A;  3VYW A;  4WGZ A;  1TWC A;  3B71 A;  2PNO A;  3L34 A;  3Q7L A;  3TD7 A;  3X1O A;  3ZSU A;  2XM4 A;  2YEV A;  4C7O A;  2IM8 A;  2KGO A;  4JCH A;  4LLE A;  2HV6 A;  1CPQ A;  3WAQ A;  2NUP B;  3I5P A;  4GYT A;  4MVM A;  3S27 A;  2VAS A;  1H9G A;  3KPH A;  2X0C A;  5TJ5 E;  3RIP A;  2R7T A;  3C8G A;  1S7Z A;  5L3Q A;  1MMA A;  1T5O A;  1VB5 A;  2XLW A;  2LFF A;  3C7J A;  4MVZ A;  4QI2 A;  1R4T A;  2KSF A;  2ZPA A;  2XLE A;  4EBJ A;  1AEP A;  1JRA A;  4Q7C A;  4NQF A;  2DYR C;  2YWA A;  2W45 A;  1FMW A;  3EGD A;  3MYI A;  2HUJ A;  1YAR O;  2CW0 F;  3ABL C;  2NUT A;  2LP4 A;  1NLX A;  1OXB A;  5KYW B;  5CIV A;  4P6I C;  1LE4 A;  3E9V A;  2GAQ A;  1HW2 A;  3SZR A;  3FAJ A;  3L8I A;  1YZA A;  2WVO A;  2B0J A;  3EH1 A;  4EWC A;  3PHF 2;  1ZZP A;  1QSP A;  4AX2 A;  4EIY A;  4HFF B;  3ABM C;  2G62 A;  5F5H A;  3GM2 A;  2Q9A A;  2J9B A;  5L0D A;  2YLD A;  3SEO A;  4MTF A;  1HMD A;  3EGX B;  5AGF A;  3WHN A;  3U8V A;  4XWJ A;  2NUP A;  1H7I A;  1TQG A;  2I8B A;  4ULW A;  1JAF A;  1OKK D;  3CEX A;  5K0I A;  1MND A;  3S84 A;  4CS8 A;  3VM6 A;  1NZE A;  3UMI A;  1T6Q A;  1BR2 A;  3IQT A;  4L6R A;  5EHH A;  5L0H A;  5F5F A;  1MQV A;  3S0X A;  3MLG A;  3MFN A;  4ER9 A;  1D0Y A;  4PAC A;  1J8Y F;  3EG9 A;  2WB7 A;  3H65 A;  4CS7 A;  1DOW A;  3FAP B;  4RD9 A;  4CS9 A;  5KYY B;  2WZF A;  4YWQ A;  5T3W A;  4AK9 A;  2PFD A;  1YYX A;  2R7Q A;  3RW0 A;  4EHP A;  5DS4 A;  2YHS A;  4MND A;  2XXA B;  3NYJ A;  3T9O A;  2J8W A;  3LJB A;  4CDA A;  1ZU4 A;  4C3B A;  2HV7 A;  1YA9 A;  3LS0 A;  2C03 A;  3G4Z A;  4J32 B;  2VCB A;  3W8I A;  1HE1 A;  4DRI B;  3U2M A;  1H6G A;  2NSF A;  3NKE A;  2EIN C;  4MQ9 F;  3QZC A;  3SXK A;  3UGP A;  4YN0 B;  4ONS A;  2LD6 A;  2OG2 A;  2MHR A;  3ZVR A;  1LPE A;  2J0X A;  2QNL A;  2CNW D;  3W8H A;  1ZW3 A;  2C04 A;  4A2N B;  3SNH A;  2JD3 A;  1W2W A;  3HNI A;  3X2Q C;  4FAP B;  5B3I A;  3TUL A;  4MVS A;  4AL0 A;  1YA7 O;  3KH2 A;  2VH3 A;  2X51 A;  2J7P D;  2J45 A;  3T4R A;  1HW1 A;  4JC7 A;  3EFO A;  1Z63 A;  4AE4 B;  2YZS A;  3DWW A;  4LDQ A;  4N4W A;  3A11 A;  2HZ8 A;  2QE9 A;  2XLO A;  4JCZ A;  3B9Q A;  1YYJ A;  4NCQ A;  2XXA A;  2H7B A;  5GPG B;  4XPY A;  4OD4 A;  1K04 A;  1LVK A;  3NYL A;  4W8P A;  1E83 A;  2P0N A;  2V3C C;  3VAY A;  2G3V A;  3L8J A;  3HTK C;  5B1A C;  5L0I A;  3CQZ A;  4OIQ F;  3DZA A;  3V5X A;  2ZXR A;  2GA0 A;  2W4B A;  3O39 A;  1A7E A;  1WGW A;  2GWW A;  3TOM A;  2J9W A;  4XLN F;  2L6H A;  1SZI A;  4J7Y A;  2TMV P;  1C02 A;  2O9X A;  3U3B A;  5DQZ A;  3O55 A;  1MMD A;  3O6X A;  3QVY A;  3CZ6 A;  2L6G A;  2VCC A;  1OR2 A;  2IXO A;  3EZI A;  4H4K C;  1OW7 A;  3RQE A;  2R7O A;  4C3E A;  4PFP A;  2KYH A;  1M57 C;  2WZL A;  2YL0 A;  3U8P A;  4U5G A;  4R32 A;  5BQH A;  4J7T A;  4JTC B;  4DRH B;  3UGO A;  1EA8 A;  2FAP B;  3AG3 C;  2CYD A;  2WVN A;  4BG0 A;  4EBK A;  3Q6M A;  3EHM A;  4JVS A;  1TFK B;  4DVY P;  1NFN A;  3CSK A;  3LLI A;  4G7Z F;  3NG1 A;  5KYU B;  2H7O A;  4LLC A;  1MMG A;  3HNL A;  5A6A A;  2FGY A;  2KQ9 A;  2DB4 A;  3JYY A;  4JW1 A;  3AQB A;  3MYF A;  4NTA A;  3RKO F;  2J7P A;  2B0H A;  4PK4 A;  1BDJ B;  4WGY A;  1E85 A;  4YL3 A;  3B0P A;  3N2Z B;  5JSL A;  2CCY A;  1JMW A;  2AWY A;  1XZP A;  3LLK A;  1TWG A;  2RD9 A;  4E0H A;  3PDM P;  1VOM A;  4K0D A;  1O5H A;  3E70 C;  2Q9C A;  3US6 A;  3JCU Q;  4EUK B;  3GM3 A;  3ABK C;  3KYJ A;  3T6B A;  3ZC4 A;  1L3P A;  4ANJ A;  4G7H F;  1GM5 A;  1A7V A;  1OW6 A;  3Q7G A;  5KYX A;  4M63 A;  1U89 A;  4MTO A;  5D92 A;  5E33 A;  256B A;  4NY3 A;  5AC5 A;  2YQY A;  5HV9 A;  2HJM A;  4MVU A;  2DYS C;  1PV3 A;  4BJ5 C;  2L6F A;  1Q0M A;  4XTK A;  3MX3 A;  2IXM A;  5A6K A;  4FWV A;  4MTG A;  1CGN A;  1VMA A;  2IOQ A;  3ASO C;  2G3K A;  1LM3 B;  4JIO A;  1ORS C;  2WZG A;  1HE9 A;  4E7Z A;  1QVX A;  3C8G D;  1L7C A;  2R7U A;  4WJ0 A;  1H9T A;  1TWA A;  2E87 A;  2R25 A;  4BJ6 A;  5DS6 A;  5KYW A;  1KU2 A;  1ZU5 A;  3EHN A;  2Q00 A;  1FFT C;  2D5R B;  1WAT A;  3DM5 A;  1VLT A;  1K40 A;  4PFO A;  3KL4 A;  3LUT B;  1Z3I X;  3DM9 B;  5COM A;  1OCC C;  1FFH A;  4IJJ A;  1WOL A;  4AE4 A;  1Q0F A;  2WL8 A;  2NSG A;  3LAY A;  1LS4 A;  3PMR A;  3RQG A;  5A6B A;  1CGO A;  1FTS A;  2EIM C;  1D1C A;  3AGT A;  3ITF A;  2YRF A;  2FFH A;  2W4M A;  1G4W R;  2VC9 A;  4G78 A;  4EBB A;  2BC5 A;  3K1I A;  4P9T A;  2EPM X;  2I15 A;  3HNK A;  1E84 A;  2R05 A;  2J9V A;  1ZHZ A;  4K7B A;  5CI9 A;  5COG A;  3RVY A;  1JPN A;  1LIH A;  3FMS A;  1YVI A;  2F22 A;  4E18 A;  1C17 M;  1O87 A;  4WAB A;  3U3F A;  5EK0 A;  4QDL A;  4IAR A;  2HMQ A;  2XLV A;  4IAO A;  5A6J A;  3I4U A;  3OWT A;  2JPU A;  3LEV A;  4CSA A;  2HSB A;  2OU6 A;  3QTH A;  4IRU A;  2A69 F;  3ZWI A;  1FR0 A;  5AC4 A;  4A4A A;  3K1H A;  4BJ5 A;  2IXP A;  3BRJ A;  1CGM E;  2Y39 A;  4O7G A;  4J30 B;  4N06 A;  4I44 A;  3KKB A;  3QW1 A;  4U5B E;  1MNE A;  1G8X A;  1YAU O;  1YZC A;  2BL2 A;  1J8M F;  1VK5 A;  3U9M A;  4U5F E;  4DJ9 A;  4CIH A;  1Q0K A;  3BEH A;  3G50 A;  3NYM A;  2HFI A;  4HFK B;  5BQG A;  4XEV A;  4JJF A;  2CGE A;  2ZD9 A;  4MW3 A;  5CI8 A;  2ETS A;  3B29 A;  4I1M A;  1OQC A;  4MVR A;  1RMV A;  3JTL O;  5B3S C;  1JPJ A;  1VLS A;  2YL1 A;  3JRM O;  3SP1 A;  1GGQ A;  2M64 A;  4Z9I A;  1QQ3 A;  2KNH A;  3N24 A;  4D4N A;  1QPU A;  1Q0D A;  2V26 A;  1FNT c;  4NTF A;  1Z7Q c;  2R7V A;  3FOP A;  5L3V A;  4YT8 A;  4Q4Z F;  4MS2 A;  1QZX A;  2XL4 A;  2LCH A;  4KBL A;  5E3A A;  4DOZ A;  1LKX A;  1F1M A;  3GEH A;  3OA1 A;  2R7S A;  2CDQ A;  1YDI A;  3AGU A;  1SF8 A;  2NUT B;  3DKA A;  3QW0 A;  3AG4 C;  4JKV A;  1HMO A;  4CJO A;  3LNM B;  3IPM O;  3UMK A;  4DVZ A;  4F4B A;  3U9J A;  1UG7 A;  2J9U A;  1OR3 A;  3JRT A;  3LS1 A;  3RYL A;  2Q9B A;  1GS9 A;  2A0B A;  4LER A;  4BJT A;  1M56 C;  2XSE A;  4CDY A;  3B0U X;  1T01 A;  2XL6 A;  4KC9 A;  3T6G B;  1O3U A;  4PJM A;  1Z23 A;  1V55 C;  4K1O A;  1ZW2 A;  3NKD A;  1TFO B;  1V54 C;  2AVK A;  3U2L A;  4BJ1 A;  1HY5 A;  3AG1 C;  3S9O A;  5DLJ A;  1LE2 A;  4B6I A;  2H7V C;  3V5Z A;  2EIK C;  3NRH A;  1YJG A;  3TOL A;  2EIL C;  4PJJ A;  1IZM A;  4N6H A;  4ZLD A;  1NU9 C;  1LI5 A;  2YVK A;  2OOC A;  4D4X A;  3HJC A;  1AVO B;  2EPL X;  2UUH A;  3VRC A;  5A6B D;  2ZXO A;  3GWN A;  5HSW A;  1D1A A;  1K05 A;  1QKR A;  3NMK A;  4N6C A;  5B1B C;  5IY5 C;  1EI7 A;  2MYS A;  1PCX A;  4FES A;  3U0C A;  3IQ6 A;  3JYH A;  1I4Z A;  1NSG B;  2Y3H A;  2HMZ A;  3IQC A;  4MW8 A;  3SXZ A;  2CNW A;  3O10 A;  5FZT A;  3C63 A;  1U0B B;  4C3D A;  5JS5 A;  1N1C A;  1S05 A;  4EKW A;  2R7W A;  2YLG A;  2A0U A;  2QLA A;  4JEB A;  4U5H A;  1T6U A;  2OEV A;  1D0Z A;  2R03 A;  3DJU B;  3HNJ A;  3M4C A;  3MBG A;  3ZIB A;  1NBB A;  1RXQ A;  2XLH A;  2DGJ A;  4GEH A;  2YLI A;  2AWC A;  1VTM P;  4YT5 A;  1KTM A;  3TQO A;  4XQ1 A;  4G7O F;  1WN0 A;  4MVQ A;  3GOD A;  4XEK A;  3OEO A;  1ZVZ A;  3K6B A;  3SXY A;  3ECS A;  3V7O A;  3EGX A;  1ZHY A;  2UUI A;  1WTY A;  4IB4 A;  3R7C A;  2YKZ A;  2PF4 E;  3TK0 A;  2Y69 C;  2L9J A;  5T3T A;  4CS9 C;  4XPX A;  3DMD A;  4U9D A;  4UDV A;  2Y3G A;  3JSZ A;  5L0C A;  2KW3 C;  3K33 A;  2MWQ A;  1A0B A;  1G4U S;  1LI7 A;  4JTD B;  4BPM A;  1RJ9 B;  3DE8 A;  4G0H A;  4OIN F;  3W2W A;  2QY9 A;  3HLZ A;  1ST6 A;  2VB6 A;  2ZXW C;  2Q3T A;  5L0J A;  3ATP A;  5E2Q A;  1TR2 A;  2XRH A;  5DS5 A;  3EGD B;  3RFY A;  4U5D E;  4CS8 C;  5L0F A;  4Z9H A;  4E7S A;  3A9C A;  4O6Y A;  4JUR I;  4BEJ A;  2LSE A;  4W8K A;  4YL0 A;  1XWJ A;  5FCL A;  4XLP F;  3GM1 A;  4Q5S F;  4ULV A;  3UMH A;  1OCZ C;  3FHD A;  1RCP A;  1NU7 D;  1V4A A;  1Z6A A;  4NTB A;  3SXM A;  3K66 A;  3W2V A;  5JRA A;  1ZHX A;  2GFH A;  4CSA C;  4YK5 A;  2R7R A;  1APC A;  3FOO A;  4KNV A;  5KYX B;  5JLI A;  3C62 A;  3FXH A;  4MVO A;  4RBN A;  4CX9 A;  4C7O B;  3POV A;  1TWH A;  2AU5 A;  4HEA J;  3R2P A;  5JP7 A;  4OIR F;  4LDK A;  4DBQ A;  1VYK A;  3LEO A;  4BEM J;  2A6E F;  2ZXP A;  3S90 A;  3DD7 A;  4CDV A;  1Q0G A;  5L0G A;  3ZTM A;  2P7V A;  3L1M A;  2EPO A;  2HKV A;  4PR9 A;  3RQF A;  1D1B A;  4NC3 A;  3Q6N A;  1WAS A;  1T9K A;  3M79 A;  3TJ5 A;  1B68 A;  2R9R B;  4DRJ B;  2PBE A;  4ZLC A;  3G4X A;  4O79 A;  2DI3 A;  2LQG A;  3IEE A;  4PJN A;  5D91 A;  3AG2 C;  3VF0 A;  5JT4 A;  1BBH A;  5KYY A;  1ZHW A;  3NDB B;  1BR1 A;  4JE9 A;  2KC3 A;  1RJ9 A;  1I5N A;  2ASR A;  2JX0 A;  4JZA A;  2PX3 A;  1KNY A;  2QTV A;  2Y3B A;  3KYI A;  4U5E E;  4X0R A;  2R7X A;  2XS8 A;  3EZH A;  4JEA A;  3ZQV A;  1RKC A;  2OJQ A;  1CPR A;  4P9F A;  3M1C B;  3EFO B;  1JOG A; 
#chains in the Genus database with same CATH homology
 3GWN A;  1JRA A;  3LLK A;  3U5S A;  3W4Y A;  3GWL A;  4E0I A;  3TD7 A;  4E0H A;  1JR8 A;  3MBG A;  3R7C A;  3U2L A;  3O55 A;  3TK0 A;  3LLI A;  2HJ3 A;  3U2M A;  1OQC A;  4LDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...