3GWNA

Crystal structure of the fad binding domain from mimivirus sulfhydryl oxidase r596
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
113
structure length
113
Chain Sequence
ANGLITKIWGTAGWTFNHAVTFGYPLNPTSDDKRRYKNYFISLGDVLPCRLCRESYKKFITTGKTALTNEVLRNRHTLTKWFYDVHNAVNNKLEVDYGLSYEDVVNKYESFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable FAD-linked sulfhydryl oxidase R596
publication title Dimer interface migration in a viral sulfhydryl oxidase
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 46
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3gwnA00
4LDKA 3W4YA 3U2MA 3MBGA 3LLKA 3R7CA 3GWLA 3GWNA 4E0IA 1OQCA 3U5SA 4E0HA 3TK0A 1JR8A 2HJ3A 1JRAA 3LLIA 3O55A 3TD7A 3U2LA
chains in the Genus database with same CATH superfamily
2YQYA 5CI9A 4OINF 2YLDA 2V26A 4RD9A 2L9JA 2YEVA 4N6CA 4A2NB 2HSQA 2OJQA 2LD6A 2J0XA 2XSEA 3S84A 4JIOA 4IARA 3B0PA 4W8PA 3L0IA 4YL3A 4U5FE 1HW2A 4Q7CA 4RBNA 2YKZA 4MNDA 1LM3B 3S27A 1Q0DA 1H9GA 5KYUB 5FCLA 3QVZA 5DQTA 2JD3A 3C18A 3KMIA 3LS1A 4K1OA 5L0HA 1D0ZA 2A6EF 3U9MA 4DOZA 1YYXA 4NTBA 3UNGC 1H6GA 2OKUA 3POVA 1EI7A 2DI3A 2IM8A 2YL3A 1MMNA 2VC9A 2YLGA 3O39A 1F1MA 2LK4A 2R7XA 2X0CA 4CDYA 1ZHZA 2A0UA 2HZ8A 3HKKA 5E3AA 3U3BA 4EBJA 1H9TA 2NUTB 2J7PD 3T6JA 1O5HA 1TFKB 1D1AA 2MYSA 3DE8A 4U5HA 4BEMJ 3BRJA 1ORJA 2RD9A 3HNKA 1NU7D 3QMKA 4PK4A 4DVYP 3H2UA 5B1BC 3R7CA 4CBEA 1E83A 2R7VA 1LI5A 4BJTA 3AQBA 2HMQA 3G4XA 2OU6A 2DYRC 5JUAA 3ITFA 1SF8A 5AC5A 1GS9A 3AG2C 2WL8A 4XEVA 4AX2A 3RIPA 3C63A 4ONSA 3IQCA 1EA8A 3FMSA 3I5QA 4K7BA 3S0XA 3T9OA 4A4AA 2YWAA 2G3VA 1B68A 2J9VA 2Q7RA 1D1CA 3DD7A 1MMAA 4YWQA 4BEJA 1SMYF 2IOQA 3RW0A 4BJ5C 3TULA 2Y3DA 3EG9B 1C17M 3L8IA 4AE4A 3EH2A 3W4YA 4XPXA 2AWCA 4OD4A 1L7CA 1AEPA 4EKWA 3ATPA 2W45A 4FX5A 4MVOA 3E70C 3V7OA 2WVQA 4X0RA 4GEHA 2NUPA 3L34A 2R7RA 4Q5SF 3RQEA 5L0DA 1ZZPA 1VMAA 2P61A 4N6HA 1OCZC 4NCQA 3VAYA 2FFHA 3LEVA 4K0DA 3QZCA 4U9DA 4XPWA 5EK0A 5L0IA 2IBFA 2Y3HA 3HNJA 5KYWB 4JCHA 2NSFA 5B1AC 5DVWA 4BJ1A 1VLTA 4YT4A 4LDRA 4PJJA 4LDQA 3E9VA 4JURI 1AUEA 2EIKC 1OXKA 3N24A 3TJ5A 1ST6A 1WN0A 2A69F 4DBRA 1QSPA 3LLIA 3ABMC 3GEHA 3WG7C 1U0BB 2ZXPA 2HKVA 3NMJA 5B3IA 1ZVZA 1ZYRF 2UUIA 4IRUA 4JZAA 2JX0A 3X2QC 4E17A 4U9EA 3WHNA 1YJGA 3VRCA 3A11A 1M2VA 3NRHA 3KL4A 3C7JA 1BZ4A 4IWBA 3LUTB 3WAQA 1K05A 4JRZA 2KGOA 3J06A 3EGXA 1HE1A 1NBBA 2OJED 3DWWA 3LNRA 3M4CA 1A7VA 4IGGA 4LERA 3JSZA 1TWHA 3K7DA 3K1HA 2Q9AA 5JT4A 5DS5A 3EFOA 3L8JA 2GAQA 2KSFA 4WGZA 1NFNA 3UGPA 3S90A 3DMDA 1Z3IX 2WZLA 2KJGA 1LE2A 1JRAA 1SR2A 3K66A 4KNWA 4PJNA 2EPLX 2QNLA 4RDAA 4CS9A 1CGOA 3RYLA 2XM0A 1T01A 1HE9A 1HMDA 5T1DB 4L6RA 3TQOA 5KYXB 4PACA 3U2LA 1C02A 3GEEA 3ZC4A 2AWYA 2ZXRA 2L6GA 2Z15A 3AQCA 3AOUA 1Q0MA 1I5NA 3C8GA 2LQGA 1DOVA 1OKKD 4O79A 4JEAA 4XQ1A 5E33A 3NYJA 3V5ZA 2XRHA 3B71A 2TMVP 1HMOA 2D4UA 1N1CA 1UG7A 1Y6DA 3M15A 3QTHA 1OW7A 2H8AA 4MW8A 5B3SC 1KU2A 3JSEO 4ER9A 2CNWA 3QW1A 1PD1A 4OIPF 3LNMB 2KK1A 1RCPA 2F22A 4G7OF 2R7QA 4CX9A 3ABKC 1EKYA 2P6VA 4AL1A 2G3KA 1JR8A 1Z5ZA 4H54A 4JKVA 1TR2A 4AE4B 3K6BA 1MMDA 2ASRA 4MTOA 2Q4FA 3DKAA 4GYTA 4ANJA 4JW1A 2G62A 2IYLD 4YT8A 2Q9BA 1V55C 1JAFA 1W2WA 2XXAA 1XZQA 2HJMA 1G4US 3M1CB 5BQIA 2ZXWC 3I4UA 3HJCA 3M4BA 3O10A 2HSBA 2W9YA 3U9JA 4H4KC 3FDQA 2H7OA 1JOGA 1CGNA 3EH1A 3IQ5A 5A6JA 1RKEB 5AC4A 4F4BA 2YL7A 1BR1A 3K1IC 5JSLA 4C3DA 3N2ZB 3U3FA 2CCYA 3F46A 5JS5A 4QI2A 1TKNA 2FAPB 1MNDA 1SYQA 5A6KA 3MX3A 2BE5F 4IB4A 3WODF 1M56C 2IXMA 4CJGA 4KI2A 2CYDA 3JT1A 3SXMA 1ORYA 2Y3BA 4UDVA 4Q4ZF 2LCHA 4MVQA 4DJ9A 4G7HF 4MVSA 2D5RB 1OCRC 1O87A 2R7SA 1LI7A 3S28A 1CPRA 4CIPA 3NYMA 3OA1A 3ZQYA 1U89A 3ZIBA 1Z23A 4BG0A 1E84A 2AU5A 2I8BA 2LIGA 2R9RB 2WVNA 2YRFA 3ASOC 5L0CA 3LLKA 1QLEC 1LIHA 5D92A 4NQFA 5F28E 2A0BA 2XS1A 2R03A 3IQTA 3GWLA 1WASA 2KQ9A 1G4WR 2XLMA 2ZD9A 1LS4A 2LFDA 2PP4A 2YVKA 2GFHA 4IJJA 1NLXA 2XLHA 3DXJF 4ULWA 4LLCA 1OQCA 4G78A 4P9FA 4WGYA 2Y3GA 3GEIA 3UGOA 4BJ6C 3RVZA 4Z9JA 3N0TA 1LE4A 3EGDA 3DJUB 4J7TA 4WABA 4XTKA 3JRMO 3VM6A 4OIRF 1KTMA 2VH3A 3SZRA 4EBBA 3C8GD 5TJ5E 4I1MA 2PNOA 1RXQA 4EWCA 2C04A 3CZ6A 1WATA 3JRTA 4DRHB 1TQGA 1C03A 4LACB 3FAJA 4FWVA 4OD5A 1CGME 1OW8A 3K33A 4XWJA 3RF3A 4O7GA 4JC7A 2J8WA 1T9KA 3TOLA 1A0BA 5HSWA 1QZXA 3MLGA 2YHSA 3PCVA 1RJ9B 3T6GB 1FFTC 4E0IA 4G7ZF 2OCCC 1PCXA 3DAFA 3JYYA 4NTAA 1SZIA 4MTGA 2NPUA 1BBHA 2ZPAA 4E0HA 1ZW3A 3JTLO 4ULVA 2MWQA 3T4RA 4E18A 3HNLA 3RKOF 4CSAC 5DLJA 2Y69C 1JPJA 2R7TA 4G0HA 4DRJB 2UUHA 2LFFA 5CIVA 4CS8C 4JJFA 1FR0A 2Q3TA 3ASNC 4ZLDA 2YLIA 1FMVA 4NTFA 2XS8A 4JTAB 3ZTMA 3ZDLA 4CIHA 5BUOA 2A1DD 3W2WA 2A68F 1J8MF 5L0GA 2YL0A 2XLOA 4P6IC 4C7OA 1Q0GA 2OEXA 4IAQA 1ZU4A 3ABLC 5T3TA 2AVKA 3GM2A 4OIOF 2EPOA 3GORA 1WGWA 1NZEA 4HEAJ 4YJWA 3UMIA 1TWGA 3SEOA 3FOPA 3BEHA 4PJLA 2VCBA 2H7VC 3B9QA 5COGA 2PX3A 1IW7F 1MMGA 5L0FA 3OWTA 4YT2A 1FTSA 2VASA 4KBLA 1BDJB 3LESA 4PR9A 3FOOA 3TK0A 2HS5A 1CPQA 4BJ5A 5BQHA 5HV9A 2QUPA 4MVZA 1YVIA 2OG2A 4Z9IA 3O55A 3T6BA 5EHHA 3ZG1A 2M64A 5CI8A 1YZCA 1APCA 3UR3C 5GPGB 3ZWIA 5A6AA 2R7UA 5KYYA 4YL1A 3ZVRA 1HY5A 1ZHXA 2Y39A 1KNYA 1NG1A 2P1AA 3NDBB 3MYIA 2I15A 5L3QA 1UFBA 3QVYA 1A7DA 2PBEA 1S05A 4DXWA 3NMKA 2RSEB 1T6IA 3AGUA 3KYIA 3DZAA 2V3CC 1XZPA 2IXOA 3U0CA 2CGEA 3B29A 5DQZA 1VB5A 2KW3C 3HTKC 1QVXA 4O6YA 1E85A 4O6NA 4EUKB 1VYIA 4D4NA 4EIYA 1AVOB 1OW6A 1ZHYA 4WJ0A 4J7YA 2QTVA 3LEOA 5FZTA 1E86A 1WWPA 2M4EA 3Q7GA 2R7WA 3GM1A 3CAXA 3HLZA 2J9BA 3KPHA 4P9TA 3VF0A 1WTYA 5JP7A 1I4YA 4CJOA 2EILC 3S9OA 1JPNA 3V5YA 2BL2A 1GQAA 1LPEA 2OEVA 3S29A 5KYNA 1OCOC 2NUPB 4LDKA 1U6HA 1R5ID 2HV6A 3H2VA 2IXNA 1PD0A 2KYHA 2FGYA 4MW3A 3U8PA 1VLSA 3UMKA 1D0YA 3ZSUA 1VYKA 4Z9HA 2HV7A 2NG1A 1VTMP 4YK5A 2DYSC 4MQ9F 1YARO 4HFFB 3W8HA 4C3BA 4XEKA 1Y4CA 2J0WA 3B0VC 3OEOA 3PHF2 4I44A 5JVEA 4FESA 2X51A 1V74B 4GQHA 3FVYA 3M79A 4JVSA 4B6IA 1S7ZA 4CDAA 3AGTA 5KYWA 4PFOA 2PX0A 4HFKB 1M2VB 1NSGB 1ZHTA 3JZ0A 4U5EE 2P7VA 2XLVA 1XWJA 4JCZA 3RQFA 2CW0F 3IEEA 1YZAA 3ZTZA 1M6TA 3EGXB 5E2QA 3DE9A 2J9WA 4M63A 5A6BA 1MNEA 1QKRA 3A9CA 3G50A 2DGJA 1GM5A 4U5BE 1PV3A 3CEXA 3IHUA 3LJBA 4I1OB 3DJNB 3GWNA 3DI5A 2J46A 1YA7O 2KC3A 3EHNA 3EFOB 3RVYA 1QPUA 4E7SA 4JJGA 5T3WA 4OIQF 1M2OA 5IY5C 3Q7LA 1WOLA 2VCAA 2A6HF 5EGYA 3DM9B 4KC9A 4JE9A 1A7EA 1OCCC 4YL0A 2EINC 2H7BA 2HJ3A 3IPMO 1D1BA 2XLDA 4XEFA 1I4ZA 3AG3C 5JLIA 5KYYB 1QQ3A 4JTDB 2EPKX 3C8GB 2XLEA 1YDIA 2WVOA 3ECSA 3CQZA 4U5DE 1FNTc 2O9XA 2CNWD 5E3CA 1O3UA 3K1IA 2XL8A 3SXKA 2PF4E 3L1MA 3FAPB 4DRIB 3W8IA 2B0JA 5KYXA 2LSEA 2Q9CA 3EZIA 2J45A 3ZQVA 3EHMA 3EQLF 3X1OA 1H7IA 1G5ZA 1ZW2A 3C62A 3KH2A 3LS0A 3R2PA 5AGFA 4CS7A 3EJNA 3RFYA 4QDLA 1Z7Qc 1OKKA 3FXHA 5D91A 3PDMP 3B0UX 2R02A 2GA0A 2YZSA 3AG1C 3CSKA 3GODA 4EHPA 1MQVA 4W8KA 2XXAB 2WZFA 2PFDA 1TWAA 2VB6A 1A41A 1T5OA 4R32A 1DOWA 1G8XA 4YT5A 3GANA 1Q0FA 2J9UA 1YLMA 1LVKA 5COFA 4EBKA 2C03A 3U2MA 1V4AA 3IQ6A 3DM5A 1OXBA 4CS9C 2GDCA 1EQ1A 2QLAA 4BJ6A 4FAPB 2GWWA 1M57C 2EIMC 4O6MA 3UMHA 3W2VA 2NSGA 2P0NA 2L6HA 2WB7A 4MTFA 3SYNA 5JRAA 3U5SA 4MVMA 4I3MA 5L3VA 1RKEA 2Q00A 4YN0B 4XLPF 1ZU5A 3SNHA 4N06A 1LS1A 2VCCA 2XLWA 4PFPA 1FMWA 2R25A 4HE8D 2JPUA 5KYUA 1NFOA 5A6BD 1HW1A 3JYHA 2XL6A 4NY3A 3LAYA 2XL4A 3SXZA 5DS4A 5DS6A 1V54C 2EPMX 2OQMA 4N4WA 1E2XA 256BA 3C8ZA 3MYFA 1RKCA 1Z6AA 3GM3A 4J30B 3AJMA 3SP1A 3DAGA 3O6XA 5COMA 3NG1A 4ZLCA 5L0JA 2XM4A 3MBGA 5F5HA 3G4ZA 3KKBA 2B0HA 4XLNF 5A69A 5F5FA 1BR4A 3VYWA 4CSAA 4U5CE 4DBQA 1K04A 1ORSC 2NUTA 3KYJA 1FFHA 3V5XA 4BPMA 2IXPA 1RMVA 2J7PA 3EGDB 3EZHA 4D4XA 3TJ6A 1R4TA 4C3EA 1T6UA 4CS8A 2HFIA 2QE9A 3Q6MA 3MFNA 2QY9A 1NU9C 3HNIA 3JCUQ 2MHRA 2HUJA 3H65A 4IAOA 3US6A 3NKDA 1D0XA 1YA9A 2DB4A 2CDQA 4U5GA 4AK9A 2BC5A 2KNHA 4NC3A 2L6FA 4JEBA 1T6QA 3PMRA 1YAUO 5BQGA 2LP4A 2HMZA 3NYLA 1BR2A 2ETSA 3NKEA 2EIJC 3Q6NA 1TFOB 4AL0A 2AP3A 4MVUA 3F47A 2R05A 2W4BA 1YYJA 5K0IA 3FHDA 1L3PA 2EPNA 2YL1A 3RH3A 1OR3A 1K40A 3EPVA 3EG9A 2WZGA 3NMIA 2ZXOA 3SXYA 3TOMA 4XPYA 3AG4C 4MVRA 1FAPB 3I5PA 4KNVA 4CDVA 1GGQA 3QW0A 1JMWA 4PJMA 1LKXA 1RJ9A 1TWCA 2ICWG 4MS2A 4DVZA 4E7ZA 2W4MA 2E87A 3U8VA 4JTCB 1Q0KA 2L81A 1Z63A 1J8YF 1VOMA 2R7OA 4J32B 1OR2A 1ZHWA 2OOCA 3TD7A 4C7OB 2L7AA 4LLEA 4QI0A 3RQGA 1VK5A 1IZMA
chains in the Genus database with same CATH topology
4LDKA 3W4YA 3U2MA 3MBGA 3LLKA 3R7CA 3GWLA 3GWNA 4E0IA 1OQCA 3U5SA 4E0HA 3TK0A 1JR8A 2HJ3A 1JRAA 3LLIA 3O55A 3TD7A 3U2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDK A;  3W4Y A;  3U2M A;  3MBG A;  3LLK A;  3R7C A;  3GWL A;  3GWN A;  4E0I A;  1OQC A;  3U5S A;  4E0H A;  3TK0 A;  1JR8 A;  2HJ3 A;  1JRA A;  3LLI A;  3O55 A;  3TD7 A;  3U2L A; 
#chains in the Genus database with same CATH topology
 2YQY A;  5CI9 A;  4OIN F;  2YLD A;  2V26 A;  4RD9 A;  2L9J A;  2YEV A;  4N6C A;  4A2N B;  2HSQ A;  2OJQ A;  2LD6 A;  2J0X A;  2XSE A;  3S84 A;  4JIO A;  4IAR A;  3B0P A;  4W8P A;  3L0I A;  4YL3 A;  4U5F E;  1HW2 A;  4Q7C A;  4RBN A;  2YKZ A;  4MND A;  1LM3 B;  3S27 A;  1Q0D A;  1H9G A;  5KYU B;  5FCL A;  3QVZ A;  5DQT A;  2JD3 A;  3C18 A;  3KMI A;  3LS1 A;  4K1O A;  5L0H A;  1D0Z A;  2A6E F;  3U9M A;  4DOZ A;  1YYX A;  4NTB A;  3UNG C;  1H6G A;  2OKU A;  3POV A;  1EI7 A;  2DI3 A;  2IM8 A;  2YL3 A;  1MMN A;  2VC9 A;  2YLG A;  3O39 A;  1F1M A;  2LK4 A;  2R7X A;  2X0C A;  4CDY A;  1ZHZ A;  2A0U A;  2HZ8 A;  3HKK A;  5E3A A;  3U3B A;  4EBJ A;  1H9T A;  2NUT B;  2J7P D;  3T6J A;  1O5H A;  1TFK B;  1D1A A;  2MYS A;  3DE8 A;  4U5H A;  4BEM J;  3BRJ A;  1ORJ A;  2RD9 A;  3HNK A;  1NU7 D;  3QMK A;  4PK4 A;  4DVY P;  3H2U A;  5B1B C;  3R7C A;  4CBE A;  1E83 A;  2R7V A;  1LI5 A;  4BJT A;  3AQB A;  2HMQ A;  3G4X A;  2OU6 A;  2DYR C;  5JUA A;  3ITF A;  1SF8 A;  5AC5 A;  1GS9 A;  3AG2 C;  2WL8 A;  4XEV A;  4AX2 A;  3RIP A;  3C63 A;  4ONS A;  3IQC A;  1EA8 A;  3FMS A;  3I5Q A;  4K7B A;  3S0X A;  3T9O A;  4A4A A;  2YWA A;  2G3V A;  1B68 A;  2J9V A;  2Q7R A;  1D1C A;  3DD7 A;  1MMA A;  4YWQ A;  4BEJ A;  1SMY F;  2IOQ A;  3RW0 A;  4BJ5 C;  3TUL A;  2Y3D A;  3EG9 B;  1C17 M;  3L8I A;  4AE4 A;  3EH2 A;  3W4Y A;  4XPX A;  2AWC A;  4OD4 A;  1L7C A;  1AEP A;  4EKW A;  3ATP A;  2W45 A;  4FX5 A;  4MVO A;  3E70 C;  3V7O A;  2WVQ A;  4X0R A;  4GEH A;  2NUP A;  3L34 A;  2R7R A;  4Q5S F;  3RQE A;  5L0D A;  1ZZP A;  1VMA A;  2P61 A;  4N6H A;  1OCZ C;  4NCQ A;  3VAY A;  2FFH A;  3LEV A;  4K0D A;  3QZC A;  4U9D A;  4XPW A;  5EK0 A;  5L0I A;  2IBF A;  2Y3H A;  3HNJ A;  5KYW B;  4JCH A;  2NSF A;  5B1A C;  5DVW A;  4BJ1 A;  1VLT A;  4YT4 A;  4LDR A;  4PJJ A;  4LDQ A;  3E9V A;  4JUR I;  1AUE A;  2EIK C;  1OXK A;  3N24 A;  3TJ5 A;  1ST6 A;  1WN0 A;  2A69 F;  4DBR A;  1QSP A;  3LLI A;  3ABM C;  3GEH A;  3WG7 C;  1U0B B;  2ZXP A;  2HKV A;  3NMJ A;  5B3I A;  1ZVZ A;  1ZYR F;  2UUI A;  4IRU A;  4JZA A;  2JX0 A;  3X2Q C;  4E17 A;  4U9E A;  3WHN A;  1YJG A;  3VRC A;  3A11 A;  1M2V A;  3NRH A;  3KL4 A;  3C7J A;  1BZ4 A;  4IWB A;  3LUT B;  3WAQ A;  1K05 A;  4JRZ A;  2KGO A;  3J06 A;  3EGX A;  1HE1 A;  1NBB A;  2OJE D;  3DWW A;  3LNR A;  3M4C A;  1A7V A;  4IGG A;  4LER A;  3JSZ A;  1TWH A;  3K7D A;  3K1H A;  2Q9A A;  5JT4 A;  5DS5 A;  3EFO A;  3L8J A;  2GAQ A;  2KSF A;  4WGZ A;  1NFN A;  3UGP A;  3S90 A;  3DMD A;  1Z3I X;  2WZL A;  2KJG A;  1LE2 A;  1JRA A;  1SR2 A;  3K66 A;  4KNW A;  4PJN A;  2EPL X;  2QNL A;  4RDA A;  4CS9 A;  1CGO A;  3RYL A;  2XM0 A;  1T01 A;  1HE9 A;  1HMD A;  5T1D B;  4L6R A;  3TQO A;  5KYX B;  4PAC A;  3U2L A;  1C02 A;  3GEE A;  3ZC4 A;  2AWY A;  2ZXR A;  2L6G A;  2Z15 A;  3AQC A;  3AOU A;  1Q0M A;  1I5N A;  3C8G A;  2LQG A;  1DOV A;  1OKK D;  4O79 A;  4JEA A;  4XQ1 A;  5E33 A;  3NYJ A;  3V5Z A;  2XRH A;  3B71 A;  2TMV P;  1HMO A;  2D4U A;  1N1C A;  1UG7 A;  1Y6D A;  3M15 A;  3QTH A;  1OW7 A;  2H8A A;  4MW8 A;  5B3S C;  1KU2 A;  3JSE O;  4ER9 A;  2CNW A;  3QW1 A;  1PD1 A;  4OIP F;  3LNM B;  2KK1 A;  1RCP A;  2F22 A;  4G7O F;  2R7Q A;  4CX9 A;  3ABK C;  1EKY A;  2P6V A;  4AL1 A;  2G3K A;  1JR8 A;  1Z5Z A;  4H54 A;  4JKV A;  1TR2 A;  4AE4 B;  3K6B A;  1MMD A;  2ASR A;  4MTO A;  2Q4F A;  3DKA A;  4GYT A;  4ANJ A;  4JW1 A;  2G62 A;  2IYL D;  4YT8 A;  2Q9B A;  1V55 C;  1JAF A;  1W2W A;  2XXA A;  1XZQ A;  2HJM A;  1G4U S;  3M1C B;  5BQI A;  2ZXW C;  3I4U A;  3HJC A;  3M4B A;  3O10 A;  2HSB A;  2W9Y A;  3U9J A;  4H4K C;  3FDQ A;  2H7O A;  1JOG A;  1CGN A;  3EH1 A;  3IQ5 A;  5A6J A;  1RKE B;  5AC4 A;  4F4B A;  2YL7 A;  1BR1 A;  3K1I C;  5JSL A;  4C3D A;  3N2Z B;  3U3F A;  2CCY A;  3F46 A;  5JS5 A;  4QI2 A;  1TKN A;  2FAP B;  1MND A;  1SYQ A;  5A6K A;  3MX3 A;  2BE5 F;  4IB4 A;  3WOD F;  1M56 C;  2IXM A;  4CJG A;  4KI2 A;  2CYD A;  3JT1 A;  3SXM A;  1ORY A;  2Y3B A;  4UDV A;  4Q4Z F;  2LCH A;  4MVQ A;  4DJ9 A;  4G7H F;  4MVS A;  2D5R B;  1OCR C;  1O87 A;  2R7S A;  1LI7 A;  3S28 A;  1CPR A;  4CIP A;  3NYM A;  3OA1 A;  3ZQY A;  1U89 A;  3ZIB A;  1Z23 A;  4BG0 A;  1E84 A;  2AU5 A;  2I8B A;  2LIG A;  2R9R B;  2WVN A;  2YRF A;  3ASO C;  5L0C A;  3LLK A;  1QLE C;  1LIH A;  5D92 A;  4NQF A;  5F28 E;  2A0B A;  2XS1 A;  2R03 A;  3IQT A;  3GWL A;  1WAS A;  2KQ9 A;  1G4W R;  2XLM A;  2ZD9 A;  1LS4 A;  2LFD A;  2PP4 A;  2YVK A;  2GFH A;  4IJJ A;  1NLX A;  2XLH A;  3DXJ F;  4ULW A;  4LLC A;  1OQC A;  4G78 A;  4P9F A;  4WGY A;  2Y3G A;  3GEI A;  3UGO A;  4BJ6 C;  3RVZ A;  4Z9J A;  3N0T A;  1LE4 A;  3EGD A;  3DJU B;  4J7T A;  4WAB A;  4XTK A;  3JRM O;  3VM6 A;  4OIR F;  1KTM A;  2VH3 A;  3SZR A;  4EBB A;  3C8G D;  5TJ5 E;  4I1M A;  2PNO A;  1RXQ A;  4EWC A;  2C04 A;  3CZ6 A;  1WAT A;  3JRT A;  4DRH B;  1TQG A;  1C03 A;  4LAC B;  3FAJ A;  4FWV A;  4OD5 A;  1CGM E;  1OW8 A;  3K33 A;  4XWJ A;  3RF3 A;  4O7G A;  4JC7 A;  2J8W A;  1T9K A;  3TOL A;  1A0B A;  5HSW A;  1QZX A;  3MLG A;  2YHS A;  3PCV A;  1RJ9 B;  3T6G B;  1FFT C;  4E0I A;  4G7Z F;  2OCC C;  1PCX A;  3DAF A;  3JYY A;  4NTA A;  1SZI A;  4MTG A;  2NPU A;  1BBH A;  2ZPA A;  4E0H A;  1ZW3 A;  3JTL O;  4ULV A;  2MWQ A;  3T4R A;  4E18 A;  3HNL A;  3RKO F;  4CSA C;  5DLJ A;  2Y69 C;  1JPJ A;  2R7T A;  4G0H A;  4DRJ B;  2UUH A;  2LFF A;  5CIV A;  4CS8 C;  4JJF A;  1FR0 A;  2Q3T A;  3ASN C;  4ZLD A;  2YLI A;  1FMV A;  4NTF A;  2XS8 A;  4JTA B;  3ZTM A;  3ZDL A;  4CIH A;  5BUO A;  2A1D D;  3W2W A;  2A68 F;  1J8M F;  5L0G A;  2YL0 A;  2XLO A;  4P6I C;  4C7O A;  1Q0G A;  2OEX A;  4IAQ A;  1ZU4 A;  3ABL C;  5T3T A;  2AVK A;  3GM2 A;  4OIO F;  2EPO A;  3GOR A;  1WGW A;  1NZE A;  4HEA J;  4YJW A;  3UMI A;  1TWG A;  3SEO A;  3FOP A;  3BEH A;  4PJL A;  2VCB A;  2H7V C;  3B9Q A;  5COG A;  2PX3 A;  1IW7 F;  1MMG A;  5L0F A;  3OWT A;  4YT2 A;  1FTS A;  2VAS A;  4KBL A;  1BDJ B;  3LES A;  4PR9 A;  3FOO A;  3TK0 A;  2HS5 A;  1CPQ A;  4BJ5 A;  5BQH A;  5HV9 A;  2QUP A;  4MVZ A;  1YVI A;  2OG2 A;  4Z9I A;  3O55 A;  3T6B A;  5EHH A;  3ZG1 A;  2M64 A;  5CI8 A;  1YZC A;  1APC A;  3UR3 C;  5GPG B;  3ZWI A;  5A6A A;  2R7U A;  5KYY A;  4YL1 A;  3ZVR A;  1HY5 A;  1ZHX A;  2Y39 A;  1KNY A;  1NG1 A;  2P1A A;  3NDB B;  3MYI A;  2I15 A;  5L3Q A;  1UFB A;  3QVY A;  1A7D A;  2PBE A;  1S05 A;  4DXW A;  3NMK A;  2RSE B;  1T6I A;  3AGU A;  3KYI A;  3DZA A;  2V3C C;  1XZP A;  2IXO A;  3U0C A;  2CGE A;  3B29 A;  5DQZ A;  1VB5 A;  2KW3 C;  3HTK C;  1QVX A;  4O6Y A;  1E85 A;  4O6N A;  4EUK B;  1VYI A;  4D4N A;  4EIY A;  1AVO B;  1OW6 A;  1ZHY A;  4WJ0 A;  4J7Y A;  2QTV A;  3LEO A;  5FZT A;  1E86 A;  1WWP A;  2M4E A;  3Q7G A;  2R7W A;  3GM1 A;  3CAX A;  3HLZ A;  2J9B A;  3KPH A;  4P9T A;  3VF0 A;  1WTY A;  5JP7 A;  1I4Y A;  4CJO A;  2EIL C;  3S9O A;  1JPN A;  3V5Y A;  2BL2 A;  1GQA A;  1LPE A;  2OEV A;  3S29 A;  5KYN A;  1OCO C;  2NUP B;  4LDK A;  1U6H A;  1R5I D;  2HV6 A;  3H2V A;  2IXN A;  1PD0 A;  2KYH A;  2FGY A;  4MW3 A;  3U8P A;  1VLS A;  3UMK A;  1D0Y A;  3ZSU A;  1VYK A;  4Z9H A;  2HV7 A;  2NG1 A;  1VTM P;  4YK5 A;  2DYS C;  4MQ9 F;  1YAR O;  4HFF B;  3W8H A;  4C3B A;  4XEK A;  1Y4C A;  2J0W A;  3B0V C;  3OEO A;  3PHF 2;  4I44 A;  5JVE A;  4FES A;  2X51 A;  1V74 B;  4GQH A;  3FVY A;  3M79 A;  4JVS A;  4B6I A;  1S7Z A;  4CDA A;  3AGT A;  5KYW A;  4PFO A;  2PX0 A;  4HFK B;  1M2V B;  1NSG B;  1ZHT A;  3JZ0 A;  4U5E E;  2P7V A;  2XLV A;  1XWJ A;  4JCZ A;  3RQF A;  2CW0 F;  3IEE A;  1YZA A;  3ZTZ A;  1M6T A;  3EGX B;  5E2Q A;  3DE9 A;  2J9W A;  4M63 A;  5A6B A;  1MNE A;  1QKR A;  3A9C A;  3G50 A;  2DGJ A;  1GM5 A;  4U5B E;  1PV3 A;  3CEX A;  3IHU A;  3LJB A;  4I1O B;  3DJN B;  3GWN A;  3DI5 A;  2J46 A;  1YA7 O;  2KC3 A;  3EHN A;  3EFO B;  3RVY A;  1QPU A;  4E7S A;  4JJG A;  5T3W A;  4OIQ F;  1M2O A;  5IY5 C;  3Q7L A;  1WOL A;  2VCA A;  2A6H F;  5EGY A;  3DM9 B;  4KC9 A;  4JE9 A;  1A7E A;  1OCC C;  4YL0 A;  2EIN C;  2H7B A;  2HJ3 A;  3IPM O;  1D1B A;  2XLD A;  4XEF A;  1I4Z A;  3AG3 C;  5JLI A;  5KYY B;  1QQ3 A;  4JTD B;  2EPK X;  3C8G B;  2XLE A;  1YDI A;  2WVO A;  3ECS A;  3CQZ A;  4U5D E;  1FNT c;  2O9X A;  2CNW D;  5E3C A;  1O3U A;  3K1I A;  2XL8 A;  3SXK A;  2PF4 E;  3L1M A;  3FAP B;  4DRI B;  3W8I A;  2B0J A;  5KYX A;  2LSE A;  2Q9C A;  3EZI A;  2J45 A;  3ZQV A;  3EHM A;  3EQL F;  3X1O A;  1H7I A;  1G5Z A;  1ZW2 A;  3C62 A;  3KH2 A;  3LS0 A;  3R2P A;  5AGF A;  4CS7 A;  3EJN A;  3RFY A;  4QDL A;  1Z7Q c;  1OKK A;  3FXH A;  5D91 A;  3PDM P;  3B0U X;  2R02 A;  2GA0 A;  2YZS A;  3AG1 C;  3CSK A;  3GOD A;  4EHP A;  1MQV A;  4W8K A;  2XXA B;  2WZF A;  2PFD A;  1TWA A;  2VB6 A;  1A41 A;  1T5O A;  4R32 A;  1DOW A;  1G8X A;  4YT5 A;  3GAN A;  1Q0F A;  2J9U A;  1YLM A;  1LVK A;  5COF A;  4EBK A;  2C03 A;  3U2M A;  1V4A A;  3IQ6 A;  3DM5 A;  1OXB A;  4CS9 C;  2GDC A;  1EQ1 A;  2QLA A;  4BJ6 A;  4FAP B;  2GWW A;  1M57 C;  2EIM C;  4O6M A;  3UMH A;  3W2V A;  2NSG A;  2P0N A;  2L6H A;  2WB7 A;  4MTF A;  3SYN A;  5JRA A;  3U5S A;  4MVM A;  4I3M A;  5L3V A;  1RKE A;  2Q00 A;  4YN0 B;  4XLP F;  1ZU5 A;  3SNH A;  4N06 A;  1LS1 A;  2VCC A;  2XLW A;  4PFP A;  1FMW A;  2R25 A;  4HE8 D;  2JPU A;  5KYU A;  1NFO A;  5A6B D;  1HW1 A;  3JYH A;  2XL6 A;  4NY3 A;  3LAY A;  2XL4 A;  3SXZ A;  5DS4 A;  5DS6 A;  1V54 C;  2EPM X;  2OQM A;  4N4W A;  1E2X A;  256B A;  3C8Z A;  3MYF A;  1RKC A;  1Z6A A;  3GM3 A;  4J30 B;  3AJM A;  3SP1 A;  3DAG A;  3O6X A;  5COM A;  3NG1 A;  4ZLC A;  5L0J A;  2XM4 A;  3MBG A;  5F5H A;  3G4Z A;  3KKB A;  2B0H A;  4XLN F;  5A69 A;  5F5F A;  1BR4 A;  3VYW A;  4CSA A;  4U5C E;  4DBQ A;  1K04 A;  1ORS C;  2NUT A;  3KYJ A;  1FFH A;  3V5X A;  4BPM A;  2IXP A;  1RMV A;  2J7P A;  3EGD B;  3EZH A;  4D4X A;  3TJ6 A;  1R4T A;  4C3E A;  1T6U A;  4CS8 A;  2HFI A;  2QE9 A;  3Q6M A;  3MFN A;  2QY9 A;  1NU9 C;  3HNI A;  3JCU Q;  2MHR A;  2HUJ A;  3H65 A;  4IAO A;  3US6 A;  3NKD A;  1D0X A;  1YA9 A;  2DB4 A;  2CDQ A;  4U5G A;  4AK9 A;  2BC5 A;  2KNH A;  4NC3 A;  2L6F A;  4JEB A;  1T6Q A;  3PMR A;  1YAU O;  5BQG A;  2LP4 A;  2HMZ A;  3NYL A;  1BR2 A;  2ETS A;  3NKE A;  2EIJ C;  3Q6N A;  1TFO B;  4AL0 A;  2AP3 A;  4MVU A;  3F47 A;  2R05 A;  2W4B A;  1YYJ A;  5K0I A;  3FHD A;  1L3P A;  2EPN A;  2YL1 A;  3RH3 A;  1OR3 A;  1K40 A;  3EPV A;  3EG9 A;  2WZG A;  3NMI A;  2ZXO A;  3SXY A;  3TOM A;  4XPY A;  3AG4 C;  4MVR A;  1FAP B;  3I5P A;  4KNV A;  4CDV A;  1GGQ A;  3QW0 A;  1JMW A;  4PJM A;  1LKX A;  1RJ9 A;  1TWC A;  2ICW G;  4MS2 A;  4DVZ A;  4E7Z A;  2W4M A;  2E87 A;  3U8V A;  4JTC B;  1Q0K A;  2L81 A;  1Z63 A;  1J8Y F;  1VOM A;  2R7O A;  4J32 B;  1OR2 A;  1ZHW A;  2OOC A;  3TD7 A;  4C7O B;  2L7A A;  4LLE A;  4QI0 A;  3RQG A;  1VK5 A;  1IZM A; 
#chains in the Genus database with same CATH homology
 4LDK A;  3W4Y A;  3U2M A;  3MBG A;  3LLK A;  3R7C A;  3GWL A;  3GWN A;  4E0I A;  1OQC A;  3U5S A;  4E0H A;  3TK0 A;  1JR8 A;  2HJ3 A;  1JRA A;  3LLI A;  3O55 A;  3TD7 A;  3U2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...