2LSEA

Solution nmr structure of de novo designed four helix bundle protein, northeast structural genomics consortium (nesg) target or188
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of a Denovo Design Four Helix Bundle Protein, Northeast Structural Genomics Consortium Target OR188
rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords Four Helix Bundle Protein
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1360 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2lseA00
2LSEA
chains in the Genus database with same CATH superfamily
1YA9A 3KYJA 1E86A 4XWJA 1M6TA 3IEEA 3ZDLA 2HS5A 2OG2A 4JURI 4XTKA 3FOPA 3OEOA 4XPWA 1YA7O 5COMA 3WODF 4C7OB 2HJ3A 3N24A 3ABLC 3FHDA 3M79A 4W8KA 2NPUA 3LUTB 5F28E 4HFKB 2G62A 5A6BA 2QNLA 4DJ9A 1V55C 2ZXOA 1OXKA 3AQCA 4MVMA 4PJNA 2L6GA 2CNWD 5E2QA 4CS7A 2OCCC 4BJ5A 1B68A 3EZIA 3NYJA 1L7CA 1OW6A 4BJ5C 3ZVRA 3G50A 2CCYA 2IXNA 1JAFA 3C8GB 2Q9BA 4QDLA 4MQ9F 1BR1A 1BDJB 3GEIA 1IZMA 3KH2A 3LEOA 1G4WR 4GYTA 1FTSA 1QLEC 1XZPA 2VC9A 3LLIA 2Y3GA 3KYIA 2GDCA 2MWQA 1M2VB 4GEHA 5D91A 3ZC4A 4KI2A 4BJTA 4YK5A 1VOMA 1Y4CA 4LERA 1HE9A 3TOMA 4YL3A 3E9VA 5JUAA 1BR4A 1YDIA 2QY9A 3Q6MA 4FX5A 2YQYA 3HTKC 4NCQA 4RDAA 2XLHA 4EUKB 3S9OA 1ZHXA 2KYHA 2LSEA 4NTAA 1E83A 2GAQA 4MVUA 5KYXA 4MVZA 4AE4B 2QUPA 2LCHA 2PX3A 4MW3A 3U8PA 3NDBB 4JTDB 3U9JA 3RVZA 1YYJA 2KQ9A 4ER9A 3E70C 2QLAA 4K7BA 4WJ0A 3W4YA 3ASNC 2L6HA 1O5HA 2MHRA 3RFYA 4PJJA 256BA 1RMVA 2WZLA 4EBKA 3B0UX 1QKRA 2HFIA 2W9YA 1QZXA 3ECSA 3QZCA 4K1OA 1TFOB 2HJMA 1H9GA 2IYLD 2XLMA 3V5ZA 4BG0A 3QW0A 4DRHB 1YAUO 1UG7A 4U5GA 4UDVA 4KBLA 4U9DA 3L8JA 3DKAA 1OCZC 3L8IA 4CIHA 1MMAA 4MTFA 3QW1A 1RCPA 3EH1A 2A0UA 2Y39A 4PR9A 2EPLX 2JD3A 1J8YF 1VYKA 1C17M 2NUTA 4O6MA 2AWYA 4FAPB 4GQHA 3S0XA 3B9QA 3OWTA 2R25A 1VB5A 2P6VA 3DMDA 2WZFA 3EG9B 1QQ3A 4I1OB 3TD7A 1ZU4A 1W2WA 2KNHA 1YZAA 1OR3A 5DQTA 2EINC 1KNYA 1VMAA 3N0TA 4IAQA 4XEFA 3TJ5A 3DAGA 1HMOA 3NMIA 1YJGA 3LESA 4P6IC 5CI8A 4D4XA 3O55A 3U9MA 3AGUA 4F4BA 1FNTc 3EPVA 2A1DD 4U9EA 3LJBA 2PBEA 4CS8A 2XRHA 4W8PA 2CYDA 2ZPAA 4K0DA 4O79A 3GEEA 5F5HA 4BJ6C 3C62A 4WGYA 4AK9A 4IRUA 2R7WA 5L0HA 1LE2A 4H4KC 4Q7CA 3GORA 3MLGA 4MS2A 4U5EE 5EGYA 3LEVA 3K1HA 5L0DA 3LS1A 5FZTA 1T6UA 4J32B 3SNHA 4ANJA 1HW1A 4IAOA 3PMRA 4CJOA 4EHPA 3MFNA 1MNDA 3MYFA 4IB4A 5A6AA 1TQGA 1O3UA 2YZSA 3DE9A 2RD9A 3GWNA 3K1IC 2WZGA 1E2XA 3SP1A 4CS9A 3UR3C 2VB6A 1WASA 1APCA 5L0IA 1LS4A 4NTBA 3R2PA 2CNWA 1PD0A 1TWGA 2Y3DA 1YZCA 1Q0KA 3J06A 1QPUA 2R7UA 4N6HA 4YL1A 1LIHA 2OU6A 2OQMA 5KYWA 1LS1A 4C3EA 3O10A 3EGXA 3K33A 4JTCB 3OA1A 3VYWA 4AL0A 4FWVA 1U6HA 2J45A 4I44A 1WATA 4DBQA 5B3SC 3VF0A 4EIYA 2AVKA 5L3VA 2Q9CA 2YL7A 4MW8A 4PFOA 5BQGA 1WWPA 5T3TA 2OEVA 5A6KA 2CW0F 1D0YA 3C8ZA 2YVKA 5BQHA 1H9TA 2R02A 3TK0A 2PFDA 3EG9A 2ASRA 4U5DE 1LKXA 3C63A 4JRZA 1VYIA 4IGGA 1ZHWA 1G4US 3U2MA 3EGDB 3ZWIA 3IPMO 1ZZPA 2P7VA 3Q7GA 5TJ5E 3WG7C 3C8GA 3MX3A 4MVSA 2J9BA 3DI5A 1NBBA 3TOLA 1WN0A 2YEVA 3CQZA 1ZYRF 1TR2A 4PJLA 5A6BD 1ZW3A 5KYWB 4DRJB 3ATPA 2R03A 5EK0A 1Z6AA 2CDQA 2L6FA 3EFOB 2GWWA 3IHUA 2J9WA 1HMDA 4IARA 4OIRF 1L3PA 1M57C 1H7IA 3M4CA 4O7GA 3W2WA 4C3BA 4G7OF 3NKDA 3NMKA 3U8VA 1IW7F 2E87A 2HV7A 2KK1A 4JZAA 2QE9A 3FMSA 3U3BA 4DXWA 5DS6A 3C7JA 4XLNF 2W45A 1OQCA 2EPNA 2FGYA 3VRCA 5KYYA 3KL4A 4MTOA 2ZXPA 3G4ZA 4E7ZA 2WVQA 3W8IA 3HKKA 4DOZA 1MNEA 2YL3A 3LAYA 4X0RA 5CI9A 3L1MA 4YN0B 1BZ4A 1LI7A 2Q3TA 1MQVA 2OOCA 2DYRC 1C02A 2OKUA 2YRFA 3DM9B 3HNJA 3LNMB 4Z9JA 5F5FA 2XL6A 4BEJA 2I15A 1K40A 4ZLCA 5COGA 1CPQA 5DS4A 4JIOA 3AG4C 2OJQA 1KTMA 1A7VA 2XLDA 2H7BA 2A69F 2B0HA 3EZHA 3EQLF 1ZHZA 3RW0A 4WGZA 1RXQA 2L7AA 2EILC 1TKNA 3Q6NA 4NTFA 2XL8A 3RKOF 1M2VA 3S27A 5DQZA 1OXBA 3DM5A 4LDQA 4Z9IA 2C03A 5T3WA 3BRJA 3RVYA 4EBBA 3TJ6A 1SZIA 4I1MA 2JX0A 4Z9HA 3JRMO 4XEVA 3UGPA 2HV6A 1SF8A 2J0XA 5JSLA 1JPNA 2UUHA 1RJ9B 3TULA 4OIOF 2XLOA 2DI3A 1Z63A 1D1AA 1JRAA 3B0PA 2PX0A 3SXMA 1JMWA 1CGOA 4CDAA 4YT5A 2J7PD 2J9VA 4JC7A 4LDKA 1VLTA 2P61A 4KNWA 5D92A 2XSEA 1BBHA 3HNIA 1Z7Qc 3RH3A 4CX9A 5JS5A 1NZEA 4PFPA 3V5YA 2HMZA 3G4XA 5JP7A 2XLEA 2R7RA 2XXAB 1UFBA 4LLEA 3VAYA 1D0ZA 4JTAB 3DJUB 1VTMP 4C7OA 4XLPF 3X1OA 2YLGA 3ZG1A 1T01A 2I8BA 2R9RB 2R7OA 4A2NB 1H6GA 4H54A 3M15A 1S05A 4PK4A 4HFFB 3ZQVA 3ZTMA 2KGOA 1NG1A 1EQ1A 1HE1A 2LFFA 1CPRA 4U5FE 1HY5A 2JPUA 2PF4E 1T6QA 3SXKA 1Q0DA 4CDYA 5AGFA 3LLKA 4G7ZF 1AVOB 2H7VC 2DB4A 3M4BA 2PNOA 3SXYA 2IBFA 3DAFA 2H8AA 4M63A 3GANA 1Q0FA 5JVEA 3LS0A 4N4WA 2C04A 1E85A 1LVKA 3GM1A 1OCRC 4G0HA 5FCLA 1C03A 3I5PA 1XZQA 3V5XA 4KNVA 2MYSA 3ZIBA 2J8WA 1OW8A 2LIGA 3BEHA 1OKKA 3AGTA 4N06A 4G78A 1RKEA 1ORYA 4NQFA 3K1IA 1LI5A 4XPYA 2F22A 3DD7A 4YT8A 3DJNB 2L81A 2P1AA 4YWQA 4NY3A 2Z15A 2LD6A 2BE5F 2DYSC 3NRHA 3NYMA 4RD9A 1YYXA 3C18A 3U3FA 1KU2A 3RQFA 3L34A 4EWCA 3C8GD 3FVYA 1NFNA 3HLZA 4R32A 3WHNA 4CBEA 1GS9A 1NU9C 1YARO 2RSEB 2J9UA 1Z23A 3EHMA 3FOOA 3FXHA 3GM2A 3GODA 3JSZA 2WL8A 2YWAA 3A11A 4EKWA 5KYUB 3ABKC 2R7VA 2R7TA 4C3DA 2H7OA 4MVQA 4B6IA 1SYQA 4U5CE 5B3IA 1EI7A 4XPXA 2YHSA 3UGOA 3IQ6A 4JVSA 5EHHA 2R7XA 5BQIA 1FMVA 4E7SA 1ZVZA 4FESA 2P0NA 2XS8A 4CS8C 2B0JA 3K66A 1TWAA 3B0VC 3POVA 3Q7LA 3K6BA 3AOUA 1RJ9A 2YKZA 1RKCA 4BJ6A 4JE9A 1WGWA 1PCXA 3PCVA 2NSGA 3QVZA 4KC9A 3T4RA 3TQOA 4QI2A 3A9CA 5KYYB 2XLWA 3ZQYA 3GWLA 4DBRA 1HW2A 2YL0A 2ZXWC 3UMIA 1V54C 3U2LA 3CEXA 3US6A 2XXAA 4P9TA 2V3CC 2VCBA 2KJGA 4OIQF 4L6RA 4AE4A 4E18A 3EFOA 2NUTB 1FMWA 1NSGB 3RIPA 3V7OA 1D1BA 1AUEA 2KSFA 3PDMP 5JRAA 1D1CA 3X2QC 4OIPF 2AU5A 2HUJA 4E17A 5JT4A 1DOWA 2KC3A 1OW7A 4DVYP 2J46A 2WB7A 4JJFA 1A41A 2A0BA 2EIMC 2J0WA 3JTLO 4IJJA 2Q7RA 2VCAA 3T6GB 1E84A 3O39A 2A68F 2GFHA 2W4BA 1FFTC 1A0BA 1SMYF 2NG1A 3NG1A 3UMHA 5K0IA 1Q0MA 2GA0A 3I4UA 3JCUQ 2A6HF 3HNKA 3MBGA 4OD5A 5GPGB 4AX2A 1WOLA 1V74B 2IM8A 2OEXA 3FAPB 4HEAJ 5IY5C 4YT4A 1T9KA 3T6BA 3KMIA 4BPMA 1CGNA 3S84A 1YLMA 1T5OA 3FDQA 4XQ1A 2D5RB 2BC5A 2Q00A 2KW3C 1NU7D 3VM6A 1OR2A 2WVNA 4MVOA 1LM3B 3CSKA 1TWHA 3T9OA 1JR8A 3IQTA 1M56C 2G3VA 1JOGA 2PP4A 4LACB 2BL2A 1AEPA 3JZ0A 4YT2A 1V4AA 1WTYA 4CIPA 1U89A 2XM0A 3EJNA 1EKYA 2DGJA 5E33A 4BJ1A 2XLVA 2HSQA 4EBJA 4IWBA 3SZRA 4U5HA 3H2UA 1G5ZA 3QVYA 2UUIA 5COFA 3R7CA 3KPHA 3EGDA 5KYNA 1VK5A 4WABA 2X51A 2XS1A 3K7DA 4D4NA 4LDRA 5HV9A 3S90A 1T6IA 1CGME 4XEKA 3JT1A 1S7ZA 2R05A 5DLJA 1I4YA 4JW1A 3ABMC 3DXJF 4HE8D 2LP4A 2O9XA 3FAJA 3AG1C 2ZD9A 2EPMX 4J7TA 2W4MA 3MYIA 3NKEA 4MTGA 3RQGA 5L3QA 5A69A 3QMKA 3IQ5A 1NFOA 4I3MA 5KYXB 2QTVA 3DE8A 5L0JA 4RBNA 4MVRA 2X0CA 3UMKA 5B1BC 1PV3A 4BEMJ 1VLSA 4O6NA 2NUPA 1Z5ZA 3AG3C 1FFHA 4E0HA 1M2OA 1LPEA 4OINF 1K05A 2IXPA 1LE4A 3GM3A 4LLCA 3RF3A 4ULVA 1A7DA 4AL1A 1F1MA 4NC3A 2LFDA 1Y6DA 2Q9AA 5L0GA 5E3CA 1GM5A 4JEAA 4A4AA 5L0FA 3I5QA 2VCCA 2L9JA 1I4ZA 2HMQA 3JSEO 2ICWG 1BR2A 2VASA 1EA8A 1R5ID 1D0XA 1ZW2A 4JCHA 2EPKX 3RQEA 1I5NA 1MMDA 4J7YA 4PACA 4DRIB 3PHF2 4CSAA 1K04A 1TWCA 2CGEA 1O87A 2HKVA 2FFHA 3DWWA 3LNRA 3ZTZA 4MNDA 3W8HA 3O6XA 4CSAC 2AWCA 3IQCA 3S29A 2NSFA 2ETSA 5A6JA 1FAPB 1OKKD 2HZ8A 2EIKC 2G3KA 2M64A 3KKBA 4PJMA 4O6YA 3AG2C 5AC5A 1R4TA 3S28A 3AJMA 2Y3BA 3CZ6A 1ORSC 1Q0GA 3JYHA 1XWJA 4CS9C 2A6EF 3WAQA 3CAXA 2LK4A 2XL4A 2IXOA 4YL0A 3B29A 4Q5SF 2FAPB 4P9FA 2OJED 3DZAA 3ITFA 1MMGA 2D4UA 3JYYA 5B1AC 1OCOC 4CDVA 3QTHA 4JCZA 1QVXA 4QI0A 4YJWA 3HNLA 2NUPB 1J8MF 1ZU5A 4ULWA 5DVWA 5CIVA 2V26A 3SXZA 1GGQA 2VH3A 2YLDA 1G8XA 3EGXB 4N6CA 5HSWA 1U0BB 3U5SA 2ZXRA 3EH2A 5BUOA 3F46A 3GEHA 2WVOA 2Y69C 5KYUA 1ZHTA 1JPJA 2Q4FA 2TMVP 4OD4A 3F47A 1A7EA 5DS5A 3HJCA 3T6JA 1ZHYA 2HSBA 2Y3HA 5L0CA 1GQAA 1TFKB 3AQBA 4ZLDA 1OCCC 2LQGA 4DVZA 4JEBA 2J7PA 4Q4ZF 3N2ZB 3NYLA 4E0IA 1RKEB 3JRTA 3H65A 2R7QA 5T1DB 3U0CA 1PD1A 1YVIA 3UNGC 5AC4A 1FR0A 1MMNA 4JKVA 3H2VA 3NMJA 5E3AA 1Z3IX 3B71A 2M4EA 2IXMA 3SEOA 2XM4A 2EPOA 1ST6A 3SYNA 2EIJC 1SR2A 4G7HF 4JJGA 4U5BE 2AP3A 5JLIA 4ONSA 3ZSUA 3L0IA 3W2VA 4J30B 2R7SA 3RYLA 1ORJA 2YLIA 3ASOC 1DOVA 2IOQA 3EHNA 2YL1A 3M1CB 4CJGA 1QSPA 1NLXA 1N1CA
chains in the Genus database with same CATH topology
4XWJA 3IEEA 2OG2A 4JURI 4XTKA 3OEOA 3WODF 4C7OB 3N24A 3ABLC 3FHDA 4W8KA 4HFKB 2G62A 1V55C 2ZXOA 4PJNA 3AQCA 5E2QA 2CNWD 4CS7A 2OCCC 4BJ5A 3EZIA 3NYJA 4BJ5C 3ZVRA 2IXNA 2Q9BA 4QDLA 4MQ9F 1BR1A 3KH2A 1IZMA 4GYTA 1FTSA 1QLEC 3LLIA 2Y3GA 2MWQA 1M2VB 4GEHA 5D91A 3ZC4A 4BJTA 1VOMA 4LERA 3E9VA 1BR4A 4FX5A 2QY9A 3Q6MA 3HTKC 4RDAA 1ZHXA 2LSEA 4AE4B 3NDBB 2PX3A 2KQ9A 3E70C 4K7BA 4WJ0A 3ASNC 3RFYA 1O5HA 4PJJA 2WZLA 3B0UX 3ECSA 3QZCA 2W9YA 1QZXA 2IYLD 4BG0A 4U5GA 4KBLA 1OCZC 4CIHA 1MMAA 3EH1A 2Y39A 2JD3A 1J8YF 1VYKA 2NUTA 4O6MA 3OWTA 3B9QA 2P6VA 3DMDA 2WZFA 3EG9B 4I1OB 3TD7A 1ZU4A 1W2WA 2KNHA 5DQTA 2EINC 1VMAA 3N0TA 3DAGA 3LESA 4P6IC 5CI8A 4F4BA 3EPVA 2A1DD 3LJBA 4CS8A 2XRHA 5F5HA 2ZPAA 4K0DA 4O79A 4BJ6C 4AK9A 4IRUA 2R7WA 4H4KC 4Q7CA 4U5EE 3MLGA 5EGYA 3LEVA 3K1HA 3LS1A 4ANJA 4J32B 3SNHA 4IAOA 3PMRA 1MNDA 3K1IC 2YZSA 2WZGA 3SP1A 4CS9A 3UR3C 2VB6A 2CNWA 1PD0A 1TWGA 2Y3DA 2R7UA 5KYWA 1LS1A 4C3EA 3EGXA 3K33A 3OA1A 3VYWA 4FWVA 2J45A 4I44A 4DBQA 5B3SC 5L3VA 2Q9CA 4PFOA 5T3TA 2CW0F 1D0YA 2PFDA 3EG9A 4U5DE 1LKXA 1VYIA 1ZHWA 3EGDB 2P7VA 3Q7GA 3WG7C 3MX3A 3CQZA 2YEVA 1ZYRF 1TR2A 4PJLA 5KYWB 1Z6AA 2CDQA 3EFOB 2J9WA 4OIRF 3W2WA 1M57C 4O7GA 4C3BA 4G7OF 3NKDA 1IW7F 2E87A 2HV7A 4JZAA 5DS6A 4XLNF 2W45A 2FGYA 5KYYA 3KL4A 2ZXPA 4E7ZA 2WVQA 3W8IA 4DOZA 1MNEA 3LAYA 4X0RA 5CI9A 4YN0B 2Q3TA 3DM9B 2DYRC 5F5FA 4BEJA 4ZLCA 5DS4A 3AG4C 2H7BA 2A69F 3EZHA 3EQLF 1ZHZA 2EILC 1TKNA 3Q6NA 3RKOF 3S27A 5DQZA 1M2VA 3DM5A 4EBBA 2C03A 5T3WA 1SZIA 4I1MA 2HV6A 1SF8A 2J0XA 1JPNA 1RJ9B 4OIOF 1Z63A 1D1AA 3B0PA 2PX0A 4YT5A 2J7PD 2J9VA 4KNWA 5D92A 2XSEA 3RH3A 1NZEA 4PFPA 2R7RA 2XXAB 4LLEA 3VAYA 1D0ZA 3DJUB 4C7OA 4XLPF 3X1OA 3ZG1A 2I8BA 2R7OA 4A2NB 4PK4A 4HFFB 2KGOA 1NG1A 4U5FE 2PF4E 3LLKA 4G7ZF 2H7VC 3DAFA 4M63A 3GANA 3LS0A 2C04A 1LVKA 1OCRC 4G0HA 5FCLA 3I5PA 4KNVA 2MYSA 3ZIBA 4N06A 1OKKA 4YT8A 3DD7A 3DJNB 2L81A 4YWQA 4NY3A 2Z15A 3NYMA 2BE5F 2DYSC 3NRHA 4RD9A 1KU2A 4EWCA 3L34A 3FVYA 3HLZA 4CBEA 1NU9C 3GODA 2J9UA 1Z23A 3EHMA 3JSZA 2WL8A 2R7VA 5KYUB 3ABKC 2R7TA 4C3DA 2H7OA 4B6IA 4U5CE 2YHSA 3UGOA 2R7XA 4JVSA 5EHHA 1FMVA 4E7SA 4FESA 4CS8C 2B0JA 3K66A 1TWAA 3B0VC 3POVA 3Q7LA 3K6BA 1RJ9A 4BJ6A 1WGWA 1PCXA 4KC9A 3T4RA 4QI2A 5KYYB 4DBRA 2ZXWC 3UMIA 1V54C 2XXAA 2KJGA 4OIQF 4AE4A 3EFOA 2NUTB 1FMWA 3RIPA 3V7OA 1D1BA 1D1CA 3X2QC 4OIPF 4DVYP 2J46A 2WB7A 4JJFA 2J0WA 2EIMC 4IJJA 3O39A 2A68F 2GFHA 2W4BA 3NG1A 1FFTC 1SMYF 2NG1A 3UMHA 2V3CC 3I4UA 3JCUQ 4OD5A 2A6HF 4AX2A 5IY5C 4HEAJ 4YT4A 3T6BA 3KMIA 3FDQA 2D5RB 2KW3C 1NU7D 2WVNA 3CSKA 1TWHA 3UGPA 5KYXA 1M56C 2G3VA 2PP4A 4LACB 4YT2A 3S0XA 3EJNA 2DGJA 5E33A 4BJ1A 4IWBA 3SZRA 4U5HA 5KYNA 3EGDA 1VK5A 2X51A 3K7DA 3JT1A 1S7ZA 5DLJA 4JW1A 3ABMC 3DXJF 4HE8D 2O9XA 3FAJA 3AG1C 2W4MA 3NKEA 5L3QA 3QMKA 4I3MA 5KYXB 2QTVA 4RBNA 3UMKA 5B1BC 4O6NA 2NUPA 1Z5ZA 3AG3C 1FFHA 1M2OA 4OINF 2IXPA 4LLCA 2Q9AA 5E3CA 3I5QA 2L9JA 1BR2A 2VASA 1D0XA 4JCHA 1MMDA 3PHF2 4CSAA 1TWCA 2CGEA 1O87A 2FFHA 3LNRA 4MNDA 3W8HA 3O6XA 4CSAC 3S29A 1OKKD 4PJMA 2EIKC 2G3KA 3KKBA 4O6YA 3AG2C 3S28A 2Y3BA 3CZ6A 3JYHA 4CS9C 4KI2A 2A6EF 2XL4A 2IXOA 4Q5SF 3ITFA 3DZAA 1MMGA 5B1AC 1OCOC 4QI0A 4YJWA 2NUPB 1J8MF 1ZU5A 4ULWA 5DVWA 2V26A 2VH3A 1G8XA 3EGXB 5HSWA 2ZXRA 3EH2A 5BUOA 3F46A 5KYUA 2WVOA 2Y69C 1ZHTA 1JPJA 4OD4A 3F47A 5DS5A 3HJCA 3T6JA 1ZHYA 2Y3HA 3AQBA 4ZLDA 1OCCC 4DVZA 2J7PA 4Q4ZF 3N2ZB 3NYLA 3JRTA 3H65A 2R7QA 5T1DB 1PD1A 3UNGC 1MMNA 5E3AA 1Z3IX 2M4EA 2IXMA 3SEOA 3SYNA 4G7HF 1ST6A 2EIJC 4JJGA 4U5BE 3ZSUA 3L0IA 3W2VA 4J30B 2R7SA 3ASOC 2IOQA 3EHNA 3M1CB 3RYLA 1N1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSE A; 
#chains in the Genus database with same CATH topology
 1YA9 A;  3KYJ A;  1E86 A;  4XWJ A;  1M6T A;  3IEE A;  3ZDL A;  2HS5 A;  2OG2 A;  4JUR I;  4XTK A;  3FOP A;  3OEO A;  4XPW A;  1YA7 O;  5COM A;  3WOD F;  4C7O B;  2HJ3 A;  3N24 A;  3ABL C;  3FHD A;  3M79 A;  4W8K A;  2NPU A;  3LUT B;  5F28 E;  4HFK B;  2G62 A;  5A6B A;  2QNL A;  4DJ9 A;  1V55 C;  2ZXO A;  1OXK A;  3AQC A;  4MVM A;  4PJN A;  2L6G A;  2CNW D;  5E2Q A;  4CS7 A;  2OCC C;  4BJ5 A;  1B68 A;  3EZI A;  3NYJ A;  1L7C A;  1OW6 A;  4BJ5 C;  3ZVR A;  3G50 A;  2CCY A;  2IXN A;  1JAF A;  3C8G B;  2Q9B A;  4QDL A;  4MQ9 F;  1BR1 A;  1BDJ B;  3GEI A;  1IZM A;  3KH2 A;  3LEO A;  1G4W R;  4GYT A;  1FTS A;  1QLE C;  1XZP A;  2VC9 A;  3LLI A;  2Y3G A;  3KYI A;  2GDC A;  2MWQ A;  1M2V B;  4GEH A;  5D91 A;  3ZC4 A;  4KI2 A;  4BJT A;  4YK5 A;  1VOM A;  1Y4C A;  4LER A;  1HE9 A;  3TOM A;  4YL3 A;  3E9V A;  5JUA A;  1BR4 A;  1YDI A;  2QY9 A;  3Q6M A;  4FX5 A;  2YQY A;  3HTK C;  4NCQ A;  4RDA A;  2XLH A;  4EUK B;  3S9O A;  1ZHX A;  2KYH A;  2LSE A;  4NTA A;  1E83 A;  2GAQ A;  4MVU A;  5KYX A;  4MVZ A;  4AE4 B;  2QUP A;  2LCH A;  2PX3 A;  4MW3 A;  3U8P A;  3NDB B;  4JTD B;  3U9J A;  3RVZ A;  1YYJ A;  2KQ9 A;  4ER9 A;  3E70 C;  2QLA A;  4K7B A;  4WJ0 A;  3W4Y A;  3ASN C;  2L6H A;  1O5H A;  2MHR A;  3RFY A;  4PJJ A;  256B A;  1RMV A;  2WZL A;  4EBK A;  3B0U X;  1QKR A;  2HFI A;  2W9Y A;  1QZX A;  3ECS A;  3QZC A;  4K1O A;  1TFO B;  2HJM A;  1H9G A;  2IYL D;  2XLM A;  3V5Z A;  4BG0 A;  3QW0 A;  4DRH B;  1YAU O;  1UG7 A;  4U5G A;  4UDV A;  4KBL A;  4U9D A;  3L8J A;  3DKA A;  1OCZ C;  3L8I A;  4CIH A;  1MMA A;  4MTF A;  3QW1 A;  1RCP A;  3EH1 A;  2A0U A;  2Y39 A;  4PR9 A;  2EPL X;  2JD3 A;  1J8Y F;  1VYK A;  1C17 M;  2NUT A;  4O6M A;  2AWY A;  4FAP B;  4GQH A;  3S0X A;  3B9Q A;  3OWT A;  2R25 A;  1VB5 A;  2P6V A;  3DMD A;  2WZF A;  3EG9 B;  1QQ3 A;  4I1O B;  3TD7 A;  1ZU4 A;  1W2W A;  2KNH A;  1YZA A;  1OR3 A;  5DQT A;  2EIN C;  1KNY A;  1VMA A;  3N0T A;  4IAQ A;  4XEF A;  3TJ5 A;  3DAG A;  1HMO A;  3NMI A;  1YJG A;  3LES A;  4P6I C;  5CI8 A;  4D4X A;  3O55 A;  3U9M A;  3AGU A;  4F4B A;  1FNT c;  3EPV A;  2A1D D;  4U9E A;  3LJB A;  2PBE A;  4CS8 A;  2XRH A;  4W8P A;  2CYD A;  2ZPA A;  4K0D A;  4O79 A;  3GEE A;  5F5H A;  4BJ6 C;  3C62 A;  4WGY A;  4AK9 A;  4IRU A;  2R7W A;  5L0H A;  1LE2 A;  4H4K C;  4Q7C A;  3GOR A;  3MLG A;  4MS2 A;  4U5E E;  5EGY A;  3LEV A;  3K1H A;  5L0D A;  3LS1 A;  5FZT A;  1T6U A;  4J32 B;  3SNH A;  4ANJ A;  1HW1 A;  4IAO A;  3PMR A;  4CJO A;  4EHP A;  3MFN A;  1MND A;  3MYF A;  4IB4 A;  5A6A A;  1TQG A;  1O3U A;  2YZS A;  3DE9 A;  2RD9 A;  3GWN A;  3K1I C;  2WZG A;  1E2X A;  3SP1 A;  4CS9 A;  3UR3 C;  2VB6 A;  1WAS A;  1APC A;  5L0I A;  1LS4 A;  4NTB A;  3R2P A;  2CNW A;  1PD0 A;  1TWG A;  2Y3D A;  1YZC A;  1Q0K A;  3J06 A;  1QPU A;  2R7U A;  4N6H A;  4YL1 A;  1LIH A;  2OU6 A;  2OQM A;  5KYW A;  1LS1 A;  4C3E A;  3O10 A;  3EGX A;  3K33 A;  4JTC B;  3OA1 A;  3VYW A;  4AL0 A;  4FWV A;  1U6H A;  2J45 A;  4I44 A;  1WAT A;  4DBQ A;  5B3S C;  3VF0 A;  4EIY A;  2AVK A;  5L3V A;  2Q9C A;  2YL7 A;  4MW8 A;  4PFO A;  5BQG A;  1WWP A;  5T3T A;  2OEV A;  5A6K A;  2CW0 F;  1D0Y A;  3C8Z A;  2YVK A;  5BQH A;  1H9T A;  2R02 A;  3TK0 A;  2PFD A;  3EG9 A;  2ASR A;  4U5D E;  1LKX A;  3C63 A;  4JRZ A;  1VYI A;  4IGG A;  1ZHW A;  1G4U S;  3U2M A;  3EGD B;  3ZWI A;  3IPM O;  1ZZP A;  2P7V A;  3Q7G A;  5TJ5 E;  3WG7 C;  3C8G A;  3MX3 A;  4MVS A;  2J9B A;  3DI5 A;  1NBB A;  3TOL A;  1WN0 A;  2YEV A;  3CQZ A;  1ZYR F;  1TR2 A;  4PJL A;  5A6B D;  1ZW3 A;  5KYW B;  4DRJ B;  3ATP A;  2R03 A;  5EK0 A;  1Z6A A;  2CDQ A;  2L6F A;  3EFO B;  2GWW A;  3IHU A;  2J9W A;  1HMD A;  4IAR A;  4OIR F;  1L3P A;  1M57 C;  1H7I A;  3M4C A;  4O7G A;  3W2W A;  4C3B A;  4G7O F;  3NKD A;  3NMK A;  3U8V A;  1IW7 F;  2E87 A;  2HV7 A;  2KK1 A;  4JZA A;  2QE9 A;  3FMS A;  3U3B A;  4DXW A;  5DS6 A;  3C7J A;  4XLN F;  2W45 A;  1OQC A;  2EPN A;  2FGY A;  3VRC A;  5KYY A;  3KL4 A;  4MTO A;  2ZXP A;  3G4Z A;  4E7Z A;  2WVQ A;  3W8I A;  3HKK A;  4DOZ A;  1MNE A;  2YL3 A;  3LAY A;  4X0R A;  5CI9 A;  3L1M A;  4YN0 B;  1BZ4 A;  1LI7 A;  2Q3T A;  1MQV A;  2OOC A;  2DYR C;  1C02 A;  2OKU A;  2YRF A;  3DM9 B;  3HNJ A;  3LNM B;  4Z9J A;  5F5F A;  2XL6 A;  4BEJ A;  2I15 A;  1K40 A;  4ZLC A;  5COG A;  1CPQ A;  5DS4 A;  4JIO A;  3AG4 C;  2OJQ A;  1KTM A;  1A7V A;  2XLD A;  2H7B A;  2A69 F;  2B0H A;  3EZH A;  3EQL F;  1ZHZ A;  3RW0 A;  4WGZ A;  1RXQ A;  2L7A A;  2EIL C;  1TKN A;  3Q6N A;  4NTF A;  2XL8 A;  3RKO F;  1M2V A;  3S27 A;  5DQZ A;  1OXB A;  3DM5 A;  4LDQ A;  4Z9I A;  2C03 A;  5T3W A;  3BRJ A;  3RVY A;  4EBB A;  3TJ6 A;  1SZI A;  4I1M A;  2JX0 A;  4Z9H A;  3JRM O;  4XEV A;  3UGP A;  2HV6 A;  1SF8 A;  2J0X A;  5JSL A;  1JPN A;  2UUH A;  1RJ9 B;  3TUL A;  4OIO F;  2XLO A;  2DI3 A;  1Z63 A;  1D1A A;  1JRA A;  3B0P A;  2PX0 A;  3SXM A;  1JMW A;  1CGO A;  4CDA A;  4YT5 A;  2J7P D;  2J9V A;  4JC7 A;  4LDK A;  1VLT A;  2P61 A;  4KNW A;  5D92 A;  2XSE A;  1BBH A;  3HNI A;  1Z7Q c;  3RH3 A;  4CX9 A;  5JS5 A;  1NZE A;  4PFP A;  3V5Y A;  2HMZ A;  3G4X A;  5JP7 A;  2XLE A;  2R7R A;  2XXA B;  1UFB A;  4LLE A;  3VAY A;  1D0Z A;  4JTA B;  3DJU B;  1VTM P;  4C7O A;  4XLP F;  3X1O A;  2YLG A;  3ZG1 A;  1T01 A;  2I8B A;  2R9R B;  2R7O A;  4A2N B;  1H6G A;  4H54 A;  3M15 A;  1S05 A;  4PK4 A;  4HFF B;  3ZQV A;  3ZTM A;  2KGO A;  1NG1 A;  1EQ1 A;  1HE1 A;  2LFF A;  1CPR A;  4U5F E;  1HY5 A;  2JPU A;  2PF4 E;  1T6Q A;  3SXK A;  1Q0D A;  4CDY A;  5AGF A;  3LLK A;  4G7Z F;  1AVO B;  2H7V C;  2DB4 A;  3M4B A;  2PNO A;  3SXY A;  2IBF A;  3DAF A;  2H8A A;  4M63 A;  3GAN A;  1Q0F A;  5JVE A;  3LS0 A;  4N4W A;  2C04 A;  1E85 A;  1LVK A;  3GM1 A;  1OCR C;  4G0H A;  5FCL A;  1C03 A;  3I5P A;  1XZQ A;  3V5X A;  4KNV A;  2MYS A;  3ZIB A;  2J8W A;  1OW8 A;  2LIG A;  3BEH A;  1OKK A;  3AGT A;  4N06 A;  4G78 A;  1RKE A;  1ORY A;  4NQF A;  3K1I A;  1LI5 A;  4XPY A;  2F22 A;  3DD7 A;  4YT8 A;  3DJN B;  2L81 A;  2P1A A;  4YWQ A;  4NY3 A;  2Z15 A;  2LD6 A;  2BE5 F;  2DYS C;  3NRH A;  3NYM A;  4RD9 A;  1YYX A;  3C18 A;  3U3F A;  1KU2 A;  3RQF A;  3L34 A;  4EWC A;  3C8G D;  3FVY A;  1NFN A;  3HLZ A;  4R32 A;  3WHN A;  4CBE A;  1GS9 A;  1NU9 C;  1YAR O;  2RSE B;  2J9U A;  1Z23 A;  3EHM A;  3FOO A;  3FXH A;  3GM2 A;  3GOD A;  3JSZ A;  2WL8 A;  2YWA A;  3A11 A;  4EKW A;  5KYU B;  3ABK C;  2R7V A;  2R7T A;  4C3D A;  2H7O A;  4MVQ A;  4B6I A;  1SYQ A;  4U5C E;  5B3I A;  1EI7 A;  4XPX A;  2YHS A;  3UGO A;  3IQ6 A;  4JVS A;  5EHH A;  2R7X A;  5BQI A;  1FMV A;  4E7S A;  1ZVZ A;  4FES A;  2P0N A;  2XS8 A;  4CS8 C;  2B0J A;  3K66 A;  1TWA A;  3B0V C;  3POV A;  3Q7L A;  3K6B A;  3AOU A;  1RJ9 A;  2YKZ A;  1RKC A;  4BJ6 A;  4JE9 A;  1WGW A;  1PCX A;  3PCV A;  2NSG A;  3QVZ A;  4KC9 A;  3T4R A;  3TQO A;  4QI2 A;  3A9C A;  5KYY B;  2XLW A;  3ZQY A;  3GWL A;  4DBR A;  1HW2 A;  2YL0 A;  2ZXW C;  3UMI A;  1V54 C;  3U2L A;  3CEX A;  3US6 A;  2XXA A;  4P9T A;  2V3C C;  2VCB A;  2KJG A;  4OIQ F;  4L6R A;  4AE4 A;  4E18 A;  3EFO A;  2NUT B;  1FMW A;  1NSG B;  3RIP A;  3V7O A;  1D1B A;  1AUE A;  2KSF A;  3PDM P;  5JRA A;  1D1C A;  3X2Q C;  4OIP F;  2AU5 A;  2HUJ A;  4E17 A;  5JT4 A;  1DOW A;  2KC3 A;  1OW7 A;  4DVY P;  2J46 A;  2WB7 A;  4JJF A;  1A41 A;  2A0B A;  2EIM C;  2J0W A;  3JTL O;  4IJJ A;  2Q7R A;  2VCA A;  3T6G B;  1E84 A;  3O39 A;  2A68 F;  2GFH A;  2W4B A;  1FFT C;  1A0B A;  1SMY F;  2NG1 A;  3NG1 A;  3UMH A;  5K0I A;  1Q0M A;  2GA0 A;  3I4U A;  3JCU Q;  2A6H F;  3HNK A;  3MBG A;  4OD5 A;  5GPG B;  4AX2 A;  1WOL A;  1V74 B;  2IM8 A;  2OEX A;  3FAP B;  4HEA J;  5IY5 C;  4YT4 A;  1T9K A;  3T6B A;  3KMI A;  4BPM A;  1CGN A;  3S84 A;  1YLM A;  1T5O A;  3FDQ A;  4XQ1 A;  2D5R B;  2BC5 A;  2Q00 A;  2KW3 C;  1NU7 D;  3VM6 A;  1OR2 A;  2WVN A;  4MVO A;  1LM3 B;  3CSK A;  1TWH A;  3T9O A;  1JR8 A;  3IQT A;  1M56 C;  2G3V A;  1JOG A;  2PP4 A;  4LAC B;  2BL2 A;  1AEP A;  3JZ0 A;  4YT2 A;  1V4A A;  1WTY A;  4CIP A;  1U89 A;  2XM0 A;  3EJN A;  1EKY A;  2DGJ A;  5E33 A;  4BJ1 A;  2XLV A;  2HSQ A;  4EBJ A;  4IWB A;  3SZR A;  4U5H A;  3H2U A;  1G5Z A;  3QVY A;  2UUI A;  5COF A;  3R7C A;  3KPH A;  3EGD A;  5KYN A;  1VK5 A;  4WAB A;  2X51 A;  2XS1 A;  3K7D A;  4D4N A;  4LDR A;  5HV9 A;  3S90 A;  1T6I A;  1CGM E;  4XEK A;  3JT1 A;  1S7Z A;  2R05 A;  5DLJ A;  1I4Y A;  4JW1 A;  3ABM C;  3DXJ F;  4HE8 D;  2LP4 A;  2O9X A;  3FAJ A;  3AG1 C;  2ZD9 A;  2EPM X;  4J7T A;  2W4M A;  3MYI A;  3NKE A;  4MTG A;  3RQG A;  5L3Q A;  5A69 A;  3QMK A;  3IQ5 A;  1NFO A;  4I3M A;  5KYX B;  2QTV A;  3DE8 A;  5L0J A;  4RBN A;  4MVR A;  2X0C A;  3UMK A;  5B1B C;  1PV3 A;  4BEM J;  1VLS A;  4O6N A;  2NUP A;  1Z5Z A;  3AG3 C;  1FFH A;  4E0H A;  1M2O A;  1LPE A;  4OIN F;  1K05 A;  2IXP A;  1LE4 A;  3GM3 A;  4LLC A;  3RF3 A;  4ULV A;  1A7D A;  4AL1 A;  1F1M A;  4NC3 A;  2LFD A;  1Y6D A;  2Q9A A;  5L0G A;  5E3C A;  1GM5 A;  4JEA A;  4A4A A;  5L0F A;  3I5Q A;  2VCC A;  2L9J A;  1I4Z A;  2HMQ A;  3JSE O;  2ICW G;  1BR2 A;  2VAS A;  1EA8 A;  1R5I D;  1D0X A;  1ZW2 A;  4JCH A;  2EPK X;  3RQE A;  1I5N A;  1MMD A;  4J7Y A;  4PAC A;  4DRI B;  3PHF 2;  4CSA A;  1K04 A;  1TWC A;  2CGE A;  1O87 A;  2HKV A;  2FFH A;  3DWW A;  3LNR A;  3ZTZ A;  4MND A;  3W8H A;  3O6X A;  4CSA C;  2AWC A;  3IQC A;  3S29 A;  2NSF A;  2ETS A;  5A6J A;  1FAP B;  1OKK D;  2HZ8 A;  2EIK C;  2G3K A;  2M64 A;  3KKB A;  4PJM A;  4O6Y A;  3AG2 C;  5AC5 A;  1R4T A;  3S28 A;  3AJM A;  2Y3B A;  3CZ6 A;  1ORS C;  1Q0G A;  3JYH A;  1XWJ A;  4CS9 C;  2A6E F;  3WAQ A;  3CAX A;  2LK4 A;  2XL4 A;  2IXO A;  4YL0 A;  3B29 A;  4Q5S F;  2FAP B;  4P9F A;  2OJE D;  3DZA A;  3ITF A;  1MMG A;  2D4U A;  3JYY A;  5B1A C;  1OCO C;  4CDV A;  3QTH A;  4JCZ A;  1QVX A;  4QI0 A;  4YJW A;  3HNL A;  2NUP B;  1J8M F;  1ZU5 A;  4ULW A;  5DVW A;  5CIV A;  2V26 A;  3SXZ A;  1GGQ A;  2VH3 A;  2YLD A;  1G8X A;  3EGX B;  4N6C A;  5HSW A;  1U0B B;  3U5S A;  2ZXR A;  3EH2 A;  5BUO A;  3F46 A;  3GEH A;  2WVO A;  2Y69 C;  5KYU A;  1ZHT A;  1JPJ A;  2Q4F A;  2TMV P;  4OD4 A;  3F47 A;  1A7E A;  5DS5 A;  3HJC A;  3T6J A;  1ZHY A;  2HSB A;  2Y3H A;  5L0C A;  1GQA A;  1TFK B;  3AQB A;  4ZLD A;  1OCC C;  2LQG A;  4DVZ A;  4JEB A;  2J7P A;  4Q4Z F;  3N2Z B;  3NYL A;  4E0I A;  1RKE B;  3JRT A;  3H65 A;  2R7Q A;  5T1D B;  3U0C A;  1PD1 A;  1YVI A;  3UNG C;  5AC4 A;  1FR0 A;  1MMN A;  4JKV A;  3H2V A;  3NMJ A;  5E3A A;  1Z3I X;  3B71 A;  2M4E A;  2IXM A;  3SEO A;  2XM4 A;  2EPO A;  1ST6 A;  3SYN A;  2EIJ C;  1SR2 A;  4G7H F;  4JJG A;  4U5B E;  2AP3 A;  5JLI A;  4ONS A;  3ZSU A;  3L0I A;  3W2V A;  4J30 B;  2R7S A;  3RYL A;  1ORJ A;  2YLI A;  3ASO C;  1DOV A;  2IOQ A;  3EHN A;  2YL1 A;  3M1C B;  4CJG A;  1QSP A;  1NLX A;  1N1C A; 
#chains in the Genus database with same CATH homology
 4XWJ A;  3IEE A;  2OG2 A;  4JUR I;  4XTK A;  3OEO A;  3WOD F;  4C7O B;  3N24 A;  3ABL C;  3FHD A;  4W8K A;  4HFK B;  2G62 A;  1V55 C;  2ZXO A;  4PJN A;  3AQC A;  5E2Q A;  2CNW D;  4CS7 A;  2OCC C;  4BJ5 A;  3EZI A;  3NYJ A;  4BJ5 C;  3ZVR A;  2IXN A;  2Q9B A;  4QDL A;  4MQ9 F;  1BR1 A;  3KH2 A;  1IZM A;  4GYT A;  1FTS A;  1QLE C;  3LLI A;  2Y3G A;  2MWQ A;  1M2V B;  4GEH A;  5D91 A;  3ZC4 A;  4BJT A;  1VOM A;  4LER A;  3E9V A;  1BR4 A;  4FX5 A;  2QY9 A;  3Q6M A;  3HTK C;  4RDA A;  1ZHX A;  2LSE A;  4AE4 B;  3NDB B;  2PX3 A;  2KQ9 A;  3E70 C;  4K7B A;  4WJ0 A;  3ASN C;  3RFY A;  1O5H A;  4PJJ A;  2WZL A;  3B0U X;  3ECS A;  3QZC A;  2W9Y A;  1QZX A;  2IYL D;  4BG0 A;  4U5G A;  4KBL A;  1OCZ C;  4CIH A;  1MMA A;  3EH1 A;  2Y39 A;  2JD3 A;  1J8Y F;  1VYK A;  2NUT A;  4O6M A;  3OWT A;  3B9Q A;  2P6V A;  3DMD A;  2WZF A;  3EG9 B;  4I1O B;  3TD7 A;  1ZU4 A;  1W2W A;  2KNH A;  5DQT A;  2EIN C;  1VMA A;  3N0T A;  3DAG A;  3LES A;  4P6I C;  5CI8 A;  4F4B A;  3EPV A;  2A1D D;  3LJB A;  4CS8 A;  2XRH A;  5F5H A;  2ZPA A;  4K0D A;  4O79 A;  4BJ6 C;  4AK9 A;  4IRU A;  2R7W A;  4H4K C;  4Q7C A;  4U5E E;  3MLG A;  5EGY A;  3LEV A;  3K1H A;  3LS1 A;  4ANJ A;  4J32 B;  3SNH A;  4IAO A;  3PMR A;  1MND A;  3K1I C;  2YZS A;  2WZG A;  3SP1 A;  4CS9 A;  3UR3 C;  2VB6 A;  2CNW A;  1PD0 A;  1TWG A;  2Y3D A;  2R7U A;  5KYW A;  1LS1 A;  4C3E A;  3EGX A;  3K33 A;  3OA1 A;  3VYW A;  4FWV A;  2J45 A;  4I44 A;  4DBQ A;  5B3S C;  5L3V A;  2Q9C A;  4PFO A;  5T3T A;  2CW0 F;  1D0Y A;  2PFD A;  3EG9 A;  4U5D E;  1LKX A;  1VYI A;  1ZHW A;  3EGD B;  2P7V A;  3Q7G A;  3WG7 C;  3MX3 A;  3CQZ A;  2YEV A;  1ZYR F;  1TR2 A;  4PJL A;  5KYW B;  1Z6A A;  2CDQ A;  3EFO B;  2J9W A;  4OIR F;  3W2W A;  1M57 C;  4O7G A;  4C3B A;  4G7O F;  3NKD A;  1IW7 F;  2E87 A;  2HV7 A;  4JZA A;  5DS6 A;  4XLN F;  2W45 A;  2FGY A;  5KYY A;  3KL4 A;  2ZXP A;  4E7Z A;  2WVQ A;  3W8I A;  4DOZ A;  1MNE A;  3LAY A;  4X0R A;  5CI9 A;  4YN0 B;  2Q3T A;  3DM9 B;  2DYR C;  5F5F A;  4BEJ A;  4ZLC A;  5DS4 A;  3AG4 C;  2H7B A;  2A69 F;  3EZH A;  3EQL F;  1ZHZ A;  2EIL C;  1TKN A;  3Q6N A;  3RKO F;  3S27 A;  5DQZ A;  1M2V A;  3DM5 A;  4EBB A;  2C03 A;  5T3W A;  1SZI A;  4I1M A;  2HV6 A;  1SF8 A;  2J0X A;  1JPN A;  1RJ9 B;  4OIO F;  1Z63 A;  1D1A A;  3B0P A;  2PX0 A;  4YT5 A;  2J7P D;  2J9V A;  4KNW A;  5D92 A;  2XSE A;  3RH3 A;  1NZE A;  4PFP A;  2R7R A;  2XXA B;  4LLE A;  3VAY A;  1D0Z A;  3DJU B;  4C7O A;  4XLP F;  3X1O A;  3ZG1 A;  2I8B A;  2R7O A;  4A2N B;  4PK4 A;  4HFF B;  2KGO A;  1NG1 A;  4U5F E;  2PF4 E;  3LLK A;  4G7Z F;  2H7V C;  3DAF A;  4M63 A;  3GAN A;  3LS0 A;  2C04 A;  1LVK A;  1OCR C;  4G0H A;  5FCL A;  3I5P A;  4KNV A;  2MYS A;  3ZIB A;  4N06 A;  1OKK A;  4YT8 A;  3DD7 A;  3DJN B;  2L81 A;  4YWQ A;  4NY3 A;  2Z15 A;  3NYM A;  2BE5 F;  2DYS C;  3NRH A;  4RD9 A;  1KU2 A;  4EWC A;  3L34 A;  3FVY A;  3HLZ A;  4CBE A;  1NU9 C;  3GOD A;  2J9U A;  1Z23 A;  3EHM A;  3JSZ A;  2WL8 A;  2R7V A;  5KYU B;  3ABK C;  2R7T A;  4C3D A;  2H7O A;  4B6I A;  4U5C E;  2YHS A;  3UGO A;  2R7X A;  4JVS A;  5EHH A;  1FMV A;  4E7S A;  4FES A;  4CS8 C;  2B0J A;  3K66 A;  1TWA A;  3B0V C;  3POV A;  3Q7L A;  3K6B A;  1RJ9 A;  4BJ6 A;  1WGW A;  1PCX A;  4KC9 A;  3T4R A;  4QI2 A;  5KYY B;  4DBR A;  2ZXW C;  3UMI A;  1V54 C;  2XXA A;  2KJG A;  4OIQ F;  4AE4 A;  3EFO A;  2NUT B;  1FMW A;  3RIP A;  3V7O A;  1D1B A;  1D1C A;  3X2Q C;  4OIP F;  4DVY P;  2J46 A;  2WB7 A;  4JJF A;  2J0W A;  2EIM C;  4IJJ A;  3O39 A;  2A68 F;  2GFH A;  2W4B A;  3NG1 A;  1FFT C;  1SMY F;  2NG1 A;  3UMH A;  2V3C C;  3I4U A;  3JCU Q;  4OD5 A;  2A6H F;  4AX2 A;  5IY5 C;  4HEA J;  4YT4 A;  3T6B A;  3KMI A;  3FDQ A;  2D5R B;  2KW3 C;  1NU7 D;  2WVN A;  3CSK A;  1TWH A;  3UGP A;  5KYX A;  1M56 C;  2G3V A;  2PP4 A;  4LAC B;  4YT2 A;  3S0X A;  3EJN A;  2DGJ A;  5E33 A;  4BJ1 A;  4IWB A;  3SZR A;  4U5H A;  5KYN A;  3EGD A;  1VK5 A;  2X51 A;  3K7D A;  3JT1 A;  1S7Z A;  5DLJ A;  4JW1 A;  3ABM C;  3DXJ F;  4HE8 D;  2O9X A;  3FAJ A;  3AG1 C;  2W4M A;  3NKE A;  5L3Q A;  3QMK A;  4I3M A;  5KYX B;  2QTV A;  4RBN A;  3UMK A;  5B1B C;  4O6N A;  2NUP A;  1Z5Z A;  3AG3 C;  1FFH A;  1M2O A;  4OIN F;  2IXP A;  4LLC A;  2Q9A A;  5E3C A;  3I5Q A;  2L9J A;  1BR2 A;  2VAS A;  1D0X A;  4JCH A;  1MMD A;  3PHF 2;  4CSA A;  1TWC A;  2CGE A;  1O87 A;  2FFH A;  3LNR A;  4MND A;  3W8H A;  3O6X A;  4CSA C;  3S29 A;  1OKK D;  4PJM A;  2EIK C;  2G3K A;  3KKB A;  4O6Y A;  3AG2 C;  3S28 A;  2Y3B A;  3CZ6 A;  3JYH A;  4CS9 C;  4KI2 A;  2A6E F;  2XL4 A;  2IXO A;  4Q5S F;  3ITF A;  3DZA A;  1MMG A;  5B1A C;  1OCO C;  4QI0 A;  4YJW A;  2NUP B;  1J8M F;  1ZU5 A;  4ULW A;  5DVW A;  2V26 A;  2VH3 A;  1G8X A;  3EGX B;  5HSW A;  2ZXR A;  3EH2 A;  5BUO A;  3F46 A;  5KYU A;  2WVO A;  2Y69 C;  1ZHT A;  1JPJ A;  4OD4 A;  3F47 A;  5DS5 A;  3HJC A;  3T6J A;  1ZHY A;  2Y3H A;  3AQB A;  4ZLD A;  1OCC C;  4DVZ A;  2J7P A;  4Q4Z F;  3N2Z B;  3NYL A;  3JRT A;  3H65 A;  2R7Q A;  5T1D B;  1PD1 A;  3UNG C;  1MMN A;  5E3A A;  1Z3I X;  2M4E A;  2IXM A;  3SEO A;  3SYN A;  4G7H F;  1ST6 A;  2EIJ C;  4JJG A;  4U5B E;  3ZSU A;  3L0I A;  3W2V A;  4J30 B;  2R7S A;  3ASO C;  2IOQ A;  3EHN A;  3M1C B;  3RYL A;  1N1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...