2LSEA

Solution nmr structure of de novo designed four helix bundle protein, northeast structural genomics consortium (nesg) target or188
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Four Helix Bundle Protein
publication title Solution NMR Structure of a Denovo Design Four Helix Bundle Protein, Northeast Structural Genomics Consortium Target OR188
rcsb
source organism Artificial gene
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1360 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2lseA00
2LSEA
chains in the Genus database with same CATH superfamily
2ZXWC 4IAOA 4YJWA 2LCHA 2ETSA 4C3EA 1ZU5A 2ASRA 1NU9C 2UUHA 2VASA 2EPKX 3QVZA 2H7VC 1S05A 1E84A 3TJ6A 4OIPF 2QUPA 3G4XA 1H7IA 2ZXOA 1ZHZA 1HW2A 4U9EA 2WZGA 1Z63A 3TULA 1RKEA 3L0IA 4NCQA 2GWWA 4HEAJ 3T9OA 1QPUA 2YLDA 5JUAA 1TR2A 3SXMA 1XZPA 1NSGB 3A9CA 3L8JA 4MVQA 4QDLA 3U2MA 2XL4A 4AE4B 3TJ5A 1RMVA 3ABMC 2AVKA 3GM2A 2BC5A 2HS5A 3QTHA 4Q5SF 3NKEA 4MNDA 2OOCA 2A0BA 2HFIA 2XL8A 3LNRA 4IARA 4JC7A 1AUEA 4N6HA 1WWPA 1YYXA 4ULVA 1M57C 4MS2A 4C7OA 4I44A 1AVOB 2Y3HA 3BRJA 1M2VA 4O79A 5BQHA 1NBBA 4X0RA 1O5HA 4CJGA 1YARO 3W2VA 4U9DA 1Z7Qc 3ZQVA 1OW7A 3ZTMA 4G7OF 4JVSA 2DGJA 2Q7RA 1MMNA 1V54C 2W4MA 3FAJA 2G3VA 4BEMJ 4WABA 1CPRA 2J9VA 3E70C 4D4NA 1TWAA 3QW0A 4PJNA 5CIVA 5T3TA 2YL3A 5IY5C 5DVWA 3K33A 2IXMA 3WODF 3T6JA 3IQCA 1VYIA 5JLIA 2R7WA 4U5HA 1LVKA 5DS6A 5KYUB 3NDBB 4DVZA 3W2WA 1L7CA 1QLEC 4CIPA 2XXAB 3O6XA 4N06A 3HNIA 2NUTA 3SXZA 4FAPB 1QKRA 1H9TA 2HUJA 2IXOA 2KW3C 3MLGA 4LLCA 4J32B 2Y3GA 3UMIA 4Q4ZF 4U5DE 5DQTA 1D1AA 2I15A 3NYJA 2C03A 4JE9A 3U3BA 2WZLA 1OCRC 1R5ID 3MBGA 4G7ZF 2YZSA 3VF0A 2R9RB 1GM5A 4YWQA 2IYLD 5BQIA 1U0BB 1JR8A 1E2XA 4F4BA 1PD0A 2Q9AA 5AGFA 3TD7A 1LE2A 1D0XA 1Y4CA 3B9QA 5COMA 3EHNA 1GS9A 2MYSA 3JRTA 1FMWA 4JURI 4MTOA 5DLJA 1A7EA 1Q0MA 4WJ0A 4JW1A 4WGYA 2LFDA 4OIQF 5DQZA 2HZ8A 2J8WA 3RQFA 2JD3A 4DRHB 3S9OA 4U5FE 4CS9C 1O87A 1TWGA 1M56C 1Z3IX 2CDQA 3M4CA 3K1IC 3UGPA 3U5SA 3DKAA 3EGDB 4PK4A 4CDYA 5KYYA 2XRHA 3EJNA 4PR9A 2XM0A 3FAPB 5DS5A 4MW8A 1OQCA 2HJMA 1CGOA 4LDQA 4XEVA 4IWBA 4JJGA 3UR3C 3DWWA 3RF3A 2XLVA 4EBKA 1T6UA 3C8GB 1LPEA 4P9TA 1ZYRF 5CI9A 3U8PA 3ASNC 5L0FA 4KI2A 2DYRC 1TFKB 4E17A 4JTCB 2CW0F 3PHF2 4YT8A 1JMWA 4JRZA 4DXWA 5DS4A 1T01A 2DYSC 1I4ZA 3JYYA 2Q4FA 2EIMC 3U8VA 1EKYA 1FMVA 2AWYA 3MX3A 2EPOA 1U89A 1A7DA 2EILC 2Q3TA 3AG3C 3SXKA 4EHPA 2HSBA 1LS4A 3FOOA 3C8GD 4E7ZA 5A6BD 5JP7A 1H9GA 1TKNA 3DM5A 4AL1A 2LD6A 2J46A 1ZHTA 3SYNA 1ZZPA 1YA7O 3ATPA 3KYIA 3EG9A 4PJJA 3RW0A 3TOMA 2KNHA 5EHHA 1E86A 2NUPB 2YWAA 2NG1A 5L0DA 2R05A 4CIHA 3FXHA 3GEIA 3J06A 1T6QA 4C3BA 5KYXA 5L3VA 2V3CC 4DVYP 1BDJB 2M4EA 2XLHA 1L3PA 2EPMX 2Y3DA 2OG2A 3NRHA 1I4YA 3RVYA 3NYLA 3MYIA 3ABKC 2J9WA 2O9XA 1BZ4A 1M2OA 3AQBA 3GWNA 3HJCA 2YRFA 4AE4A 1NZEA 2L6GA 3RIPA 2OEXA 4O7GA 3FVYA 3EFOB 4YL1A 1SR2A 3FOPA 4YN0B 3S27A 4M63A 3ZTZA 3WHNA 5KYNA 1XZQA 2BL2A 2LQGA 3VAYA 2LP4A 1MMGA 4ER9A 2OJQA 2ICWG 3JYHA 1FFHA 1O3UA 4JEBA 1JRAA 1TFOB 1VK5A 4K1OA 1Z5ZA 3KL4A 4G78A 4EBJA 2VCCA 5HSWA 2HV7A 3HNJA 1J8MF 3Q7LA 2QTVA 4PJMA 1JOGA 2GFHA 2PF4E 2EPLX 2UUIA 5JT4A 2PNOA 4LLEA 5D92A 3F46A 4NC3A 3VYWA 3W8IA 3DAGA 4ZLDA 2P6VA 1M6TA 1V4AA 1NU7D 2KJGA 3JZ0A 4P6IC 1E85A 3N24A 1ZHYA 2G62A 1ZHXA 3M15A 4LDRA 4GEHA 3V5YA 2JX0A 5B1BC 5KYWB 3U9MA 4HFKB 1D1BA 1FNTc 1YDIA 4Z9HA 1SF8A 2L9JA 3B0PA 5B1AC 2OCCC 2DB4A 2BE5F 3DE8A 1UFBA 2CNWA 2WZFA 2Y39A 3GEEA 3GEHA 3LLKA 4KNWA 2H7OA 2WVNA 3RVZA 4LACB 3RKOF 1D0ZA 2Q9CA 3S28A 4O6MA 4I1MA 3SP1A 2WL8A 5CI8A 1LI7A 4IB4A 5GPGB 1SYQA 1PD1A 2VCAA 3L8IA 4LERA 3N0TA 2ZPAA 4KBLA 5L0GA 1LM3B 2KSFA 4KC9A 3U0CA 5F28E 4NTBA 4W8KA 3DMDA 2VC9A 2QNLA 4K0DA 4U5BE 3ZQYA 5AC5A 4XEFA 5L0JA 4IAQA 2ZXPA 1SMYF 1QZXA 3FHDA 2HV6A 4JZAA 4I3MA 1VYKA 2H7BA 4L6RA 1OKKA 3IHUA 3K66A 3T4RA 5L3QA 2AU5A 3B71A 3WAQA 1Q0KA 1W2WA 5FCLA 1ORSC 4XEKA 1IZMA 3X1OA 4H4KC 1EQ1A 1QQ3A 1V55C 2KC3A 3IEEA 2VCBA 1EA8A 1G4WR 2VH3A 3GORA 3GM1A 3HTKC 3B29A 4OD5A 4H54A 4Z9JA 4CS7A 4UDVA 4PFOA 2R7TA 4B6IA 2DI3A 4U5CE 2IM8A 3U2LA 5JRAA 3UMHA 4AX2A 3HNKA 1BR1A 1RCPA 1ST6A 2R7OA 1T9KA 1BBHA 2J7PA 2IXPA 3CSKA 2EIJC 3HNLA 4I1OB 1ORYA 2J9UA 2R03A 4U5EE 2A1DD 4MVMA 3TK0A 4BEJA 4JKVA 4C7OB 4BJ6C 1Z23A 1CGNA 2B0HA 2GA0A 5T1DB 1BR4A 3CQZA 2NSGA 3E9VA 3LJBA 3M1CB 4HE8D 1FR0A 4XLPF 2YKZA 1NLXA 3EGXA 1PCXA 3EQLF 1WTYA 4EBBA 3Q6NA 4DJ9A 2LIGA 2OEVA 3H2VA 5K0IA 1WASA 3SEOA 3Q6MA 3O10A 2AWCA 2Y3BA 1NG1A 1CPQA 5JSLA 3HKKA 256BA 2QE9A 2CYDA 4C3DA 1YYJA 2A6HF 4EIYA 2FAPB 2KQ9A 2Q9BA 2B0JA 3GM3A 1A41A 4ANJA 3RFYA 4MW3A 3PMRA 3C8ZA 3F47A 3AGUA 3POVA 2D5RB 3FMSA 4CS8C 1LE4A 2WVQA 3MFNA 1HMDA 3JSEO 4D4XA 2W9YA 1TWCA 3RQGA 1KTMA 1RJ9B 4BJ1A 4BJ5C 2R7SA 1A0BA 4IJJA 4W8PA 4XTKA 4XPYA 2HMQA 4HFFB 2H8AA 1XWJA 5E2QA 3L34A 3AGTA 1OCOC 4O6NA 2HJ3A 4EKWA 3HLZA 4BJ6A 3R2PA 1K40A 1WN0A 2EPNA 2YLGA 4NTAA 4Q7CA 4CJOA 5B3IA 5T3WA 3S84A 2XSEA 2Q00A 1T5OA 4YL0A 3MYFA 2M64A 2YQYA 4NY3A 2OKUA 1LS1A 1MNDA 4J7TA 4MQ9F 1TQGA 3QZCA 2PP4A 2CCYA 2XL6A 3H65A 3I5QA 3EPVA 4YT4A 2ZD9A 1G4US 4DBQA 1N1CA 4AL0A 3EZIA 4G0HA 2A69F 1FTSA 1RXQA 3AOUA 2NPUA 3I4UA 3JT1A 5COGA 3ZIBA 2YL1A 4A2NB 5KYYB 2R7UA 2NSFA 3OWTA 3EZHA 3O55A 3EHMA 1H6GA 2E87A 3ECSA 4XWJA 3L1MA 4N6CA 3JTLO 4XQ1A 4CS8A 4E0HA 2XLWA 5KYWA 5AC4A 2C04A 1Q0FA 2G3KA 3ZVRA 4BJ5A 5A6AA 4A4AA 4CDAA 3CAXA 3QVYA 2R7XA 3VRCA 1DOWA 2W45A 2LSEA 2P0NA 4MVOA 1AEPA 3RQEA 5JVEA 4G7HF 1FAPB 2YEVA 3DE9A 1OR3A 4MTFA 3X2QC 2YL0A 3JRMO 3B0UX 1UG7A 4JTDB 2XLEA 2Z15A 3NG1A 1VLTA 4MVSA 2A68F 1KU2A 1JAFA 2XXAA 2XLDA 3NMIA 1EI7A 3CZ6A 1K05A 1T6IA 3O39A 2KGOA 4O6YA 3W8HA 1APCA 4JJFA 2YL7A 2XS1A 5L0IA 4YL3A 2WVOA 3UMKA 4EWCA 1HW1A 3EG9B 1QSPA 4IRUA 1C03A 4ZLCA 2WB7A 1YVIA 1TWHA 2P7VA 1Q0DA 2V26A 5KYUA 1DOVA 5L0HA 4AK9A 4DOZA 5A6KA 2LFFA 5B3SC 5KYXB 4KNVA 3ZSUA 2QLAA 1ZU4A 2RSEB 2YVKA 2Y69C 3AQCA 3ASOC 3EH2A 4R32A 3PDMP 3DM9B 3M4BA 1WATA 3IQ5A 2IXNA 1LKXA 1Z6AA 3KYJA 1YAUO 3KPHA 3C7JA 1YLMA 3JCUQ 4MTGA 2ZXRA 4CSAC 3DI5A 2RD9A 1CGME 1B68A 2F22A 2PFDA 2R7VA 4K7BA 3LS1A 1OW6A 2L6HA 1OXKA 3AG2C 3GANA 3TQOA 3LLIA 1OW8A 3SXYA 2FGYA 2HMZA 2TMVP 3KH2A 2HKVA 2R7QA 1E83A 5BQGA 3EH1A 1U6HA 5E33A 1K04A 3PCVA 3ZC4A 3LAYA 5BUOA 4XLNF 2J0WA 3DAFA 4BJTA 1RKEB 1LIHA 1ZVZA 3U3FA 2GDCA 3DJUB 3AG4C 3NKDA 1R4TA 4JCZA 4RD9A 4YK5A 3EGDA 3LEOA 1JPNA 1Q0GA 1ZW3A 4OD4A 1HY5A 1YZAA 3GWLA 3CEXA 2MHRA 2XS8A 4J30B 3ZDLA 3AG1C 4CBEA 1YJGA 4JEAA 2PX3A 3C8GA 1J8YF 1PV3A 5A6BA 2A0UA 3DXJF 5L0CA 4FESA 1BR2A 2R7RA 3IPMO 1D0YA 2PBEA 4NTFA 3ZG1A 2CGEA 4E0IA 5E3CA 3KMIA 4GQHA 3M79A 4CSAA 2KYHA 3FDQA 5FZTA 1G8XA 2XLOA 1JPJA 4J7YA 1M2VB 2A6EF 1HE1A 1OXBA 2R25A 3IQTA 1KNYA 3QW1A 3W4YA 1MMAA 4PACA 2OJED 1RJ9A 4YT2A 2J45A 4P9FA 5EK0A 2YHSA 1G5ZA 1WOLA 2IOQA 3C63A 1OR2A 3RYLA 3LNMB 3S29A 4JCHA 2OU6A 2KK1A 5D91A 4ULWA 2OQMA 1I5NA 4RDAA 2NUPA 1A7VA 2MWQA 4DRJB 5JS5A 1S7ZA 2HSQA 2JPUA 3U9JA 2CNWD 1WGWA 2L7AA 4CX9A 1HMOA 3DD7A 3ITFA 3UGOA 1VLSA 4PFPA 3K6BA 3OA1A 1D1CA 3QMKA 2GAQA 4JTAB 2NUTB 2YLIA 4FX5A 1VTMP 4E7SA 2FFHA 4N4WA 4WGZA 1F1MA 2EIKC 3ABLC 4BG0A 1MNEA 3NYMA 1MQVA 3S90A 1QVXA 4MVRA 2QY9A 2J0XA 2R02A 4JIOA 3ZWIA 5A69A 2I8BA 4Z9IA 1YZCA 4XPWA 5EGYA 3EFOA 2D4UA 3A11A 4DRIB 3R7CA 4QI2A 1OCCC 1VOMA 1ZW2A 2X0CA 3B0VC 2AP3A 1HE9A 4CDVA 1C17M 4MVZA 1FFTC 1OKKD 3N2ZB 5HV9A 4E18A 1RKCA 1V74B 2XLMA 1GGQA 3Q7GA 4U5GA 4OIRF 3K7DA 3WG7C 1VMAA 1OCZC 5F5FA 2L6FA 3C18A 4OINF 3S0XA 2IBFA 3V5XA 2P1AA 3SNHA 3SZRA 2P61A 2L81A 3LEVA 4GYTA 3OEOA 4MVUA 4PJLA 3IQ6A 3UNGC 2PX0A 3I5PA 3LESA 5TJ5E 1LI5A 3RH3A 1NFOA 4BPMA 3EGXB 4NQFA 3K1HA 5A6JA 2W4BA 3DZAA 1IW7F 4XPXA 2J7PD 3VM6A 5E3AA 1VB5A 3JSZA 2XM4A 1ZHWA 3T6BA 1C02A 3DJNB 3LUTB 4YT5A 5F5HA 3V5ZA 4DBRA 4CS9A 4FWVA 1YA9A 4LDKA 1Y6DA 3K1IA 4EUKB 3T6GB 3GODA 3US6A 3G4ZA 1SZIA 3H2UA 2X51A 1MMDA 3BEHA 4OIOF 3AJMA 3C62A 2EINC 2LK4A 3KKBA 4IGGA 2J9BA 3V7OA 3G50A 1NFNA 1ORJA 3NMJA 4ONSA 3TOLA 4QI0A 1GQAA 2VB6A 4RBNA 3NMKA 5COFA 3LS0A
chains in the Genus database with same CATH topology
2ZXWC 4IAOA 4YJWA 4C3EA 1ZU5A 1NU9C 2VASA 4OIPF 2H7VC 2ZXOA 1ZHZA 2WZGA 1Z63A 3L0IA 4HEAJ 1TR2A 4QDLA 2XL4A 4AE4B 3ABMC 4Q5SF 3NKEA 4MNDA 3LNRA 1M57C 4C7OA 4I44A 2Y3HA 1M2VA 4O79A 4X0RA 1O5HA 3W2VA 4G7OF 4JVSA 2DGJA 1MMNA 1V54C 2W4MA 3FAJA 2G3VA 2J9VA 3E70C 1TWAA 4PJNA 5T3TA 5IY5C 5DVWA 3K33A 2IXMA 3WODF 3T6JA 1VYIA 2R7WA 4U5HA 1LVKA 5DS6A 5KYUB 3NDBB 4DVZA 3W2WA 1QLEC 2XXAB 3O6XA 4N06A 2NUTA 3MLGA 2IXOA 2KW3C 4LLCA 4J32B 2Y3GA 3UMIA 4Q4ZF 4U5DE 5DQTA 1D1AA 3NYJA 2C03A 2WZLA 1OCRC 4G7ZF 2YZSA 4YWQA 2IYLD 4F4BA 1PD0A 2Q9AA 3TD7A 1D0XA 3B9QA 3EHNA 4JURI 2MYSA 3JRTA 1FMWA 5DLJA 4WJ0A 4OIQF 4JW1A 5DQZA 2JD3A 4U5FE 4CS9C 1O87A 1TWGA 1M56C 1Z3IX 2CDQA 3UGPA 3K1IC 3EGDB 4PK4A 5KYYA 2XRHA 3EJNA 5DS5A 4IWBA 4JJGA 3UR3C 5CI9A 1ZYRF 4KI2A 3ASNC 2DYRC 2CW0F 3PHF2 4YT8A 5DS4A 2DYSC 2EIMC 1FMVA 3MX3A 2EILC 3AG3C 2Q3TA 4E7ZA 1TKNA 3DM5A 2J46A 1ZHTA 3SYNA 4PJJA 5EHHA 3EG9A 2KNHA 2NUPB 2NG1A 4CIHA 4C3BA 5KYXA 5L3VA 2V3CC 4DVYP 2M4EA 3NRHA 2Y3DA 2OG2A 3NYLA 3ABKC 2J9WA 2O9XA 3AQBA 1M2OA 3HJCA 4AE4A 1NZEA 3RIPA 4O7GA 3FVYA 3EFOB 4YN0B 3S27A 4M63A 5KYNA 3VAYA 1MMGA 3JYHA 1FFHA 1VK5A 1Z5ZA 3KL4A 5HSWA 2HV7A 1J8MF 3Q7LA 2QTVA 4PJMA 2PF4E 2GFHA 4LLEA 5D92A 3F46A 3W8IA 3VYWA 4ZLDA 3DAGA 2P6VA 2KJGA 1NU7D 4P6IC 3N24A 1ZHYA 2G62A 1ZHXA 4GEHA 5B1BC 5KYWB 4HFKB 1D1BA 1SF8A 2L9JA 3B0PA 5B1AC 2OCCC 2XXAA 2BE5F 3LLKA 2CNWA 2WZFA 4KNWA 2Y39A 2H7OA 2WVNA 4LACB 3RKOF 1D0ZA 2Q9CA 3S28A 4O6MA 4I1MA 3SP1A 2WL8A 5CI8A 4LERA 1PD1A 3N0TA 2ZPAA 4KBLA 4KC9A 4W8KA 3DMDA 4K0DA 4U5BE 2ZXPA 1SMYF 1QZXA 3FHDA 2HV6A 4JZAA 4I3MA 1VYKA 2H7BA 1OKKA 3K66A 3T4RA 5L3QA 5FCLA 1W2WA 1IZMA 3X1OA 4H4KC 1V55C 3IEEA 2VH3A 3HTKC 4OD5A 4CS7A 4PFOA 2R7TA 4B6IA 4U5CE 3UMHA 4AX2A 1BR1A 2R7OA 1ST6A 3CSKA 2J7PA 2IXPA 4I1OB 2EIJC 4U5EE 2J9UA 2A1DD 4BEJA 4C7OB 4BJ6C 1Z23A 5T1DB 1BR4A 3CQZA 3E9VA 3LJBA 3M1CB 4HE8D 4XLPF 3EGXA 1PCXA 3EQLF 4EBBA 3Q6NA 3SEOA 3Q6MA 2Y3BA 1NG1A 4C3DA 2A6HF 2KQ9A 2Q9BA 2B0JA 4ANJA 3RFYA 3PMRA 3F47A 3POVA 2D5RB 4CS8C 2WVQA 2W9YA 1TWCA 1RJ9B 4BJ1A 4BJ5C 2R7SA 4IJJA 4XTKA 4HFFB 5E2QA 3L34A 4O6NA 1OCOC 3HLZA 4BJ6A 4Q7CA 5T3WA 2XSEA 4NY3A 1LS1A 1MNDA 4MQ9F 3QZCA 2PP4A 3I5QA 3H65A 4YT4A 3EPVA 4DBQA 1N1CA 3EZIA 4G0HA 2A69F 1FTSA 3I4UA 3JT1A 4A2NB 3ZIBA 5KYYB 2R7UA 3OWTA 3EZHA 3EHMA 2E87A 3ECSA 4XWJA 4CS8A 5KYWA 2C04A 2G3KA 3ZVRA 4BJ5A 2R7XA 2W45A 2LSEA 4G7HF 2YEVA 3X2QC 3B0UX 2Z15A 3NG1A 2A68F 1KU2A 3CZ6A 3O39A 2KGOA 4O6YA 3W8HA 4JJFA 2WVOA 3UMKA 4EWCA 3EG9B 4IRUA 4ZLCA 2WB7A 1TWHA 2P7VA 5KYUA 2V26A 4AK9A 4DOZA 5B3SC 5KYXB 4KNVA 3ZSUA 1ZU4A 2Y69C 3AQCA 3ASOC 3EH2A 3DM9B 2IXNA 1LKXA 1Z6AA 4CSAC 3JCUQ 2ZXRA 2PFDA 2R7VA 4K7BA 3LS1A 3GANA 3AG2C 3LLIA 2FGYA 3KH2A 2R7QA 3EH1A 5E33A 3ZC4A 5BUOA 3LAYA 4XLNF 2J0WA 3DAFA 4BJTA 3DJUB 3AG4C 3NKDA 4RD9A 3EGDA 1JPNA 4OD4A 4J30B 3AG1C 4CBEA 2PX3A 1J8YF 3DXJF 2R7RA 4FESA 1BR2A 1D0YA 3ZG1A 2CGEA 5E3CA 3KMIA 4CSAA 3FDQA 1G8XA 1JPJA 1M2VB 2A6EF 1MMAA 1RJ9A 4YT2A 2J45A 2YHSA 2IOQA 3RYLA 3S29A 4JCHA 5D91A 4ULWA 4RDAA 2NUPA 2MWQA 1S7ZA 2CNWD 1WGWA 3ITFA 3DD7A 3UGOA 4PFPA 3K6BA 3OA1A 1D1CA 3QMKA 2NUTB 4FX5A 4E7SA 2FFHA 2EIKC 3ABLC 4BG0A 1MNEA 3NYMA 2QY9A 2J0XA 2I8BA 5EGYA 3EFOA 4QI2A 1OCCC 1VOMA 3B0VC 1FFTC 1OKKD 3N2ZB 3Q7GA 4U5GA 4OIRF 3K7DA 3WG7C 1VMAA 1OCZC 5F5FA 4OINF 3S0XA 3SNHA 3SZRA 2L81A 3LEVA 4GYTA 3OEOA 4PJLA 3UNGC 2PX0A 3I5PA 3LESA 3RH3A 3EGXB 3K1HA 2W4BA 3DZAA 1IW7F 2J7PD 5E3AA 3JSZA 3T6BA 1ZHWA 3DJNB 5F5HA 4YT5A 4DBRA 4CS9A 4FWVA 3GODA 1SZIA 2X51A 1MMDA 4OIOF 2EINC 3KKBA 3V7OA 4QI0A 4RBNA 2VB6A 3LS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSE A; 
#chains in the Genus database with same CATH topology
 2ZXW C;  4IAO A;  4YJW A;  2LCH A;  2ETS A;  4C3E A;  1ZU5 A;  2ASR A;  1NU9 C;  2UUH A;  2VAS A;  2EPK X;  3QVZ A;  2H7V C;  1S05 A;  1E84 A;  3TJ6 A;  4OIP F;  2QUP A;  3G4X A;  1H7I A;  2ZXO A;  1ZHZ A;  1HW2 A;  4U9E A;  2WZG A;  1Z63 A;  3TUL A;  1RKE A;  3L0I A;  4NCQ A;  2GWW A;  4HEA J;  3T9O A;  1QPU A;  2YLD A;  5JUA A;  1TR2 A;  3SXM A;  1XZP A;  1NSG B;  3A9C A;  3L8J A;  4MVQ A;  4QDL A;  3U2M A;  2XL4 A;  4AE4 B;  3TJ5 A;  1RMV A;  3ABM C;  2AVK A;  3GM2 A;  2BC5 A;  2HS5 A;  3QTH A;  4Q5S F;  3NKE A;  4MND A;  2OOC A;  2A0B A;  2HFI A;  2XL8 A;  3LNR A;  4IAR A;  4JC7 A;  1AUE A;  4N6H A;  1WWP A;  1YYX A;  4ULV A;  1M57 C;  4MS2 A;  4C7O A;  4I44 A;  1AVO B;  2Y3H A;  3BRJ A;  1M2V A;  4O79 A;  5BQH A;  1NBB A;  4X0R A;  1O5H A;  4CJG A;  1YAR O;  3W2V A;  4U9D A;  1Z7Q c;  3ZQV A;  1OW7 A;  3ZTM A;  4G7O F;  4JVS A;  2DGJ A;  2Q7R A;  1MMN A;  1V54 C;  2W4M A;  3FAJ A;  2G3V A;  4BEM J;  4WAB A;  1CPR A;  2J9V A;  3E70 C;  4D4N A;  1TWA A;  3QW0 A;  4PJN A;  5CIV A;  5T3T A;  2YL3 A;  5IY5 C;  5DVW A;  3K33 A;  2IXM A;  3WOD F;  3T6J A;  3IQC A;  1VYI A;  5JLI A;  2R7W A;  4U5H A;  1LVK A;  5DS6 A;  5KYU B;  3NDB B;  4DVZ A;  3W2W A;  1L7C A;  1QLE C;  4CIP A;  2XXA B;  3O6X A;  4N06 A;  3HNI A;  2NUT A;  3SXZ A;  4FAP B;  1QKR A;  1H9T A;  2HUJ A;  2IXO A;  2KW3 C;  3MLG A;  4LLC A;  4J32 B;  2Y3G A;  3UMI A;  4Q4Z F;  4U5D E;  5DQT A;  1D1A A;  2I15 A;  3NYJ A;  2C03 A;  4JE9 A;  3U3B A;  2WZL A;  1OCR C;  1R5I D;  3MBG A;  4G7Z F;  2YZS A;  3VF0 A;  2R9R B;  1GM5 A;  4YWQ A;  2IYL D;  5BQI A;  1U0B B;  1JR8 A;  1E2X A;  4F4B A;  1PD0 A;  2Q9A A;  5AGF A;  3TD7 A;  1LE2 A;  1D0X A;  1Y4C A;  3B9Q A;  5COM A;  3EHN A;  1GS9 A;  2MYS A;  3JRT A;  1FMW A;  4JUR I;  4MTO A;  5DLJ A;  1A7E A;  1Q0M A;  4WJ0 A;  4JW1 A;  4WGY A;  2LFD A;  4OIQ F;  5DQZ A;  2HZ8 A;  2J8W A;  3RQF A;  2JD3 A;  4DRH B;  3S9O A;  4U5F E;  4CS9 C;  1O87 A;  1TWG A;  1M56 C;  1Z3I X;  2CDQ A;  3M4C A;  3K1I C;  3UGP A;  3U5S A;  3DKA A;  3EGD B;  4PK4 A;  4CDY A;  5KYY A;  2XRH A;  3EJN A;  4PR9 A;  2XM0 A;  3FAP B;  5DS5 A;  4MW8 A;  1OQC A;  2HJM A;  1CGO A;  4LDQ A;  4XEV A;  4IWB A;  4JJG A;  3UR3 C;  3DWW A;  3RF3 A;  2XLV A;  4EBK A;  1T6U A;  3C8G B;  1LPE A;  4P9T A;  1ZYR F;  5CI9 A;  3U8P A;  3ASN C;  5L0F A;  4KI2 A;  2DYR C;  1TFK B;  4E17 A;  4JTC B;  2CW0 F;  3PHF 2;  4YT8 A;  1JMW A;  4JRZ A;  4DXW A;  5DS4 A;  1T01 A;  2DYS C;  1I4Z A;  3JYY A;  2Q4F A;  2EIM C;  3U8V A;  1EKY A;  1FMV A;  2AWY A;  3MX3 A;  2EPO A;  1U89 A;  1A7D A;  2EIL C;  2Q3T A;  3AG3 C;  3SXK A;  4EHP A;  2HSB A;  1LS4 A;  3FOO A;  3C8G D;  4E7Z A;  5A6B D;  5JP7 A;  1H9G A;  1TKN A;  3DM5 A;  4AL1 A;  2LD6 A;  2J46 A;  1ZHT A;  3SYN A;  1ZZP A;  1YA7 O;  3ATP A;  3KYI A;  3EG9 A;  4PJJ A;  3RW0 A;  3TOM A;  2KNH A;  5EHH A;  1E86 A;  2NUP B;  2YWA A;  2NG1 A;  5L0D A;  2R05 A;  4CIH A;  3FXH A;  3GEI A;  3J06 A;  1T6Q A;  4C3B A;  5KYX A;  5L3V A;  2V3C C;  4DVY P;  1BDJ B;  2M4E A;  2XLH A;  1L3P A;  2EPM X;  2Y3D A;  2OG2 A;  3NRH A;  1I4Y A;  3RVY A;  3NYL A;  3MYI A;  3ABK C;  2J9W A;  2O9X A;  1BZ4 A;  1M2O A;  3AQB A;  3GWN A;  3HJC A;  2YRF A;  4AE4 A;  1NZE A;  2L6G A;  3RIP A;  2OEX A;  4O7G A;  3FVY A;  3EFO B;  4YL1 A;  1SR2 A;  3FOP A;  4YN0 B;  3S27 A;  4M63 A;  3ZTZ A;  3WHN A;  5KYN A;  1XZQ A;  2BL2 A;  2LQG A;  3VAY A;  2LP4 A;  1MMG A;  4ER9 A;  2OJQ A;  2ICW G;  3JYH A;  1FFH A;  1O3U A;  4JEB A;  1JRA A;  1TFO B;  1VK5 A;  4K1O A;  1Z5Z A;  3KL4 A;  4G78 A;  4EBJ A;  2VCC A;  5HSW A;  2HV7 A;  3HNJ A;  1J8M F;  3Q7L A;  2QTV A;  4PJM A;  1JOG A;  2GFH A;  2PF4 E;  2EPL X;  2UUI A;  5JT4 A;  2PNO A;  4LLE A;  5D92 A;  3F46 A;  4NC3 A;  3VYW A;  3W8I A;  3DAG A;  4ZLD A;  2P6V A;  1M6T A;  1V4A A;  1NU7 D;  2KJG A;  3JZ0 A;  4P6I C;  1E85 A;  3N24 A;  1ZHY A;  2G62 A;  1ZHX A;  3M15 A;  4LDR A;  4GEH A;  3V5Y A;  2JX0 A;  5B1B C;  5KYW B;  3U9M A;  4HFK B;  1D1B A;  1FNT c;  1YDI A;  4Z9H A;  1SF8 A;  2L9J A;  3B0P A;  5B1A C;  2OCC C;  2DB4 A;  2BE5 F;  3DE8 A;  1UFB A;  2CNW A;  2WZF A;  2Y39 A;  3GEE A;  3GEH A;  3LLK A;  4KNW A;  2H7O A;  2WVN A;  3RVZ A;  4LAC B;  3RKO F;  1D0Z A;  2Q9C A;  3S28 A;  4O6M A;  4I1M A;  3SP1 A;  2WL8 A;  5CI8 A;  1LI7 A;  4IB4 A;  5GPG B;  1SYQ A;  1PD1 A;  2VCA A;  3L8I A;  4LER A;  3N0T A;  2ZPA A;  4KBL A;  5L0G A;  1LM3 B;  2KSF A;  4KC9 A;  3U0C A;  5F28 E;  4NTB A;  4W8K A;  3DMD A;  2VC9 A;  2QNL A;  4K0D A;  4U5B E;  3ZQY A;  5AC5 A;  4XEF A;  5L0J A;  4IAQ A;  2ZXP A;  1SMY F;  1QZX A;  3FHD A;  2HV6 A;  4JZA A;  4I3M A;  1VYK A;  2H7B A;  4L6R A;  1OKK A;  3IHU A;  3K66 A;  3T4R A;  5L3Q A;  2AU5 A;  3B71 A;  3WAQ A;  1Q0K A;  1W2W A;  5FCL A;  1ORS C;  4XEK A;  1IZM A;  3X1O A;  4H4K C;  1EQ1 A;  1QQ3 A;  1V55 C;  2KC3 A;  3IEE A;  2VCB A;  1EA8 A;  1G4W R;  2VH3 A;  3GOR A;  3GM1 A;  3HTK C;  3B29 A;  4OD5 A;  4H54 A;  4Z9J A;  4CS7 A;  4UDV A;  4PFO A;  2R7T A;  4B6I A;  2DI3 A;  4U5C E;  2IM8 A;  3U2L A;  5JRA A;  3UMH A;  4AX2 A;  3HNK A;  1BR1 A;  1RCP A;  1ST6 A;  2R7O A;  1T9K A;  1BBH A;  2J7P A;  2IXP A;  3CSK A;  2EIJ C;  3HNL A;  4I1O B;  1ORY A;  2J9U A;  2R03 A;  4U5E E;  2A1D D;  4MVM A;  3TK0 A;  4BEJ A;  4JKV A;  4C7O B;  4BJ6 C;  1Z23 A;  1CGN A;  2B0H A;  2GA0 A;  5T1D B;  1BR4 A;  3CQZ A;  2NSG A;  3E9V A;  3LJB A;  3M1C B;  4HE8 D;  1FR0 A;  4XLP F;  2YKZ A;  1NLX A;  3EGX A;  1PCX A;  3EQL F;  1WTY A;  4EBB A;  3Q6N A;  4DJ9 A;  2LIG A;  2OEV A;  3H2V A;  5K0I A;  1WAS A;  3SEO A;  3Q6M A;  3O10 A;  2AWC A;  2Y3B A;  1NG1 A;  1CPQ A;  5JSL A;  3HKK A;  256B A;  2QE9 A;  2CYD A;  4C3D A;  1YYJ A;  2A6H F;  4EIY A;  2FAP B;  2KQ9 A;  2Q9B A;  2B0J A;  3GM3 A;  1A41 A;  4ANJ A;  3RFY A;  4MW3 A;  3PMR A;  3C8Z A;  3F47 A;  3AGU A;  3POV A;  2D5R B;  3FMS A;  4CS8 C;  1LE4 A;  2WVQ A;  3MFN A;  1HMD A;  3JSE O;  4D4X A;  2W9Y A;  1TWC A;  3RQG A;  1KTM A;  1RJ9 B;  4BJ1 A;  4BJ5 C;  2R7S A;  1A0B A;  4IJJ A;  4W8P A;  4XTK A;  4XPY A;  2HMQ A;  4HFF B;  2H8A A;  1XWJ A;  5E2Q A;  3L34 A;  3AGT A;  1OCO C;  4O6N A;  2HJ3 A;  4EKW A;  3HLZ A;  4BJ6 A;  3R2P A;  1K40 A;  1WN0 A;  2EPN A;  2YLG A;  4NTA A;  4Q7C A;  4CJO A;  5B3I A;  5T3W A;  3S84 A;  2XSE A;  2Q00 A;  1T5O A;  4YL0 A;  3MYF A;  2M64 A;  2YQY A;  4NY3 A;  2OKU A;  1LS1 A;  1MND A;  4J7T A;  4MQ9 F;  1TQG A;  3QZC A;  2PP4 A;  2CCY A;  2XL6 A;  3H65 A;  3I5Q A;  3EPV A;  4YT4 A;  2ZD9 A;  1G4U S;  4DBQ A;  1N1C A;  4AL0 A;  3EZI A;  4G0H A;  2A69 F;  1FTS A;  1RXQ A;  3AOU A;  2NPU A;  3I4U A;  3JT1 A;  5COG A;  3ZIB A;  2YL1 A;  4A2N B;  5KYY B;  2R7U A;  2NSF A;  3OWT A;  3EZH A;  3O55 A;  3EHM A;  1H6G A;  2E87 A;  3ECS A;  4XWJ A;  3L1M A;  4N6C A;  3JTL O;  4XQ1 A;  4CS8 A;  4E0H A;  2XLW A;  5KYW A;  5AC4 A;  2C04 A;  1Q0F A;  2G3K A;  3ZVR A;  4BJ5 A;  5A6A A;  4A4A A;  4CDA A;  3CAX A;  3QVY A;  2R7X A;  3VRC A;  1DOW A;  2W45 A;  2LSE A;  2P0N A;  4MVO A;  1AEP A;  3RQE A;  5JVE A;  4G7H F;  1FAP B;  2YEV A;  3DE9 A;  1OR3 A;  4MTF A;  3X2Q C;  2YL0 A;  3JRM O;  3B0U X;  1UG7 A;  4JTD B;  2XLE A;  2Z15 A;  3NG1 A;  1VLT A;  4MVS A;  2A68 F;  1KU2 A;  1JAF A;  2XXA A;  2XLD A;  3NMI A;  1EI7 A;  3CZ6 A;  1K05 A;  1T6I A;  3O39 A;  2KGO A;  4O6Y A;  3W8H A;  1APC A;  4JJF A;  2YL7 A;  2XS1 A;  5L0I A;  4YL3 A;  2WVO A;  3UMK A;  4EWC A;  1HW1 A;  3EG9 B;  1QSP A;  4IRU A;  1C03 A;  4ZLC A;  2WB7 A;  1YVI A;  1TWH A;  2P7V A;  1Q0D A;  2V26 A;  5KYU A;  1DOV A;  5L0H A;  4AK9 A;  4DOZ A;  5A6K A;  2LFF A;  5B3S C;  5KYX B;  4KNV A;  3ZSU A;  2QLA A;  1ZU4 A;  2RSE B;  2YVK A;  2Y69 C;  3AQC A;  3ASO C;  3EH2 A;  4R32 A;  3PDM P;  3DM9 B;  3M4B A;  1WAT A;  3IQ5 A;  2IXN A;  1LKX A;  1Z6A A;  3KYJ A;  1YAU O;  3KPH A;  3C7J A;  1YLM A;  3JCU Q;  4MTG A;  2ZXR A;  4CSA C;  3DI5 A;  2RD9 A;  1CGM E;  1B68 A;  2F22 A;  2PFD A;  2R7V A;  4K7B A;  3LS1 A;  1OW6 A;  2L6H A;  1OXK A;  3AG2 C;  3GAN A;  3TQO A;  3LLI A;  1OW8 A;  3SXY A;  2FGY A;  2HMZ A;  2TMV P;  3KH2 A;  2HKV A;  2R7Q A;  1E83 A;  5BQG A;  3EH1 A;  1U6H A;  5E33 A;  1K04 A;  3PCV A;  3ZC4 A;  3LAY A;  5BUO A;  4XLN F;  2J0W A;  3DAF A;  4BJT A;  1RKE B;  1LIH A;  1ZVZ A;  3U3F A;  2GDC A;  3DJU B;  3AG4 C;  3NKD A;  1R4T A;  4JCZ A;  4RD9 A;  4YK5 A;  3EGD A;  3LEO A;  1JPN A;  1Q0G A;  1ZW3 A;  4OD4 A;  1HY5 A;  1YZA A;  3GWL A;  3CEX A;  2MHR A;  2XS8 A;  4J30 B;  3ZDL A;  3AG1 C;  4CBE A;  1YJG A;  4JEA A;  2PX3 A;  3C8G A;  1J8Y F;  1PV3 A;  5A6B A;  2A0U A;  3DXJ F;  5L0C A;  4FES A;  1BR2 A;  2R7R A;  3IPM O;  1D0Y A;  2PBE A;  4NTF A;  3ZG1 A;  2CGE A;  4E0I A;  5E3C A;  3KMI A;  4GQH A;  3M79 A;  4CSA A;  2KYH A;  3FDQ A;  5FZT A;  1G8X A;  2XLO A;  1JPJ A;  4J7Y A;  1M2V B;  2A6E F;  1HE1 A;  1OXB A;  2R25 A;  3IQT A;  1KNY A;  3QW1 A;  3W4Y A;  1MMA A;  4PAC A;  2OJE D;  1RJ9 A;  4YT2 A;  2J45 A;  4P9F A;  5EK0 A;  2YHS A;  1G5Z A;  1WOL A;  2IOQ A;  3C63 A;  1OR2 A;  3RYL A;  3LNM B;  3S29 A;  4JCH A;  2OU6 A;  2KK1 A;  5D91 A;  4ULW A;  2OQM A;  1I5N A;  4RDA A;  2NUP A;  1A7V A;  2MWQ A;  4DRJ B;  5JS5 A;  1S7Z A;  2HSQ A;  2JPU A;  3U9J A;  2CNW D;  1WGW A;  2L7A A;  4CX9 A;  1HMO A;  3DD7 A;  3ITF A;  3UGO A;  1VLS A;  4PFP A;  3K6B A;  3OA1 A;  1D1C A;  3QMK A;  2GAQ A;  4JTA B;  2NUT B;  2YLI A;  4FX5 A;  1VTM P;  4E7S A;  2FFH A;  4N4W A;  4WGZ A;  1F1M A;  2EIK C;  3ABL C;  4BG0 A;  1MNE A;  3NYM A;  1MQV A;  3S90 A;  1QVX A;  4MVR A;  2QY9 A;  2J0X A;  2R02 A;  4JIO A;  3ZWI A;  5A69 A;  2I8B A;  4Z9I A;  1YZC A;  4XPW A;  5EGY A;  3EFO A;  2D4U A;  3A11 A;  4DRI B;  3R7C A;  4QI2 A;  1OCC C;  1VOM A;  1ZW2 A;  2X0C A;  3B0V C;  2AP3 A;  1HE9 A;  4CDV A;  1C17 M;  4MVZ A;  1FFT C;  1OKK D;  3N2Z B;  5HV9 A;  4E18 A;  1RKC A;  1V74 B;  2XLM A;  1GGQ A;  3Q7G A;  4U5G A;  4OIR F;  3K7D A;  3WG7 C;  1VMA A;  1OCZ C;  5F5F A;  2L6F A;  3C18 A;  4OIN F;  3S0X A;  2IBF A;  3V5X A;  2P1A A;  3SNH A;  3SZR A;  2P61 A;  2L81 A;  3LEV A;  4GYT A;  3OEO A;  4MVU A;  4PJL A;  3IQ6 A;  3UNG C;  2PX0 A;  3I5P A;  3LES A;  5TJ5 E;  1LI5 A;  3RH3 A;  1NFO A;  4BPM A;  3EGX B;  4NQF A;  3K1H A;  5A6J A;  2W4B A;  3DZA A;  1IW7 F;  4XPX A;  2J7P D;  3VM6 A;  5E3A A;  1VB5 A;  3JSZ A;  2XM4 A;  1ZHW A;  3T6B A;  1C02 A;  3DJN B;  3LUT B;  4YT5 A;  5F5H A;  3V5Z A;  4DBR A;  4CS9 A;  4FWV A;  1YA9 A;  4LDK A;  1Y6D A;  3K1I A;  4EUK B;  3T6G B;  3GOD A;  3US6 A;  3G4Z A;  1SZI A;  3H2U A;  2X51 A;  1MMD A;  3BEH A;  4OIO F;  3AJM A;  3C62 A;  2EIN C;  2LK4 A;  3KKB A;  4IGG A;  2J9B A;  3V7O A;  3G50 A;  1NFN A;  1ORJ A;  3NMJ A;  4ONS A;  3TOL A;  4QI0 A;  1GQA A;  2VB6 A;  4RBN A;  3NMK A;  5COF A;  3LS0 A; 
#chains in the Genus database with same CATH homology
 2ZXW C;  4IAO A;  4YJW A;  4C3E A;  1ZU5 A;  1NU9 C;  2VAS A;  4OIP F;  2H7V C;  2ZXO A;  1ZHZ A;  2WZG A;  1Z63 A;  3L0I A;  4HEA J;  1TR2 A;  4QDL A;  2XL4 A;  4AE4 B;  3ABM C;  4Q5S F;  3NKE A;  4MND A;  3LNR A;  1M57 C;  4C7O A;  4I44 A;  2Y3H A;  1M2V A;  4O79 A;  4X0R A;  1O5H A;  3W2V A;  4G7O F;  4JVS A;  2DGJ A;  1MMN A;  1V54 C;  2W4M A;  3FAJ A;  2G3V A;  2J9V A;  3E70 C;  1TWA A;  4PJN A;  5T3T A;  5IY5 C;  5DVW A;  3K33 A;  2IXM A;  3WOD F;  3T6J A;  1VYI A;  2R7W A;  4U5H A;  1LVK A;  5DS6 A;  5KYU B;  3NDB B;  4DVZ A;  3W2W A;  1QLE C;  2XXA B;  3O6X A;  4N06 A;  2NUT A;  3MLG A;  2IXO A;  2KW3 C;  4LLC A;  4J32 B;  2Y3G A;  3UMI A;  4Q4Z F;  4U5D E;  5DQT A;  1D1A A;  3NYJ A;  2C03 A;  2WZL A;  1OCR C;  4G7Z F;  2YZS A;  4YWQ A;  2IYL D;  4F4B A;  1PD0 A;  2Q9A A;  3TD7 A;  1D0X A;  3B9Q A;  3EHN A;  4JUR I;  2MYS A;  3JRT A;  1FMW A;  5DLJ A;  4WJ0 A;  4OIQ F;  4JW1 A;  5DQZ A;  2JD3 A;  4U5F E;  4CS9 C;  1O87 A;  1TWG A;  1M56 C;  1Z3I X;  2CDQ A;  3UGP A;  3K1I C;  3EGD B;  4PK4 A;  5KYY A;  2XRH A;  3EJN A;  5DS5 A;  4IWB A;  4JJG A;  3UR3 C;  5CI9 A;  1ZYR F;  4KI2 A;  3ASN C;  2DYR C;  2CW0 F;  3PHF 2;  4YT8 A;  5DS4 A;  2DYS C;  2EIM C;  1FMV A;  3MX3 A;  2EIL C;  3AG3 C;  2Q3T A;  4E7Z A;  1TKN A;  3DM5 A;  2J46 A;  1ZHT A;  3SYN A;  4PJJ A;  5EHH A;  3EG9 A;  2KNH A;  2NUP B;  2NG1 A;  4CIH A;  4C3B A;  5KYX A;  5L3V A;  2V3C C;  4DVY P;  2M4E A;  3NRH A;  2Y3D A;  2OG2 A;  3NYL A;  3ABK C;  2J9W A;  2O9X A;  3AQB A;  1M2O A;  3HJC A;  4AE4 A;  1NZE A;  3RIP A;  4O7G A;  3FVY A;  3EFO B;  4YN0 B;  3S27 A;  4M63 A;  5KYN A;  3VAY A;  1MMG A;  3JYH A;  1FFH A;  1VK5 A;  1Z5Z A;  3KL4 A;  5HSW A;  2HV7 A;  1J8M F;  3Q7L A;  2QTV A;  4PJM A;  2PF4 E;  2GFH A;  4LLE A;  5D92 A;  3F46 A;  3W8I A;  3VYW A;  4ZLD A;  3DAG A;  2P6V A;  2KJG A;  1NU7 D;  4P6I C;  3N24 A;  1ZHY A;  2G62 A;  1ZHX A;  4GEH A;  5B1B C;  5KYW B;  4HFK B;  1D1B A;  1SF8 A;  2L9J A;  3B0P A;  5B1A C;  2OCC C;  2XXA A;  2BE5 F;  3LLK A;  2CNW A;  2WZF A;  4KNW A;  2Y39 A;  2H7O A;  2WVN A;  4LAC B;  3RKO F;  1D0Z A;  2Q9C A;  3S28 A;  4O6M A;  4I1M A;  3SP1 A;  2WL8 A;  5CI8 A;  4LER A;  1PD1 A;  3N0T A;  2ZPA A;  4KBL A;  4KC9 A;  4W8K A;  3DMD A;  4K0D A;  4U5B E;  2ZXP A;  1SMY F;  1QZX A;  3FHD A;  2HV6 A;  4JZA A;  4I3M A;  1VYK A;  2H7B A;  1OKK A;  3K66 A;  3T4R A;  5L3Q A;  5FCL A;  1W2W A;  1IZM A;  3X1O A;  4H4K C;  1V55 C;  3IEE A;  2VH3 A;  3HTK C;  4OD5 A;  4CS7 A;  4PFO A;  2R7T A;  4B6I A;  4U5C E;  3UMH A;  4AX2 A;  1BR1 A;  2R7O A;  1ST6 A;  3CSK A;  2J7P A;  2IXP A;  4I1O B;  2EIJ C;  4U5E E;  2J9U A;  2A1D D;  4BEJ A;  4C7O B;  4BJ6 C;  1Z23 A;  5T1D B;  1BR4 A;  3CQZ A;  3E9V A;  3LJB A;  3M1C B;  4HE8 D;  4XLP F;  3EGX A;  1PCX A;  3EQL F;  4EBB A;  3Q6N A;  3SEO A;  3Q6M A;  2Y3B A;  1NG1 A;  4C3D A;  2A6H F;  2KQ9 A;  2Q9B A;  2B0J A;  4ANJ A;  3RFY A;  3PMR A;  3F47 A;  3POV A;  2D5R B;  4CS8 C;  2WVQ A;  2W9Y A;  1TWC A;  1RJ9 B;  4BJ1 A;  4BJ5 C;  2R7S A;  4IJJ A;  4XTK A;  4HFF B;  5E2Q A;  3L34 A;  4O6N A;  1OCO C;  3HLZ A;  4BJ6 A;  4Q7C A;  5T3W A;  2XSE A;  4NY3 A;  1LS1 A;  1MND A;  4MQ9 F;  3QZC A;  2PP4 A;  3I5Q A;  3H65 A;  4YT4 A;  3EPV A;  4DBQ A;  1N1C A;  3EZI A;  4G0H A;  2A69 F;  1FTS A;  3I4U A;  3JT1 A;  4A2N B;  3ZIB A;  5KYY B;  2R7U A;  3OWT A;  3EZH A;  3EHM A;  2E87 A;  3ECS A;  4XWJ A;  4CS8 A;  5KYW A;  2C04 A;  2G3K A;  3ZVR A;  4BJ5 A;  2R7X A;  2W45 A;  2LSE A;  4G7H F;  2YEV A;  3X2Q C;  3B0U X;  2Z15 A;  3NG1 A;  2A68 F;  1KU2 A;  3CZ6 A;  3O39 A;  2KGO A;  4O6Y A;  3W8H A;  4JJF A;  2WVO A;  3UMK A;  4EWC A;  3EG9 B;  4IRU A;  4ZLC A;  2WB7 A;  1TWH A;  2P7V A;  5KYU A;  2V26 A;  4AK9 A;  4DOZ A;  5B3S C;  5KYX B;  4KNV A;  3ZSU A;  1ZU4 A;  2Y69 C;  3AQC A;  3ASO C;  3EH2 A;  3DM9 B;  2IXN A;  1LKX A;  1Z6A A;  4CSA C;  3JCU Q;  2ZXR A;  2PFD A;  2R7V A;  4K7B A;  3LS1 A;  3GAN A;  3AG2 C;  3LLI A;  2FGY A;  3KH2 A;  2R7Q A;  3EH1 A;  5E33 A;  3ZC4 A;  5BUO A;  3LAY A;  4XLN F;  2J0W A;  3DAF A;  4BJT A;  3DJU B;  3AG4 C;  3NKD A;  4RD9 A;  3EGD A;  1JPN A;  4OD4 A;  4J30 B;  3AG1 C;  4CBE A;  2PX3 A;  1J8Y F;  3DXJ F;  2R7R A;  4FES A;  1BR2 A;  1D0Y A;  3ZG1 A;  2CGE A;  5E3C A;  3KMI A;  4CSA A;  3FDQ A;  1G8X A;  1JPJ A;  1M2V B;  2A6E F;  1MMA A;  1RJ9 A;  4YT2 A;  2J45 A;  2YHS A;  2IOQ A;  3RYL A;  3S29 A;  4JCH A;  5D91 A;  4ULW A;  4RDA A;  2NUP A;  2MWQ A;  1S7Z A;  2CNW D;  1WGW A;  3ITF A;  3DD7 A;  3UGO A;  4PFP A;  3K6B A;  3OA1 A;  1D1C A;  3QMK A;  2NUT B;  4FX5 A;  4E7S A;  2FFH A;  2EIK C;  3ABL C;  4BG0 A;  1MNE A;  3NYM A;  2QY9 A;  2J0X A;  2I8B A;  5EGY A;  3EFO A;  4QI2 A;  1OCC C;  1VOM A;  3B0V C;  1FFT C;  1OKK D;  3N2Z B;  3Q7G A;  4U5G A;  4OIR F;  3K7D A;  3WG7 C;  1VMA A;  1OCZ C;  5F5F A;  4OIN F;  3S0X A;  3SNH A;  3SZR A;  2L81 A;  3LEV A;  4GYT A;  3OEO A;  4PJL A;  3UNG C;  2PX0 A;  3I5P A;  3LES A;  3RH3 A;  3EGX B;  3K1H A;  2W4B A;  3DZA A;  1IW7 F;  2J7P D;  5E3A A;  3JSZ A;  3T6B A;  1ZHW A;  3DJN B;  5F5H A;  4YT5 A;  4DBR A;  4CS9 A;  4FWV A;  3GOD A;  1SZI A;  2X51 A;  1MMD A;  4OIO F;  2EIN C;  3KKB A;  3V7O A;  4QI0 A;  4RBN A;  2VB6 A;  3LS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...