2LSEA

Solution nmr structure of de novo designed four helix bundle protein, northeast structural genomics consortium (nesg) target or188
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of a Denovo Design Four Helix Bundle Protein, Northeast Structural Genomics Consortium Target OR188
rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords Four Helix Bundle Protein
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1360 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2lseA00
2LSEA
chains in the Genus database with same CATH superfamily
2TMVP 4G7OF 3DJUB 3DXJF 4IRUA 3SXZA 3EJNA 3MBGA 2HMZA 4JZAA 3C62A 1HE1A 1T6UA 3K66A 2LQGA 2RSEB 3OA1A 2XM0A 2C04A 5HV9A 5DVWA 3C8GA 1OCOC 3N24A 3FVYA 3Q7LA 3FOPA 3U8VA 2LK4A 2YRFA 1ZHZA 2GFHA 5L3QA 5L0HA 4W8KA 1HMOA 1ZHYA 1ZYRF 4O6NA 3ABMC 2W4MA 3S29A 5DQTA 3O10A 5JRAA 1FMWA 4AK9A 5KYYB 2Q9AA 2KW3C 1R4TA 2ZXWC 5E2QA 4DRJB 4OIOF 4Q5SF 3U9MA 4IAOA 4BPMA 3AG1C 4CSAA 4H54A 2A1DD 4C7OB 4P9TA 1U0BB 1Z23A 4LDQA 1H6GA 1JPNA 1QVXA 3JYYA 4U9EA 1XZPA 2VH3A 3LLIA 4CSAC 2YKZA 3QTHA 1AVOB 4KC9A 1S05A 1RMVA 4PR9A 3IQ6A 1E86A 2EIJC 2YL0A 4O6MA 2Q9CA 4A4AA 2R03A 2KSFA 1QQ3A 2Q7RA 2R7SA 3NMJA 1IW7F 3U5SA 2L81A 2YL3A 2YLIA 1V74B 2LCHA 1FTSA 2ICWG 3L8IA 3UNGC 2M64A 1LE4A 4IGGA 4E7SA 5FCLA 4PFPA 5JUAA 1AEPA 1FFHA 1WN0A 5T3WA 2R05A 1RXQA 3M15A 2JX0A 4UDVA 2VASA 4B6IA 2YL1A 2IXPA 2Y3BA 1G5ZA 1VTMP 2GWWA 3C8GD 2YL7A 2PX0A 2AWCA 1S7ZA 2VCAA 2GDCA 4EWCA 3RQGA 1PV3A 4LLCA 3ZQVA 4CJOA 2NPUA 4JC7A 3B0UX 3S9OA 4MVOA 3S90A 2NUTA 4G78A 4X0RA 1Z63A 1LPEA 3C18A 3GM1A 3LNMB 1OKKA 2XLMA 3KMIA 3C7JA 1VOMA 4MW3A 2P0NA 4PK4A 3RVZA 5EHHA 1QSPA 2WVQA 4AL0A 1U89A 2QY9A 3FAJA 2HJ3A 1OQCA 2L6HA 3ATPA 3N2ZB 3DE8A 2W45A 1SYQA 5D91A 4KNWA 3TJ6A 4CIHA 2HFIA 3U3FA 1B68A 2VB6A 4DRIB 4CX9A 3UGOA 2Y3HA 2ETSA 1CGOA 1OW6A 2NSGA 1RKEA 3AOUA 1OKKD 3ZG1A 1LKXA 4JIOA 4Z9IA 1GM5A 5B3SC 2NUTB 1GS9A 2OU6A 3BEHA 3H65A 4BEMJ 2ASRA 2OG2A 3JCUQ 2R7UA 1ZW3A 2JPUA 5COGA 2KC3A 2H8AA 1T6IA 2IOQA 2OJED 3EPVA 4MVUA 2VCCA 4NTAA 5BQGA 1E83A 3S0XA 4YT4A 4CIPA 4U5EE 4D4NA 3ZWIA 1NSGB 2R7TA 4DVZA 2EIKC 1MQVA 3HLZA 1F1MA 4I44A 3WODF 1TFKB 3GODA 4NY3A 2DI3A 2NSFA 4XEVA 4YWQA 3FHDA 4NQFA 4OIPF 2PF4E 3L34A 3MX3A 1L3PA 3HJCA 2ZXPA 3EHNA 4ULWA 2ZXRA 3V5YA 3ZC4A 2EPLX 2HZ8A 1EKYA 1I5NA 1NG1A 1WOLA 3AG2C 4I1MA 5JP7A 3W4YA 3JSEO 3RVYA 5AC5A 4P6IC 1CGME 1LE2A 3DZAA 2J7PA 1TWAA 5A6BA 2EPMX 2I15A 4RD9A 1LS4A 2NUPA 1V55C 2J9BA 3HKKA 4A2NB 4M63A 1BBHA 4ANJA 2OEVA 3ITFA 4DBQA 1RJ9A 2Q9BA 3EHMA 4DBRA 2XL6A 1ORYA 3DM5A 3M1CB 4J30B 4ULVA 1Z5ZA 4YL0A 1LVKA 3S84A 5BQIA 4PACA 4J7YA 3TJ5A 2J0XA 1J8MF 3B0PA 1HMDA 1SMYF 1M57C 1TWGA 4W8PA 5L0CA 1YJGA 1E84A 3JTLO 3T4RA 3C63A 2A0UA 1TKNA 2Q3TA 4C3BA 2PNOA 3HNIA 3LESA 4U5DE 4JEBA 1PCXA 1SF8A 2A0BA 3NYMA 2KNHA 3CSKA 1YZCA 1A7DA 1J8YF 4EHPA 5AGFA 4GQHA 3SP1A 3V7OA 3C8ZA 4LACB 2LFDA 3NMKA 3DJNB 1OXBA 2XL8A 3IQCA 5E3AA 1OCZC 3UGPA 3AG3C 1NFOA 3KKBA 2YQYA 3VYWA 5L0JA 1M2OA 1WGWA 3V5ZA 2J46A 3J06A 4O6YA 2R7WA 4LDKA 1D1AA 4K7BA 3N0TA 3T9OA 1ST6A 4DXWA 2J9UA 2ZPAA 1AUEA 1YARO 3W2VA 1QZXA 3KPHA 3EGXA 3TQOA 3OEOA 4YT5A 1GQAA 2KJGA 3T6BA 4I3MA 3M79A 2R9RB 3L8JA 4MS2A 4N6CA 2WL8A 2MWQA 1D1BA 5JS5A 1O5HA 3AG4C 1ORJA 3V5XA 2EILC 1MMGA 2M4EA 4JKVA 2Y69C 2KK1A 4AX2A 3JRMO 2EIMC 4JCZA 3T6GB 1FAPB 3A11A 2EPOA 2B0HA 3I5PA 2WZFA 2C03A 3JYHA 256BA 4IWBA 2OQMA 4O79A 4YJWA 3DAGA 5CIVA 3E9VA 4GYTA 4JURI 4C7OA 1OW8A 3W8HA 1H9TA 2J0WA 2A6EF 2GAQA 3W2WA 4CS9C 4JJFA 4N4WA 3L0IA 4K0DA 3GM3A 2NG1A 5D92A 3WHNA 4JTAB 3ZIBA 3IQ5A 1EA8A 3O6XA 1A0BA 4U5BE 4BJ6C 3FDQA 2B0JA 2CW0F 4KNVA 3NG1A 2BE5F 2Y39A 2R02A 3LJBA 3RIPA 3DM9B 2WVOA 3EQLF 2Y3GA 1K05A 3GEHA 3MYIA 5T3TA 2MHRA 4WGYA 3JSZA 3EG9B 4O7GA 3JRTA 3K1IA 1LI7A 2X51A 4CS9A 4U9DA 1LM3B 3TK0A 4MVZA 3VF0A 2KQ9A 5HSWA 2X0CA 3NDBB 4CJGA 3G4XA 3KYIA 1PD1A 1Z3IX 4Q7CA 3O39A 4MTGA 4U5HA 1OCCC 2AP3A 1APCA 3I4UA 3R2PA 5B1BC 5F5HA 2HSQA 1T9KA 2XM4A 3AQBA 4YL1A 3M4CA 2Q4FA 3Q6MA 2R7VA 3X2QC 4EBKA 5KYYA 1W2WA 4CS8C 1U6HA 3LLKA 4H4KC 1MMAA 5CI9A 3TOLA 4CBEA 1M2VA 1JPJA 4AL1A 2YEVA 3F47A 1Z7Qc 2J45A 4JCHA 1VB5A 2FFHA 4WABA 4WJ0A 4Q4ZF 4QI0A 4PJNA 5L0FA 2UUIA 1KNYA 3DI5A 3PCVA 5A6KA 2LP4A 3EH2A 1G8XA 3AQCA 3CAXA 3EGDA 5DS4A 5A6JA 1EQ1A 4FESA 2XLHA 1EI7A 3B71A 2V26A 2R7OA 1D0ZA 5K0IA 1VYKA 3ZSUA 4EUKB 2HV6A 2OJQA 4FWVA 2HMQA 2XS1A 3O55A 4J32B 4ONSA 2P7VA 1D0XA 5E33A 1BR1A 2PBEA 4NTFA 1MNDA 3CZ6A 3EFOB 2VC9A 3JT1A 2J9VA 1FFTC 3DKAA 2R7RA 2XXAA 2P1AA 4DOZA 1OR3A 3F46A 3CEXA 3L1MA 3ZVRA 2XLWA 5L0DA 3DE9A 5KYWB 3DMDA 1ZHXA 3PHF2 4ER9A 4JRZA 3DD7A 3SXMA 1FR0A 1YYXA 1G4WR 1QPUA 2OKUA 1WTYA 2XRHA 4XQ1A 4XTKA 4J7TA 3I5QA 4EBJA 3RQEA 3U0CA 2NUPB 2YHSA 4MNDA 4PJJA 1GGQA 4FX5A 1JRAA 1TWHA 3QW1A 2FGYA 3ZTMA 2F22A 4ZLCA 4G7HF 3S27A 2L7AA 4JW1A 1NU7D 4BJ1A 3EFOA 3NYJA 4MTFA 4XEKA 5EGYA 2LIGA 3ZTZA 2QLAA 3OWTA 2HUJA 2XLEA 4IB4A 2Q00A 5AC4A 1N1CA 2CYDA 3HTKC 2ZD9A 4MW8A 1HW1A 1Q0DA 2Y3DA 2YLGA 3U2LA 3ASNC 3G50A 3WAQA 2I8BA 1O87A 4HFKB 5A69A 2V3CC 1Q0MA 3QZCA 3E70C 4PJLA 4BJTA 2G62A 2W9YA 2YVKA 1M2VB 1H9GA 3LEOA 4OD5A 3SXKA 3TD7A 1UG7A 1BR2A 1OXKA 3EH1A 4JTCB 1D1CA 1ORSC 1WATA 2A6HF 4QI2A 4N6HA 2WB7A 4EIYA 3VAYA 3B29A 5F28E 4XPWA 4C3EA 3Q7GA 1L7CA 4PJMA 2L6GA 2PX3A 2PFDA 1KU2A 3EZIA 3FOOA 2YLDA 5KYNA 3GORA 4YN0B 3TULA 4I1OB 1YLMA 1QLEC 2LSEA 1YA9A 2A69F 2RD9A 1JR8A 2QNLA 3RFYA 4QDLA 1FMVA 5A6BD 3RQFA 3MLGA 3IEEA 1SR2A 4JTDB 3ZDLA 3QW0A 4IARA 4XPXA 5KYUB 4BJ6A 3R7CA 3K33A 1V54C 2OEXA 2AU5A 4L6RA 2AWYA 4CDYA 3BRJA 1OR2A 4MQ9F 5JT4A 4NCQA 2CGEA 2WZGA 2VCBA 4HEAJ 1OW7A 1V4AA 2EINC 4GEHA 3HNLA 4P9FA 3EZHA 2GA0A 5GPGB 4XEFA 1C02A 1YAUO 1CPRA 1G4US 2IXNA 1MNEA 1XWJA 2L9JA 2BL2A 3LEVA 3MYFA 4E18A 2DB4A 4MTOA 3NRHA 2KGOA 3LAYA 5COFA 1O3UA 2CCYA 2XS8A 5BUOA 1OCRC 2O9XA 4DVYP 3DWWA 1NFNA 2HJMA 2YZSA 3B9QA 1LIHA 4OIRF 1ZW2A 1WWPA 4BJ5A 3GM2A 3Q6NA 1VMAA 4G7ZF 2H7VC 3M4BA 2H7BA 1YZAA 1RKCA 3K7DA 4K1OA 3US6A 2G3KA 3VM6A 5A6AA 3ABKC 3IPMO 3FXHA 2XLDA 4EBBA 2YWAA 1RCPA 5DS6A 2CDQA 1VLTA 3LUTB 1T5OA 5KYXA 3NKDA 2WVNA 3HNJA 4CDAA 4PFOA 1VLSA 2A68F 5IY5C 2D5RB 3AGUA 3JZ0A 3RW0A 1LS1A 4BJ5C 1MMDA 1DOWA 1T01A 1Y6DA 2HS5A 1TFOB 2QE9A 3UR3C 5TJ5E 1A7EA 1ZHWA 1CPQA 3FMSA 4MVQA 4E17A 5DS5A 4AE4B 3ZQYA 4C3DA 5L0IA 1JOGA 2R7QA 1Q0FA 2EPKX 3H2UA 3SXYA 2AVKA 4XWJA 3NYLA 3LS1A 3ASOC 3EGDB 1QKRA 1BZ4A 2WZLA 2XLOA 1NLXA 1LI5A 3QMKA 3K1HA 2OOCA 5E3CA 1YVIA 1ZVZA 2KYHA 2QUPA 3LNRA 3NMIA 4MVMA 3UMKA 1HE9A 1PD0A 2QTVA 4JJGA 1VK5A 3W8IA 1TQGA 3U3BA 3SZRA 4RBNA 3ABLC 4JEAA 2L6FA 1KTMA 4AE4A 4XLNF 5FZTA 3GEEA 3A9CA 2IYLD 3QVZA 1Z6AA 2XXAB 3B0VC 5B3IA 4DRHB 2FAPB 1A7VA 1K04A 4G0HA 4R32A 3SNHA 2EPNA 4BEJA 4KI2A 3AGTA 5EK0A 4RDAA 1I4ZA 1IZMA 3POVA 5DLJA 3FAPB 1SZIA 1I4YA 1Q0GA 3QVYA 1RKEB 4E7ZA 1JMWA 2J8WA 2R7XA 4LERA 3U2MA 4YT8A 1XZQA 2LD6A 4YL3A 2J9WA 2IM8A 2P6VA 2DYRC 1ZZPA 4BG0A 3EGXB 4LDRA 2HKVA 1M56C 4EKWA 1T6QA 2JD3A 5KYWA 1TWCA 2IXOA 2IBFA 4KBLA 1D0YA 3U9JA 2Z15A 4U5CE 4OD4A 1NZEA 3C8GB 2CNWA 1ZU5A 4XPYA 4WGZA 4CS8A 3ECSA 4JVSA 2CNWD 1C03A 2R25A 3NKEA 3TOMA 4E0IA 2XL4A 3RYLA 1E2XA 5F5FA 1E85A 4HE8D 1Y4CA 4CS7A 1YDIA 3S28A 3PDMP 4XLPF 3K1IC 4D4XA 3GWNA 1C17M 1ZU4A 3LS0A 1K40A 4YK5A 5T1DB 2DGJA 4E0HA 4N06A 4OINF 4U5GA 1A41A 2ZXOA 2E87A 4Z9JA 3IQTA 3RF3A 3WG7C 1YYJA 1NU9C 3H2VA 3AJMA 3GANA 4JE9A 5CI8A 2HV7A 1VYIA 2UUHA 2OCCC 4MVSA 3U8PA 5L3VA 4YT2A 5COMA 1HY5A 2D4UA 2W4BA 1TR2A 3KH2A 1Q0KA 1FNTc 5JSLA 5JVEA 4MVRA 2PP4A 3EG9A 4HFFB 4LLEA 1RJ9B 5B1AC 4ZLDA 3PMRA 1CGNA 3RKOF 4FAPB 1UFBA 4F4BA 3UMHA 4CDVA 3CQZA 4DJ9A 3SYNA 2G3VA 4OIQF 3GEIA 3UMIA 1JAFA 2H7OA 3RH3A 5L0GA 3HNKA 5DQZA 1MMNA 1WASA 3G4ZA 1DOVA 2LFFA 3GWLA 2P61A 2XLVA 4NC3A 2XSEA 4NTBA 5KYUA 2HSBA 5JLIA 3T6JA 5BQHA 1M6TA 1ZHTA 3SEOA 2MYSA 1H7IA 1NBBA 2DYSC 3IHUA 4IJJA 3X1OA 5KYXB 3K6BA 1R5ID 1YA7O 3MFNA 4Z9HA 2J7PD 1HW2A 1BR4A 3KYJA 2IXMA 3VRCA 1BDJB 4IAQA 4U5FE 2BC5A 3KL4A 3DAFA
chains in the Genus database with same CATH topology
4G7OF 3DJUB 3DXJF 4IRUA 3EJNA 4JZAA 3K66A 3OA1A 2C04A 5DVWA 1OCOC 3N24A 3FVYA 3Q7LA 1ZHZA 2GFHA 5L3QA 4W8KA 1ZHYA 1ZYRF 4O6NA 3ABMC 2W4MA 3S29A 5DQTA 1FMWA 4AK9A 5KYYB 2Q9AA 2KW3C 2ZXWC 5E2QA 4Q5SF 4OIOF 4IAOA 3AG1C 4CSAA 4C7OB 2A1DD 1Z23A 1JPNA 2VH3A 3LLIA 4CSAC 4KC9A 2EIJC 4O6MA 2Q9CA 2R7SA 1IW7F 2L81A 3UNGC 1FTSA 4E7SA 5FCLA 4PFPA 1FFHA 5T3WA 2VASA 4B6IA 2IXPA 2Y3BA 2PX0A 1S7ZA 4EWCA 4LLCA 3B0UX 2NUTA 4X0RA 1Z63A 1OKKA 3KMIA 1VOMA 4PK4A 5EHHA 2WVQA 2QY9A 3FAJA 3N2ZB 2W45A 5D91A 4CIHA 4KNWA 2VB6A 3UGOA 2Y3HA 3ZG1A 1OKKD 1LKXA 5B3SC 2NUTB 3H65A 2R7UA 2OG2A 3JCUQ 2IOQA 3S0XA 3EPVA 4YT4A 4U5EE 2R7TA 4DVZA 2EIKC 3HLZA 4I44A 3WODF 3GODA 4NY3A 4YWQA 3FHDA 4OIPF 2PF4E 3L34A 3MX3A 3HJCA 2ZXPA 3EHNA 4ULWA 2ZXRA 3ZC4A 1NG1A 3AG2C 4P6IC 3DZAA 2J7PA 1TWAA 4RD9A 2NUPA 1V55C 4ANJA 4A2NB 4M63A 3ITFA 4DBQA 1RJ9A 2Q9BA 3EHMA 4DBRA 3DM5A 3M1CB 4J30B 1Z5ZA 1LVKA 2J0XA 1J8MF 3B0PA 1SMYF 1M57C 1TWGA 3T4RA 1TKNA 2Q3TA 4C3BA 3LESA 4U5DE 1PCXA 1SF8A 3NYMA 2KNHA 3CSKA 1J8YF 3SP1A 3V7OA 4LACB 3DJNB 5E3AA 1OCZC 3UGPA 3AG3C 3KKBA 3VYWA 1M2OA 1WGWA 2J46A 4O6YA 2R7WA 1D1AA 4K7BA 3N0TA 1ST6A 2J9UA 2ZPAA 3W2VA 1QZXA 3EGXA 3OEOA 4YT5A 3T6BA 2KJGA 4I3MA 2WL8A 2MWQA 1D1BA 1O5HA 3AG4C 2EILC 1MMGA 2M4EA 2Y69C 4AX2A 2EIMC 3JYHA 3I5PA 2WZFA 2C03A 4IWBA 4O79A 4YJWA 3DAGA 3E9VA 4GYTA 4JURI 4C7OA 3W8HA 2J0WA 2A6EF 3W2WA 4CS9C 4JJFA 3L0IA 4K0DA 2NG1A 5D92A 3ZIBA 3O6XA 4BJ6C 4U5BE 3FDQA 2B0JA 2CW0F 4KNVA 3NG1A 2BE5F 2Y39A 3LJBA 3RIPA 3DM9B 2WVOA 3EQLF 2Y3GA 5T3TA 3JSZA 3EG9B 4O7GA 3JRTA 2X51A 4CS9A 2KQ9A 5HSWA 3NDBB 1PD1A 1Z3IX 4Q7CA 3O39A 4U5HA 1OCCC 3I4UA 5B1BC 5F5HA 3AQBA 3Q6MA 2R7VA 3X2QC 5KYYA 1W2WA 4CS8C 4H4KC 3LLKA 5CI9A 1MMAA 4CBEA 1M2VA 1JPJA 2YEVA 3F47A 2J45A 4JCHA 2FFHA 4WJ0A 4Q4ZF 4QI0A 4PJNA 3EH2A 1G8XA 3AQCA 3EGDA 5DS4A 4FESA 2V26A 2R7OA 1D0ZA 1VYKA 3ZSUA 2HV6A 4FWVA 4J32B 2P7VA 1D0XA 5E33A 1BR1A 1MNDA 3CZ6A 3EFOB 3JT1A 2J9VA 1FFTC 2R7RA 2XXAA 4DOZA 3F46A 3ZVRA 5KYWB 3DMDA 1ZHXA 3PHF2 3DD7A 2XRHA 4XTKA 3I5QA 2NUPB 2YHSA 4MNDA 4PJJA 4FX5A 1TWHA 2FGYA 4ZLCA 4G7HF 3S27A 5EGYA 4JW1A 1NU7D 4BJ1A 3EFOA 3NYJA 3OWTA 1N1CA 3HTKC 2Y3DA 3ASNC 2V3CC 2I8BA 1O87A 4HFKB 3QZCA 3E70C 4PJLA 4BJTA 2G62A 2W9YA 1M2VB 4OD5A 3TD7A 1BR2A 3EH1A 1D1CA 2A6HF 4QI2A 2WB7A 3VAYA 4C3EA 3Q7GA 4PJMA 2PX3A 2PFDA 1KU2A 3EZIA 5KYNA 4YN0B 4I1OB 1QLEC 2LSEA 2A69F 3RFYA 4QDLA 1FMVA 3MLGA 3IEEA 5KYUB 4BJ6A 3K33A 1V54C 4MQ9F 2CGEA 2WZGA 4HEAJ 4GEHA 2EINC 3EZHA 4I1MA 2IXNA 2L9JA 1MNEA 4OIQF 3LEVA 3NRHA 2KGOA 3LAYA 5BUOA 1OCRC 2O9XA 4DVYP 2YZSA 3B9QA 4OIRF 4BJ5A 3Q6NA 1VMAA 4G7ZF 2H7VC 2H7BA 3K7DA 2G3KA 3ABKC 4EBBA 5DS6A 2CDQA 5KYXA 3NKDA 2WVNA 4PFOA 2A68F 5IY5C 2D5RB 1LS1A 4BJ5C 1MMDA 3UR3C 1ZHWA 5DS5A 4AE4B 4C3DA 2R7QA 4XWJA 3NYLA 3LS1A 3ASOC 3EGDB 2WZLA 3QMKA 3K1HA 5E3CA 3LNRA 3UMKA 1PD0A 2QTVA 4JJGA 1VK5A 3W8IA 3SZRA 4RBNA 3ABLC 4AE4A 4XLNF 2IYLD 1Z6AA 2XXAB 3B0VC 4KI2A 4G0HA 3SNHA 4BEJA 4RDAA 1IZMA 3POVA 5DLJA 1SZIA 4E7ZA 2R7XA 4LERA 4YT8A 2J9WA 4BG0A 2P6VA 2DYRC 3EGXB 1M56C 5KYWA 2JD3A 1TWCA 2IXOA 4KBLA 1D0YA 2Z15A 4U5CE 4OD4A 1NZEA 2CNWA 1ZU5A 4CS8A 3ECSA 4JVSA 2CNWD 3NKEA 2XL4A 3RYLA 5F5FA 4HE8D 4CS7A 3S28A 4XLPF 3K1IC 1ZU4A 3LS0A 5T1DB 2DGJA 4N06A 4OINF 4U5GA 2ZXOA 2E87A 3WG7C 1NU9C 3GANA 5CI8A 2HV7A 1VYIA 2OCCC 5L3VA 4YT2A 2W4BA 1TR2A 3KH2A 5B1AC 2PP4A 3EG9A 4HFFB 4LLEA 1RJ9B 4ZLDA 3PMRA 3RKOF 4F4BA 3UMHA 3CQZA 3SYNA 2G3VA 3UMIA 2H7OA 3RH3A 5DQZA 1MMNA 2XSEA 5KYUA 3T6JA 1ZHTA 3SEOA 2MYSA 4IJJA 2DYSC 5KYXB 3X1OA 3K6BA 2J7PD 1BR4A 2IXMA 4U5FE 3KL4A 3DAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSE A; 
#chains in the Genus database with same CATH topology
 2TMV P;  4G7O F;  3DJU B;  3DXJ F;  4IRU A;  3SXZ A;  3EJN A;  3MBG A;  2HMZ A;  4JZA A;  3C62 A;  1HE1 A;  1T6U A;  3K66 A;  2LQG A;  2RSE B;  3OA1 A;  2XM0 A;  2C04 A;  5HV9 A;  5DVW A;  3C8G A;  1OCO C;  3N24 A;  3FVY A;  3Q7L A;  3FOP A;  3U8V A;  2LK4 A;  2YRF A;  1ZHZ A;  2GFH A;  5L3Q A;  5L0H A;  4W8K A;  1HMO A;  1ZHY A;  1ZYR F;  4O6N A;  3ABM C;  2W4M A;  3S29 A;  5DQT A;  3O10 A;  5JRA A;  1FMW A;  4AK9 A;  5KYY B;  2Q9A A;  2KW3 C;  1R4T A;  2ZXW C;  5E2Q A;  4DRJ B;  4OIO F;  4Q5S F;  3U9M A;  4IAO A;  4BPM A;  3AG1 C;  4CSA A;  4H54 A;  2A1D D;  4C7O B;  4P9T A;  1U0B B;  1Z23 A;  4LDQ A;  1H6G A;  1JPN A;  1QVX A;  3JYY A;  4U9E A;  1XZP A;  2VH3 A;  3LLI A;  4CSA C;  2YKZ A;  3QTH A;  1AVO B;  4KC9 A;  1S05 A;  1RMV A;  4PR9 A;  3IQ6 A;  1E86 A;  2EIJ C;  2YL0 A;  4O6M A;  2Q9C A;  4A4A A;  2R03 A;  2KSF A;  1QQ3 A;  2Q7R A;  2R7S A;  3NMJ A;  1IW7 F;  3U5S A;  2L81 A;  2YL3 A;  2YLI A;  1V74 B;  2LCH A;  1FTS A;  2ICW G;  3L8I A;  3UNG C;  2M64 A;  1LE4 A;  4IGG A;  4E7S A;  5FCL A;  4PFP A;  5JUA A;  1AEP A;  1FFH A;  1WN0 A;  5T3W A;  2R05 A;  1RXQ A;  3M15 A;  2JX0 A;  4UDV A;  2VAS A;  4B6I A;  2YL1 A;  2IXP A;  2Y3B A;  1G5Z A;  1VTM P;  2GWW A;  3C8G D;  2YL7 A;  2PX0 A;  2AWC A;  1S7Z A;  2VCA A;  2GDC A;  4EWC A;  3RQG A;  1PV3 A;  4LLC A;  3ZQV A;  4CJO A;  2NPU A;  4JC7 A;  3B0U X;  3S9O A;  4MVO A;  3S90 A;  2NUT A;  4G78 A;  4X0R A;  1Z63 A;  1LPE A;  3C18 A;  3GM1 A;  3LNM B;  1OKK A;  2XLM A;  3KMI A;  3C7J A;  1VOM A;  4MW3 A;  2P0N A;  4PK4 A;  3RVZ A;  5EHH A;  1QSP A;  2WVQ A;  4AL0 A;  1U89 A;  2QY9 A;  3FAJ A;  2HJ3 A;  1OQC A;  2L6H A;  3ATP A;  3N2Z B;  3DE8 A;  2W45 A;  1SYQ A;  5D91 A;  4KNW A;  3TJ6 A;  4CIH A;  2HFI A;  3U3F A;  1B68 A;  2VB6 A;  4DRI B;  4CX9 A;  3UGO A;  2Y3H A;  2ETS A;  1CGO A;  1OW6 A;  2NSG A;  1RKE A;  3AOU A;  1OKK D;  3ZG1 A;  1LKX A;  4JIO A;  4Z9I A;  1GM5 A;  5B3S C;  2NUT B;  1GS9 A;  2OU6 A;  3BEH A;  3H65 A;  4BEM J;  2ASR A;  2OG2 A;  3JCU Q;  2R7U A;  1ZW3 A;  2JPU A;  5COG A;  2KC3 A;  2H8A A;  1T6I A;  2IOQ A;  2OJE D;  3EPV A;  4MVU A;  2VCC A;  4NTA A;  5BQG A;  1E83 A;  3S0X A;  4YT4 A;  4CIP A;  4U5E E;  4D4N A;  3ZWI A;  1NSG B;  2R7T A;  4DVZ A;  2EIK C;  1MQV A;  3HLZ A;  1F1M A;  4I44 A;  3WOD F;  1TFK B;  3GOD A;  4NY3 A;  2DI3 A;  2NSF A;  4XEV A;  4YWQ A;  3FHD A;  4NQF A;  4OIP F;  2PF4 E;  3L34 A;  3MX3 A;  1L3P A;  3HJC A;  2ZXP A;  3EHN A;  4ULW A;  2ZXR A;  3V5Y A;  3ZC4 A;  2EPL X;  2HZ8 A;  1EKY A;  1I5N A;  1NG1 A;  1WOL A;  3AG2 C;  4I1M A;  5JP7 A;  3W4Y A;  3JSE O;  3RVY A;  5AC5 A;  4P6I C;  1CGM E;  1LE2 A;  3DZA A;  2J7P A;  1TWA A;  5A6B A;  2EPM X;  2I15 A;  4RD9 A;  1LS4 A;  2NUP A;  1V55 C;  2J9B A;  3HKK A;  4A2N B;  4M63 A;  1BBH A;  4ANJ A;  2OEV A;  3ITF A;  4DBQ A;  1RJ9 A;  2Q9B A;  3EHM A;  4DBR A;  2XL6 A;  1ORY A;  3DM5 A;  3M1C B;  4J30 B;  4ULV A;  1Z5Z A;  4YL0 A;  1LVK A;  3S84 A;  5BQI A;  4PAC A;  4J7Y A;  3TJ5 A;  2J0X A;  1J8M F;  3B0P A;  1HMD A;  1SMY F;  1M57 C;  1TWG A;  4W8P A;  5L0C A;  1YJG A;  1E84 A;  3JTL O;  3T4R A;  3C63 A;  2A0U A;  1TKN A;  2Q3T A;  4C3B A;  2PNO A;  3HNI A;  3LES A;  4U5D E;  4JEB A;  1PCX A;  1SF8 A;  2A0B A;  3NYM A;  2KNH A;  3CSK A;  1YZC A;  1A7D A;  1J8Y F;  4EHP A;  5AGF A;  4GQH A;  3SP1 A;  3V7O A;  3C8Z A;  4LAC B;  2LFD A;  3NMK A;  3DJN B;  1OXB A;  2XL8 A;  3IQC A;  5E3A A;  1OCZ C;  3UGP A;  3AG3 C;  1NFO A;  3KKB A;  2YQY A;  3VYW A;  5L0J A;  1M2O A;  1WGW A;  3V5Z A;  2J46 A;  3J06 A;  4O6Y A;  2R7W A;  4LDK A;  1D1A A;  4K7B A;  3N0T A;  3T9O A;  1ST6 A;  4DXW A;  2J9U A;  2ZPA A;  1AUE A;  1YAR O;  3W2V A;  1QZX A;  3KPH A;  3EGX A;  3TQO A;  3OEO A;  4YT5 A;  1GQA A;  2KJG A;  3T6B A;  4I3M A;  3M79 A;  2R9R B;  3L8J A;  4MS2 A;  4N6C A;  2WL8 A;  2MWQ A;  1D1B A;  5JS5 A;  1O5H A;  3AG4 C;  1ORJ A;  3V5X A;  2EIL C;  1MMG A;  2M4E A;  4JKV A;  2Y69 C;  2KK1 A;  4AX2 A;  3JRM O;  2EIM C;  4JCZ A;  3T6G B;  1FAP B;  3A11 A;  2EPO A;  2B0H A;  3I5P A;  2WZF A;  2C03 A;  3JYH A;  256B A;  4IWB A;  2OQM A;  4O79 A;  4YJW A;  3DAG A;  5CIV A;  3E9V A;  4GYT A;  4JUR I;  4C7O A;  1OW8 A;  3W8H A;  1H9T A;  2J0W A;  2A6E F;  2GAQ A;  3W2W A;  4CS9 C;  4JJF A;  4N4W A;  3L0I A;  4K0D A;  3GM3 A;  2NG1 A;  5D92 A;  3WHN A;  4JTA B;  3ZIB A;  3IQ5 A;  1EA8 A;  3O6X A;  1A0B A;  4U5B E;  4BJ6 C;  3FDQ A;  2B0J A;  2CW0 F;  4KNV A;  3NG1 A;  2BE5 F;  2Y39 A;  2R02 A;  3LJB A;  3RIP A;  3DM9 B;  2WVO A;  3EQL F;  2Y3G A;  1K05 A;  3GEH A;  3MYI A;  5T3T A;  2MHR A;  4WGY A;  3JSZ A;  3EG9 B;  4O7G A;  3JRT A;  3K1I A;  1LI7 A;  2X51 A;  4CS9 A;  4U9D A;  1LM3 B;  3TK0 A;  4MVZ A;  3VF0 A;  2KQ9 A;  5HSW A;  2X0C A;  3NDB B;  4CJG A;  3G4X A;  3KYI A;  1PD1 A;  1Z3I X;  4Q7C A;  3O39 A;  4MTG A;  4U5H A;  1OCC C;  2AP3 A;  1APC A;  3I4U A;  3R2P A;  5B1B C;  5F5H A;  2HSQ A;  1T9K A;  2XM4 A;  3AQB A;  4YL1 A;  3M4C A;  2Q4F A;  3Q6M A;  2R7V A;  3X2Q C;  4EBK A;  5KYY A;  1W2W A;  4CS8 C;  1U6H A;  3LLK A;  4H4K C;  1MMA A;  5CI9 A;  3TOL A;  4CBE A;  1M2V A;  1JPJ A;  4AL1 A;  2YEV A;  3F47 A;  1Z7Q c;  2J45 A;  4JCH A;  1VB5 A;  2FFH A;  4WAB A;  4WJ0 A;  4Q4Z F;  4QI0 A;  4PJN A;  5L0F A;  2UUI A;  1KNY A;  3DI5 A;  3PCV A;  5A6K A;  2LP4 A;  3EH2 A;  1G8X A;  3AQC A;  3CAX A;  3EGD A;  5DS4 A;  5A6J A;  1EQ1 A;  4FES A;  2XLH A;  1EI7 A;  3B71 A;  2V26 A;  2R7O A;  1D0Z A;  5K0I A;  1VYK A;  3ZSU A;  4EUK B;  2HV6 A;  2OJQ A;  4FWV A;  2HMQ A;  2XS1 A;  3O55 A;  4J32 B;  4ONS A;  2P7V A;  1D0X A;  5E33 A;  1BR1 A;  2PBE A;  4NTF A;  1MND A;  3CZ6 A;  3EFO B;  2VC9 A;  3JT1 A;  2J9V A;  1FFT C;  3DKA A;  2R7R A;  2XXA A;  2P1A A;  4DOZ A;  1OR3 A;  3F46 A;  3CEX A;  3L1M A;  3ZVR A;  2XLW A;  5L0D A;  3DE9 A;  5KYW B;  3DMD A;  1ZHX A;  3PHF 2;  4ER9 A;  4JRZ A;  3DD7 A;  3SXM A;  1FR0 A;  1YYX A;  1G4W R;  1QPU A;  2OKU A;  1WTY A;  2XRH A;  4XQ1 A;  4XTK A;  4J7T A;  3I5Q A;  4EBJ A;  3RQE A;  3U0C A;  2NUP B;  2YHS A;  4MND A;  4PJJ A;  1GGQ A;  4FX5 A;  1JRA A;  1TWH A;  3QW1 A;  2FGY A;  3ZTM A;  2F22 A;  4ZLC A;  4G7H F;  3S27 A;  2L7A A;  4JW1 A;  1NU7 D;  4BJ1 A;  3EFO A;  3NYJ A;  4MTF A;  4XEK A;  5EGY A;  2LIG A;  3ZTZ A;  2QLA A;  3OWT A;  2HUJ A;  2XLE A;  4IB4 A;  2Q00 A;  5AC4 A;  1N1C A;  2CYD A;  3HTK C;  2ZD9 A;  4MW8 A;  1HW1 A;  1Q0D A;  2Y3D A;  2YLG A;  3U2L A;  3ASN C;  3G50 A;  3WAQ A;  2I8B A;  1O87 A;  4HFK B;  5A69 A;  2V3C C;  1Q0M A;  3QZC A;  3E70 C;  4PJL A;  4BJT A;  2G62 A;  2W9Y A;  2YVK A;  1M2V B;  1H9G A;  3LEO A;  4OD5 A;  3SXK A;  3TD7 A;  1UG7 A;  1BR2 A;  1OXK A;  3EH1 A;  4JTC B;  1D1C A;  1ORS C;  1WAT A;  2A6H F;  4QI2 A;  4N6H A;  2WB7 A;  4EIY A;  3VAY A;  3B29 A;  5F28 E;  4XPW A;  4C3E A;  3Q7G A;  1L7C A;  4PJM A;  2L6G A;  2PX3 A;  2PFD A;  1KU2 A;  3EZI A;  3FOO A;  2YLD A;  5KYN A;  3GOR A;  4YN0 B;  3TUL A;  4I1O B;  1YLM A;  1QLE C;  2LSE A;  1YA9 A;  2A69 F;  2RD9 A;  1JR8 A;  2QNL A;  3RFY A;  4QDL A;  1FMV A;  5A6B D;  3RQF A;  3MLG A;  3IEE A;  1SR2 A;  4JTD B;  3ZDL A;  3QW0 A;  4IAR A;  4XPX A;  5KYU B;  4BJ6 A;  3R7C A;  3K33 A;  1V54 C;  2OEX A;  2AU5 A;  4L6R A;  2AWY A;  4CDY A;  3BRJ A;  1OR2 A;  4MQ9 F;  5JT4 A;  4NCQ A;  2CGE A;  2WZG A;  2VCB A;  4HEA J;  1OW7 A;  1V4A A;  2EIN C;  4GEH A;  3HNL A;  4P9F A;  3EZH A;  2GA0 A;  5GPG B;  4XEF A;  1C02 A;  1YAU O;  1CPR A;  1G4U S;  2IXN A;  1MNE A;  1XWJ A;  2L9J A;  2BL2 A;  3LEV A;  3MYF A;  4E18 A;  2DB4 A;  4MTO A;  3NRH A;  2KGO A;  3LAY A;  5COF A;  1O3U A;  2CCY A;  2XS8 A;  5BUO A;  1OCR C;  2O9X A;  4DVY P;  3DWW A;  1NFN A;  2HJM A;  2YZS A;  3B9Q A;  1LIH A;  4OIR F;  1ZW2 A;  1WWP A;  4BJ5 A;  3GM2 A;  3Q6N A;  1VMA A;  4G7Z F;  2H7V C;  3M4B A;  2H7B A;  1YZA A;  1RKC A;  3K7D A;  4K1O A;  3US6 A;  2G3K A;  3VM6 A;  5A6A A;  3ABK C;  3IPM O;  3FXH A;  2XLD A;  4EBB A;  2YWA A;  1RCP A;  5DS6 A;  2CDQ A;  1VLT A;  3LUT B;  1T5O A;  5KYX A;  3NKD A;  2WVN A;  3HNJ A;  4CDA A;  4PFO A;  1VLS A;  2A68 F;  5IY5 C;  2D5R B;  3AGU A;  3JZ0 A;  3RW0 A;  1LS1 A;  4BJ5 C;  1MMD A;  1DOW A;  1T01 A;  1Y6D A;  2HS5 A;  1TFO B;  2QE9 A;  3UR3 C;  5TJ5 E;  1A7E A;  1ZHW A;  1CPQ A;  3FMS A;  4MVQ A;  4E17 A;  5DS5 A;  4AE4 B;  3ZQY A;  4C3D A;  5L0I A;  1JOG A;  2R7Q A;  1Q0F A;  2EPK X;  3H2U A;  3SXY A;  2AVK A;  4XWJ A;  3NYL A;  3LS1 A;  3ASO C;  3EGD B;  1QKR A;  1BZ4 A;  2WZL A;  2XLO A;  1NLX A;  1LI5 A;  3QMK A;  3K1H A;  2OOC A;  5E3C A;  1YVI A;  1ZVZ A;  2KYH A;  2QUP A;  3LNR A;  3NMI A;  4MVM A;  3UMK A;  1HE9 A;  1PD0 A;  2QTV A;  4JJG A;  1VK5 A;  3W8I A;  1TQG A;  3U3B A;  3SZR A;  4RBN A;  3ABL C;  4JEA A;  2L6F A;  1KTM A;  4AE4 A;  4XLN F;  5FZT A;  3GEE A;  3A9C A;  2IYL D;  3QVZ A;  1Z6A A;  2XXA B;  3B0V C;  5B3I A;  4DRH B;  2FAP B;  1A7V A;  1K04 A;  4G0H A;  4R32 A;  3SNH A;  2EPN A;  4BEJ A;  4KI2 A;  3AGT A;  5EK0 A;  4RDA A;  1I4Z A;  1IZM A;  3POV A;  5DLJ A;  3FAP B;  1SZI A;  1I4Y A;  1Q0G A;  3QVY A;  1RKE B;  4E7Z A;  1JMW A;  2J8W A;  2R7X A;  4LER A;  3U2M A;  4YT8 A;  1XZQ A;  2LD6 A;  4YL3 A;  2J9W A;  2IM8 A;  2P6V A;  2DYR C;  1ZZP A;  4BG0 A;  3EGX B;  4LDR A;  2HKV A;  1M56 C;  4EKW A;  1T6Q A;  2JD3 A;  5KYW A;  1TWC A;  2IXO A;  2IBF A;  4KBL A;  1D0Y A;  3U9J A;  2Z15 A;  4U5C E;  4OD4 A;  1NZE A;  3C8G B;  2CNW A;  1ZU5 A;  4XPY A;  4WGZ A;  4CS8 A;  3ECS A;  4JVS A;  2CNW D;  1C03 A;  2R25 A;  3NKE A;  3TOM A;  4E0I A;  2XL4 A;  3RYL A;  1E2X A;  5F5F A;  1E85 A;  4HE8 D;  1Y4C A;  4CS7 A;  1YDI A;  3S28 A;  3PDM P;  4XLP F;  3K1I C;  4D4X A;  3GWN A;  1C17 M;  1ZU4 A;  3LS0 A;  1K40 A;  4YK5 A;  5T1D B;  2DGJ A;  4E0H A;  4N06 A;  4OIN F;  4U5G A;  1A41 A;  2ZXO A;  2E87 A;  4Z9J A;  3IQT A;  3RF3 A;  3WG7 C;  1YYJ A;  1NU9 C;  3H2V A;  3AJM A;  3GAN A;  4JE9 A;  5CI8 A;  2HV7 A;  1VYI A;  2UUH A;  2OCC C;  4MVS A;  3U8P A;  5L3V A;  4YT2 A;  5COM A;  1HY5 A;  2D4U A;  2W4B A;  1TR2 A;  3KH2 A;  1Q0K A;  1FNT c;  5JSL A;  5JVE A;  4MVR A;  2PP4 A;  3EG9 A;  4HFF B;  4LLE A;  1RJ9 B;  5B1A C;  4ZLD A;  3PMR A;  1CGN A;  3RKO F;  4FAP B;  1UFB A;  4F4B A;  3UMH A;  4CDV A;  3CQZ A;  4DJ9 A;  3SYN A;  2G3V A;  4OIQ F;  3GEI A;  3UMI A;  1JAF A;  2H7O A;  3RH3 A;  5L0G A;  3HNK A;  5DQZ A;  1MMN A;  1WAS A;  3G4Z A;  1DOV A;  2LFF A;  3GWL A;  2P61 A;  2XLV A;  4NC3 A;  2XSE A;  4NTB A;  5KYU A;  2HSB A;  5JLI A;  3T6J A;  5BQH A;  1M6T A;  1ZHT A;  3SEO A;  2MYS A;  1H7I A;  1NBB A;  2DYS C;  3IHU A;  4IJJ A;  3X1O A;  5KYX B;  3K6B A;  1R5I D;  1YA7 O;  3MFN A;  4Z9H A;  2J7P D;  1HW2 A;  1BR4 A;  3KYJ A;  2IXM A;  3VRC A;  1BDJ B;  4IAQ A;  4U5F E;  2BC5 A;  3KL4 A;  3DAF A; 
#chains in the Genus database with same CATH homology
 4G7O F;  3DJU B;  3DXJ F;  4IRU A;  3EJN A;  4JZA A;  3K66 A;  3OA1 A;  2C04 A;  5DVW A;  1OCO C;  3N24 A;  3FVY A;  3Q7L A;  1ZHZ A;  2GFH A;  5L3Q A;  4W8K A;  1ZHY A;  1ZYR F;  4O6N A;  3ABM C;  2W4M A;  3S29 A;  5DQT A;  1FMW A;  4AK9 A;  5KYY B;  2Q9A A;  2KW3 C;  2ZXW C;  5E2Q A;  4Q5S F;  4OIO F;  4IAO A;  3AG1 C;  4CSA A;  4C7O B;  2A1D D;  1Z23 A;  1JPN A;  2VH3 A;  3LLI A;  4CSA C;  4KC9 A;  2EIJ C;  4O6M A;  2Q9C A;  2R7S A;  1IW7 F;  2L81 A;  3UNG C;  1FTS A;  4E7S A;  5FCL A;  4PFP A;  1FFH A;  5T3W A;  2VAS A;  4B6I A;  2IXP A;  2Y3B A;  2PX0 A;  1S7Z A;  4EWC A;  4LLC A;  3B0U X;  2NUT A;  4X0R A;  1Z63 A;  1OKK A;  3KMI A;  1VOM A;  4PK4 A;  5EHH A;  2WVQ A;  2QY9 A;  3FAJ A;  3N2Z B;  2W45 A;  5D91 A;  4CIH A;  4KNW A;  2VB6 A;  3UGO A;  2Y3H A;  3ZG1 A;  1OKK D;  1LKX A;  5B3S C;  2NUT B;  3H65 A;  2R7U A;  2OG2 A;  3JCU Q;  2IOQ A;  3S0X A;  3EPV A;  4YT4 A;  4U5E E;  2R7T A;  4DVZ A;  2EIK C;  3HLZ A;  4I44 A;  3WOD F;  3GOD A;  4NY3 A;  4YWQ A;  3FHD A;  4OIP F;  2PF4 E;  3L34 A;  3MX3 A;  3HJC A;  2ZXP A;  3EHN A;  4ULW A;  2ZXR A;  3ZC4 A;  1NG1 A;  3AG2 C;  4P6I C;  3DZA A;  2J7P A;  1TWA A;  4RD9 A;  2NUP A;  1V55 C;  4ANJ A;  4A2N B;  4M63 A;  3ITF A;  4DBQ A;  1RJ9 A;  2Q9B A;  3EHM A;  4DBR A;  3DM5 A;  3M1C B;  4J30 B;  1Z5Z A;  1LVK A;  2J0X A;  1J8M F;  3B0P A;  1SMY F;  1M57 C;  1TWG A;  3T4R A;  1TKN A;  2Q3T A;  4C3B A;  3LES A;  4U5D E;  1PCX A;  1SF8 A;  3NYM A;  2KNH A;  3CSK A;  1J8Y F;  3SP1 A;  3V7O A;  4LAC B;  3DJN B;  5E3A A;  1OCZ C;  3UGP A;  3AG3 C;  3KKB A;  3VYW A;  1M2O A;  1WGW A;  2J46 A;  4O6Y A;  2R7W A;  1D1A A;  4K7B A;  3N0T A;  1ST6 A;  2J9U A;  2ZPA A;  3W2V A;  1QZX A;  3EGX A;  3OEO A;  4YT5 A;  3T6B A;  2KJG A;  4I3M A;  2WL8 A;  2MWQ A;  1D1B A;  1O5H A;  3AG4 C;  2EIL C;  1MMG A;  2M4E A;  2Y69 C;  4AX2 A;  2EIM C;  3JYH A;  3I5P A;  2WZF A;  2C03 A;  4IWB A;  4O79 A;  4YJW A;  3DAG A;  3E9V A;  4GYT A;  4JUR I;  4C7O A;  3W8H A;  2J0W A;  2A6E F;  3W2W A;  4CS9 C;  4JJF A;  3L0I A;  4K0D A;  2NG1 A;  5D92 A;  3ZIB A;  3O6X A;  4BJ6 C;  4U5B E;  3FDQ A;  2B0J A;  2CW0 F;  4KNV A;  3NG1 A;  2BE5 F;  2Y39 A;  3LJB A;  3RIP A;  3DM9 B;  2WVO A;  3EQL F;  2Y3G A;  5T3T A;  3JSZ A;  3EG9 B;  4O7G A;  3JRT A;  2X51 A;  4CS9 A;  2KQ9 A;  5HSW A;  3NDB B;  1PD1 A;  1Z3I X;  4Q7C A;  3O39 A;  4U5H A;  1OCC C;  3I4U A;  5B1B C;  5F5H A;  3AQB A;  3Q6M A;  2R7V A;  3X2Q C;  5KYY A;  1W2W A;  4CS8 C;  4H4K C;  3LLK A;  5CI9 A;  1MMA A;  4CBE A;  1M2V A;  1JPJ A;  2YEV A;  3F47 A;  2J45 A;  4JCH A;  2FFH A;  4WJ0 A;  4Q4Z F;  4QI0 A;  4PJN A;  3EH2 A;  1G8X A;  3AQC A;  3EGD A;  5DS4 A;  4FES A;  2V26 A;  2R7O A;  1D0Z A;  1VYK A;  3ZSU A;  2HV6 A;  4FWV A;  4J32 B;  2P7V A;  1D0X A;  5E33 A;  1BR1 A;  1MND A;  3CZ6 A;  3EFO B;  3JT1 A;  2J9V A;  1FFT C;  2R7R A;  2XXA A;  4DOZ A;  3F46 A;  3ZVR A;  5KYW B;  3DMD A;  1ZHX A;  3PHF 2;  3DD7 A;  2XRH A;  4XTK A;  3I5Q A;  2NUP B;  2YHS A;  4MND A;  4PJJ A;  4FX5 A;  1TWH A;  2FGY A;  4ZLC A;  4G7H F;  3S27 A;  5EGY A;  4JW1 A;  1NU7 D;  4BJ1 A;  3EFO A;  3NYJ A;  3OWT A;  1N1C A;  3HTK C;  2Y3D A;  3ASN C;  2V3C C;  2I8B A;  1O87 A;  4HFK B;  3QZC A;  3E70 C;  4PJL A;  4BJT A;  2G62 A;  2W9Y A;  1M2V B;  4OD5 A;  3TD7 A;  1BR2 A;  3EH1 A;  1D1C A;  2A6H F;  4QI2 A;  2WB7 A;  3VAY A;  4C3E A;  3Q7G A;  4PJM A;  2PX3 A;  2PFD A;  1KU2 A;  3EZI A;  5KYN A;  4YN0 B;  4I1O B;  1QLE C;  2LSE A;  2A69 F;  3RFY A;  4QDL A;  1FMV A;  3MLG A;  3IEE A;  5KYU B;  4BJ6 A;  3K33 A;  1V54 C;  4MQ9 F;  2CGE A;  2WZG A;  4HEA J;  4GEH A;  2EIN C;  3EZH A;  4I1M A;  2IXN A;  2L9J A;  1MNE A;  4OIQ F;  3LEV A;  3NRH A;  2KGO A;  3LAY A;  5BUO A;  1OCR C;  2O9X A;  4DVY P;  2YZS A;  3B9Q A;  4OIR F;  4BJ5 A;  3Q6N A;  1VMA A;  4G7Z F;  2H7V C;  2H7B A;  3K7D A;  2G3K A;  3ABK C;  4EBB A;  5DS6 A;  2CDQ A;  5KYX A;  3NKD A;  2WVN A;  4PFO A;  2A68 F;  5IY5 C;  2D5R B;  1LS1 A;  4BJ5 C;  1MMD A;  3UR3 C;  1ZHW A;  5DS5 A;  4AE4 B;  4C3D A;  2R7Q A;  4XWJ A;  3NYL A;  3LS1 A;  3ASO C;  3EGD B;  2WZL A;  3QMK A;  3K1H A;  5E3C A;  3LNR A;  3UMK A;  1PD0 A;  2QTV A;  4JJG A;  1VK5 A;  3W8I A;  3SZR A;  4RBN A;  3ABL C;  4AE4 A;  4XLN F;  2IYL D;  1Z6A A;  2XXA B;  3B0V C;  4KI2 A;  4G0H A;  3SNH A;  4BEJ A;  4RDA A;  1IZM A;  3POV A;  5DLJ A;  1SZI A;  4E7Z A;  2R7X A;  4LER A;  4YT8 A;  2J9W A;  4BG0 A;  2P6V A;  2DYR C;  3EGX B;  1M56 C;  5KYW A;  2JD3 A;  1TWC A;  2IXO A;  4KBL A;  1D0Y A;  2Z15 A;  4U5C E;  4OD4 A;  1NZE A;  2CNW A;  1ZU5 A;  4CS8 A;  3ECS A;  4JVS A;  2CNW D;  3NKE A;  2XL4 A;  3RYL A;  5F5F A;  4HE8 D;  4CS7 A;  3S28 A;  4XLP F;  3K1I C;  1ZU4 A;  3LS0 A;  5T1D B;  2DGJ A;  4N06 A;  4OIN F;  4U5G A;  2ZXO A;  2E87 A;  3WG7 C;  1NU9 C;  3GAN A;  5CI8 A;  2HV7 A;  1VYI A;  2OCC C;  5L3V A;  4YT2 A;  2W4B A;  1TR2 A;  3KH2 A;  5B1A C;  2PP4 A;  3EG9 A;  4HFF B;  4LLE A;  1RJ9 B;  4ZLD A;  3PMR A;  3RKO F;  4F4B A;  3UMH A;  3CQZ A;  3SYN A;  2G3V A;  3UMI A;  2H7O A;  3RH3 A;  5DQZ A;  1MMN A;  2XSE A;  5KYU A;  3T6J A;  1ZHT A;  3SEO A;  2MYS A;  4IJJ A;  2DYS C;  5KYX B;  3X1O A;  3K6B A;  2J7P D;  1BR4 A;  2IXM A;  4U5F E;  3KL4 A;  3DAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...