2LSEA

Solution nmr structure of de novo designed four helix bundle protein, northeast structural genomics consortium (nesg) target or188
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Four Helix Bundle Protein
publication title Solution NMR Structure of a Denovo Design Four Helix Bundle Protein, Northeast Structural Genomics Consortium Target OR188
rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1360 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2lseA00
2LSEA
chains in the Genus database with same CATH superfamily
3SEOA 3ZTMA 4CDAA 4AX2A 4CS8A 2ZD9A 4JVSA 4MVOA 4YT2A 1EKYA 2DYRC 2EPLX 3SXMA 3GWLA 4EUKB 3JCUQ 3MX3A 3AGTA 2HS5A 4DXWA 3S9OA 3ZC4A 1VB5A 2IXMA 4UDVA 2VB6A 1OCRC 3IQCA 2IYLD 5KYXB 2PF4E 1H7IA 3Q7GA 2WVOA 2NG1A 2R02A 3DE8A 2R7TA 4O6MA 4PK4A 5CI9A 2J7PA 2YLGA 3FOOA 4YL1A 2CCYA 2R05A 2HJMA 4BG0A 4OIOF 3UMIA 4DOZA 4KI2A 4AL0A 3JSEO 1TKNA 3SZRA 1LM3B 3RIPA 5A6AA 4NC3A 4ZLCA 3M4BA 2O9XA 1B68A 4JJFA 2A6HF 3EQLF 4EBKA 4K7BA 2ZPAA 3EZIA 4IARA 2CNWD 4CJGA 3MBGA 3DJUB 4DRJB 2MHRA 5A6BD 2LFDA 4NCQA 2H7BA 2NPUA 2AVKA 4JE9A 1NBBA 3TJ6A 3AGUA 1OW7A 1VTMP 3LNMB 2XLVA 1M2VB 1OW6A 2AWCA 1EI7A 1OW8A 2V26A 4GQHA 4IAOA 2PBEA 1YVIA 1WOLA 4LLEA 3IQ6A 4P9TA 3POVA 1Y4CA 2PX3A 1KTMA 1LIHA 4QI0A 3EJNA 1K40A 3I4UA 3Q6NA 1E85A 1D1AA 3HKKA 1KU2A 2QLAA 5AC4A 1OR2A 1DOVA 4AE4B 2NSFA 2XLWA 3C8ZA 1YJGA 2XS8A 2YL0A 2AWYA 3DAGA 3U9MA 2Q4FA 2A0BA 2GFHA 2HZ8A 2CNWA 1LKXA 3G4ZA 4C3BA 5DVWA 1JPNA 2M4EA 2G3KA 2NUPB 3S90A 5L3QA 2G62A 2J9WA 3AOUA 3GEEA 5B1AC 4G7ZF 1LI5A 1OCCC 2R03A 1FFHA 4IAQA 3ATPA 3RW0A 4BJ1A 4I1OB 5T1DB 3EH2A 2MYSA 4Q7CA 2X0CA 1RKCA 2OQMA 1L3PA 3B9QA 4XPXA 1NZEA 2CDQA 2KQ9A 2V3CC 1MMDA 4K1OA 3ABLC 4YN0B 3S29A 4M63A 2CYDA 3NKDA 5DQTA 1U89A 1PCXA 2A68F 2J45A 3FAJA 2PNOA 1HE1A 1I4YA 3X1OA 1OQCA 1LI7A 3L8IA 3GM1A 3EHNA 4DJ9A 5KYXA 3IQTA 4GYTA 4MTGA 3PDMP 2B0HA 1TWCA 2KJGA 2R7QA 2HSQA 3LESA 3TQOA 3WHNA 3H2VA 3I5PA 3MYIA 1VYKA 1ZHZA 2H8AA 2L9JA 3W2VA 1E84A 1TWGA 3JRMO 5JS5A 4XPYA 2ICWG 3ASNC 3B71A 2R7VA 3DMDA 4H54A 4NTBA 1VYIA 1M57C 4U9EA 5COFA 4E7ZA 3DAFA 4RDAA 1T6QA 5T3WA 1D0ZA 1U0BB 1J8YF 4JRZA 2OEXA 3GEHA 2HUJA 3BEHA 1V54C 2QE9A 4N4WA 4JCHA 4HE8D 4K0DA 4YL3A 4YJWA 3ZG1A 5BQGA 2P1AA 1HMOA 4ANJA 1R4TA 3V7OA 1O3UA 5F28E 3VAYA 2Q9BA 1ZU4A 2A1DD 3A9CA 4KNWA 4MVMA 1Z6AA 4PJJA 1W2WA 2XM0A 3U3BA 3UGOA 2EPNA 1VOMA 2JX0A 4XLPF 1M2VA 3DE9A 1PD0A 3U0CA 1RKEB 3U8PA 1LVKA 1Q0GA 2J9VA 2C04A 4KC9A 4MQ9F 5COGA 1V4AA 4CS9A 1RMVA 3WODF 3R7CA 4EWCA 4XWJA 4YT4A 3HNKA 3EHMA 4AE4A 1TR2A 4PACA 4RD9A 4XQ1A 2ZXPA 4C3DA 5JRAA 4I1MA 5HSWA 3FOPA 4NTFA 5AC5A 4CIPA 2EINC 4PFOA 4IRUA 5L0FA 2OCCC 3QZCA 3VF0A 4F4BA 1NFOA 1AVOB 3AG1C 2IM8A 4PFPA 5K0IA 2NUPA 3W8IA 1YYJA 2JD3A 5EGYA 2VCAA 2XSEA 4DRHB 3S28A 1YYXA 1V55C 2P7VA 3GEIA 4GEHA 4J7YA 4OD4A 1G8XA 2D5RB 4J30B 3EH1A 4JTDB 5JP7A 3ABMC 3UMHA 1QLEC 1BR1A 3SYNA 2J0WA 3M1CB 4I44A 2YZSA 5COMA 1D1BA 3W4YA 1BR4A 2NUTB 5E2QA 1WATA 3U3FA 5KYYB 1MMAA 3B29A 1YA9A 3LAYA 4LDQA 1E83A 4NTAA 2CGEA 1FMWA 2P61A 4NQFA 4XTKA 1MMNA 4X0RA 2J9UA 4DVZA 4IWBA 1LS1A 2G3VA 2QNLA 2D4UA 1N1CA 3MFNA 5B3IA 5EHHA 2PP4A 2XRHA 1JOGA 1CPQA 4MTOA 3T4RA 3HTKC 1Q0FA 4HEAJ 1BR2A 4CJOA 1LE2A 1C02A 4EBJA 2Q3TA 4XEFA 1Q0MA 5L0CA 2XL8A 3FXHA 2A69F 5B1BC 3M4CA 2E87A 2Q9CA 4NY3A 3LEOA 2Y3HA 4B6IA 3RH3A 3U2MA 4W8PA 5BQHA 3OWTA 5CIVA 2HKVA 3DM5A 4JCZA 2L6GA 3ZQYA 2B0JA 2VCBA 3A11A 5GPGB 4E0HA 3ASOC 2C03A 3DM9B 4LDRA 4MVSA 1NSGB 3H2UA 4P6IC 3GM3A 4HFFB 1APCA 3GORA 5DS4A 1SF8A 2HJ3A 1T6IA 5DQZA 2VASA 1D1CA 2XS1A 3S84A 3AQBA 4MS2A 2J46A 1FMVA 3AG3C 5AGFA 2WVQA 2I8BA 1OCZC 2GWWA 1G5ZA 256BA 2LD6A 1BBHA 1RKEA 2OG2A 3K1IA 3T6BA 4JJGA 4EBBA 3VM6A 2WB7A 2HMQA 3R2PA 4BEMJ 5TJ5E 1TWHA 3DKAA 5F5FA 4WGYA 1XWJA 1HE9A 2RD9A 3LLIA 3O55A 5JLIA 3TOLA 4L6RA 3NYLA 3JYHA 1VLSA 1Y6DA 2YVKA 3T6GB 4CSAA 2J8WA 3C63A 2OOCA 3KPHA 3ZDLA 5L0JA 3V5ZA 5A6BA 1Z63A 5JSLA 1Q0KA 3GWNA 2KGOA 1C17M 2R9RB 4FESA 4U5CE 1EA8A 1JRAA 2DB4A 2P0NA 2FFHA 4IGGA 2OJED 1ZU5A 3CZ6A 3KYJA 4O79A 4BJ6A 3LUTB 2YEVA 1A7DA 1NU7D 3O10A 1O87A 4YL0A 2GAQA 5E3CA 1E86A 3ZQVA 3LS1A 3EG9A 4C7OB 4CS8C 5DS5A 4ZLDA 4ER9A 3IPMO 5KYYA 1ORYA 3EGXB 2A6EF 2H7OA 2KW3C 4E0IA 5L0HA 2ZXWC 1H9TA 3ZVRA 3G4XA 4I3MA 5HV9A 1HMDA 1MNEA 5FZTA 1NLXA 4PJLA 2HSBA 3UGPA 4JTCB 1XZQA 3HNJA 1GM5A 1T9KA 3RKOF 2GDCA 4XEKA 1QZXA 4ONSA 1ORJA 4Z9JA 4O6YA 4E17A 2L81A 2P6VA 4YWQA 2YL3A 2WZGA 4EIYA 4BJ5A 1Z3IX 3NMJA 2X51A 4Q4ZF 1MMGA 4OIRF 2Z15A 4DBRA 2J9BA 1UFBA 2R7RA 4D4NA 3T6JA 1C03A 1LPEA 4BEJA 3IHUA 5KYUB 2I15A 4JEBA 1YDIA 1RCPA 3ZWIA 3V5YA 1CGNA 2R7UA 1I5NA 2M64A 3FAPB 5D92A 3HNLA 2OJQA 2YL7A 4HFKB 2QTVA 4PJNA 3HNIA 3UMKA 1VMAA 3L1MA 5JUAA 1CGME 4LERA 1RJ9B 3IEEA 3QMKA 4ULVA 1M2OA 4MW3A 3RF3A 1FTSA 4A2NB 3NMIA 3J06A 3WG7C 5E33A 5L3VA 1S7ZA 4G0HA 1QSPA 4IB4A 2Y39A 4ULWA 1ST6A 1BZ4A 2LFFA 1R5ID 4C3EA 3C18A 4MVRA 2OKUA 2XLOA 3C7JA 3LEVA 1TFKB 4DVYP 2UUHA 5KYNA 1AEPA 2YRFA 4U5GA 4W8KA 3B0UX 2JPUA 3C8GB 3TJ5A 3NG1A 3Q6MA 1G4US 3KKBA 2ASRA 3QVYA 4KBLA 3K7DA 2PFDA 5B3SC 1Q0DA 1OR3A 3NDBB 2AP3A 3FHDA 3QTHA 4MVZA 3MLGA 3K66A 4R32A 2DYSC 2VH3A 4C7OA 1LE4A 2ETSA 1JAFA 4YK5A 4BJTA 2R7XA 2IXNA 2IXOA 3EGXA 2Y69C 3GODA 5E3AA 2RSEB 3FVYA 4J7TA 3AQCA 5L0IA 4QI2A 2BE5F 2W9YA 2W4BA 2H7VC 3SNHA 2EIJC 3NRHA 3GM2A 1SR2A 1YAUO 2HV7A 1Z7Qc 1ZVZA 2LCHA 3G50A 2R7SA 3JT1A 3O6XA 3OA1A 4FAPB 1JPJA 5EK0A 3KYIA 2J7PD 2YL1A 5DS6A 3EZHA 1G4WR 4JURI 3H65A 4O7GA 2R7OA 2YQYA 2EIMC 1T01A 2CW0F 1ZHWA 1MQVA 5IY5C 4JTAB 5F5HA 4KNVA 4N6CA 1A7VA 3QW1A 1Z23A 3E70C 2TMVP 4MVQA 2XLDA 4JW1A 1K04A 2FGYA 5KYUA 2XM4A 2YKZA 3W2WA 3T9OA 2YWAA 2LP4A 4JZAA 1H6GA 2LIGA 2VC9A 3C8GD 4XLNF 3S27A 3F46A 1A41A 1FFTC 1V74B 3F47A 1YARO 2QUPA 3IQ5A 1TFOB 2WL8A 3AG4C 1RJ9A 1J8MF 4CS9C 3L34A 1WWPA 2IOQA 3I5QA 3L0IA 4A4AA 1MNDA 3NYJA 3RVYA 3VRCA 1XZPA 4U5HA 4MTFA 4Z9IA 2LSEA 2W45A 3B0PA 2EIKC 1DOWA 1VK5A 2L7AA 1JMWA 3FMSA 3GANA 4JIOA 3UNGC 1UG7A 1T6UA 1QQ3A 4IJJA 4U5DE 3ZTZA 3LS0A 2L6FA 3PMRA 3E9VA 1VLTA 1ZHXA 2KC3A 3N0TA 4FX5A 5L0DA 3S0XA 3KMIA 3ITFA 1HY5A 3LNRA 3NMKA 2PX0A 1S05A 4U5EE 3M79A 3JSZA 3C8GA 3SXZA 2EPOA 2ZXOA 3NKEA 1NG1A 4RBNA 2IXPA 4PR9A 3US6A 2KK1A 2YLIA 1FNTc 3DD7A 1F1MA 4MW8A 3QW0A 4E7SA 2KYHA 4G7HF 3CSKA 5D91A 4CX9A 4Q5SF 2WZLA 1K05A 1T5OA 2XLHA 3DJNB 3HJCA 4MVUA 2NUTA 5A6KA 3FDQA 1LS4A 1OCOC 2OU6A 1A7EA 3OEOA 4DRIB 1D0YA 1ZHYA 2A0UA 4MNDA 4CBEA 2R7WA 5A69A 4OD5A 1M6TA 3N2ZB 4QDLA 2Y3BA 4J32B 3EGDB 1M56C 3WAQA 2XXAB 3RQEA 2YLDA 2WVNA 4LDKA 3RYLA 1D0XA 1SYQA 1QVXA 4N06A 3K6BA 1A0BA 4YT5A 3U2LA 3UR3C 4D4XA 1BDJB 2NSGA 3NYMA 2J0XA 1L7CA 1OXBA 1U6HA 2KSFA 3ABKC 2HV6A 4PJMA 3AG2C 1NFNA 4BPMA 5KYWB 3EFOB 4CDYA 4FWVA 2DI3A 5FCLA 1QKRA 3CQZA 4P9FA 4Z9HA 5L0GA 2UUIA 1H9GA 2F22A 2VCCA 4LLCA 3TULA 2LK4A 2DGJA 1QPUA 3QVZA 3JZ0A 5T3TA 3KH2A 3U8VA 1FAPB 3M15A 4OINF 4OIPF 1ZZPA 3RQGA 1GQAA 1WASA 4DBQA 5BQIA 1ORSC 1CPRA 4CIHA 5BUOA 4CS7A 1WTYA 1YZAA 2EPKX 3Q7LA 3W8HA 5CI8A 1KNYA 3BRJA 1TWAA 5A6JA 1GGQA 4EKWA 3K1IC 3C62A 3DI5A 1TQGA 3LJBA 3MYFA 1NU9C 3PHF2 4G7OF 4G78A 1EQ1A 2WZFA 1IZMA 2XL6A 3DXJF 3SXYA 3VYWA 1FR0A 2BC5A 2HMZA 3N24A 2GA0A 4CDVA 4N6HA 4CSAC 3ZSUA 4JEAA 3TOMA 2AU5A 3RVZA 4LACB 4AK9A 1ZW3A 3B0VC 1OXKA 1O5HA 1YZCA 2Q9AA 2Q7RA 3V5XA 3RFYA 4U9DA 4E18A 2HFIA 5JT4A 1HW2A 4WGZA 4XEVA 1JR8A 3KL4A 3LLKA 4BJ6C 3JTLO 2XLEA 3SP1A 2KNHA 3K33A 2L6HA 4JC7A 1OKKD 3X2QC 1CGOA 2LQGA 2Y3GA 3ZIBA 1WN0A 5DLJA 4OIQF 3U5SA 2OEVA 2YHSA 2Q00A 3HLZA 1ZHTA 3TK0A 3ECSA 3AJMA 3EPVA 3SXKA 1SMYF 2Y3DA 1SZIA 1WGWA 2ZXRA 2XLMA 4WABA 4H4KC 4WJ0A 1ZW2A 3DWWA 3U9JA 4JKVA 3EGDA 2EILC 2EPMX 2XXAA 1Z5ZA 2W4MA 4BJ5C 3PCVA 4YT8A 4EHPA 1AUEA 1IW7F 2QY9A 2R25A 1HW1A 2IBFA 4U5BE 2MWQA 3O39A 4U5FE 3RQFA 5JVEA 1ZYRF 1YA7O 4AL1A 3K1HA 1E2XA 4O6NA 1OKKA 5KYWA 1PV3A 1YLMA 3L8JA 1RXQA 3CAXA 3EFOA 3DZAA 3EG9B 1PD1A 3TD7A 2XL4A 1GS9A 1I4ZA 2BL2A 3JYYA 4XPWA 3CEXA 2FAPB 3JRTA
chains in the Genus database with same CATH topology
3SEOA 4CS8A 4AX2A 4YT2A 4JVSA 2DYRC 3JCUQ 3MX3A 3ZC4A 2IXMA 2VB6A 1OCRC 2IYLD 5KYXB 2PF4E 3Q7GA 2WVOA 2NG1A 2R7TA 4O6MA 4PK4A 5CI9A 2J7PA 4BG0A 4OIOF 3UMIA 4DOZA 4KI2A 1TKNA 3SZRA 3RIPA 4ZLCA 2O9XA 4JJFA 2A6HF 3EQLF 4K7BA 2ZPAA 3EZIA 2CNWD 3DJUB 2H7BA 1M2VB 4IAOA 3PHF2 2V26A 4LLEA 3POVA 2PX3A 4QI0A 3EJNA 3I4UA 3Q6NA 1D1AA 1KU2A 4AE4B 3DAGA 2GFHA 2CNWA 1LKXA 4C3BA 5DVWA 1JPNA 2M4EA 2G3KA 2NUPB 5L3QA 2G62A 2J9WA 5B1AC 4G7ZF 1OCCC 4BJ1A 1FFHA 4I1OB 5T1DB 3EH2A 2MYSA 4Q7CA 3B9QA 1NZEA 2CDQA 2KQ9A 2V3CC 1MMDA 3ABLC 4YN0B 3S29A 4M63A 3NKDA 5DQTA 1PCXA 2A68F 2J45A 3FAJA 3X1OA 3EHNA 5KYXA 4GYTA 2KJGA 1TWCA 3LESA 2R7QA 3I5PA 1VYKA 1ZHZA 2L9JA 3W2VA 1TWGA 3ASNC 2R7VA 3DMDA 1VYIA 1M57C 4E7ZA 3DAFA 4RDAA 5T3WA 1D0ZA 1J8YF 1V54C 4JCHA 4HE8D 4K0DA 4YJWA 3ZG1A 4ANJA 3V7OA 3VAYA 4Q4ZF 2Q9BA 1ZU4A 2A1DD 4KNWA 4PJJA 1Z6AA 1W2WA 1VOMA 4XLPF 1M2VA 1PD0A 1LVKA 4KC9A 2J9VA 2C04A 4MQ9F 4CS9A 3WODF 4EWCA 4XWJA 4YT4A 3EHMA 4AE4A 1TR2A 4RD9A 4C3DA 2ZXPA 4I1MA 5HSWA 2EINC 4PFOA 4IRUA 2OCCC 3QZCA 4F4BA 3AG1C 4PFPA 2NUPA 3W8IA 2JD3A 5EGYA 2XSEA 3S28A 3UGOA 1V55C 2P7VA 4GEHA 4OD4A 1G8XA 2D5RB 4J30B 3EH1A 3ABMC 3UMHA 1QLEC 1BR1A 3SYNA 2J0WA 3M1CB 4I44A 2YZSA 1D1BA 1BR4A 2NUTB 5E2QA 5KYYB 1MMAA 3LAYA 2CGEA 1FMWA 4XTKA 1MMNA 4X0RA 2J9UA 4DVZA 4IWBA 1LS1A 2G3VA 5EHHA 1N1CA 2PP4A 2XRHA 3T4RA 3HTKC 4HEAJ 1BR2A 2Q3TA 2A69F 5B1BC 2E87A 2Q9CA 4NY3A 2Y3HA 4B6IA 3RH3A 3OWTA 3DM5A 2B0JA 3ASOC 2C03A 3DM9B 4P6IC 4HFFB 5DS4A 1SF8A 5DQZA 2VASA 1D1CA 2J46A 1FMVA 3AG3C 2WVQA 2I8BA 1OCZC 3T6BA 2OG2A 4JJGA 4EBBA 2WB7A 1TWHA 5F5FA 3LLIA 3NYLA 3JYHA 4CSAA 1Z63A 2KGOA 4U5CE 4FESA 2FFHA 1ZU5A 3CZ6A 4O79A 4BJ6A 2YEVA 1NU7D 1O87A 5E3CA 3LS1A 3EG9A 4C7OB 4CS8C 5DS5A 4ZLDA 5KYYA 3EGXB 2A6EF 2H7OA 2KW3C 2ZXWC 3ZVRA 4I3MA 1MNEA 4PJLA 3UGPA 3RKOF 1QZXA 4O6YA 2L81A 2P6VA 4YWQA 2WZGA 4BJ5A 1Z3IX 2X51A 1MMGA 4OIRF 2Z15A 4DBRA 2R7RA 3T6JA 4BEJA 5KYUB 2R7UA 5D92A 4HFKB 4PJNA 2QTVA 3UMKA 1VMAA 4LERA 1RJ9B 3IEEA 3QMKA 1M2OA 1FTSA 4A2NB 3WG7C 5E33A 5L3VA 1S7ZA 4G0HA 2Y39A 4ULWA 1ST6A 4C3EA 3LEVA 4DVYP 5KYNA 4U5GA 3B0UX 4W8KA 3NG1A 3Q6MA 3KKBA 4KBLA 3K7DA 2PFDA 5B3SC 3NDBB 3FHDA 3MLGA 3K66A 2DYSC 2VH3A 4C7OA 4BJTA 2R7XA 2IXNA 2IXOA 3EGXA 2Y69C 3GODA 5E3AA 3FVYA 3AQCA 4QI2A 2BE5F 2W9YA 2W4BA 2H7VC 3SNHA 2EIJC 3NRHA 2HV7A 2R7SA 3JT1A 3O6XA 3OA1A 1JPJA 5DS6A 2J7PD 3EZHA 4JURI 4O7GA 3H65A 2R7OA 2EIMC 2CW0F 1ZHWA 5IY5C 5F5HA 4KNVA 1Z23A 3E70C 4JW1A 2FGYA 5KYUA 3W2WA 4JZAA 4XLNF 3S27A 3F46A 1FFTC 3F47A 2WL8A 3AG4C 1RJ9A 1J8MF 4CS9C 3L34A 3I5QA 3L0IA 2IOQA 1MNDA 3NYJA 4U5HA 2LSEA 2W45A 3B0PA 2EIKC 1VK5A 3GANA 3UNGC 4IJJA 4U5DE 3LS0A 3PMRA 3E9VA 1ZHXA 3N0TA 4FX5A 3S0XA 3KMIA 3ITFA 3LNRA 2PX0A 4U5EE 3JSZA 2ZXOA 3NKEA 1NG1A 4RBNA 2IXPA 3DD7A 4E7SA 4G7HF 3CSKA 5D91A 4Q5SF 2WZLA 3FDQA 2NUTA 3HJCA 3DJNB 1OCOC 3OEOA 1D0YA 1ZHYA 4MNDA 4CBEA 2R7WA 4OD5A 3N2ZB 4QDLA 2Y3BA 4J32B 3EGDB 1M56C 2XXAB 2WVNA 3RYLA 1D0XA 4N06A 3UR3C 3K6BA 4YT5A 3NYMA 2J0XA 4PJMA 3ABKC 2HV6A 3AG2C 5KYWB 3EFOB 4FWVA 5FCLA 3CQZA 4LLCA 2DGJA 5T3TA 3KH2A 4OINF 4OIPF 4DBQA 4CIHA 5BUOA 4CS7A 3Q7LA 3W8HA 5CI8A 1TWAA 3K1IC 3LJBA 1NU9C 4G7OF 2WZFA 1IZMA 3DXJF 3VYWA 3N24A 4CSAC 3ZSUA 4LACB 4AK9A 3B0VC 1O5HA 2Q9AA 3RFYA 3KL4A 3LLKA 4BJ6C 3SP1A 2KNHA 3K33A 1OKKD 3X2QC 2Y3GA 3ZIBA 5DLJA 4OIQF 2YHSA 3HLZA 1ZHTA 3ECSA 3EPVA 1SMYF 2Y3DA 1SZIA 1WGWA 2ZXRA 4WJ0A 4H4KC 3EGDA 2EILC 2XXAA 1Z5ZA 2W4MA 4BJ5C 4YT8A 1IW7F 4U5FE 2QY9A 4U5BE 2MWQA 3O39A 1ZYRF 3K1HA 4O6NA 1OKKA 5KYWA 3TD7A 3EFOA 3DZAA 3EG9B 1PD1A 2XL4A 3AQBA 3JRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSE A; 
#chains in the Genus database with same CATH topology
 3SEO A;  3ZTM A;  4CDA A;  4AX2 A;  4CS8 A;  2ZD9 A;  4JVS A;  4MVO A;  4YT2 A;  1EKY A;  2DYR C;  2EPL X;  3SXM A;  3GWL A;  4EUK B;  3JCU Q;  3MX3 A;  3AGT A;  2HS5 A;  4DXW A;  3S9O A;  3ZC4 A;  1VB5 A;  2IXM A;  4UDV A;  2VB6 A;  1OCR C;  3IQC A;  2IYL D;  5KYX B;  2PF4 E;  1H7I A;  3Q7G A;  2WVO A;  2NG1 A;  2R02 A;  3DE8 A;  2R7T A;  4O6M A;  4PK4 A;  5CI9 A;  2J7P A;  2YLG A;  3FOO A;  4YL1 A;  2CCY A;  2R05 A;  2HJM A;  4BG0 A;  4OIO F;  3UMI A;  4DOZ A;  4KI2 A;  4AL0 A;  3JSE O;  1TKN A;  3SZR A;  1LM3 B;  3RIP A;  5A6A A;  4NC3 A;  4ZLC A;  3M4B A;  2O9X A;  1B68 A;  4JJF A;  2A6H F;  3EQL F;  4EBK A;  4K7B A;  2ZPA A;  3EZI A;  4IAR A;  2CNW D;  4CJG A;  3MBG A;  3DJU B;  4DRJ B;  2MHR A;  5A6B D;  2LFD A;  4NCQ A;  2H7B A;  2NPU A;  2AVK A;  4JE9 A;  1NBB A;  3TJ6 A;  3AGU A;  1OW7 A;  1VTM P;  3LNM B;  2XLV A;  1M2V B;  1OW6 A;  2AWC A;  1EI7 A;  1OW8 A;  2V26 A;  4GQH A;  4IAO A;  2PBE A;  1YVI A;  1WOL A;  4LLE A;  3IQ6 A;  4P9T A;  3POV A;  1Y4C A;  2PX3 A;  1KTM A;  1LIH A;  4QI0 A;  3EJN A;  1K40 A;  3I4U A;  3Q6N A;  1E85 A;  1D1A A;  3HKK A;  1KU2 A;  2QLA A;  5AC4 A;  1OR2 A;  1DOV A;  4AE4 B;  2NSF A;  2XLW A;  3C8Z A;  1YJG A;  2XS8 A;  2YL0 A;  2AWY A;  3DAG A;  3U9M A;  2Q4F A;  2A0B A;  2GFH A;  2HZ8 A;  2CNW A;  1LKX A;  3G4Z A;  4C3B A;  5DVW A;  1JPN A;  2M4E A;  2G3K A;  2NUP B;  3S90 A;  5L3Q A;  2G62 A;  2J9W A;  3AOU A;  3GEE A;  5B1A C;  4G7Z F;  1LI5 A;  1OCC C;  2R03 A;  1FFH A;  4IAQ A;  3ATP A;  3RW0 A;  4BJ1 A;  4I1O B;  5T1D B;  3EH2 A;  2MYS A;  4Q7C A;  2X0C A;  1RKC A;  2OQM A;  1L3P A;  3B9Q A;  4XPX A;  1NZE A;  2CDQ A;  2KQ9 A;  2V3C C;  1MMD A;  4K1O A;  3ABL C;  4YN0 B;  3S29 A;  4M63 A;  2CYD A;  3NKD A;  5DQT A;  1U89 A;  1PCX A;  2A68 F;  2J45 A;  3FAJ A;  2PNO A;  1HE1 A;  1I4Y A;  3X1O A;  1OQC A;  1LI7 A;  3L8I A;  3GM1 A;  3EHN A;  4DJ9 A;  5KYX A;  3IQT A;  4GYT A;  4MTG A;  3PDM P;  2B0H A;  1TWC A;  2KJG A;  2R7Q A;  2HSQ A;  3LES A;  3TQO A;  3WHN A;  3H2V A;  3I5P A;  3MYI A;  1VYK A;  1ZHZ A;  2H8A A;  2L9J A;  3W2V A;  1E84 A;  1TWG A;  3JRM O;  5JS5 A;  4XPY A;  2ICW G;  3ASN C;  3B71 A;  2R7V A;  3DMD A;  4H54 A;  4NTB A;  1VYI A;  1M57 C;  4U9E A;  5COF A;  4E7Z A;  3DAF A;  4RDA A;  1T6Q A;  5T3W A;  1D0Z A;  1U0B B;  1J8Y F;  4JRZ A;  2OEX A;  3GEH A;  2HUJ A;  3BEH A;  1V54 C;  2QE9 A;  4N4W A;  4JCH A;  4HE8 D;  4K0D A;  4YL3 A;  4YJW A;  3ZG1 A;  5BQG A;  2P1A A;  1HMO A;  4ANJ A;  1R4T A;  3V7O A;  1O3U A;  5F28 E;  3VAY A;  2Q9B A;  1ZU4 A;  2A1D D;  3A9C A;  4KNW A;  4MVM A;  1Z6A A;  4PJJ A;  1W2W A;  2XM0 A;  3U3B A;  3UGO A;  2EPN A;  1VOM A;  2JX0 A;  4XLP F;  1M2V A;  3DE9 A;  1PD0 A;  3U0C A;  1RKE B;  3U8P A;  1LVK A;  1Q0G A;  2J9V A;  2C04 A;  4KC9 A;  4MQ9 F;  5COG A;  1V4A A;  4CS9 A;  1RMV A;  3WOD F;  3R7C A;  4EWC A;  4XWJ A;  4YT4 A;  3HNK A;  3EHM A;  4AE4 A;  1TR2 A;  4PAC A;  4RD9 A;  4XQ1 A;  2ZXP A;  4C3D A;  5JRA A;  4I1M A;  5HSW A;  3FOP A;  4NTF A;  5AC5 A;  4CIP A;  2EIN C;  4PFO A;  4IRU A;  5L0F A;  2OCC C;  3QZC A;  3VF0 A;  4F4B A;  1NFO A;  1AVO B;  3AG1 C;  2IM8 A;  4PFP A;  5K0I A;  2NUP A;  3W8I A;  1YYJ A;  2JD3 A;  5EGY A;  2VCA A;  2XSE A;  4DRH B;  3S28 A;  1YYX A;  1V55 C;  2P7V A;  3GEI A;  4GEH A;  4J7Y A;  4OD4 A;  1G8X A;  2D5R B;  4J30 B;  3EH1 A;  4JTD B;  5JP7 A;  3ABM C;  3UMH A;  1QLE C;  1BR1 A;  3SYN A;  2J0W A;  3M1C B;  4I44 A;  2YZS A;  5COM A;  1D1B A;  3W4Y A;  1BR4 A;  2NUT B;  5E2Q A;  1WAT A;  3U3F A;  5KYY B;  1MMA A;  3B29 A;  1YA9 A;  3LAY A;  4LDQ A;  1E83 A;  4NTA A;  2CGE A;  1FMW A;  2P61 A;  4NQF A;  4XTK A;  1MMN A;  4X0R A;  2J9U A;  4DVZ A;  4IWB A;  1LS1 A;  2G3V A;  2QNL A;  2D4U A;  1N1C A;  3MFN A;  5B3I A;  5EHH A;  2PP4 A;  2XRH A;  1JOG A;  1CPQ A;  4MTO A;  3T4R A;  3HTK C;  1Q0F A;  4HEA J;  1BR2 A;  4CJO A;  1LE2 A;  1C02 A;  4EBJ A;  2Q3T A;  4XEF A;  1Q0M A;  5L0C A;  2XL8 A;  3FXH A;  2A69 F;  5B1B C;  3M4C A;  2E87 A;  2Q9C A;  4NY3 A;  3LEO A;  2Y3H A;  4B6I A;  3RH3 A;  3U2M A;  4W8P A;  5BQH A;  3OWT A;  5CIV A;  2HKV A;  3DM5 A;  4JCZ A;  2L6G A;  3ZQY A;  2B0J A;  2VCB A;  3A11 A;  5GPG B;  4E0H A;  3ASO C;  2C03 A;  3DM9 B;  4LDR A;  4MVS A;  1NSG B;  3H2U A;  4P6I C;  3GM3 A;  4HFF B;  1APC A;  3GOR A;  5DS4 A;  1SF8 A;  2HJ3 A;  1T6I A;  5DQZ A;  2VAS A;  1D1C A;  2XS1 A;  3S84 A;  3AQB A;  4MS2 A;  2J46 A;  1FMV A;  3AG3 C;  5AGF A;  2WVQ A;  2I8B A;  1OCZ C;  2GWW A;  1G5Z A;  256B A;  2LD6 A;  1BBH A;  1RKE A;  2OG2 A;  3K1I A;  3T6B A;  4JJG A;  4EBB A;  3VM6 A;  2WB7 A;  2HMQ A;  3R2P A;  4BEM J;  5TJ5 E;  1TWH A;  3DKA A;  5F5F A;  4WGY A;  1XWJ A;  1HE9 A;  2RD9 A;  3LLI A;  3O55 A;  5JLI A;  3TOL A;  4L6R A;  3NYL A;  3JYH A;  1VLS A;  1Y6D A;  2YVK A;  3T6G B;  4CSA A;  2J8W A;  3C63 A;  2OOC A;  3KPH A;  3ZDL A;  5L0J A;  3V5Z A;  5A6B A;  1Z63 A;  5JSL A;  1Q0K A;  3GWN A;  2KGO A;  1C17 M;  2R9R B;  4FES A;  4U5C E;  1EA8 A;  1JRA A;  2DB4 A;  2P0N A;  2FFH A;  4IGG A;  2OJE D;  1ZU5 A;  3CZ6 A;  3KYJ A;  4O79 A;  4BJ6 A;  3LUT B;  2YEV A;  1A7D A;  1NU7 D;  3O10 A;  1O87 A;  4YL0 A;  2GAQ A;  5E3C A;  1E86 A;  3ZQV A;  3LS1 A;  3EG9 A;  4C7O B;  4CS8 C;  5DS5 A;  4ZLD A;  4ER9 A;  3IPM O;  5KYY A;  1ORY A;  3EGX B;  2A6E F;  2H7O A;  2KW3 C;  4E0I A;  5L0H A;  2ZXW C;  1H9T A;  3ZVR A;  3G4X A;  4I3M A;  5HV9 A;  1HMD A;  1MNE A;  5FZT A;  1NLX A;  4PJL A;  2HSB A;  3UGP A;  4JTC B;  1XZQ A;  3HNJ A;  1GM5 A;  1T9K A;  3RKO F;  2GDC A;  4XEK A;  1QZX A;  4ONS A;  1ORJ A;  4Z9J A;  4O6Y A;  4E17 A;  2L81 A;  2P6V A;  4YWQ A;  2YL3 A;  2WZG A;  4EIY A;  4BJ5 A;  1Z3I X;  3NMJ A;  2X51 A;  4Q4Z F;  1MMG A;  4OIR F;  2Z15 A;  4DBR A;  2J9B A;  1UFB A;  2R7R A;  4D4N A;  3T6J A;  1C03 A;  1LPE A;  4BEJ A;  3IHU A;  5KYU B;  2I15 A;  4JEB A;  1YDI A;  1RCP A;  3ZWI A;  3V5Y A;  1CGN A;  2R7U A;  1I5N A;  2M64 A;  3FAP B;  5D92 A;  3HNL A;  2OJQ A;  2YL7 A;  4HFK B;  2QTV A;  4PJN A;  3HNI A;  3UMK A;  1VMA A;  3L1M A;  5JUA A;  1CGM E;  4LER A;  1RJ9 B;  3IEE A;  3QMK A;  4ULV A;  1M2O A;  4MW3 A;  3RF3 A;  1FTS A;  4A2N B;  3NMI A;  3J06 A;  3WG7 C;  5E33 A;  5L3V A;  1S7Z A;  4G0H A;  1QSP A;  4IB4 A;  2Y39 A;  4ULW A;  1ST6 A;  1BZ4 A;  2LFF A;  1R5I D;  4C3E A;  3C18 A;  4MVR A;  2OKU A;  2XLO A;  3C7J A;  3LEV A;  1TFK B;  4DVY P;  2UUH A;  5KYN A;  1AEP A;  2YRF A;  4U5G A;  4W8K A;  3B0U X;  2JPU A;  3C8G B;  3TJ5 A;  3NG1 A;  3Q6M A;  1G4U S;  3KKB A;  2ASR A;  3QVY A;  4KBL A;  3K7D A;  2PFD A;  5B3S C;  1Q0D A;  1OR3 A;  3NDB B;  2AP3 A;  3FHD A;  3QTH A;  4MVZ A;  3MLG A;  3K66 A;  4R32 A;  2DYS C;  2VH3 A;  4C7O A;  1LE4 A;  2ETS A;  1JAF A;  4YK5 A;  4BJT A;  2R7X A;  2IXN A;  2IXO A;  3EGX A;  2Y69 C;  3GOD A;  5E3A A;  2RSE B;  3FVY A;  4J7T A;  3AQC A;  5L0I A;  4QI2 A;  2BE5 F;  2W9Y A;  2W4B A;  2H7V C;  3SNH A;  2EIJ C;  3NRH A;  3GM2 A;  1SR2 A;  1YAU O;  2HV7 A;  1Z7Q c;  1ZVZ A;  2LCH A;  3G50 A;  2R7S A;  3JT1 A;  3O6X A;  3OA1 A;  4FAP B;  1JPJ A;  5EK0 A;  3KYI A;  2J7P D;  2YL1 A;  5DS6 A;  3EZH A;  1G4W R;  4JUR I;  3H65 A;  4O7G A;  2R7O A;  2YQY A;  2EIM C;  1T01 A;  2CW0 F;  1ZHW A;  1MQV A;  5IY5 C;  4JTA B;  5F5H A;  4KNV A;  4N6C A;  1A7V A;  3QW1 A;  1Z23 A;  3E70 C;  2TMV P;  4MVQ A;  2XLD A;  4JW1 A;  1K04 A;  2FGY A;  5KYU A;  2XM4 A;  2YKZ A;  3W2W A;  3T9O A;  2YWA A;  2LP4 A;  4JZA A;  1H6G A;  2LIG A;  2VC9 A;  3C8G D;  4XLN F;  3S27 A;  3F46 A;  1A41 A;  1FFT C;  1V74 B;  3F47 A;  1YAR O;  2QUP A;  3IQ5 A;  1TFO B;  2WL8 A;  3AG4 C;  1RJ9 A;  1J8M F;  4CS9 C;  3L34 A;  1WWP A;  2IOQ A;  3I5Q A;  3L0I A;  4A4A A;  1MND A;  3NYJ A;  3RVY A;  3VRC A;  1XZP A;  4U5H A;  4MTF A;  4Z9I A;  2LSE A;  2W45 A;  3B0P A;  2EIK C;  1DOW A;  1VK5 A;  2L7A A;  1JMW A;  3FMS A;  3GAN A;  4JIO A;  3UNG C;  1UG7 A;  1T6U A;  1QQ3 A;  4IJJ A;  4U5D E;  3ZTZ A;  3LS0 A;  2L6F A;  3PMR A;  3E9V A;  1VLT A;  1ZHX A;  2KC3 A;  3N0T A;  4FX5 A;  5L0D A;  3S0X A;  3KMI A;  3ITF A;  1HY5 A;  3LNR A;  3NMK A;  2PX0 A;  1S05 A;  4U5E E;  3M79 A;  3JSZ A;  3C8G A;  3SXZ A;  2EPO A;  2ZXO A;  3NKE A;  1NG1 A;  4RBN A;  2IXP A;  4PR9 A;  3US6 A;  2KK1 A;  2YLI A;  1FNT c;  3DD7 A;  1F1M A;  4MW8 A;  3QW0 A;  4E7S A;  2KYH A;  4G7H F;  3CSK A;  5D91 A;  4CX9 A;  4Q5S F;  2WZL A;  1K05 A;  1T5O A;  2XLH A;  3DJN B;  3HJC A;  4MVU A;  2NUT A;  5A6K A;  3FDQ A;  1LS4 A;  1OCO C;  2OU6 A;  1A7E A;  3OEO A;  4DRI B;  1D0Y A;  1ZHY A;  2A0U A;  4MND A;  4CBE A;  2R7W A;  5A69 A;  4OD5 A;  1M6T A;  3N2Z B;  4QDL A;  2Y3B A;  4J32 B;  3EGD B;  1M56 C;  3WAQ A;  2XXA B;  3RQE A;  2YLD A;  2WVN A;  4LDK A;  3RYL A;  1D0X A;  1SYQ A;  1QVX A;  4N06 A;  3K6B A;  1A0B A;  4YT5 A;  3U2L A;  3UR3 C;  4D4X A;  1BDJ B;  2NSG A;  3NYM A;  2J0X A;  1L7C A;  1OXB A;  1U6H A;  2KSF A;  3ABK C;  2HV6 A;  4PJM A;  3AG2 C;  1NFN A;  4BPM A;  5KYW B;  3EFO B;  4CDY A;  4FWV A;  2DI3 A;  5FCL A;  1QKR A;  3CQZ A;  4P9F A;  4Z9H A;  5L0G A;  2UUI A;  1H9G A;  2F22 A;  2VCC A;  4LLC A;  3TUL A;  2LK4 A;  2DGJ A;  1QPU A;  3QVZ A;  3JZ0 A;  5T3T A;  3KH2 A;  3U8V A;  1FAP B;  3M15 A;  4OIN F;  4OIP F;  1ZZP A;  3RQG A;  1GQA A;  1WAS A;  4DBQ A;  5BQI A;  1ORS C;  1CPR A;  4CIH A;  5BUO A;  4CS7 A;  1WTY A;  1YZA A;  2EPK X;  3Q7L A;  3W8H A;  5CI8 A;  1KNY A;  3BRJ A;  1TWA A;  5A6J A;  1GGQ A;  4EKW A;  3K1I C;  3C62 A;  3DI5 A;  1TQG A;  3LJB A;  3MYF A;  1NU9 C;  3PHF 2;  4G7O F;  4G78 A;  1EQ1 A;  2WZF A;  1IZM A;  2XL6 A;  3DXJ F;  3SXY A;  3VYW A;  1FR0 A;  2BC5 A;  2HMZ A;  3N24 A;  2GA0 A;  4CDV A;  4N6H A;  4CSA C;  3ZSU A;  4JEA A;  3TOM A;  2AU5 A;  3RVZ A;  4LAC B;  4AK9 A;  1ZW3 A;  3B0V C;  1OXK A;  1O5H A;  1YZC A;  2Q9A A;  2Q7R A;  3V5X A;  3RFY A;  4U9D A;  4E18 A;  2HFI A;  5JT4 A;  1HW2 A;  4WGZ A;  4XEV A;  1JR8 A;  3KL4 A;  3LLK A;  4BJ6 C;  3JTL O;  2XLE A;  3SP1 A;  2KNH A;  3K33 A;  2L6H A;  4JC7 A;  1OKK D;  3X2Q C;  1CGO A;  2LQG A;  2Y3G A;  3ZIB A;  1WN0 A;  5DLJ A;  4OIQ F;  3U5S A;  2OEV A;  2YHS A;  2Q00 A;  3HLZ A;  1ZHT A;  3TK0 A;  3ECS A;  3AJM A;  3EPV A;  3SXK A;  1SMY F;  2Y3D A;  1SZI A;  1WGW A;  2ZXR A;  2XLM A;  4WAB A;  4H4K C;  4WJ0 A;  1ZW2 A;  3DWW A;  3U9J A;  4JKV A;  3EGD A;  2EIL C;  2EPM X;  2XXA A;  1Z5Z A;  2W4M A;  4BJ5 C;  3PCV A;  4YT8 A;  4EHP A;  1AUE A;  1IW7 F;  2QY9 A;  2R25 A;  1HW1 A;  2IBF A;  4U5B E;  2MWQ A;  3O39 A;  4U5F E;  3RQF A;  5JVE A;  1ZYR F;  1YA7 O;  4AL1 A;  3K1H A;  1E2X A;  4O6N A;  1OKK A;  5KYW A;  1PV3 A;  1YLM A;  3L8J A;  1RXQ A;  3CAX A;  3EFO A;  3DZA A;  3EG9 B;  1PD1 A;  3TD7 A;  2XL4 A;  1GS9 A;  1I4Z A;  2BL2 A;  3JYY A;  4XPW A;  3CEX A;  2FAP B;  3JRT A; 
#chains in the Genus database with same CATH homology
 3SEO A;  4CS8 A;  4AX2 A;  4YT2 A;  4JVS A;  2DYR C;  3JCU Q;  3MX3 A;  3ZC4 A;  2IXM A;  2VB6 A;  1OCR C;  2IYL D;  5KYX B;  2PF4 E;  3Q7G A;  2WVO A;  2NG1 A;  2R7T A;  4O6M A;  4PK4 A;  5CI9 A;  2J7P A;  4BG0 A;  4OIO F;  3UMI A;  4DOZ A;  4KI2 A;  1TKN A;  3SZR A;  3RIP A;  4ZLC A;  2O9X A;  4JJF A;  2A6H F;  3EQL F;  4K7B A;  2ZPA A;  3EZI A;  2CNW D;  3DJU B;  2H7B A;  1M2V B;  4IAO A;  3PHF 2;  2V26 A;  4LLE A;  3POV A;  2PX3 A;  4QI0 A;  3EJN A;  3I4U A;  3Q6N A;  1D1A A;  1KU2 A;  4AE4 B;  3DAG A;  2GFH A;  2CNW A;  1LKX A;  4C3B A;  5DVW A;  1JPN A;  2M4E A;  2G3K A;  2NUP B;  5L3Q A;  2G62 A;  2J9W A;  5B1A C;  4G7Z F;  1OCC C;  4BJ1 A;  1FFH A;  4I1O B;  5T1D B;  3EH2 A;  2MYS A;  4Q7C A;  3B9Q A;  1NZE A;  2CDQ A;  2KQ9 A;  2V3C C;  1MMD A;  3ABL C;  4YN0 B;  3S29 A;  4M63 A;  3NKD A;  5DQT A;  1PCX A;  2A68 F;  2J45 A;  3FAJ A;  3X1O A;  3EHN A;  5KYX A;  4GYT A;  2KJG A;  1TWC A;  3LES A;  2R7Q A;  3I5P A;  1VYK A;  1ZHZ A;  2L9J A;  3W2V A;  1TWG A;  3ASN C;  2R7V A;  3DMD A;  1VYI A;  1M57 C;  4E7Z A;  3DAF A;  4RDA A;  5T3W A;  1D0Z A;  1J8Y F;  1V54 C;  4JCH A;  4HE8 D;  4K0D A;  4YJW A;  3ZG1 A;  4ANJ A;  3V7O A;  3VAY A;  4Q4Z F;  2Q9B A;  1ZU4 A;  2A1D D;  4KNW A;  4PJJ A;  1Z6A A;  1W2W A;  1VOM A;  4XLP F;  1M2V A;  1PD0 A;  1LVK A;  4KC9 A;  2J9V A;  2C04 A;  4MQ9 F;  4CS9 A;  3WOD F;  4EWC A;  4XWJ A;  4YT4 A;  3EHM A;  4AE4 A;  1TR2 A;  4RD9 A;  4C3D A;  2ZXP A;  4I1M A;  5HSW A;  2EIN C;  4PFO A;  4IRU A;  2OCC C;  3QZC A;  4F4B A;  3AG1 C;  4PFP A;  2NUP A;  3W8I A;  2JD3 A;  5EGY A;  2XSE A;  3S28 A;  3UGO A;  1V55 C;  2P7V A;  4GEH A;  4OD4 A;  1G8X A;  2D5R B;  4J30 B;  3EH1 A;  3ABM C;  3UMH A;  1QLE C;  1BR1 A;  3SYN A;  2J0W A;  3M1C B;  4I44 A;  2YZS A;  1D1B A;  1BR4 A;  2NUT B;  5E2Q A;  5KYY B;  1MMA A;  3LAY A;  2CGE A;  1FMW A;  4XTK A;  1MMN A;  4X0R A;  2J9U A;  4DVZ A;  4IWB A;  1LS1 A;  2G3V A;  5EHH A;  1N1C A;  2PP4 A;  2XRH A;  3T4R A;  3HTK C;  4HEA J;  1BR2 A;  2Q3T A;  2A69 F;  5B1B C;  2E87 A;  2Q9C A;  4NY3 A;  2Y3H A;  4B6I A;  3RH3 A;  3OWT A;  3DM5 A;  2B0J A;  3ASO C;  2C03 A;  3DM9 B;  4P6I C;  4HFF B;  5DS4 A;  1SF8 A;  5DQZ A;  2VAS A;  1D1C A;  2J46 A;  1FMV A;  3AG3 C;  2WVQ A;  2I8B A;  1OCZ C;  3T6B A;  2OG2 A;  4JJG A;  4EBB A;  2WB7 A;  1TWH A;  5F5F A;  3LLI A;  3NYL A;  3JYH A;  4CSA A;  1Z63 A;  2KGO A;  4U5C E;  4FES A;  2FFH A;  1ZU5 A;  3CZ6 A;  4O79 A;  4BJ6 A;  2YEV A;  1NU7 D;  1O87 A;  5E3C A;  3LS1 A;  3EG9 A;  4C7O B;  4CS8 C;  5DS5 A;  4ZLD A;  5KYY A;  3EGX B;  2A6E F;  2H7O A;  2KW3 C;  2ZXW C;  3ZVR A;  4I3M A;  1MNE A;  4PJL A;  3UGP A;  3RKO F;  1QZX A;  4O6Y A;  2L81 A;  2P6V A;  4YWQ A;  2WZG A;  4BJ5 A;  1Z3I X;  2X51 A;  1MMG A;  4OIR F;  2Z15 A;  4DBR A;  2R7R A;  3T6J A;  4BEJ A;  5KYU B;  2R7U A;  5D92 A;  4HFK B;  4PJN A;  2QTV A;  3UMK A;  1VMA A;  4LER A;  1RJ9 B;  3IEE A;  3QMK A;  1M2O A;  1FTS A;  4A2N B;  3WG7 C;  5E33 A;  5L3V A;  1S7Z A;  4G0H A;  2Y39 A;  4ULW A;  1ST6 A;  4C3E A;  3LEV A;  4DVY P;  5KYN A;  4U5G A;  3B0U X;  4W8K A;  3NG1 A;  3Q6M A;  3KKB A;  4KBL A;  3K7D A;  2PFD A;  5B3S C;  3NDB B;  3FHD A;  3MLG A;  3K66 A;  2DYS C;  2VH3 A;  4C7O A;  4BJT A;  2R7X A;  2IXN A;  2IXO A;  3EGX A;  2Y69 C;  3GOD A;  5E3A A;  3FVY A;  3AQC A;  4QI2 A;  2BE5 F;  2W9Y A;  2W4B A;  2H7V C;  3SNH A;  2EIJ C;  3NRH A;  2HV7 A;  2R7S A;  3JT1 A;  3O6X A;  3OA1 A;  1JPJ A;  5DS6 A;  2J7P D;  3EZH A;  4JUR I;  4O7G A;  3H65 A;  2R7O A;  2EIM C;  2CW0 F;  1ZHW A;  5IY5 C;  5F5H A;  4KNV A;  1Z23 A;  3E70 C;  4JW1 A;  2FGY A;  5KYU A;  3W2W A;  4JZA A;  4XLN F;  3S27 A;  3F46 A;  1FFT C;  3F47 A;  2WL8 A;  3AG4 C;  1RJ9 A;  1J8M F;  4CS9 C;  3L34 A;  3I5Q A;  3L0I A;  2IOQ A;  1MND A;  3NYJ A;  4U5H A;  2LSE A;  2W45 A;  3B0P A;  2EIK C;  1VK5 A;  3GAN A;  3UNG C;  4IJJ A;  4U5D E;  3LS0 A;  3PMR A;  3E9V A;  1ZHX A;  3N0T A;  4FX5 A;  3S0X A;  3KMI A;  3ITF A;  3LNR A;  2PX0 A;  4U5E E;  3JSZ A;  2ZXO A;  3NKE A;  1NG1 A;  4RBN A;  2IXP A;  3DD7 A;  4E7S A;  4G7H F;  3CSK A;  5D91 A;  4Q5S F;  2WZL A;  3FDQ A;  2NUT A;  3HJC A;  3DJN B;  1OCO C;  3OEO A;  1D0Y A;  1ZHY A;  4MND A;  4CBE A;  2R7W A;  4OD5 A;  3N2Z B;  4QDL A;  2Y3B A;  4J32 B;  3EGD B;  1M56 C;  2XXA B;  2WVN A;  3RYL A;  1D0X A;  4N06 A;  3UR3 C;  3K6B A;  4YT5 A;  3NYM A;  2J0X A;  4PJM A;  3ABK C;  2HV6 A;  3AG2 C;  5KYW B;  3EFO B;  4FWV A;  5FCL A;  3CQZ A;  4LLC A;  2DGJ A;  5T3T A;  3KH2 A;  4OIN F;  4OIP F;  4DBQ A;  4CIH A;  5BUO A;  4CS7 A;  3Q7L A;  3W8H A;  5CI8 A;  1TWA A;  3K1I C;  3LJB A;  1NU9 C;  4G7O F;  2WZF A;  1IZM A;  3DXJ F;  3VYW A;  3N24 A;  4CSA C;  3ZSU A;  4LAC B;  4AK9 A;  3B0V C;  1O5H A;  2Q9A A;  3RFY A;  3KL4 A;  3LLK A;  4BJ6 C;  3SP1 A;  2KNH A;  3K33 A;  1OKK D;  3X2Q C;  2Y3G A;  3ZIB A;  5DLJ A;  4OIQ F;  2YHS A;  3HLZ A;  1ZHT A;  3ECS A;  3EPV A;  1SMY F;  2Y3D A;  1SZI A;  1WGW A;  2ZXR A;  4WJ0 A;  4H4K C;  3EGD A;  2EIL C;  2XXA A;  1Z5Z A;  2W4M A;  4BJ5 C;  4YT8 A;  1IW7 F;  4U5F E;  2QY9 A;  4U5B E;  2MWQ A;  3O39 A;  1ZYR F;  3K1H A;  4O6N A;  1OKK A;  5KYW A;  3TD7 A;  3EFO A;  3DZA A;  3EG9 B;  1PD1 A;  2XL4 A;  3AQB A;  3JRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...