2LSEA

Solution nmr structure of de novo designed four helix bundle protein, northeast structural genomics consortium (nesg) target or188
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
MQEERKKLLEKLEKILDEVTDGAPDEARERIEKLAKDVKDELEEGDAKNMIEKFRDEMEQMYKDAPNAVMEQLLEEIEKLLKKAGSLVPRGSYLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Four Helix Bundle Protein
publication title Solution NMR Structure of a Denovo Design Four Helix Bundle Protein, Northeast Structural Genomics Consortium Target OR188
rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1360 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2lseA00
2LSEA
chains in the Genus database with same CATH superfamily
2IYLD 2YVKA 4CSAC 3CEXA 1XZPA 2YZSA 1MMAA 1TR2A 4EWCA 4XLPF 3EGDA 1LE4A 4AK9A 1R4TA 2XM0A 5BQIA 4GQHA 5KYXA 3N0TA 2IBFA 2R7XA 3AG2C 3K33A 3AQBA 4P9FA 2VB6A 4D4NA 4N6HA 1YARO 1F1MA 4C7OB 2KSFA 1H6GA 4CS8C 1YYJA 4I1OB 2B0HA 2OG2A 1Z7Qc 1OCRC 3DAGA 4IAQA 4MVQA 3S0XA 3C8GB 3FDQA 2XS8A 3B0PA 1H9GA 4DRJB 3PDMP 5BQHA 3NMJA 1WN0A 5HSWA 1S7ZA 3C8GD 2R25A 2IXPA 2H8AA 2NPUA 2J9VA 3A9CA 4RDAA 5KYNA 2DI3A 1I4ZA 2XSEA 2I15A 3SZRA 2YEVA 3EG9B 1NBBA 2A6EF 1OR3A 1ZHXA 4MNDA 5BQGA 3UGOA 3TK0A 4K1OA 1TWGA 3ECSA 3KYIA 2NSFA 3QTHA 3HNLA 3K1HA 4H54A 4F4BA 2WB7A 1YZCA 3EG9A 3EPVA 3LNMB 4OD4A 2BC5A 2L6HA 3SXKA 5A6AA 3RQEA 4BJ1A 5FCLA 4B6IA 1K05A 2LD6A 2XM4A 4W8KA 4CDVA 1PD0A 1OCOC 1OXBA 1RKEA 2BL2A 2L6FA 3ABKC 3DE8A 3FVYA 3ZSUA 4ZLCA 1ORYA 2XL6A 4JVSA 2AP3A 4Z9IA 2EPNA 3VAYA 2CNWD 2P6VA 4NQFA 5COFA 2JPUA 2RD9A 3W2WA 4AE4B 4FAPB 1G4US 3FOOA 4J30B 2P61A 2R7OA 2NUPA 1JMWA 1LE2A 2DGJA 2JX0A 4JE9A 4JIOA 4O7GA 4E17A 3TQOA 2HJMA 5IY5C 4E18A 1SYQA 5DS4A 4RD9A 4JC7A 4AE4A 1YDIA 2ASRA 2W45A 1FNTc 2HMZA 4BEMJ 5FZTA 5DQTA 1V4AA 3S28A 4LDKA 3WG7C 4ZLDA 3U3FA 2P0NA 1LS4A 4IWBA 1RXQA 4JEBA 2KJGA 2EIJC 2HZ8A 5HV9A 1ZYRF 3KKBA 4YN0B 3TD7A 2Y39A 1CGME 2V3CC 1BZ4A 1LIHA 2AWCA 2M4EA 4GYTA 2NUTB 4E7SA 1Q0MA 1LPEA 1Q0GA 2J0XA 1QSPA 2L9JA 2VCAA 3L34A 2ETSA 2FAPB 1OCZC 4NC3A 4G7ZF 3K1IC 4CDYA 5B1AC 4MVMA 3NG1A 1BR2A 4E7ZA 3GORA 4CS9A 2EPOA 2W4BA 2LSEA 3ZIBA 5DS5A 4CSAA 2CCYA 5A69A 4JZAA 1YVIA 4KI2A 3Q6MA 3NYMA 3EQLF 4JURI 1A41A 1MMNA 2E87A 3ATPA 3W8IA 5KYWB 2YL3A 1QZXA 3C18A 4BG0A 2HUJA 3MYIA 4IARA 3EGXA 1VYKA 2IXOA 3KMIA 4XEVA 3PHF2 3WODF 2L81A 2Y3BA 3EFOB 3UGPA 4CS8A 2J9BA 2QE9A 3W4YA 5KYWA 1NZEA 4YWQA 1EQ1A 3L8JA 2J45A 3NKDA 3O6XA 1ZVZA 2XLWA 2DYSC 4AX2A 4CX9A 2WL8A 1TQGA 2OJQA 3UMKA 3VM6A 5KYYB 2YHSA 1OKKD 5L0JA 1DOWA 2CGEA 2CW0F 3K66A 3EZHA 4U5DE 1ZU4A 4MVSA 4IJJA 4WJ0A 4DJ9A 3L0IA 5K0IA 4MVOA 4MW3A 3GM2A 2C04A 3FMSA 5CIVA 1PD1A 1QQ3A 1YZAA 3PMRA 1VTMP 1C17M 2ZXWC 1TKNA 3DJUB 1M2OA 1O5HA 1T6UA 1TFOB 3EH1A 3HNIA 4RBNA 3I4UA 4D4XA 2R7QA 1WASA 4HE8D 3UMHA 2PP4A 4YK5A 4G7OF 2R7TA 3DM5A 1Z5ZA 4Q7CA 4FWVA 1C03A 2UUIA 1MNEA 4PFOA 1NU9C 4CJOA 5L0CA 1XZQA 2LFFA 3JRTA 2R02A 3O10A 4G78A 3RVZA 3U2MA 2XLEA 4KBLA 2ZPAA 3MLGA 4Z9JA 3U5SA 4EHPA 2R7SA 3EGDB 2J7PD 4E0IA 2R03A 4BEJA 2R7RA 4XLNF 1I5NA 3GM1A 3EH2A 3EHNA 3E70C 4U5GA 4PJMA 2R9RB 2D4UA 2HFIA 3AG1C 4PJJA 3TULA 3SNHA 1OW7A 3LNRA 3ZDLA 2W4MA 1KTMA 1DOVA 2Y69C 2XLHA 3C63A 4MTGA 4C3DA 2IXNA 2WVOA 3O55A 4MTOA 4YT2A 1ZHZA 3U0CA 1RMVA 3B9QA 4N6CA 1AEPA 2HKVA 2IM8A 3DJNB 3L8IA 3LLIA 1VLTA 3M1CB 1PV3A 2XLMA 4A4AA 2HV6A 3H2UA 3RQFA 2ZD9A 2MHRA 3KH2A 1VB5A 4WGYA 1K04A 4XEFA 2Q3TA 3G4ZA 3LS0A 1TWCA 4JJGA 2O9XA 2TMVP 2KK1A 4Z9HA 3RQGA 2YLIA 4DXWA 1Z6AA 5AC4A 2F22A 3FAPB 3E9VA 1OW8A 4XPWA 4JCHA 2KQ9A 4FESA 2QNLA 3IQTA 2WVQA 2Q9CA 1D0XA 3I5PA 3MX3A 2LIGA 1ORSC 4O6NA 3RW0A 4NTFA 4XWJA 3SXZA 1O87A 2HS5A 4YT5A 4I44A 4Q4ZF 5CI9A 4DVYP 4XQ1A 1M2VA 2DYRC 1FMWA 4YT8A 1HMDA 2PFDA 2YKZA 3CQZA 1RKEB 3JYYA 1GGQA 1LS1A 2OJED 3K1IA 4LERA 1WATA 4N4WA 3S27A 1G5ZA 2H7BA 2KNHA 2LP4A 3U2LA 1C02A 1JAFA 3U3BA 2EIMC 1FMVA 5F5FA 1D1BA 1HE1A 2AU5A 256BA 2CYDA 1LM3B 2P1AA 3DZAA 3LEOA 3TJ6A 3EZIA 2UUHA 3MFNA 3RF3A 3RFYA 1T6IA 2NUPB 4DRHB 4ER9A 3EJNA 4JRZA 2R7VA 4PFPA 1A7DA 1QVXA 4H4KC 4YL1A 1LI7A 2LK4A 2J9WA 4CBEA 2XXAA 3RH3A 3CAXA 4XEKA 2R7WA 3B0VC 3VRCA 1EKYA 2EPKX 3AOUA 4QI0A 3W8HA 4AL1A 1I4YA 1SF8A 2VCBA 3UNGC 4OD5A 1CPRA 2MWQA 3CSKA 3T6GB 3AG3C 1EI7A 3ASOC 4KNWA 1QLEC 4X0RA 3U8PA 1MNDA 1Z3IX 1JPNA 4FX5A 4NTBA 2NSGA 1HW2A 1BBHA 1ZZPA 3HLZA 1BDJB 1H7IA 1YLMA 2FFHA 3CZ6A 4OINF 1MMDA 1VMAA 3C62A 3GEEA 3RVYA 3DD7A 4Q5SF 1AUEA 2J8WA 2YL0A 3G50A 5BUOA 3H2VA 4OIOF 1FFTC 2LCHA 1VLSA 4JJFA 3ZTZA 1S05A 3DM9B 1E83A 1Y4CA 4O6YA 3SXMA 2HMQA 3M4BA 1JR8A 2KW3C 1SR2A 1KU2A 3ZWIA 3GWNA 4HEAJ 3JSZA 4JCZA 4U9DA 3RIPA 3TJ5A 4EBBA 4UDVA 2A0BA 5A6JA 3L1MA 3EGXB 3B29A 3JCUQ 5GPGB 4MVRA 3ITFA 5JVEA 3F47A 2NG1A 1WOLA 1E2XA 1WGWA 1D0YA 2RSEB 3IQCA 3SXYA 4DRIB 2OU6A 4IRUA 1NSGB 5T3TA 3QVZA 4XTKA 1YAUO 2Y3DA 1ZU5A 4ONSA 3M4CA 3S29A 4CS9C 4EUKB 2VASA 2PF4E 2Q7RA 1E86A 4W8PA 1FR0A 3LAYA 3X1OA 2Q00A 5JUAA 1V55C 2QTVA 3Q7LA 3JSEO 1RJ9A 2QLAA 1NFNA 2XLVA 3IPMO 1J8YF 2OQMA 3ABMC 4G0HA 1Z63A 4L6RA 4A2NB 1BR4A 1YYXA 3RYLA 1QKRA 1E85A 3LLKA 4I3MA 3S84A 4EKWA 3AGTA 1OCCC 2GAQA 1FFHA 1AVOB 2VCCA 3GM3A 4WABA 2OOCA 2R05A 1GS9A 3C7JA 1YA9A 2EINC 4O6MA 1JPJA 3JRMO 3QMKA 3GWLA 3HJCA 4NY3A 2A0UA 4AL0A 3NMIA 2EPMX 2YL1A 1HMOA 4YJWA 3POVA 4EBJA 4ULWA 1XWJA 3AG4C 3JTLO 4QDLA 5E3AA 5CI8A 3T9OA 1PCXA 4NCQA 2KGOA 1VOMA 3NKEA 3OEOA 4P6IC 5D92A 5EK0A 3U9JA 1ZW3A 1OQCA 4PJNA 2L7AA 1YJGA 1VYIA 2D5RB 3V5XA 3M15A 1M6TA 2Y3GA 2Y3HA 1FAPB 4BJTA 3A11A 1ZHYA 3GEIA 1HY5A 1NLXA 2ZXOA 3MBGA 3R7CA 5JRAA 1LVKA 3FOPA 1YA7O 2A6HF 2CDQA 1JOGA 1TFKB 3QVYA 4MS2A 3R2PA 4OIRF 3ASNC 5JS5A 2YRFA 4MVUA 3ABLC 3OWTA 4HFKB 4J7YA 4XPXA 3FAJA 4KC9A 2A69F 2AWYA 4IGGA 5E2QA 3NYJA 3X2QC 2OEVA 4JEAA 5A6BA 5DS6A 4O79A 3JYHA 3SEOA 4LDQA 4PACA 3S9OA 2QY9A 4DOZA 3GODA 3DMDA 2H7VC 4K0DA 2IOQA 3US6A 2YLGA 3ZC4A 1NG1A 3WAQA 1M56C 3HNKA 3MYFA 2X0CA 2XLDA 3T6BA 3NDBB 3IQ5A 2H7OA 1RCPA 2WZFA 4KNVA 1M2VB 4DBRA 2QUPA 2GDCA 2XLOA 3PCVA 3V5ZA 1SMYF 2EIKC 1J8MF 2ICWG 3M79A 1LI5A 3DI5A 5B1BC 5JP7A 5T1DB 3WHNA 4BPMA 4EIYA 1IZMA 4QI2A 4BJ6C 1Y6DA 1A7VA 3LS1A 4LDRA 5L0HA 2KC3A 2YLDA 2WZLA 4CIPA 4IAOA 1QPUA 5JSLA 3VYWA 3U8VA 3T4RA 3O39A 4CIHA 1APCA 4YL0A 1G8XA 5L0IA 1E84A 3LJBA 3UR3C 4C7OA 2P7VA 1BR1A 2XXAB 1HW1A 1OR2A 4LLCA 2XL8A 5COMA 1EA8A 4NTAA 5AGFA 1HE9A 4PR9A 5COGA 2J46A 3U9MA 4DBQA 2R7UA 2WZGA 5F5HA 3C8GA 5TJ5E 1T9KA 4OIPF 3N24A 1GM5A 2G62A 3BRJA 4J7TA 3K6BA 1L3PA 3Q7GA 5F28E 4EBKA 1ZHTA 4MQ9F 2AVKA 1D1AA 2J7PA 1KNYA 2PX0A 2ZXPA 3LUTB 3DXJF 2G3VA 2JD3A 1GQAA 1T5OA 1ZW2A 5A6KA 2XS1A 1L7CA 1OXKA 2YL7A 4BJ5C 3B71A 5B3SC 3QW1A 2FGYA 1MMGA 2OEXA 2M64A 3SYNA 1SZIA 4N06A 3ZVRA 4ULVA 1U6HA 4PJLA 5T3WA 3TOMA 2Q9AA 3DKAA 4JKVA 3JZ0A 3S90A 3UMIA 1K40A 3ZQVA 1A0BA 5KYUB 3GEHA 3GANA 5DQZA 2PBEA 2LQGA 5L3VA 2IXMA 4U5FE 1RKCA 2YWAA 1VK5A 2LFDA 4YL3A 2CNWA 3BEHA 1WWPA 4P9TA 1UFBA 4JTAB 3V5YA 3SP1A 1TWHA 1ZHWA 3NMKA 4LACB 3J06A 4JW1A 1H9TA 5KYUA 2I8BA 1B68A 2L6GA 4PK4A 5L0FA 2Q4FA 3HKKA 4LLEA 3DAFA 4U5HA 4C3EA 1R5ID 5EHHA 1D1CA 3ZQYA 2KYHA 3FHDA 2MYSA 4R32A 4U5EE 1MQVA 4WGZA 5DVWA 3LESA 3QW0A 4MVZA 4E0HA 4U9EA 3V7OA 5B3IA 5E3CA 1D0ZA 1RJ9B 3AQCA 3AGUA 4CJGA 3IQ6A 2DB4A 1Q0DA 3KL4A 1LKXA 5L0DA 3G4XA 1WTYA 5L3QA 3N2ZB 5JLIA 4U5BE 4M63A 2NUTA 3ZTMA 3DE9A 2GFHA 1CGNA 3KPHA 4IB4A 1O3UA 2XL4A 1V74B 1T6QA 2A1DD 1U89A 2B0JA 3K7DA 4ANJA 5EGYA 3AJMA 4JTCB 4CS7A 2OKUA 5DLJA 4U5CE 1W2WA 2OCCC 4MW8A 3JT1A 1OW6A 3C8ZA 4I1MA 2GA0A 4J32B 3EHMA 3HTKC 3IEEA 4MTFA 4BJ6A 2A68F 3ZG1A 5L0GA 3I5QA 4G7HF 3VF0A 3QZCA 1M57C 2J9UA 5D91A 2Q9BA 1ST6A 2WVNA 4YT4A 2Z15A 3IHUA 1IW7F 3NYLA 4HFFB 2V26A 1UG7A 2J0WA 3EFOA 2C03A 1FTSA 2EPLX 3W2VA 3H65A 1OKKA 2HJ3A 2W9YA 4DVZA 1TWAA 4OIQF 2HSQA 1CPQA 2GWWA 4GEHA 5KYYA 2X51A 3RKOF 1G4WR 2PNOA 3KYJA 4JTDB 1Q0KA 1U0BB 3OA1A 5E33A 2HSBA 5A6BD 2G3KA 3NRHA 3FXHA 2EILC 4K7BA 1A7EA 1Q0FA 2PX3A 3B0UX 5JT4A 3T6JA 4CDAA 1NFOA 1NU7D 4BJ5A 4XPYA 1Z23A 3Q6NA 2ZXRA 5AC5A 2YQYA 1V54C 3DWWA 1JRAA 2BE5F 3HNJA 5KYXB 3TOLA 1CGOA 1ORJA 2VH3A 2VC9A 3F46A 2HV7A 3LEVA 2XRHA 4C3BA 1T01A 1N1CA
chains in the Genus database with same CATH topology
2IYLD 4CSAC 2YZSA 4EWCA 1MMAA 1TR2A 4XLPF 3EGDA 4AK9A 5KYXA 3N0TA 2R7XA 3AG2C 3K33A 3AQBA 2VB6A 4C7OB 4CS8C 4I1OB 2OG2A 1OCRC 3DAGA 3S0XA 3FDQA 3B0PA 5HSWA 1S7ZA 2IXPA 2J9VA 4RDAA 2XSEA 3SZRA 2YEVA 3EG9B 2A6EF 1ZHXA 4MNDA 1TWGA 3ECSA 3K1HA 4F4BA 2WB7A 3EG9A 3EPVA 4OD4A 4BJ1A 5FCLA 4B6IA 4W8KA 1PD0A 1OCOC 3B0UX 3ABKC 3FVYA 3ZSUA 4ZLCA 4JVSA 3VAYA 2CNWD 2P6VA 3W2WA 4AE4B 4J30B 2R7OA 2NUPA 2DGJA 4O7GA 5IY5C 5DS4A 4RD9A 4AE4A 2W45A 5DQTA 3S28A 3WG7C 4ZLDA 4IWBA 2KJGA 2EIJC 1ZYRF 3KKBA 4YN0B 3TD7A 2Y39A 2V3CC 4GYTA 2M4EA 4E7SA 2NUTB 2J0XA 2L9JA 3L34A 1OCZC 3K1IC 5B1AC 3NG1A 1BR2A 4E7ZA 4CS9A 3ZIBA 2W4BA 2LSEA 4CSAA 5DS5A 4JZAA 4KI2A 3Q6MA 3NYMA 3EQLF 4JURI 1MMNA 2E87A 5KYWB 3W8IA 1QZXA 4BG0A 3EGXA 1VYKA 2IXOA 3KMIA 3PHF2 3WODF 2L81A 2Y3BA 3EFOB 3UGPA 4CS8A 5KYWA 1NZEA 4YWQA 2J45A 3NKDA 3O6XA 2DYSC 4AX2A 2WL8A 3UMKA 5KYYB 2YHSA 1OKKD 2CW0F 2CGEA 4U5DE 3K66A 3EZHA 1ZU4A 4IJJA 4WJ0A 3L0IA 2C04A 1PD1A 3PMRA 2ZXWC 1TKNA 3DJUB 1M2OA 1O5HA 3EH1A 3UGOA 3POVA 4RBNA 3I4UA 2R7QA 3UMHA 4HE8D 4G7OF 2PP4A 2R7TA 3DM5A 1Z5ZA 4Q7CA 4FWVA 1MNEA 4PFOA 1NU9C 3JRTA 4KBLA 2ZPAA 3MLGA 2R7SA 3EGDB 2J7PD 4BEJA 2R7RA 4XLNF 3EH2A 3EHNA 3E70C 4U5GA 4PJMA 4PJJA 3AG1C 3SNHA 3LNRA 2W4MA 2Y69C 4C3DA 4YT2A 2IXNA 2WVOA 1ZHZA 3B9QA 3DJNB 3LLIA 3M1CB 2HV6A 3KH2A 2Q3TA 3LS0A 1TWCA 4JJGA 2O9XA 1Z6AA 3E9VA 4JCHA 2KQ9A 4FESA 2WVQA 2Q9CA 1D0XA 3I5PA 3MX3A 4O6NA 2HV7A 4XWJA 1O87A 4YT5A 4I44A 4Q4ZF 5CI9A 4DVYP 1M2VA 2DYRC 1FMWA 4YT8A 2PFDA 3CQZA 1LS1A 4LERA 3S27A 2H7BA 2KNHA 2EIMC 1FMVA 5F5FA 1D1BA 3DZAA 3EZIA 3RFYA 2NUPB 3EJNA 2R7VA 4PFPA 4H4KC 2XXAA 4CBEA 2J9WA 3RH3A 2R7WA 3B0VC 4QI0A 3W8HA 1SF8A 3UNGC 4OD5A 2MWQA 3CSKA 3AG3C 4KNWA 3ASOC 1QLEC 4X0RA 1MNDA 1Z3IX 1JPNA 4FX5A 3HLZA 2FFHA 3CZ6A 4OINF 1MMDA 1VMAA 3DD7A 4Q5SF 5BUOA 4OIOF 1FFTC 4JJFA 3DM9B 4O6YA 2KW3C 1KU2A 4EBBA 4HEAJ 3JSZA 3RIPA 3EGXB 3JCUQ 3ITFA 3F47A 2NG1A 1WGWA 1D0YA 4IRUA 5T3TA 4XTKA 2Y3DA 1ZU5A 3S29A 4CS9C 2VASA 2PF4E 3LAYA 3X1OA 1V55C 2QTVA 3Q7LA 1RJ9A 1J8YF 3ABMC 4G0HA 1Z63A 4A2NB 1BR4A 3RYLA 3LLKA 4I3MA 1OCCC 1FFHA 2EINC 4O6MA 1JPJA 3QMKA 3HJCA 4NY3A 4YJWA 4ULWA 3AG4C 4QDLA 5E3AA 5CI8A 1PCXA 2KGOA 1VOMA 3NKEA 3OEOA 4P6IC 5D92A 4PJNA 2D5RB 1VYIA 2Y3GA 2Y3HA 4BJTA 1ZHYA 2ZXOA 1LVKA 2A6HF 2CDQA 4OIRF 3ASNC 3ABLC 3OWTA 4HFKB 3FAJA 4KC9A 2A69F 5E2QA 3NYJA 3X2QC 5DS6A 4O79A 3JYHA 3SEOA 2QY9A 4DOZA 3GODA 3DMDA 2H7VC 4K0DA 2IOQA 3ZC4A 1NG1A 1M56C 3T6BA 3NDBB 2H7OA 2WZFA 4KNVA 4DBRA 1M2VB 1SMYF 2EIKC 1J8MF 5T1DB 5B1BC 4QI2A 1IZMA 4BJ6C 3LS1A 2WZLA 4IAOA 3VYWA 3T4RA 3O39A 4CIHA 1G8XA 4C7OA 3LJBA 3UR3C 2P7VA 1BR1A 2XXAB 4LLCA 4DBQA 2J46A 2R7UA 2WZGA 5F5HA 4OIPF 3N24A 2G62A 3K6BA 3Q7GA 1ZHTA 4MQ9F 1D1AA 2PX0A 2ZXPA 3DXJF 2G3VA 2JD3A 4BJ5C 5B3SC 2FGYA 1MMGA 3SYNA 1SZIA 4N06A 3ZVRA 4PJLA 5T3WA 2Q9AA 3UMIA 5KYUB 3GANA 5DQZA 5L3VA 2IXMA 4U5FE 1VK5A 2CNWA 3SP1A 1TWHA 1ZHWA 4LACB 4JW1A 5KYUA 2I8BA 4PK4A 4LLEA 4C3EA 3DAFA 4U5HA 5EHHA 1D1CA 3FHDA 2MYSA 4U5EE 5DVWA 3LESA 3V7OA 5E3CA 1D0ZA 1RJ9B 3AQCA 3KL4A 1LKXA 5L3QA 3N2ZB 4U5BE 4M63A 2NUTA 2GFHA 2XL4A 2A1DD 2B0JA 3K7DA 4ANJA 5EGYA 4CS7A 5DLJA 4U5CE 1W2WA 2OCCC 3JT1A 4J32B 4I1MA 5KYNA 3EHMA 3HTKC 3IEEA 4BJ6A 4G7ZF 2A68F 3ZG1A 3I5QA 4G7HF 3QZCA 1M57C 2J9UA 5D91A 2Q9BA 1ST6A 2WVNA 4YT4A 2Z15A 3NYLA 1IW7F 4HFFB 2V26A 2J0WA 3EFOA 2C03A 1FTSA 3W2VA 3H65A 1OKKA 4DVZA 2W9YA 1TWAA 4OIQF 4GEHA 5KYYA 2X51A 3RKOF 3OA1A 5E33A 2G3KA 3NRHA 2EILC 4K7BA 2PX3A 3T6JA 1NU7D 4BJ5A 1Z23A 3Q6NA 2ZXRA 1V54C 2BE5F 5KYXB 2VH3A 3F46A 2J7PA 3LEVA 2XRHA 4C3BA 1N1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSE A; 
#chains in the Genus database with same CATH topology
 2IYL D;  2YVK A;  4CSA C;  3CEX A;  1XZP A;  2YZS A;  1MMA A;  1TR2 A;  4EWC A;  4XLP F;  3EGD A;  1LE4 A;  4AK9 A;  1R4T A;  2XM0 A;  5BQI A;  4GQH A;  5KYX A;  3N0T A;  2IBF A;  2R7X A;  3AG2 C;  3K33 A;  3AQB A;  4P9F A;  2VB6 A;  4D4N A;  4N6H A;  1YAR O;  1F1M A;  4C7O B;  2KSF A;  1H6G A;  4CS8 C;  1YYJ A;  4I1O B;  2B0H A;  2OG2 A;  1Z7Q c;  1OCR C;  3DAG A;  4IAQ A;  4MVQ A;  3S0X A;  3C8G B;  3FDQ A;  2XS8 A;  3B0P A;  1H9G A;  4DRJ B;  3PDM P;  5BQH A;  3NMJ A;  1WN0 A;  5HSW A;  1S7Z A;  3C8G D;  2R25 A;  2IXP A;  2H8A A;  2NPU A;  2J9V A;  3A9C A;  4RDA A;  5KYN A;  2DI3 A;  1I4Z A;  2XSE A;  2I15 A;  3SZR A;  2YEV A;  3EG9 B;  1NBB A;  2A6E F;  1OR3 A;  1ZHX A;  4MND A;  5BQG A;  3UGO A;  3TK0 A;  4K1O A;  1TWG A;  3ECS A;  3KYI A;  2NSF A;  3QTH A;  3HNL A;  3K1H A;  4H54 A;  4F4B A;  2WB7 A;  1YZC A;  3EG9 A;  3EPV A;  3LNM B;  4OD4 A;  2BC5 A;  2L6H A;  3SXK A;  5A6A A;  3RQE A;  4BJ1 A;  5FCL A;  4B6I A;  1K05 A;  2LD6 A;  2XM4 A;  4W8K A;  4CDV A;  1PD0 A;  1OCO C;  1OXB A;  1RKE A;  2BL2 A;  2L6F A;  3ABK C;  3DE8 A;  3FVY A;  3ZSU A;  4ZLC A;  1ORY A;  2XL6 A;  4JVS A;  2AP3 A;  4Z9I A;  2EPN A;  3VAY A;  2CNW D;  2P6V A;  4NQF A;  5COF A;  2JPU A;  2RD9 A;  3W2W A;  4AE4 B;  4FAP B;  1G4U S;  3FOO A;  4J30 B;  2P61 A;  2R7O A;  2NUP A;  1JMW A;  1LE2 A;  2DGJ A;  2JX0 A;  4JE9 A;  4JIO A;  4O7G A;  4E17 A;  3TQO A;  2HJM A;  5IY5 C;  4E18 A;  1SYQ A;  5DS4 A;  4RD9 A;  4JC7 A;  4AE4 A;  1YDI A;  2ASR A;  2W45 A;  1FNT c;  2HMZ A;  4BEM J;  5FZT A;  5DQT A;  1V4A A;  3S28 A;  4LDK A;  3WG7 C;  4ZLD A;  3U3F A;  2P0N A;  1LS4 A;  4IWB A;  1RXQ A;  4JEB A;  2KJG A;  2EIJ C;  2HZ8 A;  5HV9 A;  1ZYR F;  3KKB A;  4YN0 B;  3TD7 A;  2Y39 A;  1CGM E;  2V3C C;  1BZ4 A;  1LIH A;  2AWC A;  2M4E A;  4GYT A;  2NUT B;  4E7S A;  1Q0M A;  1LPE A;  1Q0G A;  2J0X A;  1QSP A;  2L9J A;  2VCA A;  3L34 A;  2ETS A;  2FAP B;  1OCZ C;  4NC3 A;  4G7Z F;  3K1I C;  4CDY A;  5B1A C;  4MVM A;  3NG1 A;  1BR2 A;  4E7Z A;  3GOR A;  4CS9 A;  2EPO A;  2W4B A;  2LSE A;  3ZIB A;  5DS5 A;  4CSA A;  2CCY A;  5A69 A;  4JZA A;  1YVI A;  4KI2 A;  3Q6M A;  3NYM A;  3EQL F;  4JUR I;  1A41 A;  1MMN A;  2E87 A;  3ATP A;  3W8I A;  5KYW B;  2YL3 A;  1QZX A;  3C18 A;  4BG0 A;  2HUJ A;  3MYI A;  4IAR A;  3EGX A;  1VYK A;  2IXO A;  3KMI A;  4XEV A;  3PHF 2;  3WOD F;  2L81 A;  2Y3B A;  3EFO B;  3UGP A;  4CS8 A;  2J9B A;  2QE9 A;  3W4Y A;  5KYW A;  1NZE A;  4YWQ A;  1EQ1 A;  3L8J A;  2J45 A;  3NKD A;  3O6X A;  1ZVZ A;  2XLW A;  2DYS C;  4AX2 A;  4CX9 A;  2WL8 A;  1TQG A;  2OJQ A;  3UMK A;  3VM6 A;  5KYY B;  2YHS A;  1OKK D;  5L0J A;  1DOW A;  2CGE A;  2CW0 F;  3K66 A;  3EZH A;  4U5D E;  1ZU4 A;  4MVS A;  4IJJ A;  4WJ0 A;  4DJ9 A;  3L0I A;  5K0I A;  4MVO A;  4MW3 A;  3GM2 A;  2C04 A;  3FMS A;  5CIV A;  1PD1 A;  1QQ3 A;  1YZA A;  3PMR A;  1VTM P;  1C17 M;  2ZXW C;  1TKN A;  3DJU B;  1M2O A;  1O5H A;  1T6U A;  1TFO B;  3EH1 A;  3HNI A;  4RBN A;  3I4U A;  4D4X A;  2R7Q A;  1WAS A;  4HE8 D;  3UMH A;  2PP4 A;  4YK5 A;  4G7O F;  2R7T A;  3DM5 A;  1Z5Z A;  4Q7C A;  4FWV A;  1C03 A;  2UUI A;  1MNE A;  4PFO A;  1NU9 C;  4CJO A;  5L0C A;  1XZQ A;  2LFF A;  3JRT A;  2R02 A;  3O10 A;  4G78 A;  3RVZ A;  3U2M A;  2XLE A;  4KBL A;  2ZPA A;  3MLG A;  4Z9J A;  3U5S A;  4EHP A;  2R7S A;  3EGD B;  2J7P D;  4E0I A;  2R03 A;  4BEJ A;  2R7R A;  4XLN F;  1I5N A;  3GM1 A;  3EH2 A;  3EHN A;  3E70 C;  4U5G A;  4PJM A;  2R9R B;  2D4U A;  2HFI A;  3AG1 C;  4PJJ A;  3TUL A;  3SNH A;  1OW7 A;  3LNR A;  3ZDL A;  2W4M A;  1KTM A;  1DOV A;  2Y69 C;  2XLH A;  3C63 A;  4MTG A;  4C3D A;  2IXN A;  2WVO A;  3O55 A;  4MTO A;  4YT2 A;  1ZHZ A;  3U0C A;  1RMV A;  3B9Q A;  4N6C A;  1AEP A;  2HKV A;  2IM8 A;  3DJN B;  3L8I A;  3LLI A;  1VLT A;  3M1C B;  1PV3 A;  2XLM A;  4A4A A;  2HV6 A;  3H2U A;  3RQF A;  2ZD9 A;  2MHR A;  3KH2 A;  1VB5 A;  4WGY A;  1K04 A;  4XEF A;  2Q3T A;  3G4Z A;  3LS0 A;  1TWC A;  4JJG A;  2O9X A;  2TMV P;  2KK1 A;  4Z9H A;  3RQG A;  2YLI A;  4DXW A;  1Z6A A;  5AC4 A;  2F22 A;  3FAP B;  3E9V A;  1OW8 A;  4XPW A;  4JCH A;  2KQ9 A;  4FES A;  2QNL A;  3IQT A;  2WVQ A;  2Q9C A;  1D0X A;  3I5P A;  3MX3 A;  2LIG A;  1ORS C;  4O6N A;  3RW0 A;  4NTF A;  4XWJ A;  3SXZ A;  1O87 A;  2HS5 A;  4YT5 A;  4I44 A;  4Q4Z F;  5CI9 A;  4DVY P;  4XQ1 A;  1M2V A;  2DYR C;  1FMW A;  4YT8 A;  1HMD A;  2PFD A;  2YKZ A;  3CQZ A;  1RKE B;  3JYY A;  1GGQ A;  1LS1 A;  2OJE D;  3K1I A;  4LER A;  1WAT A;  4N4W A;  3S27 A;  1G5Z A;  2H7B A;  2KNH A;  2LP4 A;  3U2L A;  1C02 A;  1JAF A;  3U3B A;  2EIM C;  1FMV A;  5F5F A;  1D1B A;  1HE1 A;  2AU5 A;  256B A;  2CYD A;  1LM3 B;  2P1A A;  3DZA A;  3LEO A;  3TJ6 A;  3EZI A;  2UUH A;  3MFN A;  3RF3 A;  3RFY A;  1T6I A;  2NUP B;  4DRH B;  4ER9 A;  3EJN A;  4JRZ A;  2R7V A;  4PFP A;  1A7D A;  1QVX A;  4H4K C;  4YL1 A;  1LI7 A;  2LK4 A;  2J9W A;  4CBE A;  2XXA A;  3RH3 A;  3CAX A;  4XEK A;  2R7W A;  3B0V C;  3VRC A;  1EKY A;  2EPK X;  3AOU A;  4QI0 A;  3W8H A;  4AL1 A;  1I4Y A;  1SF8 A;  2VCB A;  3UNG C;  4OD5 A;  1CPR A;  2MWQ A;  3CSK A;  3T6G B;  3AG3 C;  1EI7 A;  3ASO C;  4KNW A;  1QLE C;  4X0R A;  3U8P A;  1MND A;  1Z3I X;  1JPN A;  4FX5 A;  4NTB A;  2NSG A;  1HW2 A;  1BBH A;  1ZZP A;  3HLZ A;  1BDJ B;  1H7I A;  1YLM A;  2FFH A;  3CZ6 A;  4OIN F;  1MMD A;  1VMA A;  3C62 A;  3GEE A;  3RVY A;  3DD7 A;  4Q5S F;  1AUE A;  2J8W A;  2YL0 A;  3G50 A;  5BUO A;  3H2V A;  4OIO F;  1FFT C;  2LCH A;  1VLS A;  4JJF A;  3ZTZ A;  1S05 A;  3DM9 B;  1E83 A;  1Y4C A;  4O6Y A;  3SXM A;  2HMQ A;  3M4B A;  1JR8 A;  2KW3 C;  1SR2 A;  1KU2 A;  3ZWI A;  3GWN A;  4HEA J;  3JSZ A;  4JCZ A;  4U9D A;  3RIP A;  3TJ5 A;  4EBB A;  4UDV A;  2A0B A;  5A6J A;  3L1M A;  3EGX B;  3B29 A;  3JCU Q;  5GPG B;  4MVR A;  3ITF A;  5JVE A;  3F47 A;  2NG1 A;  1WOL A;  1E2X A;  1WGW A;  1D0Y A;  2RSE B;  3IQC A;  3SXY A;  4DRI B;  2OU6 A;  4IRU A;  1NSG B;  5T3T A;  3QVZ A;  4XTK A;  1YAU O;  2Y3D A;  1ZU5 A;  4ONS A;  3M4C A;  3S29 A;  4CS9 C;  4EUK B;  2VAS A;  2PF4 E;  2Q7R A;  1E86 A;  4W8P A;  1FR0 A;  3LAY A;  3X1O A;  2Q00 A;  5JUA A;  1V55 C;  2QTV A;  3Q7L A;  3JSE O;  1RJ9 A;  2QLA A;  1NFN A;  2XLV A;  3IPM O;  1J8Y F;  2OQM A;  3ABM C;  4G0H A;  1Z63 A;  4L6R A;  4A2N B;  1BR4 A;  1YYX A;  3RYL A;  1QKR A;  1E85 A;  3LLK A;  4I3M A;  3S84 A;  4EKW A;  3AGT A;  1OCC C;  2GAQ A;  1FFH A;  1AVO B;  2VCC A;  3GM3 A;  4WAB A;  2OOC A;  2R05 A;  1GS9 A;  3C7J A;  1YA9 A;  2EIN C;  4O6M A;  1JPJ A;  3JRM O;  3QMK A;  3GWL A;  3HJC A;  4NY3 A;  2A0U A;  4AL0 A;  3NMI A;  2EPM X;  2YL1 A;  1HMO A;  4YJW A;  3POV A;  4EBJ A;  4ULW A;  1XWJ A;  3AG4 C;  3JTL O;  4QDL A;  5E3A A;  5CI8 A;  3T9O A;  1PCX A;  4NCQ A;  2KGO A;  1VOM A;  3NKE A;  3OEO A;  4P6I C;  5D92 A;  5EK0 A;  3U9J A;  1ZW3 A;  1OQC A;  4PJN A;  2L7A A;  1YJG A;  1VYI A;  2D5R B;  3V5X A;  3M15 A;  1M6T A;  2Y3G A;  2Y3H A;  1FAP B;  4BJT A;  3A11 A;  1ZHY A;  3GEI A;  1HY5 A;  1NLX A;  2ZXO A;  3MBG A;  3R7C A;  5JRA A;  1LVK A;  3FOP A;  1YA7 O;  2A6H F;  2CDQ A;  1JOG A;  1TFK B;  3QVY A;  4MS2 A;  3R2P A;  4OIR F;  3ASN C;  5JS5 A;  2YRF A;  4MVU A;  3ABL C;  3OWT A;  4HFK B;  4J7Y A;  4XPX A;  3FAJ A;  4KC9 A;  2A69 F;  2AWY A;  4IGG A;  5E2Q A;  3NYJ A;  3X2Q C;  2OEV A;  4JEA A;  5A6B A;  5DS6 A;  4O79 A;  3JYH A;  3SEO A;  4LDQ A;  4PAC A;  3S9O A;  2QY9 A;  4DOZ A;  3GOD A;  3DMD A;  2H7V C;  4K0D A;  2IOQ A;  3US6 A;  2YLG A;  3ZC4 A;  1NG1 A;  3WAQ A;  1M56 C;  3HNK A;  3MYF A;  2X0C A;  2XLD A;  3T6B A;  3NDB B;  3IQ5 A;  2H7O A;  1RCP A;  2WZF A;  4KNV A;  1M2V B;  4DBR A;  2QUP A;  2GDC A;  2XLO A;  3PCV A;  3V5Z A;  1SMY F;  2EIK C;  1J8M F;  2ICW G;  3M79 A;  1LI5 A;  3DI5 A;  5B1B C;  5JP7 A;  5T1D B;  3WHN A;  4BPM A;  4EIY A;  1IZM A;  4QI2 A;  4BJ6 C;  1Y6D A;  1A7V A;  3LS1 A;  4LDR A;  5L0H A;  2KC3 A;  2YLD A;  2WZL A;  4CIP A;  4IAO A;  1QPU A;  5JSL A;  3VYW A;  3U8V A;  3T4R A;  3O39 A;  4CIH A;  1APC A;  4YL0 A;  1G8X A;  5L0I A;  1E84 A;  3LJB A;  3UR3 C;  4C7O A;  2P7V A;  1BR1 A;  2XXA B;  1HW1 A;  1OR2 A;  4LLC A;  2XL8 A;  5COM A;  1EA8 A;  4NTA A;  5AGF A;  1HE9 A;  4PR9 A;  5COG A;  2J46 A;  3U9M A;  4DBQ A;  2R7U A;  2WZG A;  5F5H A;  3C8G A;  5TJ5 E;  1T9K A;  4OIP F;  3N24 A;  1GM5 A;  2G62 A;  3BRJ A;  4J7T A;  3K6B A;  1L3P A;  3Q7G A;  5F28 E;  4EBK A;  1ZHT A;  4MQ9 F;  2AVK A;  1D1A A;  2J7P A;  1KNY A;  2PX0 A;  2ZXP A;  3LUT B;  3DXJ F;  2G3V A;  2JD3 A;  1GQA A;  1T5O A;  1ZW2 A;  5A6K A;  2XS1 A;  1L7C A;  1OXK A;  2YL7 A;  4BJ5 C;  3B71 A;  5B3S C;  3QW1 A;  2FGY A;  1MMG A;  2OEX A;  2M64 A;  3SYN A;  1SZI A;  4N06 A;  3ZVR A;  4ULV A;  1U6H A;  4PJL A;  5T3W A;  3TOM A;  2Q9A A;  3DKA A;  4JKV A;  3JZ0 A;  3S90 A;  3UMI A;  1K40 A;  3ZQV A;  1A0B A;  5KYU B;  3GEH A;  3GAN A;  5DQZ A;  2PBE A;  2LQG A;  5L3V A;  2IXM A;  4U5F E;  1RKC A;  2YWA A;  1VK5 A;  2LFD A;  4YL3 A;  2CNW A;  3BEH A;  1WWP A;  4P9T A;  1UFB A;  4JTA B;  3V5Y A;  3SP1 A;  1TWH A;  1ZHW A;  3NMK A;  4LAC B;  3J06 A;  4JW1 A;  1H9T A;  5KYU A;  2I8B A;  1B68 A;  2L6G A;  4PK4 A;  5L0F A;  2Q4F A;  3HKK A;  4LLE A;  3DAF A;  4U5H A;  4C3E A;  1R5I D;  5EHH A;  1D1C A;  3ZQY A;  2KYH A;  3FHD A;  2MYS A;  4R32 A;  4U5E E;  1MQV A;  4WGZ A;  5DVW A;  3LES A;  3QW0 A;  4MVZ A;  4E0H A;  4U9E A;  3V7O A;  5B3I A;  5E3C A;  1D0Z A;  1RJ9 B;  3AQC A;  3AGU A;  4CJG A;  3IQ6 A;  2DB4 A;  1Q0D A;  3KL4 A;  1LKX A;  5L0D A;  3G4X A;  1WTY A;  5L3Q A;  3N2Z B;  5JLI A;  4U5B E;  4M63 A;  2NUT A;  3ZTM A;  3DE9 A;  2GFH A;  1CGN A;  3KPH A;  4IB4 A;  1O3U A;  2XL4 A;  1V74 B;  1T6Q A;  2A1D D;  1U89 A;  2B0J A;  3K7D A;  4ANJ A;  5EGY A;  3AJM A;  4JTC B;  4CS7 A;  2OKU A;  5DLJ A;  4U5C E;  1W2W A;  2OCC C;  4MW8 A;  3JT1 A;  1OW6 A;  3C8Z A;  4I1M A;  2GA0 A;  4J32 B;  3EHM A;  3HTK C;  3IEE A;  4MTF A;  4BJ6 A;  2A68 F;  3ZG1 A;  5L0G A;  3I5Q A;  4G7H F;  3VF0 A;  3QZC A;  1M57 C;  2J9U A;  5D91 A;  2Q9B A;  1ST6 A;  2WVN A;  4YT4 A;  2Z15 A;  3IHU A;  1IW7 F;  3NYL A;  4HFF B;  2V26 A;  1UG7 A;  2J0W A;  3EFO A;  2C03 A;  1FTS A;  2EPL X;  3W2V A;  3H65 A;  1OKK A;  2HJ3 A;  2W9Y A;  4DVZ A;  1TWA A;  4OIQ F;  2HSQ A;  1CPQ A;  2GWW A;  4GEH A;  5KYY A;  2X51 A;  3RKO F;  1G4W R;  2PNO A;  3KYJ A;  4JTD B;  1Q0K A;  1U0B B;  3OA1 A;  5E33 A;  2HSB A;  5A6B D;  2G3K A;  3NRH A;  3FXH A;  2EIL C;  4K7B A;  1A7E A;  1Q0F A;  2PX3 A;  3B0U X;  5JT4 A;  3T6J A;  4CDA A;  1NFO A;  1NU7 D;  4BJ5 A;  4XPY A;  1Z23 A;  3Q6N A;  2ZXR A;  5AC5 A;  2YQY A;  1V54 C;  3DWW A;  1JRA A;  2BE5 F;  3HNJ A;  5KYX B;  3TOL A;  1CGO A;  1ORJ A;  2VH3 A;  2VC9 A;  3F46 A;  2HV7 A;  3LEV A;  2XRH A;  4C3B A;  1T01 A;  1N1C A; 
#chains in the Genus database with same CATH homology
 2IYL D;  4CSA C;  2YZS A;  4EWC A;  1MMA A;  1TR2 A;  4XLP F;  3EGD A;  4AK9 A;  5KYX A;  3N0T A;  2R7X A;  3AG2 C;  3K33 A;  3AQB A;  2VB6 A;  4C7O B;  4CS8 C;  4I1O B;  2OG2 A;  1OCR C;  3DAG A;  3S0X A;  3FDQ A;  3B0P A;  5HSW A;  1S7Z A;  2IXP A;  2J9V A;  4RDA A;  2XSE A;  3SZR A;  2YEV A;  3EG9 B;  2A6E F;  1ZHX A;  4MND A;  1TWG A;  3ECS A;  3K1H A;  4F4B A;  2WB7 A;  3EG9 A;  3EPV A;  4OD4 A;  4BJ1 A;  5FCL A;  4B6I A;  4W8K A;  1PD0 A;  1OCO C;  3B0U X;  3ABK C;  3FVY A;  3ZSU A;  4ZLC A;  4JVS A;  3VAY A;  2CNW D;  2P6V A;  3W2W A;  4AE4 B;  4J30 B;  2R7O A;  2NUP A;  2DGJ A;  4O7G A;  5IY5 C;  5DS4 A;  4RD9 A;  4AE4 A;  2W45 A;  5DQT A;  3S28 A;  3WG7 C;  4ZLD A;  4IWB A;  2KJG A;  2EIJ C;  1ZYR F;  3KKB A;  4YN0 B;  3TD7 A;  2Y39 A;  2V3C C;  4GYT A;  2M4E A;  4E7S A;  2NUT B;  2J0X A;  2L9J A;  3L34 A;  1OCZ C;  3K1I C;  5B1A C;  3NG1 A;  1BR2 A;  4E7Z A;  4CS9 A;  3ZIB A;  2W4B A;  2LSE A;  4CSA A;  5DS5 A;  4JZA A;  4KI2 A;  3Q6M A;  3NYM A;  3EQL F;  4JUR I;  1MMN A;  2E87 A;  5KYW B;  3W8I A;  1QZX A;  4BG0 A;  3EGX A;  1VYK A;  2IXO A;  3KMI A;  3PHF 2;  3WOD F;  2L81 A;  2Y3B A;  3EFO B;  3UGP A;  4CS8 A;  5KYW A;  1NZE A;  4YWQ A;  2J45 A;  3NKD A;  3O6X A;  2DYS C;  4AX2 A;  2WL8 A;  3UMK A;  5KYY B;  2YHS A;  1OKK D;  2CW0 F;  2CGE A;  4U5D E;  3K66 A;  3EZH A;  1ZU4 A;  4IJJ A;  4WJ0 A;  3L0I A;  2C04 A;  1PD1 A;  3PMR A;  2ZXW C;  1TKN A;  3DJU B;  1M2O A;  1O5H A;  3EH1 A;  3UGO A;  3POV A;  4RBN A;  3I4U A;  2R7Q A;  3UMH A;  4HE8 D;  4G7O F;  2PP4 A;  2R7T A;  3DM5 A;  1Z5Z A;  4Q7C A;  4FWV A;  1MNE A;  4PFO A;  1NU9 C;  3JRT A;  4KBL A;  2ZPA A;  3MLG A;  2R7S A;  3EGD B;  2J7P D;  4BEJ A;  2R7R A;  4XLN F;  3EH2 A;  3EHN A;  3E70 C;  4U5G A;  4PJM A;  4PJJ A;  3AG1 C;  3SNH A;  3LNR A;  2W4M A;  2Y69 C;  4C3D A;  4YT2 A;  2IXN A;  2WVO A;  1ZHZ A;  3B9Q A;  3DJN B;  3LLI A;  3M1C B;  2HV6 A;  3KH2 A;  2Q3T A;  3LS0 A;  1TWC A;  4JJG A;  2O9X A;  1Z6A A;  3E9V A;  4JCH A;  2KQ9 A;  4FES A;  2WVQ A;  2Q9C A;  1D0X A;  3I5P A;  3MX3 A;  4O6N A;  2HV7 A;  4XWJ A;  1O87 A;  4YT5 A;  4I44 A;  4Q4Z F;  5CI9 A;  4DVY P;  1M2V A;  2DYR C;  1FMW A;  4YT8 A;  2PFD A;  3CQZ A;  1LS1 A;  4LER A;  3S27 A;  2H7B A;  2KNH A;  2EIM C;  1FMV A;  5F5F A;  1D1B A;  3DZA A;  3EZI A;  3RFY A;  2NUP B;  3EJN A;  2R7V A;  4PFP A;  4H4K C;  2XXA A;  4CBE A;  2J9W A;  3RH3 A;  2R7W A;  3B0V C;  4QI0 A;  3W8H A;  1SF8 A;  3UNG C;  4OD5 A;  2MWQ A;  3CSK A;  3AG3 C;  4KNW A;  3ASO C;  1QLE C;  4X0R A;  1MND A;  1Z3I X;  1JPN A;  4FX5 A;  3HLZ A;  2FFH A;  3CZ6 A;  4OIN F;  1MMD A;  1VMA A;  3DD7 A;  4Q5S F;  5BUO A;  4OIO F;  1FFT C;  4JJF A;  3DM9 B;  4O6Y A;  2KW3 C;  1KU2 A;  4EBB A;  4HEA J;  3JSZ A;  3RIP A;  3EGX B;  3JCU Q;  3ITF A;  3F47 A;  2NG1 A;  1WGW A;  1D0Y A;  4IRU A;  5T3T A;  4XTK A;  2Y3D A;  1ZU5 A;  3S29 A;  4CS9 C;  2VAS A;  2PF4 E;  3LAY A;  3X1O A;  1V55 C;  2QTV A;  3Q7L A;  1RJ9 A;  1J8Y F;  3ABM C;  4G0H A;  1Z63 A;  4A2N B;  1BR4 A;  3RYL A;  3LLK A;  4I3M A;  1OCC C;  1FFH A;  2EIN C;  4O6M A;  1JPJ A;  3QMK A;  3HJC A;  4NY3 A;  4YJW A;  4ULW A;  3AG4 C;  4QDL A;  5E3A A;  5CI8 A;  1PCX A;  2KGO A;  1VOM A;  3NKE A;  3OEO A;  4P6I C;  5D92 A;  4PJN A;  2D5R B;  1VYI A;  2Y3G A;  2Y3H A;  4BJT A;  1ZHY A;  2ZXO A;  1LVK A;  2A6H F;  2CDQ A;  4OIR F;  3ASN C;  3ABL C;  3OWT A;  4HFK B;  3FAJ A;  4KC9 A;  2A69 F;  5E2Q A;  3NYJ A;  3X2Q C;  5DS6 A;  4O79 A;  3JYH A;  3SEO A;  2QY9 A;  4DOZ A;  3GOD A;  3DMD A;  2H7V C;  4K0D A;  2IOQ A;  3ZC4 A;  1NG1 A;  1M56 C;  3T6B A;  3NDB B;  2H7O A;  2WZF A;  4KNV A;  4DBR A;  1M2V B;  1SMY F;  2EIK C;  1J8M F;  5T1D B;  5B1B C;  4QI2 A;  1IZM A;  4BJ6 C;  3LS1 A;  2WZL A;  4IAO A;  3VYW A;  3T4R A;  3O39 A;  4CIH A;  1G8X A;  4C7O A;  3LJB A;  3UR3 C;  2P7V A;  1BR1 A;  2XXA B;  4LLC A;  4DBQ A;  2J46 A;  2R7U A;  2WZG A;  5F5H A;  4OIP F;  3N24 A;  2G62 A;  3K6B A;  3Q7G A;  1ZHT A;  4MQ9 F;  1D1A A;  2PX0 A;  2ZXP A;  3DXJ F;  2G3V A;  2JD3 A;  4BJ5 C;  5B3S C;  2FGY A;  1MMG A;  3SYN A;  1SZI A;  4N06 A;  3ZVR A;  4PJL A;  5T3W A;  2Q9A A;  3UMI A;  5KYU B;  3GAN A;  5DQZ A;  5L3V A;  2IXM A;  4U5F E;  1VK5 A;  2CNW A;  3SP1 A;  1TWH A;  1ZHW A;  4LAC B;  4JW1 A;  5KYU A;  2I8B A;  4PK4 A;  4LLE A;  4C3E A;  3DAF A;  4U5H A;  5EHH A;  1D1C A;  3FHD A;  2MYS A;  4U5E E;  5DVW A;  3LES A;  3V7O A;  5E3C A;  1D0Z A;  1RJ9 B;  3AQC A;  3KL4 A;  1LKX A;  5L3Q A;  3N2Z B;  4U5B E;  4M63 A;  2NUT A;  2GFH A;  2XL4 A;  2A1D D;  2B0J A;  3K7D A;  4ANJ A;  5EGY A;  4CS7 A;  5DLJ A;  4U5C E;  1W2W A;  2OCC C;  3JT1 A;  4J32 B;  4I1M A;  5KYN A;  3EHM A;  3HTK C;  3IEE A;  4BJ6 A;  4G7Z F;  2A68 F;  3ZG1 A;  3I5Q A;  4G7H F;  3QZC A;  1M57 C;  2J9U A;  5D91 A;  2Q9B A;  1ST6 A;  2WVN A;  4YT4 A;  2Z15 A;  3NYL A;  1IW7 F;  4HFF B;  2V26 A;  2J0W A;  3EFO A;  2C03 A;  1FTS A;  3W2V A;  3H65 A;  1OKK A;  4DVZ A;  2W9Y A;  1TWA A;  4OIQ F;  4GEH A;  5KYY A;  2X51 A;  3RKO F;  3OA1 A;  5E33 A;  2G3K A;  3NRH A;  2EIL C;  4K7B A;  2PX3 A;  3T6J A;  1NU7 D;  4BJ5 A;  1Z23 A;  3Q6N A;  2ZXR A;  1V54 C;  2BE5 F;  5KYX B;  2VH3 A;  3F46 A;  2J7P A;  3LEV A;  2XRH A;  4C3B A;  1N1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...