1K05A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
135
structure length
135
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 57
structure length 135
sequence length 135
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k05A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k05A02
4XEKA 1K04A 3U3FA 3AE2C 3AJMA 1K40A 3AEDC 4EBKA 1ZOYC 1UFBA 3AE9C 2Q00A 4R32A 5F28E 4YTPC 1WWPA 2HSBA 1YQ3C 1ZP0C 3K7DA 3MFNA 3C8GB 3AE1C 2JX0A 1PV3A 3JZ0A 3RQFA 3AE7C 3O10A 3L8JA 3TULA 3C8GD 3SFDC 4XEVA 3AE5C 3S9OA 1KNYA 1QVXA 2LK4A 2L6FA 1OW7A 3AEEC 2G3AA 3GM3A 2H88C 4NQFA 2H89C 4EBJA 3AEBC 2JPUA 2YWAA 2FBWC 2L6GA 1OW6A 3AE3C 3AEAC 1WTYA 3B71A 3RQGA 3C18A 4XEFA 3AE4C 3AE6C 2L6HA 1K05A 3AEFC 1KTMA 3L8IA 3C8GA 2PBEA 3BRJA 3ABVC 1V4AA 3SFEC 2KK1A 2WQYC 4YXDC 1O3UA 1JOGA 3U0CA 3JYYA 1OW8A 1WOLA 3RQEA 3AECC 3GM2A 1YQ4C 3AEGC 3AE8C 3GM1A 1ZZPA
chains in the Genus database with same CATH superfamily
3P32A 3KPHA 3AE2C 4JBZA 1U7MA 3JC22 2LD6A 4HFFB 2WB7A 1SYQA 2OG2A 4BRYB 1PD1A 1VYKA 2QTVA 2G8YA 2Z4EA 2PX0A 4G7HF 1GW3A 2ZYGA 4GODA 2QEXP 3MHVA 2VCCA 2YHSA 5T3WA 2NRGA 3HD7B 2IZ1A 5JUAA 4RJTA 4EKWA 2K37A 3RF3A 1SP4A 1LS4A 2W4MA 4D4NA 1D1CA 4AE4B 3S4RA 1ORJA 4LERA 1SQVK 4BJ6A 2YMYA 1PGOA 5APTA 1HMDA 1BE3G 3CXHI 5F5FA 2NSFA 3NYMA 2C9NY 4QDLA 3SFDC 2YO2A 4J7TA 2Q3TA 3UR3C 2OYHC 5A6JA 1J2JB 5DQZA 4U5HA 4CIHA 4H44B 1S7ZA 256BA 2IPPA 1ZR2A 1A02F 5AW6B 3GM3A 2Q9CA 2V7QJ 2GWWA 4MVQA 4BJ5A 3CMEP 1URQB 1OXZA 1EDJA 2A45I 5C39A 2ZJSE 1R8EA 3ZTMA 2FY8A 3KHUA 4I1LA 3QTHA 4OGQB 5DJTB 3BRTB 1VQ4P 1NTMK 4MS2A 1PD0A 2RKLA 1JY3P 1TWGA 2RD9A 1T6UA 1SFCD 2C04A 1JY2P 4MNDA 3WMM0 4HH2A 3RYLA 4E17A 4P6IC 1K05A 1SQXJ 1Q7YQ 1EZVD 1IO4A 1CGOA 2PBEA 3TJ5A 3L71E 3M15A 3HUSB 4CDAA 1E2XA 4XPXA 4IL6H 3RK3E 1OW8A 3RVZA 1MFZA 3B0VC 2IBZG 4Y28J 3WG7C 2CW0F 2XM0A 4PV1D 1QSPA 4U3FD 2ZVOB 3HE5B 4NC3A 4K1OA 1QX8A 3W67A 3OA1A 3Q7LA 4AYCA 2FFHA 2XL4A 1DX7A 3H1JG 3W68A 1X22A 2JJLA 1E86A 4D6TG 1FZAA 2Q00A 3V4QA 3ABKC 3DMDA 4CSAC 1LT1A 4R32A 1SQQJ 4YTPC 2NUTB 1SZIA 3EJNA 4LDRA 3NKDA 4JJGA 3E7KA 1FJKA 5JLIA 2G3KA 2X0CA 3SWKA 2Y9YA 3Q5SA 3RL0g 2KGOA 3M4CA 2OYHA 3ZQYA 2Z5HA 3E1IA 3LJBA 3IQTA 5D92A 2B0JA 3A0BH 1JNMA 4IRUA 1JMMA 2LR2A 3O10A 3RKOF 1RHZB 3M1CB 4CS9A 3PMRA 2KYVA 1GK4A 3JSZA 1SQXD 1GD2E 2O9XA 3TYYA 1VQKP 1S5LH 3HNKA 3V2QA 3MUDC 5HSWA 3HNLA 3M9QA 4I6MC 5L0DA 2FYNC 1TWHA 1USDA 3UIAA 3A0HH 3DAFA 2FYUD 2KXPB 3B0PA 4PR9A 2E87A 1CI6B 2GDCA 3KYQA 4E18A 1L0LD 1GL2D 3LW5H 3SXMA 3L75G 2M4EA 1FU1A 5E3CA 3MIWA 3SYNA 3BVHA 3G50A 2A69F 3AE3C 1EDLA 1USEA 1BSHA 1M8OB 2Q7RA 3KDPB 3FX0A 1VQ5P 2W9YA 5L0JA 1BE3J 3OAKA 3T9OA 4DOZA 3S90A 2L6HA 1LT9C 3QVYA 4H44C 4MTOA 1OVRA 3BASA 3JTLO 1NYHA 3H1ID 3FAJA 1AQ5A 3EG9A 3TF5A 3TQOA 2KK1A 3MX3A 5JVEA 2IYPA 2HG5D 2XS8A 4PD4D 1J1DB 2BC5A 2J5UA 3K6BA 4DBRA 3K1IC 1YA7O 3RQEA 1A41A 2JWDA 2QJYB 1VQ7P 4YN0B 4HE8D 5L0HA 1VPCA 3AE8C 1V55C 3H1LD 1OVVA 2XZRA 4CSAA 2ZXRA 2C9LY 3F89A 4EOTA 3GODA 4IAOA 5B5EE 1LTJA 1NTKJ 1LTIC 2AXTH 3DM5A 1LTSC 3QW1A 3FHDA 4NPDA 3A9CA 3EHNA 4Q4ZF 2Q5UA 2R5DA 4G78A 4W8PA 3WHNA 1GL2C 2H7HA 1FZEA 2M64A 2KSFA 2LIGA 1BGYE 1KILC 1N7SC 1JCCA 4EYYQ 3ASOC 2FYNB 3MYIA 3M9BA 1S05A 2Q7CA 4N3YB 1NVOA 4I1OB 3U8VA 1M1JC 2IBZE 2YXQB 3CWBG 2P58A 4MW3A 1E83A 4E0IA 5T1DB 4HKZH 2ZT9B 2Y3BA 3ZDMA 1URQD 1YYCA 3U1CA 1URQA 2GFHA 5B3IA 4H0LD 4JEBA 4JPZB 3JCUQ 1S5LE 1I4ZA 3CC4P 1SQQK 3DAGA 1VF5C 1SQXG 3NKEA 2M3EA 1LTJB 2PP6A 1NJIQ 4NY3A 1KC8Q 2J9UA 4F4BA 3CXHH 4JKVA 2J0XA 1LI5A 1X9VA 4DJGA 3T6GB 1KU2A 1TQGA 1M2VA 3D70A 1BGYD 3GEEA 1GS9A 2CDQA 2DW3A 1RJ9A 3RL0C 2R7TA 2ZYDA 5CCGC 3LEOA 4XEFA 3L72D 4E7SA 1E85A 2ETSA 1EQ1A 2WSFJ 3VYWA 3CCLP 2IXMA 4GT1A 4PJNA 3L71D 1NTMG 2N1TB 4JTAB 3S29A 4YL1A 2ASRA 2HV6A 3L74E 1KD1Q 2KC3A 1EZVI 3GANA 4OD5A 3VP9A 1Q86Q 3JYYA 2OCCC 3CWBE 2E74D 2JEEA 4PJ0H 2KOGA 1N7SA 2VH3A 4NPFX 2XSEA 4U9DA 1RKCA 2I1JA 3HE4A 4U3FG 3L1MA 3C8ZA 4CS8C 3C8VA 3TDKA 1KZUB 3KQGA 4XQ1A 1D1BA 1M2VB 3PCVA 3V5YA 1GMJA 2XRHA 4O6NA 4NPEA 1EXJA 1BE3E 2O1JA 3N24A 3SWYA 3RIPA 2ZD9A 1GM5A 1KB9I 3G4XA 2W27A 3RL0D 1FJPA 2V4HA 2RMZA 3JT1A 2J45A 2ZYAA 2HFIA 5TJHA 1PCXA 5BQGA 2WSFH 3I56P 5L8RJ 1A02J 1EI7A 3QMKA 2EPNA 4IFFA 1D0ZA 2XLMA 2PFXA 1JTHB 2AEJA 3L8JA 3P8MC 3N2ZB 2QM8A 4W7ZA 4XTKA 1GK6A 1LE4A 4KHXA 2J9VA 3HTKB 2QJKC 1WGWA 3H1JE 3BEHA 1OCRC 1CPQA 4H4KC 2R7OA 2H7VC 3L75D 2FYUG 1ST6A 2A06D 4IFMA 3EG9B 2P61A 1WATA 1FAVA 2WT7A 3S1KA 1Q0GA 5JT4A 2C0WA 2YKQA 5AC5A 2P1JA 1P84D 3G71P 3CCQP 4PJ0E 4JIOA 1OR2A 2LSEA 1SQPJ 1LTAC 4FWVA 3D6YA 1W2EA 2OYIC 1R4TA 1SF8A 3P8CE 1M57C 2XM4A 3NTNA 1KV4A 2WPRA 1YI2P 1ZMEC 1KTMA 4XA4A 5JP7A 1RE4A 3B5NA 2Y0DA 1T6IA 3OA7A 3CCRP 2HUJA 3BRJA 1IW7F 1VTMP 4U7JA 1SQVD 1AA0A 5JSLA 1KILB 5CI9A 1DD4A 3H1LG 2C03A 3RW0A 2XLHA 4MQ9F 2R7QA 2ZVNB 2FYZA 3M91A 5KKZC 1VQLP 3GF7A 4OINF 5L3VA 1Z7Qc 3EZIA 4MVOA 1G4WR 1G2CB 2KQ9A 3CEXA 2R7WA 1M7LA 4BEMJ 1LKXA 1JUNA 2JP3A 3B29A 1P84E 3PDMP 1K9MQ 4R4LA 1BSNA 4PV1B 3D6ZA 4M3LA 4LLCA 3L73J 2ZAEB 1OIPA 2O3JA 5H2FH 2HS5A 2A0BA 2QE9A 1LTJC 1EC5A 2A06E 3L35A 2E5YA 1JOCA 2FAPB 1HVVA 1VDFA 5DS5A 2JX0A 5F5HA 3WU2H 1IFJA 3H1HG 1FBMA 1X79B 1RQVA 3WODF 5AVWB 4BJ5C 4PD4E 2HJ3A 5A6AA 2EPKX 3KL4A 4I1MA 1M57D 4DCKA 4EI2A 1VK5A 5APQA 4Z9IA 2LXCB 2QA4P 1YLMA 3A5TA 3LEVA 2YRFA 5EK0A 1R5ID 2K3RA 1GU5A 1ZN5A 2EPOA 2VCBA 1ZYRF 1ZVZA 2AWYA 2EIMC 2A0UA 3TGUD 1NBBA 3TGUE 5KLIC 1BDCA 1JY2O 1SQXK 3SZRA 3BCCD 2CNWA 4BEJA 1FS0E 1L0NE 2N9YB 3CCVP 4YPCA 1OXBA 1AJYA 4RD9A 2RN0A 3LIEA 3C1LA 1MQVA 4YT4A 1AFOA 2KSEA 4DRJB 1KB9H 4JVSA 5DJUB 2BASA 3FGAD 1ZW3A 2WVNA 4AL0A 4C3DA 2HODB 5COMA 2M8RA 3L74J 1Z63A 3C8GA 1V4AA 2Y0CA 4KI2A 2YL7A 5KLVE 4PV1C 4YXDC 5GTHH 2XS1A 4YWQA 1ZHTA 4AUWA 1SVFA 1FFHA 1YQ4C 3O8ZA 4D6TE 2QY9A 2OQMA 2KLUA 5DQTA 4XEKA 2B87A 2Q6QA 5EHHA 1H0TA 3BCCG 1ZOYC 3PLNA 4BWNA 4PFOA 2J46A 2D5RB 3CPWO 3AE9C 4CS9C 4GYTA 1EZVE 5AW2B 1L2PA 1OWAA 5APSA 2GAQA 3NG1A 4XPYA 3O55A 4IAQA 5BU8B 4YK5A 1JY3N 2HODA 1QZXA 5B3SC 1NU9C 2KSJA 2W45A 3C8GB 1LWUA 5KLIB 3L72G 5AW7B 3NMKA 4YL3A 2P2UA 1AEPA 1NTZK 3C8GD 3N4XA 4ZKUA 4JYBA 3K5BA 4LGDE 1ZR4A 2IBZD 4U5FE 1S1CX 3LNMB 1KB9E 2ITAA 1QGKB 1BR1A 1PPJG 2ZPAA 4DOJA 2UUHA 3D71A 1NLXA 4QI2A 4MVUA 4LLEA 3VMXA 3G3ZA 3PTZA 4LC1A 1PFIA 2N9BA 3AEEC 3B5NB 2PAJA 2FGYA 1KYOD 2R7UA 2A06G 5CJ0A 1SQBE 5APXA 3M79A 4NQFA 5GTIH 1IJDB 2JPUA 4MW8A 2WL8A 2L6GA 4IOIH 1Q90D 2R7XA 4U5DE 4H13C 4ZMDA 2AXCA 4MN4C 3EGXA 5HV9A 1RKEB 2HJMA 5TISE 2LKMA 2Z15A 4IL6E 3HD7C 3FDQA 2LCHA 2WMMA 3H1LJ 2OARA 2W6BA 4HB1A 3RK2D 3QH9A 4W7YA 2LQGA 3FAPB 4CIPA 4L76A 3AEFC 3WUUA 1FC2C 1LJ2A 2GA0A 5E3AA 3X1OA 3HJCA 3DXJF 3VMAA 3G6EP 1EZVG 1S2EA 2KNHA 1ZRTE 2YO3A 1N7SB 5APWA 3Q6NA 1BCCE 5AVVB 2KW3C 3RBZA 3U0CA 1X0TA 2OYIA 3PRJA 5B1AC 1L0NG 1QEXA 1G1IA 2JKVA 2AEMA 4GIFA 2QNLA 1LM3B 1CGNA 3AEDC 3FWNA 3X2QC 4MVMA 3UNGC 5KYWB 1KMIZ 1MMDA 2PNOA 1M2OA 4P9FA 1URQC 3HE4B 1LIHA 2Q3IA 3K1HA 1H9TA 3O39A 3MP7B 1MMGA 3H1KG 1VYIA 1L0LJ 5KYYA 1LPEA 2OJED 3CX5H 2YL3A 2XLDA 2GUSA 1NAYA 4XWJA 2W83C 4WY4C 1FFTC 4CDYA 5AVYB 1H89A 4GEHA 3ABMC 1SQVJ 2FYUE 3Q1MA 4U5GA 2BE5F 4WJ0A 3U59A 3KZIE 3W2VA 5E79H 1Q0DA 1KN7A 4DRHB 2IXOA 2E75D 2YZSA 2NPSB 5KLVJ 4OH8B 5H2FE 4OIOF 3A2AA 3II6A 3W4YA 2QE7H 1Q0FA 4L75A 3H2UA 4FX5A 2YKOA 1BR4A 2SPZA 2HLOA 1ZV8A 4C46A 1GZLA 1N8RQ 2FBWC 2V7QH 3AEAC 2WSCJ 4PACA 4B6IA 2I1KA 2A1DD 2R3CA 1Y4CA 1KYOE 3KYJA 4EHPA 1K73Q 3V2RA 4PJLA 5DS6A 2KIKA 1WN0A 1SFCA 3DKAA 3P7KA 3GG2A 2ZT9D 1RF1B 2I8BA 2Q9BA 4CS8A 1RCPA 1LI7A 1YYJA 4IWBA 4KC9A 2OTKE 1SQXE 4UB6E 5CBOA 1FAPB 3P8CD 2M5AB 3WUVA 1L4AC 3Q2YA 1RMVA 3AEGC 1G2CA 1J1EB 1YTZT 4WY4B 1NHLA 1NTZD 2OTJP 4JF7A 3U1AA 1T8ZA 4H44D 5AVSB 1YJWP 1SMYF 1Z5ZA 5CCHD 5APYA 3L4FA 4OWFA 4NTAA 1JMBA 4KT0J 4ULVA 1U0BB 3H1HE 2I8DA 4Y99B 2PRRA 3LS0A 1KQSO 1T01A 2Y39A 4JW1A 2WSSH 5AVUB 1L0NJ 1OVUA 2J9WA 2RSEB 3K66A 4UDVA 3GLMA 3KKBA 1AVOB 1YAUO 2J8WA 2W8ZA 5GTHE 2XNDH 3IFMA 2XL8A 3L70D 4FESA 4I7ZC 3C63A 1QLED 2BCCJ 1JAFA 1A0BA 1EKYA 1KQGB 3H6PA 3HD7D 5BUOA 2M5AA 5K0IA 2XDJA 2XNXA 1RKEA 5DLJA 1S9KD 1AUEA 2UWJE 2YIUC 5BU5A 5CBNA 2MHRA 3H1KE 3C62A 2L6FA 1YTZI 2YLGA 3DD7A 2EINC 3GORA 4N6HA 3TGUG 4ZLCA 1BGYJ 4PFPA 3VTPC 1CZQA 2K9JB 5TJ5E 4U5BE 1HE1A 2ZXOA 3H65A 3HTKA 1N73C 1FZFA 1NTKE 1SQPE 2V26A 4CJGA 1L4AD 3JCUE 2AP3A 1N86A 3B71A 1AVOA 2X51A 3C18A 1KILD 3VN0A 1C02A 2WT7B 1NTME 3CCSP 4HYTB 4IB4A 3EHMA 1VQMP 1XTCC 1H7IA 3L70E 1G8XA 3W8HA 4WWIA 1J8YF 3ABVC 3H1HD 1HW1A 3VF0A 1ORSC 3IN6A 2CCYA 2WSEH 1SQBK 2N1TC 5E33A 1OKKA 1H8AA 1NAFA 1VQ6P 3Q7GA 4G7ZF 3HD7A 3FWLA 2A6EF 1M1KQ 2NPUA 1YBKA 3H1IE 3U8PA 2UUIA 4O9BA 1OCOC 2E74C 5GPGB 3A3YB 3G4SP 1K40A 1RF0C 3BATA 3O6QA 3NXSA 4C7OB 1SR2A 1Q82Q 2BEZF 2W6JH 3V4WA 2Y0EA 3KPEA 2WTYA 3V6IA 2ZXPA 3LUTB 3U3BA 2FXPA 1MNDA 3L73E 1JM0A 2AXTE 3LW5J 1MV8A 3MTUE 3JRMO 4CPGA 4QI0A 1IK7A 4O79A 2E75C 1ZHZA 3MD0A 5L0IA 1GU4A 2IM8A 3DE9A 5CJ4A 1L4AB 1NU1D 2A68F 4RDAA 3V2NA 2D2CC 1NTMD 1JRAA 4C7NA 3T6JA 1PGJA 2KUBA 3IQCA 5KYUB 1D7MA 3JZ0A 1DD3A 2Y3GA 1YHQP 3CC7P 3HUSC 3AE5C 2QJPB 1IFMA 4NTBA 2YXRB 3L70J 4JTCB 2P67A 3CX5I 1N1CA 3RH3A 2KK7A 2WWWA 1FZBA 1FMVA 1QKRA 3ZWIA 4AL1A 1OW7A 1ZXGA 2B89A 4GDOA 1SQBG 4J7YA 3ABLC 4LDQA 4H54A 2G3AA 1S9KE 2AWCA 3B0UX 5L0CA 5TISH 3V5XA 3WAQA 4Q7CA 2J58A 5B66H 3HLZA 2R9RB 4G0HA 4J32B 3ZVRA 3QWOC 5AW0B 2HR3A 2ZXXA 3DZAA 3OJAB 1C03A 1NU1G 1OW6A 3AG3C 1UIXA 3EGDB 3QW0A 2W6AA 1Z23A 4RESB 2WZGA 1JMWA 1R5SA 3H1IG 3KZIH 2YL0A 3SP1A 4CDVA 3L71G 2JO1A 3JRTA 2BCCG 1HUCA 1Z56A 3ZDLA 1IFNA 3H1LE 5K5GB 4K7BA 1CSBA 3B5ND 1N73B 4WGYA 1Y8AA 1OCZC 3DM9B 3EPVA 3IQ6A 4Z9HA 1IFPA 2B9BA 4Z1MH 1MMNA 1O3UA 2HFED 2L9JA 3ASNC 1JTHA 4EIYA 1LP1A 3HNJA 5KYXB 1JOGA 2FFDC 5D91A 3SEOA 5EFWB 1GL2A 1VMAA 2EIKC 2YVKA 1O87A 4LLHA 1VB5A 1PIXA 1ZZPA 2LFDA 4EDFA 4YJWA 1SQQD 1VF5D 2Q1KA 3V5BA 2CPBA 5CCHC 4UB8H 2E5TA 3Q3DA 4I7ZB 3MYFA 1M1JA 5BQHA 1GW4A 1YITP 5AC4A 1EDKA 2L5GB 1NOHA 1T2KD 4WY4D 3PHLA 4O6MA 1YDIA 5BVZA 3AGTA 4MTGA 3GEHA 2E74B 1U89A 1LT9B 2K9JA 1MNEA 1ZHYA 2NG1A 1HGVA 2MYSA 3TNUB 1HF9A 1OXKA 1YA9A 2WVQA 2WZLA 3HE5A 5KAIH 3WU2E 3B8EB 2FYUK 3L73D 3LNRA 2CK3H 3VOPA 4PD4H 4OIRF 1NO4A 1KYOH 2IFMA 2HMQA 2OKUA 1PP9E 3IEEA 2MWQA 1NU1E 2K88A 1YZAA 4AK9A 4JC7A 3E1RA 4U5CE 3PH0A 1YVIA 4WGZA 3H1JD 1NTKK 4XFJA 4DVZA 2P1AA 4DT0A 1ZU5A 1HGZA 1JY2N 3S84A 5AVQB 2AEFA 4KNWA 1VQNP 4D4XA 2QJPC 4MVZA 1IC2A 3M9HA 4DRIB 2R7RA 3W8IA 2OOCA 3T6BA 3IAOA 2FFDA 1EQ7A 3ZIBA 5AGFA 1TR2A 5L0FA 2H8PD 1RF1A 2LFFA 4K3AA 2POHA 4X0RA 3T4RA 1CPRA 1QL2A 1QL1A 2L7AA 3KH2A 4EBBA 4XLNF 3EGXB 1LWUC 3GF3A 3A7OA 1G5ZA 1YJ9P 1GDTA 3CCJP 1SFCB 1FZCC 2C0XA 4U9EA 1VF5B 2KB7P 2O01H 1YARO 4A2NB 3CCMP 1J1DC 2R05A 1P84I 3LS1A 2IBZI 1NTZG 1FDOA 2XL6A 1G1JA 3B4SA 4EBKA 3N7NA 3L75J 2TMVP 3R7CA 3GWLA 1T6QA 2KZIA 1YZCA 2XKMA 4TLFA 3VYIA 2Q9AA 2KYHA 1FOSE 1BCCG 2H43A 3M0AA 4N06A 1HY5A 1JR8A 3FOPA 1VQ9P 3ITKA 3QZCA 4RBNA 2ZT9C 5KJ7C 4ZLDA 3FOOA 3LESA 3U2MA 4JCHA 1Z3IX 4IFDK 4RO0A 2J0WA 1NFNA 3RK2C 5KYYB 1VLTA 3EFOA 4MTFA 1RJ9B 4W8KA 2HZ8A 3G9RA 1ZU4A 2IX7C 2YEVA 1QVXA 3L73G 3JSEO 4ANJA 3FXDA 1WT6A 1S4XA 1U6HA 1DEBA 2L81A 4XPWA 4R4MA 1HMOA 4WB4A 2B87B 1E5WA 5A69A 1RF1C 3IHUA 1L0NK 3RGUA 3IQ5A 1N2DC 2NPSA 1YJNP 3MUDA 1SFCC 1GL2B 3JSVC 1FZCB 3NMIA 3H1KD 1NFOA 2B88A 1BR2A 3F5HA 3E70C 1EA8A 1J1EC 2BL2A 4YL0A 1BCCD 2K9YA 4AE4A 3GW6A 1L0LE 2R32A 3L71J 4I44A 1K8AQ 4C3EA 1Y9BA 4L73A 3CC2P 2P0NA 3N0TA 5JS5A 3PHF2 1OX3A 4WABA 1MFTA 5AVZB 3MZWB 3DI5A 4BJ6C 1NU1J 1FDIA 2B0HA 2NSGA 3L74D 2QJKB 1TU3F 1FE6A 4U5EE 3O6QB 1VLSA 1Y47A 1N7SD 4LACB 1JPJA 1LT9A 3A0BE 3WUTA 1K04A 3L75E 3U2LA 4DBQA 2WSCH 1Z6AA 3CXHD 3MBGA 3RK2B 3CXHE 1RQUA 2AU5A 2QVAA 4KNVA 1APCA 2NUPB 3Q5RA 3F46A 5CCGA 1WMKA 5KTBA 1S5LX 3C7JA 4MVRA 4C7OA 1P84H 4BJ1A 3CZ6A 1M90Q 1NTZJ 4H13B 2G3VA 1DIPA 1TKNA 1W2BO 4A7PA 1YQ3C 5GTIE 1TFOB 2VC9A 1WASA 5KYUA 1HE9A 2VCAA 2KI7B 3CX5E 3H32A 3DE8A 5EGYA 1I4YA 3VM6A 4N78D 5APUA 3ECSA 3FMSA 2IFNA 2WZ7A 1HTLC 3PP5A 1H88A 1PP9D 1I5NA 4ZNCA 3J06A 3TULA 1BDJB 3KMIA 3U9JA 4JRZA 3Q6MA 4ASVA 2OYHB 1BBHA 3GHGA 3EZHA 1D0XA 5CHXA 2CPSA 2W90A 3AG2C 5CCHA 4OGQD 1SLQA 3KXDA 1VOMA 3VMZA 3CL3D 3E9VA 3C9IA 2R02A 1HH0A 2DGJA 1OMIA 1V54C 1KORA 2HV7A 2LP4A 2LXBA 2QSIA 2MKVA 1U7JA 3NFQA 2HPCB 2VASA 2A45H 1ZHXA 1UG7A 2QUPA 5KYWA 3CD6P 3RVYA 2R3SA 1C17M 3RBXA 2O1KA 5CCGD 1YYXA 3W2WA 3I5QA 1XWJA 1RH5B 2O01N 5CMZA 2J7PA 2GUVA 4D6TD 2R44A 5E79E 1AV1A 5KLVD 1QVGO 4DZOA 3ZG1A 3EQ2A 1Y6DA 3AGUA 2BCCE 2ZXEB 2XXAA 5AW8B 3EGDA 4LDKA 1NZEA 3FVYA 3L8IA 1RF0A 1IFDA 4YT8A 4DVYP 3RK3C 1BDDA 1BE3D 3USSA 3SFEC 3L72E 2WQYC 2HSQA 3L0IA 1M56D 2E75B 5KKZB 1JO5A 4XLPF 1ZW2A 2R5BA 3GM2A 4A4AA 4CJOA 4DXWA 1AVYA 4TT3H 5JRAA 3EFFK 1Q2NA 3H1JJ 1OQCA 2HPCA 3SNHA 4PJJA 1SS1A 3M4BA 2J59M 3UGPA 5KAFE 3IR9A 2OQQA 4J30B 1EDIA 3ZSUA 1SQQE 1T6AA 1VQ8P 1ZHWA 1S72P 3KYIA 2KS1A 2YKPA 3CWBD 2E43A 1E84A 4OVNF 1JB0J 1ZP0C 2DI3A 2PF4E 2E76B 2XU6A 3CCEP 1KB9D 4N6CA 5B5EH 2V3CC 1X8YA 5M1BA 3CLQA 3HNIA 2E42A 2YKZA 1FOSF 1FZCA 2WVRA 3SWFA 2Q3EA 2A6HF 1QLEC 1TWAA 3QVZA 2WPSA 1PP9J 3TNUA 1ORYA 1L0LK 3O6XA 3NYJA 2YMKA 5KJ7A 1LE2A 2XLWA 3DJUB 1UIIA 3ZTZA 4M63A 5A6KA 5AW3B 5B66E 2NPSD 3AQCA 4KJMA 4C7RA 1CW5A 1HW2A 3RK3D 2ICWG 4CX9A 4JTDB 4U3FE 2IXNA 2KS1B 3NMJA 1HJ0A 2FFDB 2XLVA 3ZC4A 4OIQF 1SQBJ 2R25A 2IBFA 3ATPA 3V5ZA 3JYHA 3NYLA 3SXZA 3S0XA 3NDBB 4RKUJ 4UB6H 2Y3HA 3RQGA 2XLEA 1RE3A 1H0TB 3VMYA 2A45G 4WBAA 3L70G 1A7EA 2QIWA 3AE6C 4L6RA 1HBWA 2G62A 4E7ZA 2M3BA 2P6VA 4KBLA 2KNCA 1D1AA 4NTFA 3I5PA 1U57A 2VB6A 4W80A 1OZHA 1LNQA 1NWQA 1JY3O 4ULWA 1CGME 2IYOA 2P10A 2QJYC 3GMAA 1WOLA 2E76C 3L74G 1SQVG 4JQ0D 5DS4A 4UB8E 1J8MF 4OGQC 2IDBA 4BRYA 3SXKA 1LTTC 2YQYA 4E0HA 3U3FA 4H13D 2Y69C 2NZ2A 1RE4C 3B5NC 4N6JA 3OWTA 5KYXA 1KQLA 1L0LG 3H1KJ 3PJSK 3F47A 5KJ7D 1LVKA 5COFA 3LLKA 1NU7D 3B9QA 3RK3B 5AVXB 2OEXA 1T5OA 2RH0A 3EH2A 3S27A 1VL2A 5F28E 1YIJP 1FNTc 2HYNA 2HSBA 4PD4I 1M1JB 1BGYG 1GQAA 5FZTA 4OIPF 2OGUA 2CNWD 3TK1A 2QRXA 5IY5C 1RY3A 1PP9G 3K7DA 2D2CB 1QVFO 2N1TD 1FTSA 2N1TA 4JYCA 4NCQA 1PV3A 2O01J 1W5CE 1NTMJ 4H0LC 1OR3A 1DOWA 3CAXA 2D4UA 3AE7C 3AG4C 2CYDA 2D2CD 3CCUP 2ZFCA 3FXHA 3VRCA 1DEEG 1QQ3A 1T3JA 2EPLX 3JCUH 4BJTA 4FAPB 1NKZB 3CQZA 4N4WA 1RXQA 1T9KA 3EH1A 2YLIA 5CI8A 4WVZA 4DJ9A 2F22A 4YXWH 1KFMA 2EPMX 5KAFH 1SQBD 4IJJA 2HMZA 4ZKPA 1NG1A 5L3QA 1LWUB 2L91A 1FDMA 3U5SA 5T3TA 5AVTB 2PGDA 3LIDA 3TGUJ 3V2PA 3RL0B 2Y3DA 1YJGA 1NTKD 2W4BA 3I5CA 1WTYA 1SQPK 2QG4A 3H1HJ 1XZQA 2PP4A 3CX5D 2P7VA 3H2VA 1L4AA 3TJ6A 3HUSA 1LGHB 1XTGB 2OYOA 2KLVA 1ZRTD 3LLIA 2QM7A 3R2PA 5AW5B 1MKMA 5A6BD 3EQLF 3H1IJ 3CMAP 2DYRC 1PGPA 2GA1A 4P9TA 4IARA 2Y9ZA 3OEOA 4PJMA 2H7OA 4BG0A 3HKKA 3GM1A 1OKKD 2YL1A 1PPJD 2H7BA 4EWCA 3CWBJ 1PPJE 1LTGC 1IFIA 4C3BA 3POVA 3HRNA 2Z5IA 1G4US 3TK0A 4I2LC 1D0YA 2VRSA 1H6GA 5AW4B 3CSKA 1NSGB 1FR0A 4I3MA 3US6A 1MUUA 3K1IA 2FXMA 3R4YA 3FXEA 2WITA 2KJGA 4AQRD 4PK4A 4JE9A 3H32B 4HEAJ 1PZQA 3TOMA 4YT2A 3M0DA 1NTKG 1BZ4A 1ZLLA 2OYIB 2IXPA 4HFKB 2BCCD 1E79H 1SQVE 2FYUJ 3IPMO 3V7OA 4BPMA 2KZJA 3MFNA 1NTZE 1MMAA 1AQTA 5KLVG 3LAYA 4ER9A 1LTBC 5B1BC 2IZ0A 1A7DA 1L0ND 1W2WA 4XEVA 1FZGA 2PFDA 1N73A 3HTKC 3CI9A 2NPSC 1KNYA 1V74B 3DWWA 3ITFA 3ZQVA 3UGOA 2E76D 4ONSA 1LP1B 2IYLD 3IF4A 2LK4A 3SXYA 1KILE 1KYOI 1SQPD 1TWCA 4N78E 3AOUA 5A6BA 1JCDA 3L37A 3A0HE 2DYSC 3BCCJ 3AQBA 4O7GA 2KNCB 3GHGB 1PGQA 2OEVA 4XE5B 1H9GA 4MVSA 2H88C 1HJBA 3TD7A 5APVA 3U9MA 1CI6A 2YWAA 4IL6X 3MLGA 1IK9A 2XXAB 5BQIA 2WVOA 4GOFA 1Q81Q 4IGGA 1WRGA 4WY4A 4EIJA 4U3FJ 3SSUA 2R03A 3I55P 3A11A 1O5HA 1VQOP 1NKNA 3OW2O 3Q5PA 1NU1K 2J7PD 3UMIA 3T97A 1MZ9A 4JCZA 2EILC 2YNYA 2JR8A 1Q0KA 1PL5A 2KP8A 2R7SA 4K35A 1QPUA 4K0DA 4Z9JA 2WPVB 1RE3C 2YLDA 1FMWA 2YIUB 3EFGA 4HJGH 5KLVK 5AVRB 3VP8A 2Q4FA 3GEIA 5KAIE 2R7VA 2H8AA 4Q5SF 3M0DC 1KQFB 3AJMA 1IZNB 5DVWA 1TFKB 1S3JA 2OJQA 4H0LB 1SQQG 3BCCE 2DB4A 2JWAA 2P7JA 1UFBA 2OU6A 5KYNA 4EUKB 1DH3A 3NRHA 2JDIH 3RFYA 5E2QA 3H25A 4Y99C 1WWPA 3VAYA 4JZAA 3GHGC 2J9BA 1A7VA 2NUPA 3AG1C 3T97B 1OFCX 4AX2A 1B68A 2GM4A 4JURI 2M0BA 1LS1A 3AE1C 1GGQA 3TOLA 3NMDA 1KFNA 2OTLP 2WZFA 3M06A 3RQFA 1L3PA 1JPNA 2BEQD 2WSEJ 1M6TA 2K1AA 3S9OA 4D6TJ 3GWNA 4BXLA 2MJZA 5COGA 1OCCC 2XV5A 3L72J 2AVKA 1R5LA 1BCCJ 1DOVA 4CS7A 2QLAA 3L34A 2NUTA 4GOEA 3EWKA 2FKWB 2HKVA 1HWTC 1VQPP 1M56C 5CIVA 1SQPG 1NGMB 3L36A 2PX3A 2I15A 1IZMA 1EXIA 2H89C 2Q9IA 4YT5A 4EBJA 3AEBC 1N7LA 1T3UA 4G7OF 5AW9B 3UMHA 4L74A 1GTWA 5FCLA 3S28A 2JD3A 1T2KC 5L0GA 1KILA 3AE4C 4GQHA 2FXOA 1NH4A 4O6YA 4B86A 4JEAA 4CBEA 4GKGA 2XLOA 3K33A 2CGEA 2ZXWC 1Q0MA 1ZW0A 3TSIA 1XZPA 3I4UA 4JJFA 5AW1B 3BRVB 1L7CA 3G4ZA 2EIJC 1JEKA 2IOQA 3EFOB 3DJNB 3MGNA 4ASWA 3AECC 2WPQA 1F1MA 3UMKA 4C7NB 4QMAA 4OD4A
chains in the Genus database with same CATH topology
4PV1D 4XEKA 1FDOA 1K04A 1VF5D 1KQFB 3U3FA 4H13D 3AE2C 3AJMA 2NZ2A 1K40A 3O6QA 3AEDC 4EBKA 1ZOYC 3Q3DA 4I7ZB 1KMIZ 2BEZF 4H0LB 3C8VA 4H44D 1RQUA 2OQQA 3Q5RA 2G8YA 1GMJA 2FXPA 4KT0J 3LW5J 1WMKA 2JP3A 1S5LX 1UFBA 1EXJA 3R4YA 3AE9C 2Q00A 4R4LA 1IK7A 4PV1B 3H25A 3D6ZA 1VL2A 2E75C 4R32A 4H13B 5F28E 1DIPA 4YTPC 1WWPA 2HSBA 1JB0J 1YQ3C 1ZP0C 2E76B 3GLMA 2E74B 2D2CC 3Q5SA 3T97B 3RL0g 2ZT9C 3K7DA 3MFNA 2D2CB 5L8RJ 5M1BA 3C8GB 3AE1C 2ZT9B 2JX0A 1HF9A 1PV3A 2O01J 4I7ZC 3Q1MA 4H0LC 3JZ0A 3RQFA 3AE7C 1DD3A 3O10A 2BEQD 2WSEJ 4H0LD 3L8JA 3TULA 2D2CD 3C8GD 1KQGB 1RQVA 3SFDC 4XEVA 3AE5C 3S9OA 3G9RA 1KNYA 2E76D 1VF5C 1S1CX 2QJKC 1QVXA 2E75D 2YIUC 2LK4A 2FYNC 2YMKA 1KILE 4OGQD 2L6FA 3D71A 1OW7A 4GDOA 4R4MA 3EWKA 4H44B 3AEEC 1OMIA 1KORA 4XFJA 2QSIA 2MKVA 2G3AA 3GF7A 1NGMB 5KLIC 3GM3A 2V7QJ 1EXIA 2H88C 4NQFA 2H89C 4EBJA 3AEBC 2JPUA 2YWAA 1HJ0A 2FBWC 1AJYA 2QJPC 4IL6X 3D70A 2L6GA 1OW6A 1R8EA 1Q90D 3AEAC 3AE3C 2WSCJ 1UIXA 4H13C 4OGQB 1WTYA 4RKUJ 3B71A 3RQGA 3C18A 3IAOA 2K9YA 3D6YA 4XEFA 3AE4C 1ZZPA 2QIWA 3AE6C 2L6HA 3FGAD 3Q5PA 1Y9BA 2WSFJ 1K05A 4H44C 2JO1A 3AEFC 1ZMEC 1KTMA 3L8IA 3C8GA 1U57A 1NYHA 2PBEA 3BRJA 1MKMA 2ZT9D 3ABVC 1ZRTE 1V4AA 1PL5A 4U7JA 3GF3A 3IN6A 3SFEC 4PV1C 2WQYC 4YXDC 4Z1MH 1O3UA 2E75B 2KK1A 1DD4A 1FDIA 2P10A 1JOGA 2QJYC 2WPVB 3U0CA 1VF5B 1OW8A 3GMAA 1TU3F 2J5UA 3RK3E 1WOLA 2E76C 3JYYA 3RQEA 2E74D 3AECC 3Q2YA 3GM2A 1YQ4C 5KKZC 3AEGC 3AE8C 4OGQC 4Y28J 3GM1A 4TT3H 2IDBA 1PIXA 2E74C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEK A;  1K04 A;  3U3F A;  3AE2 C;  3AJM A;  1K40 A;  3AED C;  4EBK A;  1ZOY C;  1UFB A;  3AE9 C;  2Q00 A;  4R32 A;  5F28 E;  4YTP C;  1WWP A;  2HSB A;  1YQ3 C;  1ZP0 C;  3K7D A;  3MFN A;  3C8G B;  3AE1 C;  2JX0 A;  1PV3 A;  3JZ0 A;  3RQF A;  3AE7 C;  3O10 A;  3L8J A;  3TUL A;  3C8G D;  3SFD C;  4XEV A;  3AE5 C;  3S9O A;  1KNY A;  1QVX A;  2LK4 A;  2L6F A;  1OW7 A;  3AEE C;  2G3A A;  3GM3 A;  2H88 C;  4NQF A;  2H89 C;  4EBJ A;  3AEB C;  2JPU A;  2YWA A;  2FBW C;  2L6G A;  1OW6 A;  3AE3 C;  3AEA C;  1WTY A;  3B71 A;  3RQG A;  3C18 A;  4XEF A;  3AE4 C;  3AE6 C;  2L6H A;  1K05 A;  3AEF C;  1KTM A;  3L8I A;  3C8G A;  2PBE A;  3BRJ A;  3ABV C;  1V4A A;  3SFE C;  2KK1 A;  2WQY C;  4YXD C;  1O3U A;  1JOG A;  3U0C A;  3JYY A;  1OW8 A;  1WOL A;  3RQE A;  3AEC C;  3GM2 A;  1YQ4 C;  3AEG C;  3AE8 C;  3GM1 A;  1ZZP A; 
#chains in the Genus database with same CATH topology
 3P32 A;  3KPH A;  3AE2 C;  4JBZ A;  1U7M A;  3JC2 2;  2LD6 A;  4HFF B;  2WB7 A;  1SYQ A;  2OG2 A;  4BRY B;  1PD1 A;  1VYK A;  2QTV A;  2G8Y A;  2Z4E A;  2PX0 A;  4G7H F;  1GW3 A;  2ZYG A;  4GOD A;  2QEX P;  3MHV A;  2VCC A;  2YHS A;  5T3W A;  2NRG A;  3HD7 B;  2IZ1 A;  5JUA A;  4RJT A;  4EKW A;  2K37 A;  3RF3 A;  1SP4 A;  1LS4 A;  2W4M A;  4D4N A;  1D1C A;  4AE4 B;  3S4R A;  1ORJ A;  4LER A;  1SQV K;  4BJ6 A;  2YMY A;  1PGO A;  5APT A;  1HMD A;  1BE3 G;  3CXH I;  5F5F A;  2NSF A;  3NYM A;  2C9N Y;  4QDL A;  3SFD C;  2YO2 A;  4J7T A;  2Q3T A;  3UR3 C;  2OYH C;  5A6J A;  1J2J B;  5DQZ A;  4U5H A;  4CIH A;  4H44 B;  1S7Z A;  256B A;  2IPP A;  1ZR2 A;  1A02 F;  5AW6 B;  3GM3 A;  2Q9C A;  2V7Q J;  2GWW A;  4MVQ A;  4BJ5 A;  3CME P;  1URQ B;  1OXZ A;  1EDJ A;  2A45 I;  5C39 A;  2ZJS E;  1R8E A;  3ZTM A;  2FY8 A;  3KHU A;  4I1L A;  3QTH A;  4OGQ B;  5DJT B;  3BRT B;  1VQ4 P;  1NTM K;  4MS2 A;  1PD0 A;  2RKL A;  1JY3 P;  1TWG A;  2RD9 A;  1T6U A;  1SFC D;  2C04 A;  1JY2 P;  4MND A;  3WMM 0;  4HH2 A;  3RYL A;  4E17 A;  4P6I C;  1K05 A;  1SQX J;  1Q7Y Q;  1EZV D;  1IO4 A;  1CGO A;  2PBE A;  3TJ5 A;  3L71 E;  3M15 A;  3HUS B;  4CDA A;  1E2X A;  4XPX A;  4IL6 H;  3RK3 E;  1OW8 A;  3RVZ A;  1MFZ A;  3B0V C;  2IBZ G;  4Y28 J;  3WG7 C;  2CW0 F;  2XM0 A;  4PV1 D;  1QSP A;  4U3F D;  2ZVO B;  3HE5 B;  4NC3 A;  4K1O A;  1QX8 A;  3W67 A;  3OA1 A;  3Q7L A;  4AYC A;  2FFH A;  2XL4 A;  1DX7 A;  3H1J G;  3W68 A;  1X22 A;  2JJL A;  1E86 A;  4D6T G;  1FZA A;  2Q00 A;  3V4Q A;  3ABK C;  3DMD A;  4CSA C;  1LT1 A;  4R32 A;  1SQQ J;  4YTP C;  2NUT B;  1SZI A;  3EJN A;  4LDR A;  3NKD A;  4JJG A;  3E7K A;  1FJK A;  5JLI A;  2G3K A;  2X0C A;  3SWK A;  2Y9Y A;  3Q5S A;  3RL0 g;  2KGO A;  3M4C A;  2OYH A;  3ZQY A;  2Z5H A;  3E1I A;  3LJB A;  3IQT A;  5D92 A;  2B0J A;  3A0B H;  1JNM A;  4IRU A;  1JMM A;  2LR2 A;  3O10 A;  3RKO F;  1RHZ B;  3M1C B;  4CS9 A;  3PMR A;  2KYV A;  1GK4 A;  3JSZ A;  1SQX D;  1GD2 E;  2O9X A;  3TYY A;  1VQK P;  1S5L H;  3HNK A;  3V2Q A;  3MUD C;  5HSW A;  3HNL A;  3M9Q A;  4I6M C;  5L0D A;  2FYN C;  1TWH A;  1USD A;  3UIA A;  3A0H H;  3DAF A;  2FYU D;  2KXP B;  3B0P A;  4PR9 A;  2E87 A;  1CI6 B;  2GDC A;  3KYQ A;  4E18 A;  1L0L D;  1GL2 D;  3LW5 H;  3SXM A;  3L75 G;  2M4E A;  1FU1 A;  5E3C A;  3MIW A;  3SYN A;  3BVH A;  3G50 A;  2A69 F;  3AE3 C;  1EDL A;  1USE A;  1BSH A;  1M8O B;  2Q7R A;  3KDP B;  3FX0 A;  1VQ5 P;  2W9Y A;  5L0J A;  1BE3 J;  3OAK A;  3T9O A;  4DOZ A;  3S90 A;  2L6H A;  1LT9 C;  3QVY A;  4H44 C;  4MTO A;  1OVR A;  3BAS A;  3JTL O;  1NYH A;  3H1I D;  3FAJ A;  1AQ5 A;  3EG9 A;  3TF5 A;  3TQO A;  2KK1 A;  3MX3 A;  5JVE A;  2IYP A;  2HG5 D;  2XS8 A;  4PD4 D;  1J1D B;  2BC5 A;  2J5U A;  3K6B A;  4DBR A;  3K1I C;  1YA7 O;  3RQE A;  1A41 A;  2JWD A;  2QJY B;  1VQ7 P;  4YN0 B;  4HE8 D;  5L0H A;  1VPC A;  3AE8 C;  1V55 C;  3H1L D;  1OVV A;  2XZR A;  4CSA A;  2ZXR A;  2C9L Y;  3F89 A;  4EOT A;  3GOD A;  4IAO A;  5B5E E;  1LTJ A;  1NTK J;  1LTI C;  2AXT H;  3DM5 A;  1LTS C;  3QW1 A;  3FHD A;  4NPD A;  3A9C A;  3EHN A;  4Q4Z F;  2Q5U A;  2R5D A;  4G78 A;  4W8P A;  3WHN A;  1GL2 C;  2H7H A;  1FZE A;  2M64 A;  2KSF A;  2LIG A;  1BGY E;  1KIL C;  1N7S C;  1JCC A;  4EYY Q;  3ASO C;  2FYN B;  3MYI A;  3M9B A;  1S05 A;  2Q7C A;  4N3Y B;  1NVO A;  4I1O B;  3U8V A;  1M1J C;  2IBZ E;  2YXQ B;  3CWB G;  2P58 A;  4MW3 A;  1E83 A;  4E0I A;  5T1D B;  4HKZ H;  2ZT9 B;  2Y3B A;  3ZDM A;  1URQ D;  1YYC A;  3U1C A;  1URQ A;  2GFH A;  5B3I A;  4H0L D;  4JEB A;  4JPZ B;  3JCU Q;  1S5L E;  1I4Z A;  3CC4 P;  1SQQ K;  3DAG A;  1VF5 C;  1SQX G;  3NKE A;  2M3E A;  1LTJ B;  2PP6 A;  1NJI Q;  4NY3 A;  1KC8 Q;  2J9U A;  4F4B A;  3CXH H;  4JKV A;  2J0X A;  1LI5 A;  1X9V A;  4DJG A;  3T6G B;  1KU2 A;  1TQG A;  1M2V A;  3D70 A;  1BGY D;  3GEE A;  1GS9 A;  2CDQ A;  2DW3 A;  1RJ9 A;  3RL0 C;  2R7T A;  2ZYD A;  5CCG C;  3LEO A;  4XEF A;  3L72 D;  4E7S A;  1E85 A;  2ETS A;  1EQ1 A;  2WSF J;  3VYW A;  3CCL P;  2IXM A;  4GT1 A;  4PJN A;  3L71 D;  1NTM G;  2N1T B;  4JTA B;  3S29 A;  4YL1 A;  2ASR A;  2HV6 A;  3L74 E;  1KD1 Q;  2KC3 A;  1EZV I;  3GAN A;  4OD5 A;  3VP9 A;  1Q86 Q;  3JYY A;  2OCC C;  3CWB E;  2E74 D;  2JEE A;  4PJ0 H;  2KOG A;  1N7S A;  2VH3 A;  4NPF X;  2XSE A;  4U9D A;  1RKC A;  2I1J A;  3HE4 A;  4U3F G;  3L1M A;  3C8Z A;  4CS8 C;  3C8V A;  3TDK A;  1KZU B;  3KQG A;  4XQ1 A;  1D1B A;  1M2V B;  3PCV A;  3V5Y A;  1GMJ A;  2XRH A;  4O6N A;  4NPE A;  1EXJ A;  1BE3 E;  2O1J A;  3N24 A;  3SWY A;  3RIP A;  2ZD9 A;  1GM5 A;  1KB9 I;  3G4X A;  2W27 A;  3RL0 D;  1FJP A;  2V4H A;  2RMZ A;  3JT1 A;  2J45 A;  2ZYA A;  2HFI A;  5TJH A;  1PCX A;  5BQG A;  2WSF H;  3I56 P;  5L8R J;  1A02 J;  1EI7 A;  3QMK A;  2EPN A;  4IFF A;  1D0Z A;  2XLM A;  2PFX A;  1JTH B;  2AEJ A;  3L8J A;  3P8M C;  3N2Z B;  2QM8 A;  4W7Z A;  4XTK A;  1GK6 A;  1LE4 A;  4KHX A;  2J9V A;  3HTK B;  2QJK C;  1WGW A;  3H1J E;  3BEH A;  1OCR C;  1CPQ A;  4H4K C;  2R7O A;  2H7V C;  3L75 D;  2FYU G;  1ST6 A;  2A06 D;  4IFM A;  3EG9 B;  2P61 A;  1WAT A;  1FAV A;  2WT7 A;  3S1K A;  1Q0G A;  5JT4 A;  2C0W A;  2YKQ A;  5AC5 A;  2P1J A;  1P84 D;  3G71 P;  3CCQ P;  4PJ0 E;  4JIO A;  1OR2 A;  2LSE A;  1SQP J;  1LTA C;  4FWV A;  3D6Y A;  1W2E A;  2OYI C;  1R4T A;  1SF8 A;  3P8C E;  1M57 C;  2XM4 A;  3NTN A;  1KV4 A;  2WPR A;  1YI2 P;  1ZME C;  1KTM A;  4XA4 A;  5JP7 A;  1RE4 A;  3B5N A;  2Y0D A;  1T6I A;  3OA7 A;  3CCR P;  2HUJ A;  3BRJ A;  1IW7 F;  1VTM P;  4U7J A;  1SQV D;  1AA0 A;  5JSL A;  1KIL B;  5CI9 A;  1DD4 A;  3H1L G;  2C03 A;  3RW0 A;  2XLH A;  4MQ9 F;  2R7Q A;  2ZVN B;  2FYZ A;  3M91 A;  5KKZ C;  1VQL P;  3GF7 A;  4OIN F;  5L3V A;  1Z7Q c;  3EZI A;  4MVO A;  1G4W R;  1G2C B;  2KQ9 A;  3CEX A;  2R7W A;  1M7L A;  4BEM J;  1LKX A;  1JUN A;  2JP3 A;  3B29 A;  1P84 E;  3PDM P;  1K9M Q;  4R4L A;  1BSN A;  4PV1 B;  3D6Z A;  4M3L A;  4LLC A;  3L73 J;  2ZAE B;  1OIP A;  2O3J A;  5H2F H;  2HS5 A;  2A0B A;  2QE9 A;  1LTJ C;  1EC5 A;  2A06 E;  3L35 A;  2E5Y A;  1JOC A;  2FAP B;  1HVV A;  1VDF A;  5DS5 A;  2JX0 A;  5F5H A;  3WU2 H;  1IFJ A;  3H1H G;  1FBM A;  1X79 B;  1RQV A;  3WOD F;  5AVW B;  4BJ5 C;  4PD4 E;  2HJ3 A;  5A6A A;  2EPK X;  3KL4 A;  4I1M A;  1M57 D;  4DCK A;  4EI2 A;  1VK5 A;  5APQ A;  4Z9I A;  2LXC B;  2QA4 P;  1YLM A;  3A5T A;  3LEV A;  2YRF A;  5EK0 A;  1R5I D;  2K3R A;  1GU5 A;  1ZN5 A;  2EPO A;  2VCB A;  1ZYR F;  1ZVZ A;  2AWY A;  2EIM C;  2A0U A;  3TGU D;  1NBB A;  3TGU E;  5KLI C;  1BDC A;  1JY2 O;  1SQX K;  3SZR A;  3BCC D;  2CNW A;  4BEJ A;  1FS0 E;  1L0N E;  2N9Y B;  3CCV P;  4YPC A;  1OXB A;  1AJY A;  4RD9 A;  2RN0 A;  3LIE A;  3C1L A;  1MQV A;  4YT4 A;  1AFO A;  2KSE A;  4DRJ B;  1KB9 H;  4JVS A;  5DJU B;  2BAS A;  3FGA D;  1ZW3 A;  2WVN A;  4AL0 A;  4C3D A;  2HOD B;  5COM A;  2M8R A;  3L74 J;  1Z63 A;  3C8G A;  1V4A A;  2Y0C A;  4KI2 A;  2YL7 A;  5KLV E;  4PV1 C;  4YXD C;  5GTH H;  2XS1 A;  4YWQ A;  1ZHT A;  4AUW A;  1SVF A;  1FFH A;  1YQ4 C;  3O8Z A;  4D6T E;  2QY9 A;  2OQM A;  2KLU A;  5DQT A;  4XEK A;  2B87 A;  2Q6Q A;  5EHH A;  1H0T A;  3BCC G;  1ZOY C;  3PLN A;  4BWN A;  4PFO A;  2J46 A;  2D5R B;  3CPW O;  3AE9 C;  4CS9 C;  4GYT A;  1EZV E;  5AW2 B;  1L2P A;  1OWA A;  5APS A;  2GAQ A;  3NG1 A;  4XPY A;  3O55 A;  4IAQ A;  5BU8 B;  4YK5 A;  1JY3 N;  2HOD A;  1QZX A;  5B3S C;  1NU9 C;  2KSJ A;  2W45 A;  3C8G B;  1LWU A;  5KLI B;  3L72 G;  5AW7 B;  3NMK A;  4YL3 A;  2P2U A;  1AEP A;  1NTZ K;  3C8G D;  3N4X A;  4ZKU A;  4JYB A;  3K5B A;  4LGD E;  1ZR4 A;  2IBZ D;  4U5F E;  1S1C X;  3LNM B;  1KB9 E;  2ITA A;  1QGK B;  1BR1 A;  1PPJ G;  2ZPA A;  4DOJ A;  2UUH A;  3D71 A;  1NLX A;  4QI2 A;  4MVU A;  4LLE A;  3VMX A;  3G3Z A;  3PTZ A;  4LC1 A;  1PFI A;  2N9B A;  3AEE C;  3B5N B;  2PAJ A;  2FGY A;  1KYO D;  2R7U A;  2A06 G;  5CJ0 A;  1SQB E;  5APX A;  3M79 A;  4NQF A;  5GTI H;  1IJD B;  2JPU A;  4MW8 A;  2WL8 A;  2L6G A;  4IOI H;  1Q90 D;  2R7X A;  4U5D E;  4H13 C;  4ZMD A;  2AXC A;  4MN4 C;  3EGX A;  5HV9 A;  1RKE B;  2HJM A;  5TIS E;  2LKM A;  2Z15 A;  4IL6 E;  3HD7 C;  3FDQ A;  2LCH A;  2WMM A;  3H1L J;  2OAR A;  2W6B A;  4HB1 A;  3RK2 D;  3QH9 A;  4W7Y A;  2LQG A;  3FAP B;  4CIP A;  4L76 A;  3AEF C;  3WUU A;  1FC2 C;  1LJ2 A;  2GA0 A;  5E3A A;  3X1O A;  3HJC A;  3DXJ F;  3VMA A;  3G6E P;  1EZV G;  1S2E A;  2KNH A;  1ZRT E;  2YO3 A;  1N7S B;  5APW A;  3Q6N A;  1BCC E;  5AVV B;  2KW3 C;  3RBZ A;  3U0C A;  1X0T A;  2OYI A;  3PRJ A;  5B1A C;  1L0N G;  1QEX A;  1G1I A;  2JKV A;  2AEM A;  4GIF A;  2QNL A;  1LM3 B;  1CGN A;  3AED C;  3FWN A;  3X2Q C;  4MVM A;  3UNG C;  5KYW B;  1KMI Z;  1MMD A;  2PNO A;  1M2O A;  4P9F A;  1URQ C;  3HE4 B;  1LIH A;  2Q3I A;  3K1H A;  1H9T A;  3O39 A;  3MP7 B;  1MMG A;  3H1K G;  1VYI A;  1L0L J;  5KYY A;  1LPE A;  2OJE D;  3CX5 H;  2YL3 A;  2XLD A;  2GUS A;  1NAY A;  4XWJ A;  2W83 C;  4WY4 C;  1FFT C;  4CDY A;  5AVY B;  1H89 A;  4GEH A;  3ABM C;  1SQV J;  2FYU E;  3Q1M A;  4U5G A;  2BE5 F;  4WJ0 A;  3U59 A;  3KZI E;  3W2V A;  5E79 H;  1Q0D A;  1KN7 A;  4DRH B;  2IXO A;  2E75 D;  2YZS A;  2NPS B;  5KLV J;  4OH8 B;  5H2F E;  4OIO F;  3A2A A;  3II6 A;  3W4Y A;  2QE7 H;  1Q0F A;  4L75 A;  3H2U A;  4FX5 A;  2YKO A;  1BR4 A;  2SPZ A;  2HLO A;  1ZV8 A;  4C46 A;  1GZL A;  1N8R Q;  2FBW C;  2V7Q H;  3AEA C;  2WSC J;  4PAC A;  4B6I A;  2I1K A;  2A1D D;  2R3C A;  1Y4C A;  1KYO E;  3KYJ A;  4EHP A;  1K73 Q;  3V2R A;  4PJL A;  5DS6 A;  2KIK A;  1WN0 A;  1SFC A;  3DKA A;  3P7K A;  3GG2 A;  2ZT9 D;  1RF1 B;  2I8B A;  2Q9B A;  4CS8 A;  1RCP A;  1LI7 A;  1YYJ A;  4IWB A;  4KC9 A;  2OTK E;  1SQX E;  4UB6 E;  5CBO A;  1FAP B;  3P8C D;  2M5A B;  3WUV A;  1L4A C;  3Q2Y A;  1RMV A;  3AEG C;  1G2C A;  1J1E B;  1YTZ T;  4WY4 B;  1NHL A;  1NTZ D;  2OTJ P;  4JF7 A;  3U1A A;  1T8Z A;  4H44 D;  5AVS B;  1YJW P;  1SMY F;  1Z5Z A;  5CCH D;  5APY A;  3L4F A;  4OWF A;  4NTA A;  1JMB A;  4KT0 J;  4ULV A;  1U0B B;  3H1H E;  2I8D A;  4Y99 B;  2PRR A;  3LS0 A;  1KQS O;  1T01 A;  2Y39 A;  4JW1 A;  2WSS H;  5AVU B;  1L0N J;  1OVU A;  2J9W A;  2RSE B;  3K66 A;  4UDV A;  3GLM A;  3KKB A;  1AVO B;  1YAU O;  2J8W A;  2W8Z A;  5GTH E;  2XND H;  3IFM A;  2XL8 A;  3L70 D;  4FES A;  4I7Z C;  3C63 A;  1QLE D;  2BCC J;  1JAF A;  1A0B A;  1EKY A;  1KQG B;  3H6P A;  3HD7 D;  5BUO A;  2M5A A;  5K0I A;  2XDJ A;  2XNX A;  1RKE A;  5DLJ A;  1S9K D;  1AUE A;  2UWJ E;  2YIU C;  5BU5 A;  5CBN A;  2MHR A;  3H1K E;  3C62 A;  2L6F A;  1YTZ I;  2YLG A;  3DD7 A;  2EIN C;  3GOR A;  4N6H A;  3TGU G;  4ZLC A;  1BGY J;  4PFP A;  3VTP C;  1CZQ A;  2K9J B;  5TJ5 E;  4U5B E;  1HE1 A;  2ZXO A;  3H65 A;  3HTK A;  1N73 C;  1FZF A;  1NTK E;  1SQP E;  2V26 A;  4CJG A;  1L4A D;  3JCU E;  2AP3 A;  1N86 A;  3B71 A;  1AVO A;  2X51 A;  3C18 A;  1KIL D;  3VN0 A;  1C02 A;  2WT7 B;  1NTM E;  3CCS P;  4HYT B;  4IB4 A;  3EHM A;  1VQM P;  1XTC C;  1H7I A;  3L70 E;  1G8X A;  3W8H A;  4WWI A;  1J8Y F;  3ABV C;  3H1H D;  1HW1 A;  3VF0 A;  1ORS C;  3IN6 A;  2CCY A;  2WSE H;  1SQB K;  2N1T C;  5E33 A;  1OKK A;  1H8A A;  1NAF A;  1VQ6 P;  3Q7G A;  4G7Z F;  3HD7 A;  3FWL A;  2A6E F;  1M1K Q;  2NPU A;  1YBK A;  3H1I E;  3U8P A;  2UUI A;  4O9B A;  1OCO C;  2E74 C;  5GPG B;  3A3Y B;  3G4S P;  1K40 A;  1RF0 C;  3BAT A;  3O6Q A;  3NXS A;  4C7O B;  1SR2 A;  1Q82 Q;  2BEZ F;  2W6J H;  3V4W A;  2Y0E A;  3KPE A;  2WTY A;  3V6I A;  2ZXP A;  3LUT B;  3U3B A;  2FXP A;  1MND A;  3L73 E;  1JM0 A;  2AXT E;  3LW5 J;  1MV8 A;  3MTU E;  3JRM O;  4CPG A;  4QI0 A;  1IK7 A;  4O79 A;  2E75 C;  1ZHZ A;  3MD0 A;  5L0I A;  1GU4 A;  2IM8 A;  3DE9 A;  5CJ4 A;  1L4A B;  1NU1 D;  2A68 F;  4RDA A;  3V2N A;  2D2C C;  1NTM D;  1JRA A;  4C7N A;  3T6J A;  1PGJ A;  2KUB A;  3IQC A;  5KYU B;  1D7M A;  3JZ0 A;  1DD3 A;  2Y3G A;  1YHQ P;  3CC7 P;  3HUS C;  3AE5 C;  2QJP B;  1IFM A;  4NTB A;  2YXR B;  3L70 J;  4JTC B;  2P67 A;  3CX5 I;  1N1C A;  3RH3 A;  2KK7 A;  2WWW A;  1FZB A;  1FMV A;  1QKR A;  3ZWI A;  4AL1 A;  1OW7 A;  1ZXG A;  2B89 A;  4GDO A;  1SQB G;  4J7Y A;  3ABL C;  4LDQ A;  4H54 A;  2G3A A;  1S9K E;  2AWC A;  3B0U X;  5L0C A;  5TIS H;  3V5X A;  3WAQ A;  4Q7C A;  2J58 A;  5B66 H;  3HLZ A;  2R9R B;  4G0H A;  4J32 B;  3ZVR A;  3QWO C;  5AW0 B;  2HR3 A;  2ZXX A;  3DZA A;  3OJA B;  1C03 A;  1NU1 G;  1OW6 A;  3AG3 C;  1UIX A;  3EGD B;  3QW0 A;  2W6A A;  1Z23 A;  4RES B;  2WZG A;  1JMW A;  1R5S A;  3H1I G;  3KZI H;  2YL0 A;  3SP1 A;  4CDV A;  3L71 G;  2JO1 A;  3JRT A;  2BCC G;  1HUC A;  1Z56 A;  3ZDL A;  1IFN A;  3H1L E;  5K5G B;  4K7B A;  1CSB A;  3B5N D;  1N73 B;  4WGY A;  1Y8A A;  1OCZ C;  3DM9 B;  3EPV A;  3IQ6 A;  4Z9H A;  1IFP A;  2B9B A;  4Z1M H;  1MMN A;  1O3U A;  2HFE D;  2L9J A;  3ASN C;  1JTH A;  4EIY A;  1LP1 A;  3HNJ A;  5KYX B;  1JOG A;  2FFD C;  5D91 A;  3SEO A;  5EFW B;  1GL2 A;  1VMA A;  2EIK C;  2YVK A;  1O87 A;  4LLH A;  1VB5 A;  1PIX A;  1ZZP A;  2LFD A;  4EDF A;  4YJW A;  1SQQ D;  1VF5 D;  2Q1K A;  3V5B A;  2CPB A;  5CCH C;  4UB8 H;  2E5T A;  3Q3D A;  4I7Z B;  3MYF A;  1M1J A;  5BQH A;  1GW4 A;  1YIT P;  5AC4 A;  1EDK A;  2L5G B;  1NOH A;  1T2K D;  4WY4 D;  3PHL A;  4O6M A;  1YDI A;  5BVZ A;  3AGT A;  4MTG A;  3GEH A;  2E74 B;  1U89 A;  1LT9 B;  2K9J A;  1MNE A;  1ZHY A;  2NG1 A;  1HGV A;  2MYS A;  3TNU B;  1HF9 A;  1OXK A;  1YA9 A;  2WVQ A;  2WZL A;  3HE5 A;  5KAI H;  3WU2 E;  3B8E B;  2FYU K;  3L73 D;  3LNR A;  2CK3 H;  3VOP A;  4PD4 H;  4OIR F;  1NO4 A;  1KYO H;  2IFM A;  2HMQ A;  2OKU A;  1PP9 E;  3IEE A;  2MWQ A;  1NU1 E;  2K88 A;  1YZA A;  4AK9 A;  4JC7 A;  3E1R A;  4U5C E;  3PH0 A;  1YVI A;  4WGZ A;  3H1J D;  1NTK K;  4XFJ A;  4DVZ A;  2P1A A;  4DT0 A;  1ZU5 A;  1HGZ A;  1JY2 N;  3S84 A;  5AVQ B;  2AEF A;  4KNW A;  1VQN P;  4D4X A;  2QJP C;  4MVZ A;  1IC2 A;  3M9H A;  4DRI B;  2R7R A;  3W8I A;  2OOC A;  3T6B A;  3IAO A;  2FFD A;  1EQ7 A;  3ZIB A;  5AGF A;  1TR2 A;  5L0F A;  2H8P D;  1RF1 A;  2LFF A;  4K3A A;  2POH A;  4X0R A;  3T4R A;  1CPR A;  1QL2 A;  1QL1 A;  2L7A A;  3KH2 A;  4EBB A;  4XLN F;  3EGX B;  1LWU C;  3GF3 A;  3A7O A;  1G5Z A;  1YJ9 P;  1GDT A;  3CCJ P;  1SFC B;  1FZC C;  2C0X A;  4U9E A;  1VF5 B;  2KB7 P;  2O01 H;  1YAR O;  4A2N B;  3CCM P;  1J1D C;  2R05 A;  1P84 I;  3LS1 A;  2IBZ I;  1NTZ G;  1FDO A;  2XL6 A;  1G1J A;  3B4S A;  4EBK A;  3N7N A;  3L75 J;  2TMV P;  3R7C A;  3GWL A;  1T6Q A;  2KZI A;  1YZC A;  2XKM A;  4TLF A;  3VYI A;  2Q9A A;  2KYH A;  1FOS E;  1BCC G;  2H43 A;  3M0A A;  4N06 A;  1HY5 A;  1JR8 A;  3FOP A;  1VQ9 P;  3ITK A;  3QZC A;  4RBN A;  2ZT9 C;  5KJ7 C;  4ZLD A;  3FOO A;  3LES A;  3U2M A;  4JCH A;  1Z3I X;  4IFD K;  4RO0 A;  2J0W A;  1NFN A;  3RK2 C;  5KYY B;  1VLT A;  3EFO A;  4MTF A;  1RJ9 B;  4W8K A;  2HZ8 A;  3G9R A;  1ZU4 A;  2IX7 C;  2YEV A;  1QVX A;  3L73 G;  3JSE O;  4ANJ A;  3FXD A;  1WT6 A;  1S4X A;  1U6H A;  1DEB A;  2L81 A;  4XPW A;  4R4M A;  1HMO A;  4WB4 A;  2B87 B;  1E5W A;  5A69 A;  1RF1 C;  3IHU A;  1L0N K;  3RGU A;  3IQ5 A;  1N2D C;  2NPS A;  1YJN P;  3MUD A;  1SFC C;  1GL2 B;  3JSV C;  1FZC B;  3NMI A;  3H1K D;  1NFO A;  2B88 A;  1BR2 A;  3F5H A;  3E70 C;  1EA8 A;  1J1E C;  2BL2 A;  4YL0 A;  1BCC D;  2K9Y A;  4AE4 A;  3GW6 A;  1L0L E;  2R32 A;  3L71 J;  4I44 A;  1K8A Q;  4C3E A;  1Y9B A;  4L73 A;  3CC2 P;  2P0N A;  3N0T A;  5JS5 A;  3PHF 2;  1OX3 A;  4WAB A;  1MFT A;  5AVZ B;  3MZW B;  3DI5 A;  4BJ6 C;  1NU1 J;  1FDI A;  2B0H A;  2NSG A;  3L74 D;  2QJK B;  1TU3 F;  1FE6 A;  4U5E E;  3O6Q B;  1VLS A;  1Y47 A;  1N7S D;  4LAC B;  1JPJ A;  1LT9 A;  3A0B E;  3WUT A;  1K04 A;  3L75 E;  3U2L A;  4DBQ A;  2WSC H;  1Z6A A;  3CXH D;  3MBG A;  3RK2 B;  3CXH E;  1RQU A;  2AU5 A;  2QVA A;  4KNV A;  1APC A;  2NUP B;  3Q5R A;  3F46 A;  5CCG A;  1WMK A;  5KTB A;  1S5L X;  3C7J A;  4MVR A;  4C7O A;  1P84 H;  4BJ1 A;  3CZ6 A;  1M90 Q;  1NTZ J;  4H13 B;  2G3V A;  1DIP A;  1TKN A;  1W2B O;  4A7P A;  1YQ3 C;  5GTI E;  1TFO B;  2VC9 A;  1WAS A;  5KYU A;  1HE9 A;  2VCA A;  2KI7 B;  3CX5 E;  3H32 A;  3DE8 A;  5EGY A;  1I4Y A;  3VM6 A;  4N78 D;  5APU A;  3ECS A;  3FMS A;  2IFN A;  2WZ7 A;  1HTL C;  3PP5 A;  1H88 A;  1PP9 D;  1I5N A;  4ZNC A;  3J06 A;  3TUL A;  1BDJ B;  3KMI A;  3U9J A;  4JRZ A;  3Q6M A;  4ASV A;  2OYH B;  1BBH A;  3GHG A;  3EZH A;  1D0X A;  5CHX A;  2CPS A;  2W90 A;  3AG2 C;  5CCH A;  4OGQ D;  1SLQ A;  3KXD A;  1VOM A;  3VMZ A;  3CL3 D;  3E9V A;  3C9I A;  2R02 A;  1HH0 A;  2DGJ A;  1OMI A;  1V54 C;  1KOR A;  2HV7 A;  2LP4 A;  2LXB A;  2QSI A;  2MKV A;  1U7J A;  3NFQ A;  2HPC B;  2VAS A;  2A45 H;  1ZHX A;  1UG7 A;  2QUP A;  5KYW A;  3CD6 P;  3RVY A;  2R3S A;  1C17 M;  3RBX A;  2O1K A;  5CCG D;  1YYX A;  3W2W A;  3I5Q A;  1XWJ A;  1RH5 B;  2O01 N;  5CMZ A;  2J7P A;  2GUV A;  4D6T D;  2R44 A;  5E79 E;  1AV1 A;  5KLV D;  1QVG O;  4DZO A;  3ZG1 A;  3EQ2 A;  1Y6D A;  3AGU A;  2BCC E;  2ZXE B;  2XXA A;  5AW8 B;  3EGD A;  4LDK A;  1NZE A;  3FVY A;  3L8I A;  1RF0 A;  1IFD A;  4YT8 A;  4DVY P;  3RK3 C;  1BDD A;  1BE3 D;  3USS A;  3SFE C;  3L72 E;  2WQY C;  2HSQ A;  3L0I A;  1M56 D;  2E75 B;  5KKZ B;  1JO5 A;  4XLP F;  1ZW2 A;  2R5B A;  3GM2 A;  4A4A A;  4CJO A;  4DXW A;  1AVY A;  4TT3 H;  5JRA A;  3EFF K;  1Q2N A;  3H1J J;  1OQC A;  2HPC A;  3SNH A;  4PJJ A;  1SS1 A;  3M4B A;  2J59 M;  3UGP A;  5KAF E;  3IR9 A;  2OQQ A;  4J30 B;  1EDI A;  3ZSU A;  1SQQ E;  1T6A A;  1VQ8 P;  1ZHW A;  1S72 P;  3KYI A;  2KS1 A;  2YKP A;  3CWB D;  2E43 A;  1E84 A;  4OVN F;  1JB0 J;  1ZP0 C;  2DI3 A;  2PF4 E;  2E76 B;  2XU6 A;  3CCE P;  1KB9 D;  4N6C A;  5B5E H;  2V3C C;  1X8Y A;  5M1B A;  3CLQ A;  3HNI A;  2E42 A;  2YKZ A;  1FOS F;  1FZC A;  2WVR A;  3SWF A;  2Q3E A;  2A6H F;  1QLE C;  1TWA A;  3QVZ A;  2WPS A;  1PP9 J;  3TNU A;  1ORY A;  1L0L K;  3O6X A;  3NYJ A;  2YMK A;  5KJ7 A;  1LE2 A;  2XLW A;  3DJU B;  1UII A;  3ZTZ A;  4M63 A;  5A6K A;  5AW3 B;  5B66 E;  2NPS D;  3AQC A;  4KJM A;  4C7R A;  1CW5 A;  1HW2 A;  3RK3 D;  2ICW G;  4CX9 A;  4JTD B;  4U3F E;  2IXN A;  2KS1 B;  3NMJ A;  1HJ0 A;  2FFD B;  2XLV A;  3ZC4 A;  4OIQ F;  1SQB J;  2R25 A;  2IBF A;  3ATP A;  3V5Z A;  3JYH A;  3NYL A;  3SXZ A;  3S0X A;  3NDB B;  4RKU J;  4UB6 H;  2Y3H A;  3RQG A;  2XLE A;  1RE3 A;  1H0T B;  3VMY A;  2A45 G;  4WBA A;  3L70 G;  1A7E A;  2QIW A;  3AE6 C;  4L6R A;  1HBW A;  2G62 A;  4E7Z A;  2M3B A;  2P6V A;  4KBL A;  2KNC A;  1D1A A;  4NTF A;  3I5P A;  1U57 A;  2VB6 A;  4W80 A;  1OZH A;  1LNQ A;  1NWQ A;  1JY3 O;  4ULW A;  1CGM E;  2IYO A;  2P10 A;  2QJY C;  3GMA A;  1WOL A;  2E76 C;  3L74 G;  1SQV G;  4JQ0 D;  5DS4 A;  4UB8 E;  1J8M F;  4OGQ C;  2IDB A;  4BRY A;  3SXK A;  1LTT C;  2YQY A;  4E0H A;  3U3F A;  4H13 D;  2Y69 C;  2NZ2 A;  1RE4 C;  3B5N C;  4N6J A;  3OWT A;  5KYX A;  1KQL A;  1L0L G;  3H1K J;  3PJS K;  3F47 A;  5KJ7 D;  1LVK A;  5COF A;  3LLK A;  1NU7 D;  3B9Q A;  3RK3 B;  5AVX B;  2OEX A;  1T5O A;  2RH0 A;  3EH2 A;  3S27 A;  1VL2 A;  5F28 E;  1YIJ P;  1FNT c;  2HYN A;  2HSB A;  4PD4 I;  1M1J B;  1BGY G;  1GQA A;  5FZT A;  4OIP F;  2OGU A;  2CNW D;  3TK1 A;  2QRX A;  5IY5 C;  1RY3 A;  1PP9 G;  3K7D A;  2D2C B;  1QVF O;  2N1T D;  1FTS A;  2N1T A;  4JYC A;  4NCQ A;  1PV3 A;  2O01 J;  1W5C E;  1NTM J;  4H0L C;  1OR3 A;  1DOW A;  3CAX A;  2D4U A;  3AE7 C;  3AG4 C;  2CYD A;  2D2C D;  3CCU P;  2ZFC A;  3FXH A;  3VRC A;  1DEE G;  1QQ3 A;  1T3J A;  2EPL X;  3JCU H;  4BJT A;  4FAP B;  1NKZ B;  3CQZ A;  4N4W A;  1RXQ A;  1T9K A;  3EH1 A;  2YLI A;  5CI8 A;  4WVZ A;  4DJ9 A;  2F22 A;  4YXW H;  1KFM A;  2EPM X;  5KAF H;  1SQB D;  4IJJ A;  2HMZ A;  4ZKP A;  1NG1 A;  5L3Q A;  1LWU B;  2L91 A;  1FDM A;  3U5S A;  5T3T A;  5AVT B;  2PGD A;  3LID A;  3TGU J;  3V2P A;  3RL0 B;  2Y3D A;  1YJG A;  1NTK D;  2W4B A;  3I5C A;  1WTY A;  1SQP K;  2QG4 A;  3H1H J;  1XZQ A;  2PP4 A;  3CX5 D;  2P7V A;  3H2V A;  1L4A A;  3TJ6 A;  3HUS A;  1LGH B;  1XTG B;  2OYO A;  2KLV A;  1ZRT D;  3LLI A;  2QM7 A;  3R2P A;  5AW5 B;  1MKM A;  5A6B D;  3EQL F;  3H1I J;  3CMA P;  2DYR C;  1PGP A;  2GA1 A;  4P9T A;  4IAR A;  2Y9Z A;  3OEO A;  4PJM A;  2H7O A;  4BG0 A;  3HKK A;  3GM1 A;  1OKK D;  2YL1 A;  1PPJ D;  2H7B A;  4EWC A;  3CWB J;  1PPJ E;  1LTG C;  1IFI A;  4C3B A;  3POV A;  3HRN A;  2Z5I A;  1G4U S;  3TK0 A;  4I2L C;  1D0Y A;  2VRS A;  1H6G A;  5AW4 B;  3CSK A;  1NSG B;  1FR0 A;  4I3M A;  3US6 A;  1MUU A;  3K1I A;  2FXM A;  3R4Y A;  3FXE A;  2WIT A;  2KJG A;  4AQR D;  4PK4 A;  4JE9 A;  3H32 B;  4HEA J;  1PZQ A;  3TOM A;  4YT2 A;  3M0D A;  1NTK G;  1BZ4 A;  1ZLL A;  2OYI B;  2IXP A;  4HFK B;  2BCC D;  1E79 H;  1SQV E;  2FYU J;  3IPM O;  3V7O A;  4BPM A;  2KZJ A;  3MFN A;  1NTZ E;  1MMA A;  1AQT A;  5KLV G;  3LAY A;  4ER9 A;  1LTB C;  5B1B C;  2IZ0 A;  1A7D A;  1L0N D;  1W2W A;  4XEV A;  1FZG A;  2PFD A;  1N73 A;  3HTK C;  3CI9 A;  2NPS C;  1KNY A;  1V74 B;  3DWW A;  3ITF A;  3ZQV A;  3UGO A;  2E76 D;  4ONS A;  1LP1 B;  2IYL D;  3IF4 A;  2LK4 A;  3SXY A;  1KIL E;  1KYO I;  1SQP D;  1TWC A;  4N78 E;  3AOU A;  5A6B A;  1JCD A;  3L37 A;  3A0H E;  2DYS C;  3BCC J;  3AQB A;  4O7G A;  2KNC B;  3GHG B;  1PGQ A;  2OEV A;  4XE5 B;  1H9G A;  4MVS A;  2H88 C;  1HJB A;  3TD7 A;  5APV A;  3U9M A;  1CI6 A;  2YWA A;  4IL6 X;  3MLG A;  1IK9 A;  2XXA B;  5BQI A;  2WVO A;  4GOF A;  1Q81 Q;  4IGG A;  1WRG A;  4WY4 A;  4EIJ A;  4U3F J;  3SSU A;  2R03 A;  3I55 P;  3A11 A;  1O5H A;  1VQO P;  1NKN A;  3OW2 O;  3Q5P A;  1NU1 K;  2J7P D;  3UMI A;  3T97 A;  1MZ9 A;  4JCZ A;  2EIL C;  2YNY A;  2JR8 A;  1Q0K A;  1PL5 A;  2KP8 A;  2R7S A;  4K35 A;  1QPU A;  4K0D A;  4Z9J A;  2WPV B;  1RE3 C;  2YLD A;  1FMW A;  2YIU B;  3EFG A;  4HJG H;  5KLV K;  5AVR B;  3VP8 A;  2Q4F A;  3GEI A;  5KAI E;  2R7V A;  2H8A A;  4Q5S F;  3M0D C;  1KQF B;  3AJM A;  1IZN B;  5DVW A;  1TFK B;  1S3J A;  2OJQ A;  4H0L B;  1SQQ G;  3BCC E;  2DB4 A;  2JWA A;  2P7J A;  1UFB A;  2OU6 A;  5KYN A;  4EUK B;  1DH3 A;  3NRH A;  2JDI H;  3RFY A;  5E2Q A;  3H25 A;  4Y99 C;  1WWP A;  3VAY A;  4JZA A;  3GHG C;  2J9B A;  1A7V A;  2NUP A;  3AG1 C;  3T97 B;  1OFC X;  4AX2 A;  1B68 A;  2GM4 A;  4JUR I;  2M0B A;  1LS1 A;  3AE1 C;  1GGQ A;  3TOL A;  3NMD A;  1KFN A;  2OTL P;  2WZF A;  3M06 A;  3RQF A;  1L3P A;  1JPN A;  2BEQ D;  2WSE J;  1M6T A;  2K1A A;  3S9O A;  4D6T J;  3GWN A;  4BXL A;  2MJZ A;  5COG A;  1OCC C;  2XV5 A;  3L72 J;  2AVK A;  1R5L A;  1BCC J;  1DOV A;  4CS7 A;  2QLA A;  3L34 A;  2NUT A;  4GOE A;  3EWK A;  2FKW B;  2HKV A;  1HWT C;  1VQP P;  1M56 C;  5CIV A;  1SQP G;  1NGM B;  3L36 A;  2PX3 A;  2I15 A;  1IZM A;  1EXI A;  2H89 C;  2Q9I A;  4YT5 A;  4EBJ A;  3AEB C;  1N7L A;  1T3U A;  4G7O F;  5AW9 B;  3UMH A;  4L74 A;  1GTW A;  5FCL A;  3S28 A;  2JD3 A;  1T2K C;  5L0G A;  1KIL A;  3AE4 C;  4GQH A;  2FXO A;  1NH4 A;  4O6Y A;  4B86 A;  4JEA A;  4CBE A;  4GKG A;  2XLO A;  3K33 A;  2CGE A;  2ZXW C;  1Q0M A;  1ZW0 A;  3TSI A;  1XZP A;  3I4U A;  4JJF A;  5AW1 B;  3BRV B;  1L7C A;  3G4Z A;  2EIJ C;  1JEK A;  2IOQ A;  3EFO B;  3DJN B;  3MGN A;  4ASW A;  3AEC C;  2WPQ A;  1F1M A;  3UMK A;  4C7N B;  4QMA A;  4OD4 A; 
#chains in the Genus database with same CATH homology
 4PV1 D;  4XEK A;  1FDO A;  1K04 A;  1VF5 D;  1KQF B;  3U3F A;  4H13 D;  3AE2 C;  3AJM A;  2NZ2 A;  1K40 A;  3O6Q A;  3AED C;  4EBK A;  1ZOY C;  3Q3D A;  4I7Z B;  1KMI Z;  2BEZ F;  4H0L B;  3C8V A;  4H44 D;  1RQU A;  2OQQ A;  3Q5R A;  2G8Y A;  1GMJ A;  2FXP A;  4KT0 J;  3LW5 J;  1WMK A;  2JP3 A;  1S5L X;  1UFB A;  1EXJ A;  3R4Y A;  3AE9 C;  2Q00 A;  4R4L A;  1IK7 A;  4PV1 B;  3H25 A;  3D6Z A;  1VL2 A;  2E75 C;  4R32 A;  4H13 B;  5F28 E;  1DIP A;  4YTP C;  1WWP A;  2HSB A;  1JB0 J;  1YQ3 C;  1ZP0 C;  2E76 B;  3GLM A;  2E74 B;  2D2C C;  3Q5S A;  3T97 B;  3RL0 g;  2ZT9 C;  3K7D A;  3MFN A;  2D2C B;  5L8R J;  5M1B A;  3C8G B;  3AE1 C;  2ZT9 B;  2JX0 A;  1HF9 A;  1PV3 A;  2O01 J;  4I7Z C;  3Q1M A;  4H0L C;  3JZ0 A;  3RQF A;  3AE7 C;  1DD3 A;  3O10 A;  2BEQ D;  2WSE J;  4H0L D;  3L8J A;  3TUL A;  2D2C D;  3C8G D;  1KQG B;  1RQV A;  3SFD C;  4XEV A;  3AE5 C;  3S9O A;  3G9R A;  1KNY A;  2E76 D;  1VF5 C;  1S1C X;  2QJK C;  1QVX A;  2E75 D;  2YIU C;  2LK4 A;  2FYN C;  2YMK A;  1KIL E;  4OGQ D;  2L6F A;  3D71 A;  1OW7 A;  4GDO A;  4R4M A;  3EWK A;  4H44 B;  3AEE C;  1OMI A;  1KOR A;  4XFJ A;  2QSI A;  2MKV A;  2G3A A;  3GF7 A;  1NGM B;  5KLI C;  3GM3 A;  2V7Q J;  1EXI A;  2H88 C;  4NQF A;  2H89 C;  4EBJ A;  3AEB C;  2JPU A;  2YWA A;  1HJ0 A;  2FBW C;  1AJY A;  2QJP C;  4IL6 X;  3D70 A;  2L6G A;  1OW6 A;  1R8E A;  1Q90 D;  3AEA C;  3AE3 C;  2WSC J;  1UIX A;  4H13 C;  4OGQ B;  1WTY A;  4RKU J;  3B71 A;  3RQG A;  3C18 A;  3IAO A;  2K9Y A;  3D6Y A;  4XEF A;  3AE4 C;  1ZZP A;  2QIW A;  3AE6 C;  2L6H A;  3FGA D;  3Q5P A;  1Y9B A;  2WSF J;  1K05 A;  4H44 C;  2JO1 A;  3AEF C;  1ZME C;  1KTM A;  3L8I A;  3C8G A;  1U57 A;  1NYH A;  2PBE A;  3BRJ A;  1MKM A;  2ZT9 D;  3ABV C;  1ZRT E;  1V4A A;  1PL5 A;  4U7J A;  3GF3 A;  3IN6 A;  3SFE C;  4PV1 C;  2WQY C;  4YXD C;  4Z1M H;  1O3U A;  2E75 B;  2KK1 A;  1DD4 A;  1FDI A;  2P10 A;  1JOG A;  2QJY C;  2WPV B;  3U0C A;  1VF5 B;  1OW8 A;  3GMA A;  1TU3 F;  2J5U A;  3RK3 E;  1WOL A;  2E76 C;  3JYY A;  3RQE A;  2E74 D;  3AEC C;  3Q2Y A;  3GM2 A;  1YQ4 C;  5KKZ C;  3AEG C;  3AE8 C;  4OGQ C;  4Y28 J;  3GM1 A;  4TT3 H;  2IDB A;  1PIX A;  2E74 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...