1K05A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
135
structure length
135
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 57
structure length 135
sequence length 135
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k05A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k05A02
3AECC 3U3FA 3K7DA 2WQYC 3AEBC 2Q00A 1WOLA 5F28E 2HSBA 1JOGA 4EBKA 3AE8C 3AEEC 1KTMA 3GM1A 3GM3A 2PBEA 3SFDC 3JZ0A 3S9OA 1UFBA 1YQ4C 1K40A 4YTPC 3AEAC 4YXDC 3ABVC 3C8GB 1QVXA 3AEDC 2H88C 2L6GA 2L6FA 1ZZPA 4XEKA 1WWPA 3O10A 3TULA 3AE6C 4NQFA 1ZP0C 3BRJA 1OW6A 1KNYA 2KK1A 3AE2C 3AE9C 2G3AA 3AE7C 1O3UA 3RQGA 3AJMA 3U0CA 1OW8A 1ZOYC 2JX0A 4XEVA 3AEGC 1OW7A 4R32A 3AEFC 3GM2A 3SFEC 3AE4C 2LK4A 3L8JA 2H89C 3AE3C 3JYYA 3AE1C 3RQFA 3C8GA 1YQ3C 2YWAA 3C8GD 3C18A 1K04A 3AE5C 3L8IA 1WTYA 3B71A 1K05A 2L6HA 1PV3A 1V4AA 4XEFA 4EBJA 2FBWC 3MFNA 3RQEA 2JPUA
chains in the Genus database with same CATH superfamily
4Z9JA 1EZVG 4NCQA 1SVFA 5KJ7C 2Q7CA 4H44B 3KYJA 2WVQA 3GG2A 1H89A 1ORYA 1SQBG 1HE9A 2I15A 5KJ7A 1NTZK 3B0VC 1DEEG 4H44C 1YJNP 4AK9A 1SQPJ 4KNWA 2WTYA 1QLEC 3SWYA 3CCVP 5GTIH 1KTMA 1U57A 1M57C 3JC22 3I4UA 4H54A 4I6MC 1NTMG 1FNTc 1TWHA 1D1BA 3AOUA 4CPGA 3GHGA 5AVSB 1UFBA 2AP3A 2PX0A 2O1KA 2MYSA 2JKVA 2WPQA 3RIPA 4DRJB 2IFNA 5JUAA 5AW8B 1FDMA 1KB9D 2FYUG 2W4MA 1FMVA 1L2PA 1YIJP 2ZVOB 4YL0A 1NTKE 1TFOB 2L6FA 3GWNA 3V7OA 4GEHA 1ZZPA 1JMMA 4AQRD 3TULA 1AV1A 2Y0DA 2OTJP 3ZQYA 2M8RA 3RL0g 1M56C 4HJGH 3OJAB 5E3AA 1AVYA 1FOSF 3HD7D 1KYOH 2NUTB 2E5TA 3A7OA 1JRAA 1OXZA 1L7CA 1HH0A 1FR0A 4DBQA 1RJ9A 5CJ4A 3IQ5A 1T3UA 1JTHA 2ZVNB 2IZ1A 2BCCG 4JBZA 1USDA 2HV6A 3OA1A 1HE1A 2NSGA 2LP4A 3H32A 4AL1A 5KAFH 1IFDA 1ZHTA 1T5OA 3K1IC 3AEFC 4DCKA 1NAYA 3QH9A 2R5BA 1FZGA 1T6IA 4QDLA 2QJKC 3L72E 4M63A 3AE3C 3HNIA 3AE1C 3IF4A 5E79E 1BCCE 1E5WA 2MJZA 3JT1A 2J0WA 3S90A 4XQ1A 3KKBA 1YQ3C 4N6CA 1OQCA 2YIUB 2QLAA 4U3FE 3WG7C 1M1JB 2O01H 3GEHA 1DOWA 1WTYA 4JRZA 4OWFA 1W5CE 1H8AA 2JDIH 4CSAA 3O6QA 4WGYA 2XNDH 4L6RA 4RDAA 2M0BA 1VQ7P 2Q3TA 2M3EA 3PP5A 4IL6E 1SQBE 3NYMA 1SYQA 4DRHB 1IZMA 5E2QA 5DVWA 1TQGA 1BE3D 1XTCC 2HSBA 2X51A 3E9VA 2UWJE 1JOCA 2R7QA 1FBMA 1IZNB 5T3WA 2E75B 3Q5SA 2QJPC 2QJYB 1NTME 1URQB 1USEA 3FMSA 2E75C 4IRUA 4H13D 3S0XA 3S9OA 5KYNA 2QJYC 4PV1B 2OYIB 1JPJA 3CCMP 2IBFA 3EFOB 1GZLA 1LTTC 3ABVC 4RD9A 3JRTA 2FYUE 2ZAEB 3NRHA 2CPSA 3KXDA 1QVXA 2P61A 2YVKA 3W2VA 2R7RA 2OYIC 5AW2B 2WPSA 4IJJA 3FDQA 1MMDA 1KILD 1NTKK 1OXBA 2C0XA 1KFMA 2A6EF 1LWUC 4JIOA 2EIKC 1N2DC 1F1MA 4UB6H 1PD1A 3CWBJ 1SQVG 5T3TA 2QE9A 1LWUA 4ZKPA 4G7OF 2YKPA 1YA7O 2WSFJ 1JNMA 2NPSD 4E18A 3HTKC 4HE8D 1Y47A 4U9EA 2VH3A 3B4SA 2JWDA 4TLFA 1M90Q 1HBWA 1Q0FA 4C3DA 3SWFA 2O9XA 2DGJA 4XEVA 1S3JA 2KNCB 3HTKA 1HF9A 1Q0MA 2EPLX 2LCHA 1KQGB 2LK4A 1LI7A 1GM5A 1KILE 2FYNB 1H6GA 3KDPB 3V2RA 5AVWB 4D4NA 1YBKA 1T6AA 2HS5A 3Q2YA 1FS0E 2KSJA 4NTBA 1L0NJ 1D0YA 3GMAA 1XZQA 2E87A 1K04A 1NO4A 3SXZA 1RH5B 2FAPB 4U7JA 1N86A 4E7ZA 1LTIC 3PCVA 2A0UA 3MFNA 3RQEA 2K9JA 3AECC 3H1LD 3H65A 2YL3A 4CDAA 2WSEH 1IFPA 4C7NA 2J59M 2WT7A 1R8EA 1ORSC 1WASA 2EPKX 1SQBK 1ZW2A 1OVVA 2RD9A 4JTCB 3ZSUA 2OU6A 2A6HF 1VF5D 4NY3A 4G0HA 3P8CD 2XSEA 2ZT9B 2R7TA 2CYDA 3HE5A 4HFKB 1LS4A 1BE3J 2ZFCA 4U9DA 3ZTMA 1YLMA 1GL2D 1SQQG 4PD4H 1U7MA 2ZT9C 2OYHC 4AUWA 1N7SB 4YTPC 3W8IA 2QE7H 3H1LE 1JMBA 3CSKA 4PR9A 1ZRTD 2OYHA 2FFDC 2FYUK 3B9QA 4I44A 3PDMP 4BXLA 3W68A 3CC2P 2ZJSE 2YKOA 1JY3P 3VRCA 4N6HA 1WWPA 2BC5A 2EILC 2FFDA 2M5AA 3KYIA 2GAQA 2PRRA 2PFXA 3P8CE 3D6ZA 1HVVA 2I1JA 5HV9A 1P84I 4C46A 1KC8Q 4C7OB 1M6TA 3EFGA 1H88A 2CNWD 4XLNF 4FAPB 2Y39A 2BE5F 3AE7C 1Q86Q 2GM4A 1Z56A 5COGA 3RQGA 1S9KD 2HPCA 3D70A 2RN0A 1W2EA 3GF7A 4I7ZC 1J8MF 3H1KD 3U2MA 1JB0J 2R7SA 2KB7P 1JO5A 4JE9A 3BVHA 1L0LD 1L4AB 1ZRTE 2P67A 2O01J 3CCLP 3WODF 1RKEB 3FGAD 4YT2A 5H2FH 1RE3A 4G7ZF 3RBXA 2XLMA 2OKUA 4D6TG 5A69A 1T3JA 2PFDA 1KORA 5EK0A 2M3BA 1BGYG 1NJIQ 3HKKA 3HUSC 4WB4A 3C18A 1VQKP 5A6KA 5C39A 1VQ9P 1RKEA 3QWOC 2H8AA 2YL1A 3G4SP 2R3SA 1RE4C 1S9KE 4K7BA 1TWAA 3HUSA 3KYQA 2J5UA 3M91A 3DI5A 3H1KE 3L75G 1R5LA 2KIKA 4PD4D 1L0LE 5AVYB 5B5EH 1RE4A 2DYSC 2J8WA 3K7DA 1QX8A 4U5BE 1YTZI 2KLVA 1MUUA 1Z23A 256BA 5AC4A 5L3QA 1Y4CA 1Q90D 1S7ZA 2HV7A 3AGUA 4MTFA 1LT9B 2ZD9A 1FZCA 3C7JA 1RQUA 1NWQA 3ZDLA 1OVUA 1K9MQ 3RK2C 3ZTZA 1MNDA 4PJLA 1SP4A 1KILC 3AEAC 1IK7A 1GW4A 1NU1J 3AEDC 3QVYA 3S84A 1KILA 1H9TA 3CC4P 1OKKD 5AW5B 2HMZA 1NFOA 5KLVG 5JS5A 1E83A 2Q6QA 1YI2P 2XM4A 4Y28J 3F47A 5DQTA 3Q7LA 1LTBC 3L74J 1NYHA 2I1KA 4DJ9A 4A4AA 1QVGO 4H44D 4WWIA 2WSCJ 2FGYA 5BU8B 1QLED 3L73E 4OGQB 2VRSA 1SQVK 2Y0CA 1EDLA 2OCCC 1FZBA 2HFED 1EDIA 2A45H 1M57D 2W83C 3VOPA 4XTKA 3O8ZA 3N7NA 2D2CB 1AQ5A 5KYXB 1OW8A 1HMOA 1FZAA 2N1TB 3FX0A 3E1RA 2YQYA 1X8YA 3Q5PA 4K0DA 1I4YA 1WT6A 3GM2A 5AVRB 2EIJC 3H2VA 3DZAA 4MTOA 2N1TC 4FWVA 2ETSA 3MTUE 4D6TE 2YEVA 3V5BA 2XS1A 4U5EE 5D91A 5K0IA 2XM0A 3US6A 1YYJA 1EC5A 1EXIA 1NSGB 5JRAA 3H1JJ 2N1TA 3NMDA 4CS9A 3FAJA 2V26A 3U8PA 1M7LA 2J46A 3EG9B 4YL1A 5DLJA 1MFTA 3L75E 2L6HA 2JO1A 2PF4E 1DH3A 1YITP 1NTZD 1EKYA 4WY4B 3CCJP 2WQYC 4BRYA 3MYFA 2YXRB 4GKGA 4MW3A 5BQHA 4GIFA 1M8OB 3ASOC 4WY4C 1BDJB 1GL2C 2ICWG 3RVYA 2V4HA 3FXDA 3QMKA 4C7RA 1RF1A 2PNOA 3L70D 1OR2A 1GL2A 3CAXA 5DS4A 3JZ0A 3FWLA 1SQQK 2Z5HA 1T01A 2IZ0A 1E79H 4P6IC 2WVRA 4F4BA 2W45A 1VYKA 1NTZE 2WVOA 1LT1A 2H88C 2P7VA 2Q3IA 5IY5C 1N1CA 3UMIA 5DQZA 1OZHA 2Z5IA 2A06D 2XLHA 4Z9HA 4BJ6C 1PZQA 4ASWA 3RH3A 1HGZA 2H7BA 3FWNA 2SPZA 3VMXA 4BJ6A 2CNWA 3H1ID 1KFNA 3L70E 3VP9A 2E74B 2XLEA 2QSIA 5GTHE 3I56P 3AE9C 2WB7A 1X9VA 4DZOA 1J1EC 1LTJC 2BL2A 2POHA 2R02A 1LPEA 3U3BA 2E75D 3RGUA 1LTJA 4OH8B 1PP9J 1YARO 2KYHA 5EHHA 1H0TA 1PFIA 1T9KA 1XWJA 3B5NB 2BASA 4HH2A 1SQXJ 4YJWA 1VDFA 1K8AQ 4IB4A 4GDOA 4LLEA 2A68F 4BG0A 3CXHD 3U9MA 3M4BA 4BJ1A 3CLQA 1EI7A 3U1CA 4P9TA 1OR3A 3EHNA 3VMAA 3KPHA 2IXPA 5HSWA 1LTSC 3DAGA 1YAUO 2LFFA 1S72P 1RQVA 2P1JA 2J58A 1AFOA 1V4AA 2KQ9A 2M64A 4XEFA 1QPUA 2J45A 3F5HA 3FOPA 1NKZB 5E79H 4CJGA 2XXAA 3EGXB 1OWAA 3A0HE 2C9NY 1YHQP 1DX7A 3U3FA 1DEBA 1WRGA 1KQLA 5CMZA 3LNRA 1BDCA 3U9JA 3CXHE 5K5GB 2LXBA 2QRXA 1QQ3A 2ZXRA 3Q6MA 1JOGA 3UMKA 1D1CA 3V4WA 2WVNA 2Q9BA 3EGDB 3V5ZA 1FJPA 2PBEA 3F89A 3VN0A 4IFMA 4IL6H 4BEMJ 2R3CA 4L75A 4WBAA 3CWBG 3L71J 2N9BA 4GOFA 2KZIA 1K40A 4U5GA 1NG1A 3N2ZB 1NTKD 1D1AA 1OKKA 3DXJF 1W2BO 4IFDK 2D5RB 3FVYA 1PD0A 1FZEA 4MVSA 2HYNA 1XTGB 3LESA 5KLVK 1OIPA 4L73A 3C8ZA 2B89A 3KQGA 4NQFA 2E76B 4HEAJ 2ZXWC 1U7JA 3ASNC 3JYHA 5JP7A 1KZUB 4EIJA 5L0IA 2OG2A 4DXWA 3TD7A 3U1AA 4XPWA 3JCUE 4AE4B 1L0NG 5L8RJ 3L0IA 3H1HG 2VCBA 3IQCA 4E7SA 4Q7CA 2VB6A 3H1IJ 2PGDA 3AJMA 1Y9BA 5M1BA 3N24A 1KYOI 1A41A 3C62A 2J9UA 2ZT9D 2OJED 3V5YA 1JAFA 3L72D 1IO4A 3VTPC 1BCCD 1OCRC 5E3CA 4U5CE 3RK3B 2OEXA 4IL6X 3CQZA 3JCUQ 4U3FD 2WZLA 3RBZA 1JM0A 2QG4A 4ULVA 4ANJA 3VM6A 4IOIH 3M0DC 1EDKA 5APWA 1EZVD 1CGNA 5A6JA 3WUUA 2KUBA 3QW1A 2NUTA 2J9WA 2FBWC 2ZYDA 3M0DA 1BR2A 1SQBD 1RHZB 3N4XA 2H7HA 1M2VB 1GK4A 1H7IA 5KYYB 3RW0A 3V2NA 3K1IA 1HUCA 1JY2O 5L3VA 4J7TA 2IXNA 4LACB 2MKVA 2I8DA 5CBNA 3A3YB 1AUEA 4JKVA 1NTMD 4DRIB 2KXPB 2R44A 1G8XA 1SFCB 2Y9ZA 3NTNA 5CCHC 2YIUC 4LLHA 2IFMA 1M1JC 2KP8A 2HLOA 1D0XA 1Z3IX 3JTLO 1EZVE 2IYOA 2KSEA 5CCHA 5DS5A 3C8VA 2FYUD 4JEAA 1M1JA 1T8ZA 2VCAA 3LAYA 1T6QA 1QL1A 3PTZA 3KZIE 4O6MA 3GW6A 3G71P 2IPPA 2L6GA 2P1AA 1SZIA 1IJDB 3NMIA 2Q9IA 5D92A 4UB8E 3A11A 2V3CC 1PGJA 4OIOF 3ABKC 3A5TA 3BRJA 1H9GA 5FCLA 2QUPA 2BCCD 3DM5A 4JCHA 3H1HE 5AGFA 2DB4A 1PGOA 1AQTA 3CX5I 1URQC 1YZCA 3AQBA 1YYXA 2P2UA 2IXOA 4LDQA 2YXQB 2Q7RA 3SSUA 4HB1A 2K9YA 2MWQA 4PV1C 3R4YA 2V7QH 1KMIZ 3RK2D 1URQA 2B87B 1G1JA 4CJOA 3Q7GA 5CI8A 4PJMA 1QSPA 4XPXA 3H25A 2AXTE 4L74A 2OYIA 2YNYA 3EFOA 4PFOA 3L8JA 1UIIA 2W6AA 1I4ZA 1VB5A 3L72J 5JT4A 4PJ0E 3HJCA 2YMYA 3L37A 2BCCE 3K5BA 3TOMA 4MVMA 1JR8A 3A0BH 4U3FJ 1PPJG 3O6XA 1LP1B 1N7LA 2ZXPA 3KMIA 2J9BA 5AW9B 3SXKA 1Q0DA 4W7ZA 4OGQD 4I3MA 4NC3A 4DOJA 2MHRA 1KN7A 1A02J 1JEKA 3AEBC 3CI9A 1NU1G 2L91A 3W2WA 1SQBJ 2FYNC 3P32A 5EGYA 2KNCA 4NTAA 4EBKA 2N1TD 5AW0B 3WU2H 2PX3A 2PAJA 1VYIA 3L74G 1GTWA 4K1OA 1LS1A 2WSSH 4K3AA 1VLSA 1GU4A 1R5ID 1NTMJ 2WPRA 3PMRA 4FX5A 3FXEA 5DJUB 4XFJA 1LI5A 2LD6A 1RMVA 3O55A 3VP8A 3GEIA 2Y69C 4OIRF 3M0AA 3B29A 3HE4B 4GYTA 2J0XA 2WZGA 2FXMA 2FYUJ 1QVFO 2R03A 2LQGA 2WITA 1FTSA 2Q9CA 5COMA 5A6BA 4XEKA 1ZXGA 3TJ6A 2ZXXA 1SQVD 4LC1A 2P6VA 2JEEA 3IQTA 3HLZA 4K35A 4WY4D 4JEBA 1ZU4A 4KC9A 1OW6A 1KNYA 4DVYP 1YJGA 3H1JG 3AE2C 1TWGA 2KJGA 4M3LA 1L0NK 2JR8A 1J8YF 5B1AC 4FESA 1IW7F 3HNJA 2YO3A 1G5ZA 3DD7A 1Z7Qc 1N7SC 3TOLA 1E86A 4KNVA 3RVZA 2Y3GA 2PP6A 2IBZI 1N7SA 3AE4C 3TK1A 1AVOB 2IXMA 4LLCA 3G50A 2HFIA 3HD7B 1SQVE 4E17A 1HW1A 5KLIB 4DJGA 2YLGA 2KLUA 4BJ5C 1G1IA 3QVZA 4JW1A 3MHVA 2GA1A 2KYVA 4PK4A 3G4XA 3GLMA 3CCRP 3LUTB 4BJ5A 4Q5SF 1CGME 3A0BE 1VQPP 5APUA 4U5FE 4C7OA 3CX5E 5T1DB 4H0LB 3M79A 2NUPB 4R4LA 2QVAA 1L4AC 1PCXA 4H0LC 2YL7A 3EWKA 4I1OB 4IWBA 4Y99B 2YHSA 4HYTB 1VQ5P 1L4AA 1ZVZA 4YPCA 1X0TA 3L74E 2R25A 1SQQD 2C03A 4MVOA 4Y99C 2ZYGA 3EQ2A 3NG1A 2IBZG 4L76A 5L0HA 4EKWA 3GM3A 1NBBA 3SXMA 4EOTA 3WU2E 3KL4A 1ZHZA 1D0ZA 1V54C 2HKVA 3DMDA 3I55P 1YDIA 1BZ4A 2P58A 2FKWB 3M4CA 4UDVA 3V4QA 4U5HA 2KS1B 2R7WA 3JSZA 5JVEA 2O3JA 3C8GB 4OD5A 1VMAA 2GDCA 4CS7A 3BCCG 1PP9G 3H1LJ 3TNUB 5KKZB 4N78D 5AVVB 3PHF2 1R4TA 4JJFA 4LDRA 2YLDA 1SQXG 3K66A 3NKDA 1SQQE 3L73D 1U89A 1ZP0C 2V7QJ 3ABMC 3UMHA 3ABLC 4EDFA 1LT9C 1IK9A 5JSLA 2WMMA 2B0HA 1G2CB 2G8YA 2G3AA 2CCYA 3SNHA 3BATA 4CX9A 2P0NA 3H6PA 4EYYQ 2A0BA 1LT9A 3AG2C 5TISE 1V74B 3QW0A 3TYYA 1CI6B 3OWTA 1NU7D 2FXOA 3U2LA 2C9LY 4ZMDA 4D6TD 1N8RQ 3LS1A 1TR2A 5GPGB 4IARA 2A45I 4N78E 5GTHH 1BGYD 2ZXEB 2H89C 2K1AA 4OIPF 1GK6A 2XS8A 3TGUG 1BDDA 2XLVA 2C0WA 2NPSB 3T4RA 1P84D 3L75D 3W4YA 4OGQC 4ZKUA 1WMKA 1HY5A 4MVZA 4CBEA 1PV3A 5BQGA 2G3KA 3IPMO 1NH4A 1R5SA 2R7OA 1ZHXA 2VC9A 3L71G 3MP7B 2D2CC 1Z6AA 1KQFB 3PHLA 3H1KJ 3B0UX 4JTAB 1M1KQ 4BJTA 1L0LJ 2E5YA 3VAYA 1BGYE 5KYXA 2P7JA 1S2EA 1NU1K 5F28E 2GUSA 1SQPG 3E70C 2IBZE 1LGHB 2YLIA 3UGPA 4TT3H 4EBBA 1A02F 2WSEJ 5L0FA 2L7AA 2A45G 2OTKE 4WGZA 1P84E 3A0HH 1BSNA 3MUDC 3V6IA 5AC5A 4N4WA 2C04A 4BWNA 3RK3D 1ST6A 4XPYA 1ZR2A 1ZHWA 4OD4A 4NPFX 3Q6NA 4ZLCA 1IC2A 2Q4FA 3BEHA 1YQ4C 3CXHH 5AW1B 5KLVD 5AVZB 3A2AA 3EG9A 3EH1A 1PL5A 1SMYF 3BCCE 2XL4A 5APYA 1GU5A 4JVSA 3MIWA 4ONSA 2RH0A 4ASVA 1NAFA 1SQXE 2HR3A 4DOZA 5AW3B 1TFKB 1J1DB 1S5LE 4WY4A 3T97B 3RL0B 3EJNA 1ZR4A 1C02A 1CPRA 2ZXOA 1VQMP 3H2UA 3ZWIA 1IFMA 3RK3E 2Y3BA 5CCHD 3VMYA 2CK3H 3RL0C 3LLIA 4J30B 3L73J 1O3UA 3HNLA 5APXA 3P8MC 1HTLC 5KLVE 2HJMA 1PGPA 1LVKA 1HWTC 3C1LA 3PH0A 3AEGC 1OW7A 3BRVB 4KHXA 3JCUH 1HGVA 3ITKA 2KNHA 3S4RA 4W8PA 5CHXA 3TGUE 4CS8C 3RF3A 2BEZF 2E74C 2YO2A 2LIGA 2AEFA 4O9BA 4OIQF 3N0TA 3D71A 3EQLF 2EPMX 3BASA 1G4WR 1URQD 1J2JB 3L75J 3PRJA 4MNDA 2ZPAA 2K37A 4KBLA 1VOMA 5CI9A 2GFHA 1KB9I 4Z1MH 1VQOP 2LFDA 4PV1D 3DJUB 4GODA 4B6IA 2P10A 3IN6A 1SQPE 4JCZA 1GQAA 2XDJA 3B5NC 2J7PA 3V2QA 3PJSK 3LEOA 4CDVA 3VYIA 1CGOA 4U5DE 4EIYA 5KTBA 2WWWA 3D6YA 3LLKA 3B5NA 4LERA 1DD3A 4DBRA 1NVOA 4AX2A 4N3YB 4KI2A 5APTA 1Q82Q 4YXWH 1CZQA 3ZG1A 3FHDA 4IAQA 4MVRA 3AGTA 2H8PD 2O1JA 1CW5A 2H7VC 4C3BA 2HODB 5KYUB 1NKNA 1IFJA 1O5HA 2XNXA 3R2PA 2AWYA 2K88A 5KYWB 4LGDE 2JWAA 2Z4EA 1NTZJ 1LTGC 2OOCA 3EGXA 2Q3EA 3MZWB 3DE8A 1T6UA 3SXYA 2F22A 1FDOA 3MX3A 1SQXK 2B88A 3W67A 1JY2N 2IYLD 4AYCA 2KK1A 2KI7B 1TU3F 1WN0A 3PLNA 2OYOA 3ECSA 2XL8A 3KZIH 3CMEP 3CEXA 1A7EA 4C3EA 3L70J 4YT8A 1OFCX 4Q4ZF 1JY3O 4W80A 3VF0A 4OINF 3EGDA 2HSQA 4JYBA 5B66E 2XRHA 4UB8H 2G62A 3FOOA 1BR4A 1V55C 3I5CA 3C63A 3DWWA 5BQIA 1Q0KA 3U59A 3NYJA 4O7GA 1NZEA 3SFEC 2UUIA 5A6BD 2Q9AA 2HZ8A 5TJHA 3F46A 1EA8A 4A2NB 2E76C 3NXSA 4JJGA 3GHGB 2IOQA 2AWCA 2CPBA 3L4FA 4O79A 4IGGA 1A0BA 2AXTH 2RMZA 1K05A 4JC7A 3GHGC 1ZHYA 5F5HA 3A9CA 1NGMB 4CIPA 2JPUA 2KZJA 2LXCB 1QL2A 2HJ3A 4AE4A 4I1LA 1YJWP 3CMAP 1MMGA 2B0JA 4PJ0H 1FFHA 4XLPF 5CCGC 4H4KC 1LTAC 1N7SD 2Q00A 5KAIE 1QEXA 2DYRC 3LJBA 4WVZA 1QGKB 3KH2A 3RK3C 1VQLP 5CCGA 1SQPK 4N06A 1WGWA 3POVA 1RJ9B 2CW0F 1JTHB 3CWBD 1BE3G 4YN0B 2QNLA 3MLGA 4MQ9F 3WAQA 3K1HA 2AU5A 2D4UA 1MKMA 3H32B 2OEVA 4W8KA 2X0CA 2YKQA 3BRTB 1FDIA 4EI2A 2G3VA 4MTGA 2NG1A 5CIVA 1LM3B 1M2OA 2AVKA 4WABA 1Q0GA 2QJKB 1BBHA 2XZRA 5JLIA 3LNMB 2WPVB 1HMDA 1KB9E 2GWWA 1L4AD 1M2VA 5KYYA 1OX3A 3IEEA 1L0ND 2R5DA 4H0LD 2QY9A 3G3ZA 3CWBE 3H1HD 1PGQA 1PIXA 3NFQA 2I8BA 1LJ2A 1GD2E 1SFCC 2NRGA 3O6QB 4JZAA 2HUJA 3FXHA 3L36A 2Z15A 4CSAC 5AVXB 3B0PA 1L3PA 4RKUJ 3LW5H 1SFCA 3II6A 2IDBA 1A7VA 3DAFA 3Q3DA 4E0IA 3U0CA 1GGQA 5BVZA 3DKAA 5COFA 3U8VA 1NTKJ 1LKXA 3GODA 1LNQA 2YKZA 3FAPB 3JYYA 4OVNF 3RQFA 1L0NE 3IHUA 5EFWB 2GUVA 1W2WA 2NPUA 1D7MA 4NPEA 5L0JA 5CBOA 3C8GD 2QJPB 1B68A 2JJLA 3AG4C 4E0HA 3AE5C 5B3IA 4A7PA 1VL2A 1VQ8P 3TJ5A 1EXJA 1UIXA 2XKMA 4EBJA 1OMIA 3UGOA 1S4XA 2IM8A 4DVZA 4GQHA 1S1CX 2XU6A 4MVUA 5GTIE 3SYNA 1KYOD 1T2KD 4XA4A 3WUVA 3ZC4A 3V5XA 2XLOA 2W9YA 2B87A 3M9QA 1BCCJ 3I5PA 3AG1C 3H1LG 1ZLLA 2R32A 3TDKA 1LWUB 4QMAA 1BE3E 3O39A 5AW7B 1OCZC 1FJKA 3CX5H 1FMWA 3GM1A 4RO0A 5FZTA 3NYLA 3OA7A 5APQA 1FE6A 3HTKB 1QZXA 4KJMA 1KYOE 4IAOA 2JP3A 4YK5A 1GDTA 4CIHA 3GANA 1EDJA 1LP1A 2D2CD 1VQNP 2WSCH 1I5NA 3L1MA 3EZIA 2R7VA 2NSFA 5KAFE 1FAVA 2QM7A 1GMJA 5L0DA 4EHPA 4W7YA 3B8EB 5AW4B 4Z9IA 2ZYAA 1YTZT 5APSA 2K9JB 4MN4C 3SWKA 3E7KA 1SLQA 3H1HJ 1AJYA 4P9FA 4C7NB 4B86A 2WT7B 2QTVA 4PD4I 1ZMEC 2XL6A 2L5GB 2Y9YA 1JPNA 2KK7A 3LIEA 4PJJA 2KC3A 3H1KG 3SEOA 5E33A 4G7HF 3HE5B 3GEEA 3HE4A 1L0LG 5BU5A 5DJTB 1C17M 1YVIA 2YWAA 1MMAA 1PPJD 1DOVA 5TISH 3CCSP 3MBGA 3RYLA 2BCCJ 4HFFB 1RXQA 3B71A 3CX5D 2QA4P 3TK0A 1Z63A 2OYHB 2EPNA 2J9VA 1LE2A 3RL0D 1NU1D 3S28A 1NTMK 4RESB 1FAPB 1ZW0A 2FFDB 1S05A 2M5AB 3CCQP 3T6GB 1SF8A 2RSEB 3L74D 3KPEA 4CDYA 3X2QC 3CC7P 3HD7C 2DW3A 3OAKA 4MS2A 4IFFA 3NKEA 1FU1A 3L35A 5KLIC 1PPJE 1YZAA 1AVOA 1TWCA 2HPCB 1KQSO 2WZ7A 1FZFA 3HD7A 1K73Q 2OJQA 3X1OA 5DS6A 2H7OA 5F5FA 2UUHA 1KV4A 2R7XA 2EINC 3DJNB 2E74D 4I7ZB 2YMKA 3EZHA 4PACA 1NU1E 4UB6E 3L73G 3QTHA 4YXDC 4LDKA 5AVTB 1A7DA 3E1IA 1Y6DA 2OQMA 3T9OA 1DIPA 1Q2NA 3RFYA 4I1MA 1P84H 1X22A 1VK5A 2J7PD 4XWJA 3QZCA 1RE3C 4QI2A 3O10A 5AW6B 3H1JD 5B3SC 2NUPA 3AE6C 3LW5J 2JD3A 3B5ND 3S1KA 2XLDA 3EFFK 1KU2A 3OEOA 4JYCA 3HUSB 2Y3HA 2LR2A 4PJNA 2M4EA 2K3RA 1VLTA 1FOSE 3TSIA 3CZ6A 3K6BA 2XV5A 4JQ0D 1YJ9P 1ZN5A 3CCUP 1VTMP 3ATPA 1S5LH 2YRFA 1XZPA 3UNGC 1CSBA 3UR3C 2FXPA 4R32A 3HNKA 3LEVA 2KS1A 1Q7YQ 2OQQA 3G9RA 3JRMO 5KKZC 1JUNA 4NTFA 4H13B 4G78A 3H1JE 4YWQA 3C8GA 1FZCB 1MQVA 1C03A 4BPMA 3USSA 1SQVJ 1BSHA 2KSFA 3TNUA 2CDQA 3IQ6A 1IFNA 4H13C 1FZCC 1T2KC 3L8IA 1JY2P 1U6HA 3RK2B 1EQ7A 1KILB 4O6NA 1FFTC 3LS0A 2IYPA 3GF3A 1X79B 3G6EP 2WZFA 1SS1A 1G2CA 2KW3C 1KD1Q 3AG3C 1AA0A 2Q5UA 1EQ1A 4PD4E 2FY8A 2IBZD 5APVA 1WOLA 3M1CB 1NTZG 1CI6A 3TF5A 3TQOA 2PP4A 4KT0J 3EH2A 5L0CA 1RF0C 5KJ7D 1S5LX 3EPVA 1OXKA 2ASRA 1WATA 1E85A 2NPSC 2AXCA 3DM9B 2W6BA 2OARA 2E76D 4PFPA 1RF0A 3SP1A 3SFDC 1FC2C 2EIMC 2KOGA 4NPDA 4X0RA 3I5QA 3ZIBA 5L0GA 3L70G 2VCCA 2NPSA 1GS9A 3BCCD 1PP9D 1APCA 3ZVRA 1E2XA 4ZLDA 1SQXD 1NLXA 3OW2O 3S27A 1LIHA 1QKRA 4JURI 5TJ5E 1OVRA 5CCGD 3CXHI 1YA9A 1HJBA 3JSEO 3WHNA 1RY3A 4XE5B 5A6AA 2HG5D 4I2LC 4CS9C 3M9HA 5AVQB 4JTDB 3V2PA 2Y0EA 3CPWO 2A06G 1Z5ZA 1SQQJ 4RBNA 3MUDA 3WUTA 3KHUA 5H2FE 2RKLA 2YZSA 1ZW3A 3L34A 1ZV8A 1U0BB 3H1IG 1M56D 3CD6P 4YT4A 4BRYB 3GWLA 1IFIA 3MD0A 2R7UA 1YYCA 1JMWA 1PP9E 1GW3A 3MYIA 4R4MA 3LIDA 3CL3D 1G4US 5B1BC 2BEQD 1VF5B 3NMJA 4GT1A 3TGUD 2ITAA 1RF1B 1NHLA 1VF5C 3J06A 3ZQVA 2AEJA 3T6BA 1GL2B 2FFHA 1MFZA 2QEXP 2OTLP 1L0LK 1J1DC 2XLWA 1NFNA 3M15A 5B5EE 2L9JA 3G4ZA 1RF1C 5B66H 3U5SA 2W90A 2Y3DA 3AQCA 1Q81Q 4QI0A 1AEPA 2KGOA 3L71D 1LE4A 2A1DD 1VPCA 2LSEA 4DT0A 2EPOA 1SFCD 3T97A 4N6JA 1MNEA 1ZU5A 5AVUB 1UG7A 1VQ4P 4MW8A 3P7KA 4GOEA 4J32B 3JSVC 4ZNCA 3DE9A 1SQPD 1OCCC 3NMKA 1JY3N 3GORA 1JCCA 3HRNA 2HMQA 4D6TJ 1N73B 2W6JH 4EUKB 1MV8A 1MZ9A 4CS8A 1BGYJ 2IX7C 1HJ0A 2W27A 2E42A 1NU9C 1RKCA 3Q1MA 3AE8C 1VQ6P 2OGUA 1N73C 2DI3A 3AEEC 3L71E 3CCEP 1ORJA 3M9BA 2B9BA 1J1EB 1LTJB 2WL8A 1H0TB 3EHMA 1N73A 5KAIH 3ITFA 3NDBB 1E84A 1RCPA 3M06A 3W8HA 4ULWA 2Q1KA 2H43A 2L81A 2A69F 3Q5RA 1OCOC 3K33A 2CGEA 3IFMA 3RKOF 3BCCJ 2QM8A 3IR9A 1NTKG 3C9IA 1CPQA 1HW2A 2A06E 4D4XA 3IAOA 1TKNA 4WJ0A 1JCDA 1Y8AA 2XXAB 1BR1A 1EZVI 2AEMA 3VYWA 3H1IE 4AL0A 4O6YA 3S29A 4EWCA 2QIWA 4BEJA 3ZDMA 2R05A 1KB9H 1ZYRF 4JPZB 4MVQA 1ZOYC 2JX0A 1SR2A 4J7YA 5KLVJ 2LKMA 3UIAA 2FYZA 2VASA 2HODA 1DD4A 5KYUA 2WSFH 1MMNA 2W8ZA 3WMM0 5KYWA 3L72G 4HKZH 2GA0A 3R7CA 1BCCG 4RJTA 2W4BA 3TGUJ 2N9YB 3MGNA 2O01N 4U3FG 1NOHA 4ER9A 5BUOA 1O87A 3VMZA 2R9RB 4YL3A 2E43A 2TMVP 2NZ2A 2YL0A 3T6JA 5CJ0A 3SZRA 4JF7A 4YT5A
chains in the Genus database with same CATH topology
4H0LB 2D2CC 1KQFB 3AECC 3U3FA 3K7DA 4Z1MH 4OGQD 4R4LA 4PV1D 4H44B 2WQYC 2P10A 3AEBC 3IN6A 2Q00A 4H0LC 3EWKA 1R8EA 1WOLA 5F28E 2MKVA 2HSBA 2FYNC 4H44C 4KT0J 3D6YA 1JOGA 1HJ0A 1Q90D 5KLIC 4EBKA 4TT3H 1VF5D 3Q1MA 3AE8C 1DD3A 2E75B 2WSEJ 3Q5SA 2YIUC 1S5LX 2QJPC 2ZT9B 3AEEC 1KTMA 3GM1A 3GM3A 1U57A 1RQUA 2E76D 2PBEA 3SFDC 2E75C 4H13D 1MKMA 3JZ0A 3S9OA 2E74D 2ZT9C 3C8VA 2QJYC 4I7ZB 4XFJA 2YMKA 4PV1B 1UFBA 1YQ4C 1K40A 4YTPC 3AEAC 1FDIA 4YXDC 3ABVC 1IK7A 2JP3A 1PL5A 3C8GB 1QVXA 3AEDC 2H88C 1DIPA 3Q5RA 2L6GA 2D2CD 2L6FA 2WPVB 1ZZPA 4XEKA 1WWPA 1FDOA 3O10A 3TULA 4Y28J 3AE6C 3LW5J 3RL0g 4H0LD 2E76B 4NQFA 1ZP0C 3T97B 1NYHA 2V7QJ 3BRJA 1PIXA 1GMJA 3IAOA 3D6ZA 4H44D 2E74B 2WSCJ 1OW6A 1KNYA 1TU3F 2KK1A 2QSIA 4OGQB 3AE2C 2G8YA 3AE9C 5L8RJ 3RK3E 2G3AA 3AE7C 2QIWA 2WSFJ 4RKUJ 1AJYA 1O3UA 2IDBA 3RQGA 3D70A 2K9YA 3GF7A 4I7ZC 1Y9BA 4PV1C 3R4YA 5M1BA 3Q3DA 1KMIZ 3AJMA 4R4MA 2E75D 3U0CA 2D2CB 1ZMEC 1JB0J 1OW8A 2BEQD 2ZT9D 1VF5B 1ZOYC 3Q5PA 2JX0A 4XEVA 1ZRTE 3AEGC 1OW7A 2FXPA 3H25A 4R32A 2O01J 1HF9A 3AEFC 3GM2A 3SFEC 3FGAD 1KQGB 3AE4C 2OQQA 1DD4A 2QJKC 3G9RA 2LK4A 1KILE 3L8JA 1VF5C 5KKZC 2H89C 3AE3C 4GDOA 4H13B 4IL6X 3AE1C 3JYYA 3RQFA 3C8GA 3Q2YA 1YQ3C 1EXIA 2YWAA 2E76C 3C8GD 1KORA 2BEZF 4H13C 3GMAA 3C18A 2E74C 1K04A 3AE5C 3L8IA 1WTYA 4OGQC 4U7JA 1WMKA 1RQVA 1VL2A 3GLMA 3B71A 1K05A 1EXJA 1UIXA 3D71A 2L6HA 1PV3A 1OMIA 2JO1A 2NZ2A 1V4AA 4XEFA 4EBJA 2J5UA 3O6QA 2FBWC 1S1CX 3GF3A 1NGMB 3MFNA 3RQEA 2JPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEC C;  3U3F A;  3K7D A;  2WQY C;  3AEB C;  2Q00 A;  1WOL A;  5F28 E;  2HSB A;  1JOG A;  4EBK A;  3AE8 C;  3AEE C;  1KTM A;  3GM1 A;  3GM3 A;  2PBE A;  3SFD C;  3JZ0 A;  3S9O A;  1UFB A;  1YQ4 C;  1K40 A;  4YTP C;  3AEA C;  4YXD C;  3ABV C;  3C8G B;  1QVX A;  3AED C;  2H88 C;  2L6G A;  2L6F A;  1ZZP A;  4XEK A;  1WWP A;  3O10 A;  3TUL A;  3AE6 C;  4NQF A;  1ZP0 C;  3BRJ A;  1OW6 A;  1KNY A;  2KK1 A;  3AE2 C;  3AE9 C;  2G3A A;  3AE7 C;  1O3U A;  3RQG A;  3AJM A;  3U0C A;  1OW8 A;  1ZOY C;  2JX0 A;  4XEV A;  3AEG C;  1OW7 A;  4R32 A;  3AEF C;  3GM2 A;  3SFE C;  3AE4 C;  2LK4 A;  3L8J A;  2H89 C;  3AE3 C;  3JYY A;  3AE1 C;  3RQF A;  3C8G A;  1YQ3 C;  2YWA A;  3C8G D;  3C18 A;  1K04 A;  3AE5 C;  3L8I A;  1WTY A;  3B71 A;  1K05 A;  2L6H A;  1PV3 A;  1V4A A;  4XEF A;  4EBJ A;  2FBW C;  3MFN A;  3RQE A;  2JPU A; 
#chains in the Genus database with same CATH topology
 4Z9J A;  1EZV G;  4NCQ A;  1SVF A;  5KJ7 C;  2Q7C A;  4H44 B;  3KYJ A;  2WVQ A;  3GG2 A;  1H89 A;  1ORY A;  1SQB G;  1HE9 A;  2I15 A;  5KJ7 A;  1NTZ K;  3B0V C;  1DEE G;  4H44 C;  1YJN P;  4AK9 A;  1SQP J;  4KNW A;  2WTY A;  1QLE C;  3SWY A;  3CCV P;  5GTI H;  1KTM A;  1U57 A;  1M57 C;  3JC2 2;  3I4U A;  4H54 A;  4I6M C;  1NTM G;  1FNT c;  1TWH A;  1D1B A;  3AOU A;  4CPG A;  3GHG A;  5AVS B;  1UFB A;  2AP3 A;  2PX0 A;  2O1K A;  2MYS A;  2JKV A;  2WPQ A;  3RIP A;  4DRJ B;  2IFN A;  5JUA A;  5AW8 B;  1FDM A;  1KB9 D;  2FYU G;  2W4M A;  1FMV A;  1L2P A;  1YIJ P;  2ZVO B;  4YL0 A;  1NTK E;  1TFO B;  2L6F A;  3GWN A;  3V7O A;  4GEH A;  1ZZP A;  1JMM A;  4AQR D;  3TUL A;  1AV1 A;  2Y0D A;  2OTJ P;  3ZQY A;  2M8R A;  3RL0 g;  1M56 C;  4HJG H;  3OJA B;  5E3A A;  1AVY A;  1FOS F;  3HD7 D;  1KYO H;  2NUT B;  2E5T A;  3A7O A;  1JRA A;  1OXZ A;  1L7C A;  1HH0 A;  1FR0 A;  4DBQ A;  1RJ9 A;  5CJ4 A;  3IQ5 A;  1T3U A;  1JTH A;  2ZVN B;  2IZ1 A;  2BCC G;  4JBZ A;  1USD A;  2HV6 A;  3OA1 A;  1HE1 A;  2NSG A;  2LP4 A;  3H32 A;  4AL1 A;  5KAF H;  1IFD A;  1ZHT A;  1T5O A;  3K1I C;  3AEF C;  4DCK A;  1NAY A;  3QH9 A;  2R5B A;  1FZG A;  1T6I A;  4QDL A;  2QJK C;  3L72 E;  4M63 A;  3AE3 C;  3HNI A;  3AE1 C;  3IF4 A;  5E79 E;  1BCC E;  1E5W A;  2MJZ A;  3JT1 A;  2J0W A;  3S90 A;  4XQ1 A;  3KKB A;  1YQ3 C;  4N6C A;  1OQC A;  2YIU B;  2QLA A;  4U3F E;  3WG7 C;  1M1J B;  2O01 H;  3GEH A;  1DOW A;  1WTY A;  4JRZ A;  4OWF A;  1W5C E;  1H8A A;  2JDI H;  4CSA A;  3O6Q A;  4WGY A;  2XND H;  4L6R A;  4RDA A;  2M0B A;  1VQ7 P;  2Q3T A;  2M3E A;  3PP5 A;  4IL6 E;  1SQB E;  3NYM A;  1SYQ A;  4DRH B;  1IZM A;  5E2Q A;  5DVW A;  1TQG A;  1BE3 D;  1XTC C;  2HSB A;  2X51 A;  3E9V A;  2UWJ E;  1JOC A;  2R7Q A;  1FBM A;  1IZN B;  5T3W A;  2E75 B;  3Q5S A;  2QJP C;  2QJY B;  1NTM E;  1URQ B;  1USE A;  3FMS A;  2E75 C;  4IRU A;  4H13 D;  3S0X A;  3S9O A;  5KYN A;  2QJY C;  4PV1 B;  2OYI B;  1JPJ A;  3CCM P;  2IBF A;  3EFO B;  1GZL A;  1LTT C;  3ABV C;  4RD9 A;  3JRT A;  2FYU E;  2ZAE B;  3NRH A;  2CPS A;  3KXD A;  1QVX A;  2P61 A;  2YVK A;  3W2V A;  2R7R A;  2OYI C;  5AW2 B;  2WPS A;  4IJJ A;  3FDQ A;  1MMD A;  1KIL D;  1NTK K;  1OXB A;  2C0X A;  1KFM A;  2A6E F;  1LWU C;  4JIO A;  2EIK C;  1N2D C;  1F1M A;  4UB6 H;  1PD1 A;  3CWB J;  1SQV G;  5T3T A;  2QE9 A;  1LWU A;  4ZKP A;  4G7O F;  2YKP A;  1YA7 O;  2WSF J;  1JNM A;  2NPS D;  4E18 A;  3HTK C;  4HE8 D;  1Y47 A;  4U9E A;  2VH3 A;  3B4S A;  2JWD A;  4TLF A;  1M90 Q;  1HBW A;  1Q0F A;  4C3D A;  3SWF A;  2O9X A;  2DGJ A;  4XEV A;  1S3J A;  2KNC B;  3HTK A;  1HF9 A;  1Q0M A;  2EPL X;  2LCH A;  1KQG B;  2LK4 A;  1LI7 A;  1GM5 A;  1KIL E;  2FYN B;  1H6G A;  3KDP B;  3V2R A;  5AVW B;  4D4N A;  1YBK A;  1T6A A;  2HS5 A;  3Q2Y A;  1FS0 E;  2KSJ A;  4NTB A;  1L0N J;  1D0Y A;  3GMA A;  1XZQ A;  2E87 A;  1K04 A;  1NO4 A;  3SXZ A;  1RH5 B;  2FAP B;  4U7J A;  1N86 A;  4E7Z A;  1LTI C;  3PCV A;  2A0U A;  3MFN A;  3RQE A;  2K9J A;  3AEC C;  3H1L D;  3H65 A;  2YL3 A;  4CDA A;  2WSE H;  1IFP A;  4C7N A;  2J59 M;  2WT7 A;  1R8E A;  1ORS C;  1WAS A;  2EPK X;  1SQB K;  1ZW2 A;  1OVV A;  2RD9 A;  4JTC B;  3ZSU A;  2OU6 A;  2A6H F;  1VF5 D;  4NY3 A;  4G0H A;  3P8C D;  2XSE A;  2ZT9 B;  2R7T A;  2CYD A;  3HE5 A;  4HFK B;  1LS4 A;  1BE3 J;  2ZFC A;  4U9D A;  3ZTM A;  1YLM A;  1GL2 D;  1SQQ G;  4PD4 H;  1U7M A;  2ZT9 C;  2OYH C;  4AUW A;  1N7S B;  4YTP C;  3W8I A;  2QE7 H;  3H1L E;  1JMB A;  3CSK A;  4PR9 A;  1ZRT D;  2OYH A;  2FFD C;  2FYU K;  3B9Q A;  4I44 A;  3PDM P;  4BXL A;  3W68 A;  3CC2 P;  2ZJS E;  2YKO A;  1JY3 P;  3VRC A;  4N6H A;  1WWP A;  2BC5 A;  2EIL C;  2FFD A;  2M5A A;  3KYI A;  2GAQ A;  2PRR A;  2PFX A;  3P8C E;  3D6Z A;  1HVV A;  2I1J A;  5HV9 A;  1P84 I;  4C46 A;  1KC8 Q;  4C7O B;  1M6T A;  3EFG A;  1H88 A;  2CNW D;  4XLN F;  4FAP B;  2Y39 A;  2BE5 F;  3AE7 C;  1Q86 Q;  2GM4 A;  1Z56 A;  5COG A;  3RQG A;  1S9K D;  2HPC A;  3D70 A;  2RN0 A;  1W2E A;  3GF7 A;  4I7Z C;  1J8M F;  3H1K D;  3U2M A;  1JB0 J;  2R7S A;  2KB7 P;  1JO5 A;  4JE9 A;  3BVH A;  1L0L D;  1L4A B;  1ZRT E;  2P67 A;  2O01 J;  3CCL P;  3WOD F;  1RKE B;  3FGA D;  4YT2 A;  5H2F H;  1RE3 A;  4G7Z F;  3RBX A;  2XLM A;  2OKU A;  4D6T G;  5A69 A;  1T3J A;  2PFD A;  1KOR A;  5EK0 A;  2M3B A;  1BGY G;  1NJI Q;  3HKK A;  3HUS C;  4WB4 A;  3C18 A;  1VQK P;  5A6K A;  5C39 A;  1VQ9 P;  1RKE A;  3QWO C;  2H8A A;  2YL1 A;  3G4S P;  2R3S A;  1RE4 C;  1S9K E;  4K7B A;  1TWA A;  3HUS A;  3KYQ A;  2J5U A;  3M91 A;  3DI5 A;  3H1K E;  3L75 G;  1R5L A;  2KIK A;  4PD4 D;  1L0L E;  5AVY B;  5B5E H;  1RE4 A;  2DYS C;  2J8W A;  3K7D A;  1QX8 A;  4U5B E;  1YTZ I;  2KLV A;  1MUU A;  1Z23 A;  256B A;  5AC4 A;  5L3Q A;  1Y4C A;  1Q90 D;  1S7Z A;  2HV7 A;  3AGU A;  4MTF A;  1LT9 B;  2ZD9 A;  1FZC A;  3C7J A;  1RQU A;  1NWQ A;  3ZDL A;  1OVU A;  1K9M Q;  3RK2 C;  3ZTZ A;  1MND A;  4PJL A;  1SP4 A;  1KIL C;  3AEA C;  1IK7 A;  1GW4 A;  1NU1 J;  3AED C;  3QVY A;  3S84 A;  1KIL A;  1H9T A;  3CC4 P;  1OKK D;  5AW5 B;  2HMZ A;  1NFO A;  5KLV G;  5JS5 A;  1E83 A;  2Q6Q A;  1YI2 P;  2XM4 A;  4Y28 J;  3F47 A;  5DQT A;  3Q7L A;  1LTB C;  3L74 J;  1NYH A;  2I1K A;  4DJ9 A;  4A4A A;  1QVG O;  4H44 D;  4WWI A;  2WSC J;  2FGY A;  5BU8 B;  1QLE D;  3L73 E;  4OGQ B;  2VRS A;  1SQV K;  2Y0C A;  1EDL A;  2OCC C;  1FZB A;  2HFE D;  1EDI A;  2A45 H;  1M57 D;  2W83 C;  3VOP A;  4XTK A;  3O8Z A;  3N7N A;  2D2C B;  1AQ5 A;  5KYX B;  1OW8 A;  1HMO A;  1FZA A;  2N1T B;  3FX0 A;  3E1R A;  2YQY A;  1X8Y A;  3Q5P A;  4K0D A;  1I4Y A;  1WT6 A;  3GM2 A;  5AVR B;  2EIJ C;  3H2V A;  3DZA A;  4MTO A;  2N1T C;  4FWV A;  2ETS A;  3MTU E;  4D6T E;  2YEV A;  3V5B A;  2XS1 A;  4U5E E;  5D91 A;  5K0I A;  2XM0 A;  3US6 A;  1YYJ A;  1EC5 A;  1EXI A;  1NSG B;  5JRA A;  3H1J J;  2N1T A;  3NMD A;  4CS9 A;  3FAJ A;  2V26 A;  3U8P A;  1M7L A;  2J46 A;  3EG9 B;  4YL1 A;  5DLJ A;  1MFT A;  3L75 E;  2L6H A;  2JO1 A;  2PF4 E;  1DH3 A;  1YIT P;  1NTZ D;  1EKY A;  4WY4 B;  3CCJ P;  2WQY C;  4BRY A;  3MYF A;  2YXR B;  4GKG A;  4MW3 A;  5BQH A;  4GIF A;  1M8O B;  3ASO C;  4WY4 C;  1BDJ B;  1GL2 C;  2ICW G;  3RVY A;  2V4H A;  3FXD A;  3QMK A;  4C7R A;  1RF1 A;  2PNO A;  3L70 D;  1OR2 A;  1GL2 A;  3CAX A;  5DS4 A;  3JZ0 A;  3FWL A;  1SQQ K;  2Z5H A;  1T01 A;  2IZ0 A;  1E79 H;  4P6I C;  2WVR A;  4F4B A;  2W45 A;  1VYK A;  1NTZ E;  2WVO A;  1LT1 A;  2H88 C;  2P7V A;  2Q3I A;  5IY5 C;  1N1C A;  3UMI A;  5DQZ A;  1OZH A;  2Z5I A;  2A06 D;  2XLH A;  4Z9H A;  4BJ6 C;  1PZQ A;  4ASW A;  3RH3 A;  1HGZ A;  2H7B A;  3FWN A;  2SPZ A;  3VMX A;  4BJ6 A;  2CNW A;  3H1I D;  1KFN A;  3L70 E;  3VP9 A;  2E74 B;  2XLE A;  2QSI A;  5GTH E;  3I56 P;  3AE9 C;  2WB7 A;  1X9V A;  4DZO A;  1J1E C;  1LTJ C;  2BL2 A;  2POH A;  2R02 A;  1LPE A;  3U3B A;  2E75 D;  3RGU A;  1LTJ A;  4OH8 B;  1PP9 J;  1YAR O;  2KYH A;  5EHH A;  1H0T A;  1PFI A;  1T9K A;  1XWJ A;  3B5N B;  2BAS A;  4HH2 A;  1SQX J;  4YJW A;  1VDF A;  1K8A Q;  4IB4 A;  4GDO A;  4LLE A;  2A68 F;  4BG0 A;  3CXH D;  3U9M A;  3M4B A;  4BJ1 A;  3CLQ A;  1EI7 A;  3U1C A;  4P9T A;  1OR3 A;  3EHN A;  3VMA A;  3KPH A;  2IXP A;  5HSW A;  1LTS C;  3DAG A;  1YAU O;  2LFF A;  1S72 P;  1RQV A;  2P1J A;  2J58 A;  1AFO A;  1V4A A;  2KQ9 A;  2M64 A;  4XEF A;  1QPU A;  2J45 A;  3F5H A;  3FOP A;  1NKZ B;  5E79 H;  4CJG A;  2XXA A;  3EGX B;  1OWA A;  3A0H E;  2C9N Y;  1YHQ P;  1DX7 A;  3U3F A;  1DEB A;  1WRG A;  1KQL A;  5CMZ A;  3LNR A;  1BDC A;  3U9J A;  3CXH E;  5K5G B;  2LXB A;  2QRX A;  1QQ3 A;  2ZXR A;  3Q6M A;  1JOG A;  3UMK A;  1D1C A;  3V4W A;  2WVN A;  2Q9B A;  3EGD B;  3V5Z A;  1FJP A;  2PBE A;  3F89 A;  3VN0 A;  4IFM A;  4IL6 H;  4BEM J;  2R3C A;  4L75 A;  4WBA A;  3CWB G;  3L71 J;  2N9B A;  4GOF A;  2KZI A;  1K40 A;  4U5G A;  1NG1 A;  3N2Z B;  1NTK D;  1D1A A;  1OKK A;  3DXJ F;  1W2B O;  4IFD K;  2D5R B;  3FVY A;  1PD0 A;  1FZE A;  4MVS A;  2HYN A;  1XTG B;  3LES A;  5KLV K;  1OIP A;  4L73 A;  3C8Z A;  2B89 A;  3KQG A;  4NQF A;  2E76 B;  4HEA J;  2ZXW C;  1U7J A;  3ASN C;  3JYH A;  5JP7 A;  1KZU B;  4EIJ A;  5L0I A;  2OG2 A;  4DXW A;  3TD7 A;  3U1A A;  4XPW A;  3JCU E;  4AE4 B;  1L0N G;  5L8R J;  3L0I A;  3H1H G;  2VCB A;  3IQC A;  4E7S A;  4Q7C A;  2VB6 A;  3H1I J;  2PGD A;  3AJM A;  1Y9B A;  5M1B A;  3N24 A;  1KYO I;  1A41 A;  3C62 A;  2J9U A;  2ZT9 D;  2OJE D;  3V5Y A;  1JAF A;  3L72 D;  1IO4 A;  3VTP C;  1BCC D;  1OCR C;  5E3C A;  4U5C E;  3RK3 B;  2OEX A;  4IL6 X;  3CQZ A;  3JCU Q;  4U3F D;  2WZL A;  3RBZ A;  1JM0 A;  2QG4 A;  4ULV A;  4ANJ A;  3VM6 A;  4IOI H;  3M0D C;  1EDK A;  5APW A;  1EZV D;  1CGN A;  5A6J A;  3WUU A;  2KUB A;  3QW1 A;  2NUT A;  2J9W A;  2FBW C;  2ZYD A;  3M0D A;  1BR2 A;  1SQB D;  1RHZ B;  3N4X A;  2H7H A;  1M2V B;  1GK4 A;  1H7I A;  5KYY B;  3RW0 A;  3V2N A;  3K1I A;  1HUC A;  1JY2 O;  5L3V A;  4J7T A;  2IXN A;  4LAC B;  2MKV A;  2I8D A;  5CBN A;  3A3Y B;  1AUE A;  4JKV A;  1NTM D;  4DRI B;  2KXP B;  2R44 A;  1G8X A;  1SFC B;  2Y9Z A;  3NTN A;  5CCH C;  2YIU C;  4LLH A;  2IFM A;  1M1J C;  2KP8 A;  2HLO A;  1D0X A;  1Z3I X;  3JTL O;  1EZV E;  2IYO A;  2KSE A;  5CCH A;  5DS5 A;  3C8V A;  2FYU D;  4JEA A;  1M1J A;  1T8Z A;  2VCA A;  3LAY A;  1T6Q A;  1QL1 A;  3PTZ A;  3KZI E;  4O6M A;  3GW6 A;  3G71 P;  2IPP A;  2L6G A;  2P1A A;  1SZI A;  1IJD B;  3NMI A;  2Q9I A;  5D92 A;  4UB8 E;  3A11 A;  2V3C C;  1PGJ A;  4OIO F;  3ABK C;  3A5T A;  3BRJ A;  1H9G A;  5FCL A;  2QUP A;  2BCC D;  3DM5 A;  4JCH A;  3H1H E;  5AGF A;  2DB4 A;  1PGO A;  1AQT A;  3CX5 I;  1URQ C;  1YZC A;  3AQB A;  1YYX A;  2P2U A;  2IXO A;  4LDQ A;  2YXQ B;  2Q7R A;  3SSU A;  4HB1 A;  2K9Y A;  2MWQ A;  4PV1 C;  3R4Y A;  2V7Q H;  1KMI Z;  3RK2 D;  1URQ A;  2B87 B;  1G1J A;  4CJO A;  3Q7G A;  5CI8 A;  4PJM A;  1QSP A;  4XPX A;  3H25 A;  2AXT E;  4L74 A;  2OYI A;  2YNY A;  3EFO A;  4PFO A;  3L8J A;  1UII A;  2W6A A;  1I4Z A;  1VB5 A;  3L72 J;  5JT4 A;  4PJ0 E;  3HJC A;  2YMY A;  3L37 A;  2BCC E;  3K5B A;  3TOM A;  4MVM A;  1JR8 A;  3A0B H;  4U3F J;  1PPJ G;  3O6X A;  1LP1 B;  1N7L A;  2ZXP A;  3KMI A;  2J9B A;  5AW9 B;  3SXK A;  1Q0D A;  4W7Z A;  4OGQ D;  4I3M A;  4NC3 A;  4DOJ A;  2MHR A;  1KN7 A;  1A02 J;  1JEK A;  3AEB C;  3CI9 A;  1NU1 G;  2L91 A;  3W2W A;  1SQB J;  2FYN C;  3P32 A;  5EGY A;  2KNC A;  4NTA A;  4EBK A;  2N1T D;  5AW0 B;  3WU2 H;  2PX3 A;  2PAJ A;  1VYI A;  3L74 G;  1GTW A;  4K1O A;  1LS1 A;  2WSS H;  4K3A A;  1VLS A;  1GU4 A;  1R5I D;  1NTM J;  2WPR A;  3PMR A;  4FX5 A;  3FXE A;  5DJU B;  4XFJ A;  1LI5 A;  2LD6 A;  1RMV A;  3O55 A;  3VP8 A;  3GEI A;  2Y69 C;  4OIR F;  3M0A A;  3B29 A;  3HE4 B;  4GYT A;  2J0X A;  2WZG A;  2FXM A;  2FYU J;  1QVF O;  2R03 A;  2LQG A;  2WIT A;  1FTS A;  2Q9C A;  5COM A;  5A6B A;  4XEK A;  1ZXG A;  3TJ6 A;  2ZXX A;  1SQV D;  4LC1 A;  2P6V A;  2JEE A;  3IQT A;  3HLZ A;  4K35 A;  4WY4 D;  4JEB A;  1ZU4 A;  4KC9 A;  1OW6 A;  1KNY A;  4DVY P;  1YJG A;  3H1J G;  3AE2 C;  1TWG A;  2KJG A;  4M3L A;  1L0N K;  2JR8 A;  1J8Y F;  5B1A C;  4FES A;  1IW7 F;  3HNJ A;  2YO3 A;  1G5Z A;  3DD7 A;  1Z7Q c;  1N7S C;  3TOL A;  1E86 A;  4KNV A;  3RVZ A;  2Y3G A;  2PP6 A;  2IBZ I;  1N7S A;  3AE4 C;  3TK1 A;  1AVO B;  2IXM A;  4LLC A;  3G50 A;  2HFI A;  3HD7 B;  1SQV E;  4E17 A;  1HW1 A;  5KLI B;  4DJG A;  2YLG A;  2KLU A;  4BJ5 C;  1G1I A;  3QVZ A;  4JW1 A;  3MHV A;  2GA1 A;  2KYV A;  4PK4 A;  3G4X A;  3GLM A;  3CCR P;  3LUT B;  4BJ5 A;  4Q5S F;  1CGM E;  3A0B E;  1VQP P;  5APU A;  4U5F E;  4C7O A;  3CX5 E;  5T1D B;  4H0L B;  3M79 A;  2NUP B;  4R4L A;  2QVA A;  1L4A C;  1PCX A;  4H0L C;  2YL7 A;  3EWK A;  4I1O B;  4IWB A;  4Y99 B;  2YHS A;  4HYT B;  1VQ5 P;  1L4A A;  1ZVZ A;  4YPC A;  1X0T A;  3L74 E;  2R25 A;  1SQQ D;  2C03 A;  4MVO A;  4Y99 C;  2ZYG A;  3EQ2 A;  3NG1 A;  2IBZ G;  4L76 A;  5L0H A;  4EKW A;  3GM3 A;  1NBB A;  3SXM A;  4EOT A;  3WU2 E;  3KL4 A;  1ZHZ A;  1D0Z A;  1V54 C;  2HKV A;  3DMD A;  3I55 P;  1YDI A;  1BZ4 A;  2P58 A;  2FKW B;  3M4C A;  4UDV A;  3V4Q A;  4U5H A;  2KS1 B;  2R7W A;  3JSZ A;  5JVE A;  2O3J A;  3C8G B;  4OD5 A;  1VMA A;  2GDC A;  4CS7 A;  3BCC G;  1PP9 G;  3H1L J;  3TNU B;  5KKZ B;  4N78 D;  5AVV B;  3PHF 2;  1R4T A;  4JJF A;  4LDR A;  2YLD A;  1SQX G;  3K66 A;  3NKD A;  1SQQ E;  3L73 D;  1U89 A;  1ZP0 C;  2V7Q J;  3ABM C;  3UMH A;  3ABL C;  4EDF A;  1LT9 C;  1IK9 A;  5JSL A;  2WMM A;  2B0H A;  1G2C B;  2G8Y A;  2G3A A;  2CCY A;  3SNH A;  3BAT A;  4CX9 A;  2P0N A;  3H6P A;  4EYY Q;  2A0B A;  1LT9 A;  3AG2 C;  5TIS E;  1V74 B;  3QW0 A;  3TYY A;  1CI6 B;  3OWT A;  1NU7 D;  2FXO A;  3U2L A;  2C9L Y;  4ZMD A;  4D6T D;  1N8R Q;  3LS1 A;  1TR2 A;  5GPG B;  4IAR A;  2A45 I;  4N78 E;  5GTH H;  1BGY D;  2ZXE B;  2H89 C;  2K1A A;  4OIP F;  1GK6 A;  2XS8 A;  3TGU G;  1BDD A;  2XLV A;  2C0W A;  2NPS B;  3T4R A;  1P84 D;  3L75 D;  3W4Y A;  4OGQ C;  4ZKU A;  1WMK A;  1HY5 A;  4MVZ A;  4CBE A;  1PV3 A;  5BQG A;  2G3K A;  3IPM O;  1NH4 A;  1R5S A;  2R7O A;  1ZHX A;  2VC9 A;  3L71 G;  3MP7 B;  2D2C C;  1Z6A A;  1KQF B;  3PHL A;  3H1K J;  3B0U X;  4JTA B;  1M1K Q;  4BJT A;  1L0L J;  2E5Y A;  3VAY A;  1BGY E;  5KYX A;  2P7J A;  1S2E A;  1NU1 K;  5F28 E;  2GUS A;  1SQP G;  3E70 C;  2IBZ E;  1LGH B;  2YLI A;  3UGP A;  4TT3 H;  4EBB A;  1A02 F;  2WSE J;  5L0F A;  2L7A A;  2A45 G;  2OTK E;  4WGZ A;  1P84 E;  3A0H H;  1BSN A;  3MUD C;  3V6I A;  5AC5 A;  4N4W A;  2C04 A;  4BWN A;  3RK3 D;  1ST6 A;  4XPY A;  1ZR2 A;  1ZHW A;  4OD4 A;  4NPF X;  3Q6N A;  4ZLC A;  1IC2 A;  2Q4F A;  3BEH A;  1YQ4 C;  3CXH H;  5AW1 B;  5KLV D;  5AVZ B;  3A2A A;  3EG9 A;  3EH1 A;  1PL5 A;  1SMY F;  3BCC E;  2XL4 A;  5APY A;  1GU5 A;  4JVS A;  3MIW A;  4ONS A;  2RH0 A;  4ASV A;  1NAF A;  1SQX E;  2HR3 A;  4DOZ A;  5AW3 B;  1TFK B;  1J1D B;  1S5L E;  4WY4 A;  3T97 B;  3RL0 B;  3EJN A;  1ZR4 A;  1C02 A;  1CPR A;  2ZXO A;  1VQM P;  3H2U A;  3ZWI A;  1IFM A;  3RK3 E;  2Y3B A;  5CCH D;  3VMY A;  2CK3 H;  3RL0 C;  3LLI A;  4J30 B;  3L73 J;  1O3U A;  3HNL A;  5APX A;  3P8M C;  1HTL C;  5KLV E;  2HJM A;  1PGP A;  1LVK A;  1HWT C;  3C1L A;  3PH0 A;  3AEG C;  1OW7 A;  3BRV B;  4KHX A;  3JCU H;  1HGV A;  3ITK A;  2KNH A;  3S4R A;  4W8P A;  5CHX A;  3TGU E;  4CS8 C;  3RF3 A;  2BEZ F;  2E74 C;  2YO2 A;  2LIG A;  2AEF A;  4O9B A;  4OIQ F;  3N0T A;  3D71 A;  3EQL F;  2EPM X;  3BAS A;  1G4W R;  1URQ D;  1J2J B;  3L75 J;  3PRJ A;  4MND A;  2ZPA A;  2K37 A;  4KBL A;  1VOM A;  5CI9 A;  2GFH A;  1KB9 I;  4Z1M H;  1VQO P;  2LFD A;  4PV1 D;  3DJU B;  4GOD A;  4B6I A;  2P10 A;  3IN6 A;  1SQP E;  4JCZ A;  1GQA A;  2XDJ A;  3B5N C;  2J7P A;  3V2Q A;  3PJS K;  3LEO A;  4CDV A;  3VYI A;  1CGO A;  4U5D E;  4EIY A;  5KTB A;  2WWW A;  3D6Y A;  3LLK A;  3B5N A;  4LER A;  1DD3 A;  4DBR A;  1NVO A;  4AX2 A;  4N3Y B;  4KI2 A;  5APT A;  1Q82 Q;  4YXW H;  1CZQ A;  3ZG1 A;  3FHD A;  4IAQ A;  4MVR A;  3AGT A;  2H8P D;  2O1J A;  1CW5 A;  2H7V C;  4C3B A;  2HOD B;  5KYU B;  1NKN A;  1IFJ A;  1O5H A;  2XNX A;  3R2P A;  2AWY A;  2K88 A;  5KYW B;  4LGD E;  2JWA A;  2Z4E A;  1NTZ J;  1LTG C;  2OOC A;  3EGX A;  2Q3E A;  3MZW B;  3DE8 A;  1T6U A;  3SXY A;  2F22 A;  1FDO A;  3MX3 A;  1SQX K;  2B88 A;  3W67 A;  1JY2 N;  2IYL D;  4AYC A;  2KK1 A;  2KI7 B;  1TU3 F;  1WN0 A;  3PLN A;  2OYO A;  3ECS A;  2XL8 A;  3KZI H;  3CME P;  3CEX A;  1A7E A;  4C3E A;  3L70 J;  4YT8 A;  1OFC X;  4Q4Z F;  1JY3 O;  4W80 A;  3VF0 A;  4OIN F;  3EGD A;  2HSQ A;  4JYB A;  5B66 E;  2XRH A;  4UB8 H;  2G62 A;  3FOO A;  1BR4 A;  1V55 C;  3I5C A;  3C63 A;  3DWW A;  5BQI A;  1Q0K A;  3U59 A;  3NYJ A;  4O7G A;  1NZE A;  3SFE C;  2UUI A;  5A6B D;  2Q9A A;  2HZ8 A;  5TJH A;  3F46 A;  1EA8 A;  4A2N B;  2E76 C;  3NXS A;  4JJG A;  3GHG B;  2IOQ A;  2AWC A;  2CPB A;  3L4F A;  4O79 A;  4IGG A;  1A0B A;  2AXT H;  2RMZ A;  1K05 A;  4JC7 A;  3GHG C;  1ZHY A;  5F5H A;  3A9C A;  1NGM B;  4CIP A;  2JPU A;  2KZJ A;  2LXC B;  1QL2 A;  2HJ3 A;  4AE4 A;  4I1L A;  1YJW P;  3CMA P;  1MMG A;  2B0J A;  4PJ0 H;  1FFH A;  4XLP F;  5CCG C;  4H4K C;  1LTA C;  1N7S D;  2Q00 A;  5KAI E;  1QEX A;  2DYR C;  3LJB A;  4WVZ A;  1QGK B;  3KH2 A;  3RK3 C;  1VQL P;  5CCG A;  1SQP K;  4N06 A;  1WGW A;  3POV A;  1RJ9 B;  2CW0 F;  1JTH B;  3CWB D;  1BE3 G;  4YN0 B;  2QNL A;  3MLG A;  4MQ9 F;  3WAQ A;  3K1H A;  2AU5 A;  2D4U A;  1MKM A;  3H32 B;  2OEV A;  4W8K A;  2X0C A;  2YKQ A;  3BRT B;  1FDI A;  4EI2 A;  2G3V A;  4MTG A;  2NG1 A;  5CIV A;  1LM3 B;  1M2O A;  2AVK A;  4WAB A;  1Q0G A;  2QJK B;  1BBH A;  2XZR A;  5JLI A;  3LNM B;  2WPV B;  1HMD A;  1KB9 E;  2GWW A;  1L4A D;  1M2V A;  5KYY A;  1OX3 A;  3IEE A;  1L0N D;  2R5D A;  4H0L D;  2QY9 A;  3G3Z A;  3CWB E;  3H1H D;  1PGQ A;  1PIX A;  3NFQ A;  2I8B A;  1LJ2 A;  1GD2 E;  1SFC C;  2NRG A;  3O6Q B;  4JZA A;  2HUJ A;  3FXH A;  3L36 A;  2Z15 A;  4CSA C;  5AVX B;  3B0P A;  1L3P A;  4RKU J;  3LW5 H;  1SFC A;  3II6 A;  2IDB A;  1A7V A;  3DAF A;  3Q3D A;  4E0I A;  3U0C A;  1GGQ A;  5BVZ A;  3DKA A;  5COF A;  3U8V A;  1NTK J;  1LKX A;  3GOD A;  1LNQ A;  2YKZ A;  3FAP B;  3JYY A;  4OVN F;  3RQF A;  1L0N E;  3IHU A;  5EFW B;  2GUV A;  1W2W A;  2NPU A;  1D7M A;  4NPE A;  5L0J A;  5CBO A;  3C8G D;  2QJP B;  1B68 A;  2JJL A;  3AG4 C;  4E0H A;  3AE5 C;  5B3I A;  4A7P A;  1VL2 A;  1VQ8 P;  3TJ5 A;  1EXJ A;  1UIX A;  2XKM A;  4EBJ A;  1OMI A;  3UGO A;  1S4X A;  2IM8 A;  4DVZ A;  4GQH A;  1S1C X;  2XU6 A;  4MVU A;  5GTI E;  3SYN A;  1KYO D;  1T2K D;  4XA4 A;  3WUV A;  3ZC4 A;  3V5X A;  2XLO A;  2W9Y A;  2B87 A;  3M9Q A;  1BCC J;  3I5P A;  3AG1 C;  3H1L G;  1ZLL A;  2R32 A;  3TDK A;  1LWU B;  4QMA A;  1BE3 E;  3O39 A;  5AW7 B;  1OCZ C;  1FJK A;  3CX5 H;  1FMW A;  3GM1 A;  4RO0 A;  5FZT A;  3NYL A;  3OA7 A;  5APQ A;  1FE6 A;  3HTK B;  1QZX A;  4KJM A;  1KYO E;  4IAO A;  2JP3 A;  4YK5 A;  1GDT A;  4CIH A;  3GAN A;  1EDJ A;  1LP1 A;  2D2C D;  1VQN P;  2WSC H;  1I5N A;  3L1M A;  3EZI A;  2R7V A;  2NSF A;  5KAF E;  1FAV A;  2QM7 A;  1GMJ A;  5L0D A;  4EHP A;  4W7Y A;  3B8E B;  5AW4 B;  4Z9I A;  2ZYA A;  1YTZ T;  5APS A;  2K9J B;  4MN4 C;  3SWK A;  3E7K A;  1SLQ A;  3H1H J;  1AJY A;  4P9F A;  4C7N B;  4B86 A;  2WT7 B;  2QTV A;  4PD4 I;  1ZME C;  2XL6 A;  2L5G B;  2Y9Y A;  1JPN A;  2KK7 A;  3LIE A;  4PJJ A;  2KC3 A;  3H1K G;  3SEO A;  5E33 A;  4G7H F;  3HE5 B;  3GEE A;  3HE4 A;  1L0L G;  5BU5 A;  5DJT B;  1C17 M;  1YVI A;  2YWA A;  1MMA A;  1PPJ D;  1DOV A;  5TIS H;  3CCS P;  3MBG A;  3RYL A;  2BCC J;  4HFF B;  1RXQ A;  3B71 A;  3CX5 D;  2QA4 P;  3TK0 A;  1Z63 A;  2OYH B;  2EPN A;  2J9V A;  1LE2 A;  3RL0 D;  1NU1 D;  3S28 A;  1NTM K;  4RES B;  1FAP B;  1ZW0 A;  2FFD B;  1S05 A;  2M5A B;  3CCQ P;  3T6G B;  1SF8 A;  2RSE B;  3L74 D;  3KPE A;  4CDY A;  3X2Q C;  3CC7 P;  3HD7 C;  2DW3 A;  3OAK A;  4MS2 A;  4IFF A;  3NKE A;  1FU1 A;  3L35 A;  5KLI C;  1PPJ E;  1YZA A;  1AVO A;  1TWC A;  2HPC B;  1KQS O;  2WZ7 A;  1FZF A;  3HD7 A;  1K73 Q;  2OJQ A;  3X1O A;  5DS6 A;  2H7O A;  5F5F A;  2UUH A;  1KV4 A;  2R7X A;  2EIN C;  3DJN B;  2E74 D;  4I7Z B;  2YMK A;  3EZH A;  4PAC A;  1NU1 E;  4UB6 E;  3L73 G;  3QTH A;  4YXD C;  4LDK A;  5AVT B;  1A7D A;  3E1I A;  1Y6D A;  2OQM A;  3T9O A;  1DIP A;  1Q2N A;  3RFY A;  4I1M A;  1P84 H;  1X22 A;  1VK5 A;  2J7P D;  4XWJ A;  3QZC A;  1RE3 C;  4QI2 A;  3O10 A;  5AW6 B;  3H1J D;  5B3S C;  2NUP A;  3AE6 C;  3LW5 J;  2JD3 A;  3B5N D;  3S1K A;  2XLD A;  3EFF K;  1KU2 A;  3OEO A;  4JYC A;  3HUS B;  2Y3H A;  2LR2 A;  4PJN A;  2M4E A;  2K3R A;  1VLT A;  1FOS E;  3TSI A;  3CZ6 A;  3K6B A;  2XV5 A;  4JQ0 D;  1YJ9 P;  1ZN5 A;  3CCU P;  1VTM P;  3ATP A;  1S5L H;  2YRF A;  1XZP A;  3UNG C;  1CSB A;  3UR3 C;  2FXP A;  4R32 A;  3HNK A;  3LEV A;  2KS1 A;  1Q7Y Q;  2OQQ A;  3G9R A;  3JRM O;  5KKZ C;  1JUN A;  4NTF A;  4H13 B;  4G78 A;  3H1J E;  4YWQ A;  3C8G A;  1FZC B;  1MQV A;  1C03 A;  4BPM A;  3USS A;  1SQV J;  1BSH A;  2KSF A;  3TNU A;  2CDQ A;  3IQ6 A;  1IFN A;  4H13 C;  1FZC C;  1T2K C;  3L8I A;  1JY2 P;  1U6H A;  3RK2 B;  1EQ7 A;  1KIL B;  4O6N A;  1FFT C;  3LS0 A;  2IYP A;  3GF3 A;  1X79 B;  3G6E P;  2WZF A;  1SS1 A;  1G2C A;  2KW3 C;  1KD1 Q;  3AG3 C;  1AA0 A;  2Q5U A;  1EQ1 A;  4PD4 E;  2FY8 A;  2IBZ D;  5APV A;  1WOL A;  3M1C B;  1NTZ G;  1CI6 A;  3TF5 A;  3TQO A;  2PP4 A;  4KT0 J;  3EH2 A;  5L0C A;  1RF0 C;  5KJ7 D;  1S5L X;  3EPV A;  1OXK A;  2ASR A;  1WAT A;  1E85 A;  2NPS C;  2AXC A;  3DM9 B;  2W6B A;  2OAR A;  2E76 D;  4PFP A;  1RF0 A;  3SP1 A;  3SFD C;  1FC2 C;  2EIM C;  2KOG A;  4NPD A;  4X0R A;  3I5Q A;  3ZIB A;  5L0G A;  3L70 G;  2VCC A;  2NPS A;  1GS9 A;  3BCC D;  1PP9 D;  1APC A;  3ZVR A;  1E2X A;  4ZLD A;  1SQX D;  1NLX A;  3OW2 O;  3S27 A;  1LIH A;  1QKR A;  4JUR I;  5TJ5 E;  1OVR A;  5CCG D;  3CXH I;  1YA9 A;  1HJB A;  3JSE O;  3WHN A;  1RY3 A;  4XE5 B;  5A6A A;  2HG5 D;  4I2L C;  4CS9 C;  3M9H A;  5AVQ B;  4JTD B;  3V2P A;  2Y0E A;  3CPW O;  2A06 G;  1Z5Z A;  1SQQ J;  4RBN A;  3MUD A;  3WUT A;  3KHU A;  5H2F E;  2RKL A;  2YZS A;  1ZW3 A;  3L34 A;  1ZV8 A;  1U0B B;  3H1I G;  1M56 D;  3CD6 P;  4YT4 A;  4BRY B;  3GWL A;  1IFI A;  3MD0 A;  2R7U A;  1YYC A;  1JMW A;  1PP9 E;  1GW3 A;  3MYI A;  4R4M A;  3LID A;  3CL3 D;  1G4U S;  5B1B C;  2BEQ D;  1VF5 B;  3NMJ A;  4GT1 A;  3TGU D;  2ITA A;  1RF1 B;  1NHL A;  1VF5 C;  3J06 A;  3ZQV A;  2AEJ A;  3T6B A;  1GL2 B;  2FFH A;  1MFZ A;  2QEX P;  2OTL P;  1L0L K;  1J1D C;  2XLW A;  1NFN A;  3M15 A;  5B5E E;  2L9J A;  3G4Z A;  1RF1 C;  5B66 H;  3U5S A;  2W90 A;  2Y3D A;  3AQC A;  1Q81 Q;  4QI0 A;  1AEP A;  2KGO A;  3L71 D;  1LE4 A;  2A1D D;  1VPC A;  2LSE A;  4DT0 A;  2EPO A;  1SFC D;  3T97 A;  4N6J A;  1MNE A;  1ZU5 A;  5AVU B;  1UG7 A;  1VQ4 P;  4MW8 A;  3P7K A;  4GOE A;  4J32 B;  3JSV C;  4ZNC A;  3DE9 A;  1SQP D;  1OCC C;  3NMK A;  1JY3 N;  3GOR A;  1JCC A;  3HRN A;  2HMQ A;  4D6T J;  1N73 B;  2W6J H;  4EUK B;  1MV8 A;  1MZ9 A;  4CS8 A;  1BGY J;  2IX7 C;  1HJ0 A;  2W27 A;  2E42 A;  1NU9 C;  1RKC A;  3Q1M A;  3AE8 C;  1VQ6 P;  2OGU A;  1N73 C;  2DI3 A;  3AEE C;  3L71 E;  3CCE P;  1ORJ A;  3M9B A;  2B9B A;  1J1E B;  1LTJ B;  2WL8 A;  1H0T B;  3EHM A;  1N73 A;  5KAI H;  3ITF A;  3NDB B;  1E84 A;  1RCP A;  3M06 A;  3W8H A;  4ULW A;  2Q1K A;  2H43 A;  2L81 A;  2A69 F;  3Q5R A;  1OCO C;  3K33 A;  2CGE A;  3IFM A;  3RKO F;  3BCC J;  2QM8 A;  3IR9 A;  1NTK G;  3C9I A;  1CPQ A;  1HW2 A;  2A06 E;  4D4X A;  3IAO A;  1TKN A;  4WJ0 A;  1JCD A;  1Y8A A;  2XXA B;  1BR1 A;  1EZV I;  2AEM A;  3VYW A;  3H1I E;  4AL0 A;  4O6Y A;  3S29 A;  4EWC A;  2QIW A;  4BEJ A;  3ZDM A;  2R05 A;  1KB9 H;  1ZYR F;  4JPZ B;  4MVQ A;  1ZOY C;  2JX0 A;  1SR2 A;  4J7Y A;  5KLV J;  2LKM A;  3UIA A;  2FYZ A;  2VAS A;  2HOD A;  1DD4 A;  5KYU A;  2WSF H;  1MMN A;  2W8Z A;  3WMM 0;  5KYW A;  3L72 G;  4HKZ H;  2GA0 A;  3R7C A;  1BCC G;  4RJT A;  2W4B A;  3TGU J;  2N9Y B;  3MGN A;  2O01 N;  4U3F G;  1NOH A;  4ER9 A;  5BUO A;  1O87 A;  3VMZ A;  2R9R B;  4YL3 A;  2E43 A;  2TMV P;  2NZ2 A;  2YL0 A;  3T6J A;  5CJ0 A;  3SZR A;  4JF7 A;  4YT5 A; 
#chains in the Genus database with same CATH homology
 4H0L B;  2D2C C;  1KQF B;  3AEC C;  3U3F A;  3K7D A;  4Z1M H;  4OGQ D;  4R4L A;  4PV1 D;  4H44 B;  2WQY C;  2P10 A;  3AEB C;  3IN6 A;  2Q00 A;  4H0L C;  3EWK A;  1R8E A;  1WOL A;  5F28 E;  2MKV A;  2HSB A;  2FYN C;  4H44 C;  4KT0 J;  3D6Y A;  1JOG A;  1HJ0 A;  1Q90 D;  5KLI C;  4EBK A;  4TT3 H;  1VF5 D;  3Q1M A;  3AE8 C;  1DD3 A;  2E75 B;  2WSE J;  3Q5S A;  2YIU C;  1S5L X;  2QJP C;  2ZT9 B;  3AEE C;  1KTM A;  3GM1 A;  3GM3 A;  1U57 A;  1RQU A;  2E76 D;  2PBE A;  3SFD C;  2E75 C;  4H13 D;  1MKM A;  3JZ0 A;  3S9O A;  2E74 D;  2ZT9 C;  3C8V A;  2QJY C;  4I7Z B;  4XFJ A;  2YMK A;  4PV1 B;  1UFB A;  1YQ4 C;  1K40 A;  4YTP C;  3AEA C;  1FDI A;  4YXD C;  3ABV C;  1IK7 A;  2JP3 A;  1PL5 A;  3C8G B;  1QVX A;  3AED C;  2H88 C;  1DIP A;  3Q5R A;  2L6G A;  2D2C D;  2L6F A;  2WPV B;  1ZZP A;  4XEK A;  1WWP A;  1FDO A;  3O10 A;  3TUL A;  4Y28 J;  3AE6 C;  3LW5 J;  3RL0 g;  4H0L D;  2E76 B;  4NQF A;  1ZP0 C;  3T97 B;  1NYH A;  2V7Q J;  3BRJ A;  1PIX A;  1GMJ A;  3IAO A;  3D6Z A;  4H44 D;  2E74 B;  2WSC J;  1OW6 A;  1KNY A;  1TU3 F;  2KK1 A;  2QSI A;  4OGQ B;  3AE2 C;  2G8Y A;  3AE9 C;  5L8R J;  3RK3 E;  2G3A A;  3AE7 C;  2QIW A;  2WSF J;  4RKU J;  1AJY A;  1O3U A;  2IDB A;  3RQG A;  3D70 A;  2K9Y A;  3GF7 A;  4I7Z C;  1Y9B A;  4PV1 C;  3R4Y A;  5M1B A;  3Q3D A;  1KMI Z;  3AJM A;  4R4M A;  2E75 D;  3U0C A;  2D2C B;  1ZME C;  1JB0 J;  1OW8 A;  2BEQ D;  2ZT9 D;  1VF5 B;  1ZOY C;  3Q5P A;  2JX0 A;  4XEV A;  1ZRT E;  3AEG C;  1OW7 A;  2FXP A;  3H25 A;  4R32 A;  2O01 J;  1HF9 A;  3AEF C;  3GM2 A;  3SFE C;  3FGA D;  1KQG B;  3AE4 C;  2OQQ A;  1DD4 A;  2QJK C;  3G9R A;  2LK4 A;  1KIL E;  3L8J A;  1VF5 C;  5KKZ C;  2H89 C;  3AE3 C;  4GDO A;  4H13 B;  4IL6 X;  3AE1 C;  3JYY A;  3RQF A;  3C8G A;  3Q2Y A;  1YQ3 C;  1EXI A;  2YWA A;  2E76 C;  3C8G D;  1KOR A;  2BEZ F;  4H13 C;  3GMA A;  3C18 A;  2E74 C;  1K04 A;  3AE5 C;  3L8I A;  1WTY A;  4OGQ C;  4U7J A;  1WMK A;  1RQV A;  1VL2 A;  3GLM A;  3B71 A;  1K05 A;  1EXJ A;  1UIX A;  3D71 A;  2L6H A;  1PV3 A;  1OMI A;  2JO1 A;  2NZ2 A;  1V4A A;  4XEF A;  4EBJ A;  2J5U A;  3O6Q A;  2FBW C;  1S1C X;  3GF3 A;  1NGM B;  3MFN A;  3RQE A;  2JPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...