1K05A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
135
structure length
135
Chain Sequence
b'NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 57
structure length 135
sequence length 135
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k05A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k05A02
2FBWC 3L8JA 1ZOYC 3B71A 1KTMA 5F28E 3TULA 3AEGC 3ABVC 3SFEC 1O3UA 1OW6A 3AEFC 2H88C 1JOGA 3MFNA 3U0CA 1WTYA 2H89C 3AEAC 1V4AA 3C18A 3RQFA 3AECC 1K04A 3AE5C 2HSBA 3RQGA 4EBKA 2L6FA 3RQEA 3S9OA 1WOLA 2L6GA 2KK1A 4YXDC 1YQ4C 3C8GB 4XEFA 2LK4A 3C8GD 2G3AA 3AEBC 3SFDC 3AEDC 3BRJA 1UFBA 1PV3A 3AE4C 3AE2C 1K05A 1OW8A 1K40A 3JYYA 4EBJA 3GM3A 4NQFA 1ZP0C 2JPUA 2JX0A 4R32A 4XEKA 2Q00A 1QVXA 1ZZPA 3L8IA 3AE6C 4XEVA 3GM2A 3AJMA 1OW7A 1YQ3C 3AE7C 3AE3C 3AE8C 3AEEC 1KNYA 3K7DA 3O10A 3AE9C 3C8GA 2PBEA 3GM1A 2WQYC 3U3FA 3JZ0A 2YWAA 4YTPC 1WWPA 2L6HA 3AE1C
chains in the Genus database with same CATH superfamily
1CSBA 1L2PA 2G8YA 3ZDLA 2QM8A 3BRVB 1VQMP 3SFEC 2WSFH 2OQQA 2IFNA 2QJYC 4ZKUA 1EDLA 1NU9C 2J59M 3WU2H 1N1CA 1M56D 3H1LD 4JYBA 2BC5A 2YLGA 5L0JA 1QGKB 1URQD 4OGQB 1AA0A 1J8MF 3AQBA 4LACB 3C18A 2B89A 2KJGA 3U59A 1V54C 1FE6A 3U3BA 1LI5A 3FX0A 1KB9E 3FAJA 1CW5A 1SQVG 3JRTA 4YL1A 2FYNB 1NFOA 1A41A 1YA7O 2XU6A 1CPQA 1KV4A 1P84E 1ZR4A 3L75E 1I4ZA 1SQBE 2JKVA 2D2CD 4H0LB 4YPCA 4QI0A 4BRYB 4U3FG 1M6TA 5HV9A 5AVTB 1HVVA 1LPEA 4TT3H 2A6EF 3K5BA 3L70J 2WSCJ 5KLVD 2C0XA 1LTJB 2Q6QA 3BCCD 1MV8A 5T1DB 3RF3A 1S9KD 3H1IE 1JEKA 5AW7B 1I5NA 2YEVA 3L0IA 4A4AA 1SQXE 2WPRA 3L72J 5CCGC 1N86A 2JEEA 4YXWH 4EHPA 4XWJA 1HH0A 3LW5J 2Q00A 2M8RA 4U5CE 1FFHA 2E75C 2CK3H 4D6TJ 3KMIA 1LIHA 2FYZA 3L71J 2HJ3A 3H1HJ 1EXJA 2DI3A 3M91A 4FWVA 1SR2A 5CHXA 1TWGA 1GW3A 3QW1A 4PD4D 2J9WA 4IB4A 2JWAA 1YLMA 1YZCA 3EHMA 2VCCA 4XFJA 2R7UA 5KKZC 2P2UA 3TQOA 3TOLA 5KJ7C 5EK0A 3CCUP 2XNXA 1GD2E 4RJTA 4EKWA 4G7OF 1JY3O 4PV1B 1PP9J 3WU2E 3HE5B 5GPGB 1TWHA 4PFPA 5CCGD 1N7SD 1ZHWA 3FXHA 2W8ZA 3CC2P 3GF3A 3NMJA 2IYPA 1FZAA 4L75A 2WVRA 3CX5D 1OW6A 3ASNC 2E75D 4JIOA 2YL0A 3IR9A 3RK2D 1Q90D 1IZMA 2W6AA 1W5CE 2M64A 2CW0F 2B87B 1HE9A 3P8MC 4UDVA 1EQ7A 2JP3A 2OEXA 2DYSC 4JTCB 1SQVE 3ABLC 1SQBK 3S9OA 2P61A 4JCHA 2LFDA 3T6JA 3EZIA 2O9XA 1SFCA 5KJ7D 1NKNA 1YTZI 1SQPD 2Y0CA 1NAFA 5AVZB 1VLTA 4U3FE 3FMSA 4H13B 2A45I 2KC3A 4D4XA 5L0DA 1NTKJ 2KOGA 4ER9A 3NMKA 5B3IA 4CPGA 2WT7B 2O01N 4K35A 1DIPA 2EIMC 4XE5B 3GM3A 4I1OB 2H43A 2L7AA 3KZIH 3GHGB 1W2EA 3P7KA 4DRIB 2WPQA 3Q5PA 3H1LG 2EPNA 2QSIA 4ZNCA 3ZTMA 5APVA 2WL8A 4OIRF 3NKDA 1GM5A 4L6RA 1XZQA 2C04A 2BEQD 3HTKC 4I7ZC 4WY4C 1YVIA 1WT6A 2K9JA 2NZ2A 3NXSA 1LT9A 1NTZK 2NSGA 1MMDA 2AEJA 3O8ZA 3AEEC 1RHZB 3TK1A 3RK3B 1I4YA 3G50A 3F47A 4WVZA 1HGVA 2UUIA 4UB6H 2VH3A 1OXBA 1EA8A 1GL2C 4IARA 5E33A 2NPSA 1VQ4P 3V5XA 1ZRTD 5KLVG 1RF1A 3BCCG 4WGYA 4I44A 1L7CA 2A6HF 4BEJA 3NKEA 1ZVZA 3RYLA 2J5UA 3W8HA 2L6HA 2V7QJ 1KFMA 4JC7A 1DD4A 2PAJA 4IFMA 3USSA 1GU4A 1LTSC 3EWKA 4FAPB 3B5NC 2FKWB 4PJLA 5DVWA 4WABA 1RE4C 4JW1A 5L3VA 1S5LH 5CCHC 3V2PA 2R5DA 4CX9A 4WY4D 1ZW3A 3AEAC 1QLED 1OMIA 1W2WA 1NYHA 3FWNA 5EGYA 1KZUB 3L73D 1BGYJ 1BBHA 2LSEA 2HSBA 3UGOA 1D0XA 1KYOE 4XPYA 2KUBA 2QJPC 4LGDE 5AVUB 3EG9A 3ZQYA 1H0TA 1DOVA 1FDMA 2NG1A 2R25A 1VQ9P 1ZU5A 3KZIE 2IBZD 4PD4H 3FXEA 3RVZA 2EIJC 3SFDC 3M4CA 4HKZH 3AE2C 3K1IA 1ZMEC 4HE8D 1AEPA 2Q4FA 3QMKA 5A69A 2KSEA 3W8IA 1H9TA 1NTMJ 4C3DA 4MTOA 5B5EH 1D0YA 3B5ND 2E42A 3H32A 1ZYRF 1IFDA 1SS1A 4XEKA 4C7RA 3H1LE 4R4LA 2QM7A 5CJ4A 3FOPA 4UB6E 1D7MA 2AEMA 2POHA 1FJPA 1X8YA 1L4AC 1N8RQ 1G2CA 2O01J 1OW7A 2BCCJ 2H8AA 5JUAA 3CX5H 2Y9ZA 1QPUA 5DJUB 4YN0B 3K7DA 3KHUA 2XLVA 2ZT9C 3R7CA 4BJ6A 1SQPG 3SZRA 3NMIA 1V74B 1J2JB 2Q1KA 3VMAA 2PBEA 1FBMA 2FXOA 1OVRA 2P7JA 3H1KJ 4CS9A 2E74C 3KXDA 3CCQP 3LIEA 4IGGA 3RW0A 3V5YA 3I5CA 5KLVE 2YIUB 1LT1A 3CMAP 3BCCE 3IHUA 1SFCB 1S9KE 2GUVA 1GK4A 4KNWA 2FFDC 1VQNP 2WSEJ 1E85A 2FBWC 5L0HA 5DS4A 3V4QA 1E5WA 3R2PA 2R03A 3Q6NA 3C8ZA 1CGME 1CI6A 1MFTA 3NRHA 3A2AA 1FAVA 3C62A 3EQLF 3WAQA 1XTGB 2ZXPA 4JE9A 1PZQA 4NPEA 4BPMA 3KYJA 3WODF 2XL8A 4DVZA 4FX5A 1OKKD 1LP1A 1IW7F 1MMGA 1RXQA 3MHVA 3T9OA 4JCZA 5B66H 2WB7A 3PCVA 4I1MA 4PD4E 3JRMO 3BVHA 3S1KA 1VL2A 2IOQA 1LT9B 3ZWIA 2YXRB 3HNIA 5APTA 3VAYA 3HJCA 1RH5B 4OIPF 1KQLA 2R7WA 2Q7RA 4B6IA 4DJ9A 1GQAA 3S4RA 4OGQC 2YKZA 2IFMA 2NPSB 3CWBJ 3BRJA 4NCQA 2HODA 2AEFA 2QNLA 2ZXXA 1D1AA 3MP7B 2R32A 1CZQA 1ZLLA 3RVYA 1NTKK 2IYOA 1K40A 3Q3DA 4AK9A 2FYNC 2PGDA 2XS8A 3AG1C 4I3MA 3CX5E 1G8XA 1X0TA 3ZIBA 4H0LC 1PGPA 3I55P 1O87A 2J9BA 4CBEA 2MWQA 2NSFA 3L8IA 1Q81Q 1A7EA 3OW2O 3TF5A 2YXQB 3HD7A 1NZEA 2IXOA 2Y9YA 4CS8A 3L73G 1EZVI 4J7YA 2Z5IA 3VTPC 4DOJA 1LTJC 2A0UA 3TOMA 3AE3C 4BEMJ 1H89A 5TJ5E 3B0UX 3O6XA 1BZ4A 3HNLA 3CXHH 4JJFA 3I56P 2IX7C 1PL5A 3JCUQ 3GM1A 2IBZG 2V3CC 5DS6A 1QKRA 2H8PD 2M3EA 3R4YA 4OIQF 4OGQD 5K0IA 4MTFA 1E86A 4E0IA 3EG9B 3PHLA 3MD0A 1H0TB 1JY2N 1S7ZA 3SEOA 1OVVA 3VP8A 1ZOYC 4UB8H 3B71A 2I1JA 4XLNF 1BCCE 4GIFA 2N9YB 2FXPA 4GT1A 4RD9A 4H0LD 1Q0GA 2HSQA 4CSAC 4ANJA 4MN4C 5KAFH 2XLHA 4OIOF 3U0CA 4DCKA 3H32B 1Y6DA 1OQCA 2YL3A 3AG3C 5EHHA 1FAPB 2J7PA 4E18A 2XS1A 1FJKA 2G62A 4O79A 3L34A 3AG4C 1G2CB 2W27A 3DAFA 2CGEA 1N7LA 5APYA 2WTYA 2EPLX 4RESB 5A6KA 4CDYA 1J1DC 2AP3A 5AW6B 4ZKPA 1H6GA 4LC1A 2O3JA 4OD4A 3IN6A 1K73Q 4N06A 5DQTA 1KB9I 2KP8A 3DE8A 2LQGA 1Z63A 2CPSA 2A69F 3EQ2A 3L70D 3JYYA 3Q7GA 3L75J 1P84I 1SQBJ 2ZFCA 3NG1A 4EIJA 1H8AA 2P6VA 5FCLA 2OU6A 1SP4A 2HV7A 1L0LK 4JTDB 3L72D 2HKVA 3DAGA 5CJ0A 1CI6B 5BUOA 1ZHXA 2RN0A 3CCLP 2OCCC 1TR2A 3X1OA 1U7MA 2K9YA 3H1IJ 4Z9IA 5BQHA 2VCBA 3W68A 3L73E 4GYTA 4PJ0E 1YYXA 4C7OA 4DT0A 3L71D 2M5AA 4OVNF 2UWJE 1LP1B 3LNRA 3H1HD 3OAKA 1AUEA 4EIYA 4GEHA 1FMWA 2OTKE 1NSGB 1AQ5A 1SQQK 3GHGC 4L76A 3W4YA 4CDAA 3Q5RA 1WRGA 3OEOA 2JO1A 2YQYA 2ZXOA 2IBZE 1Y8AA 1ZW2A 3RIPA 2H7OA 2XL6A 1JMMA 1TWAA 1DOWA 4ZMDA 5BVZA 1ORSC 3NDBB 1NTZJ 5KAFE 5CMZA 3LLKA 4LDQA 1HBWA 2Q9IA 1ZU4A 4JYCA 4HFKB 1PP9D 2HODB 3RK3C 3CCRP 2XSEA 4YT5A 5L0FA 3RFYA 1VYKA 1L0NE 2R44A 2ICWG 2WSFJ 4IJJA 3CCSP 2QTVA 3T97A 3HNJA 3RL0B 3S84A 2R7SA 3IFMA 1C03A 1JB0J 4EDFA 1VF5C 2NUTA 2HYNA 1A7DA 3CCMP 4WB4A 2P58A 2ZYAA 3HD7B 3UMKA 2N1TD 4C46A 3RGUA 2LKMA 1VTMP 2Z4EA 3H2UA 3EH1A 4MVRA 1KORA 2C0WA 1WOLA 2FYUK 2YL7A 1K8AQ 1GMJA 2Q3EA 1WASA 4LERA 2AWYA 4YL3A 1Y4CA 2PF4E 4Y99B 2AXCA 1MZ9A 3LIDA 2EINC 2E5TA 5JVEA 3TSIA 1ZP0C 2IBFA 1URQA 1NWQA 3V7OA 4BJ5C 2XLOA 3OWTA 3GMAA 5L0CA 1KILD 4FESA 3TD7A 1VF5D 1L3PA 4C3EA 3SXKA 3V2RA 2LR2A 1JPJA 1LE2A 4OH8B 5EFWB 2VCAA 2A0BA 4AE4A 3GWNA 2G3KA 1NU1E 3D71A 1IJDB 1OCRC 4L73A 1KQSO 3K1HA 1HJ0A 3U8PA 4W8PA 1OX3A 3MYFA 3JSZA 2Y3BA 2N9BA 2QJKB 5AVXB 4YTPC 5AGFA 1WWPA 4Z9HA 4D4NA 3L70G 3MUDA 2EILC 5COFA 2YVKA 2O1KA 2H7BA 1JCCA 3U2MA 3M15A 3ZVRA 3F5HA 3CC4P 1BR4A 2OEVA 3L72G 3TULA 3AEGC 4M3LA 1YA9A 4XTKA 1L0NK 4BJTA 3TDKA 4W80A 5L8RJ 2H88C 3N7NA 1JOGA 3MFNA 4KHXA 2QEXP 2RH0A 4MVZA 2NPUA 2TMVP 3EFOA 5D92A 3UR3C 1ZHTA 2R5BA 3UMHA 2YIUC 1HW1A 2YKPA 2VC9A 2P1JA 1SFCC 3L71G 4MNDA 1AJYA 3H1HG 4OINF 2OGUA 2CDQA 4EBKA 2L6FA 4MQ9F 1G1IA 1BGYD 4NC3A 3JYHA 3JTLO 3ATPA 5BQIA 4YXDC 4C7OB 2YKOA 2Z5HA 5DS5A 4U5EE 3H65A 2M5AB 1M1JB 2QG4A 1GS9A 1HJBA 3C8GD 1M2OA 5CCGA 1N7SA 3AEDC 1GTWA 1UFBA 3IQ5A 3C1LA 2KS1B 2ZXEB 1FZCC 1FU1A 1PP9G 4EBJA 1BR2A 3B29A 4NTFA 4JPZB 2HLOA 1Z7Qc 1HGZA 1R8EA 3TNUB 1AV1A 4NPDA 2QUPA 1NTMD 3N4XA 4EUKB 3ZC4A 3SNHA 1AVOA 2W90A 3NYLA 3O55A 1OXZA 3GM2A 2OYOA 1KYOH 2NPSC 1USEA 3GANA 1JO5A 5COGA 4W7YA 3T97B 2OTLP 1NU1K 2LXCB 5KJ7A 1NLXA 1SQXK 2BCCD 3IAOA 2KW3C 2NUTB 2KGOA 3HKKA 1JY2P 2QE9A 3H1JJ 5E3CA 4NTAA 3ITKA 1T5OA 3I4UA 3IQCA 3U3FA 1IFJA 4P9FA 1YJGA 4O6YA 3EGXA 4IAOA 2E76B 5DJTB 1PGQA 2JJLA 4E0HA 2RKLA 4CDVA 2A45G 1RJ9A 3H1KD 1AVYA 4IAQA 2IXPA 2XXAA 2WZFA 3OA7A 3N24A 5DLJA 3L70E 3KPEA 2GDCA 3FHDA 3UGPA 5KYYA 5E2QA 2Q5UA 1U0BB 1J1EC 1TKNA 1EI7A 3M9BA 3FGAD 4W8KA 5AW3B 3RBXA 5GTIH 1URQB 1T01A 1QX8A 1Q0DA 1RQUA 4IRUA 2MHRA 1FZBA 3RQFA 5APXA 5A6BA 1G5ZA 2R9RB 2R7XA 2WZLA 3II6A 2Y0DA 3L71E 4ONSA 1HW2A 3H1HE 2V26A 3QW0A 1IFNA 4A7PA 3RQGA 4RBNA 5AW8B 3HUSA 2D2CB 2JD3A 3K1IC 4JZAA 1AFOA 1EKYA 2V4HA 1YQ4C 4AE4B 3M79A 2P10A 3VP9A 1YDIA 5AW1B 2LK4A 1KD1Q 1RKEA 3IPMO 4RKUJ 2ZYDA 3VRCA 1ZN5A 5CI9A 4PD4I 3AG2C 3HNKA 1SQVK 1NFNA 4EBBA 1KU2A 2YLDA 3T6BA 1NOHA 1GL2D 3LS0A 2QJYB 4WY4A 2XL4A 4AL0A 2Q9AA 3EHNA 2W83C 2M0BA 1JMWA 4ASWA 1IZNB 3EGDA 4BJ6C 2KZIA 1KQGB 2ZJSE 1T6IA 4LLCA 1N73C 3RL0g 2R7OA 1MMNA 2NRGA 3GG2A 3EFOB 1FDOA 3C9IA 1BGYG 1M57C 3CCVP 2UUHA 2XM0A 3A3YB 3CX5I 1Z5ZA 4RDAA 1L0LJ 2OQMA 5L3QA 4A2NB 3MGNA 4HEAJ 1BE3J 2OG2A 5CCHD 2HMZA 3G3ZA 3WMM0 1FOSE 2A68F 3GEEA 4P6IC 3ZDMA 3WUTA 3KH2A 2W4MA 3B5NA 2J9VA 4CIHA 5GTIE 1JCDA 3G4SP 2FGYA 1GW4A 1ST6A 1N7SB 1SQQJ 1NTMG 1LTAC 1QQ3A 1HY5A 1KILE 3L74J 3PJSK 2QLAA 4OWFA 3RK2B 1LNQA 3NTNA 1SYQA 3L36A 1Z56A 4J7TA 4MTGA 2BCCG 2QIWA 4G78A 4IL6H 1M57D 1BCCJ 1AVOB 3Q7LA 3V2NA 4JKVA 3TGUJ 1X79B 5KKZB 2X51A 1H88A 1OCCC 1T8ZA 2IZ0A 2P0NA 2ZAEB 3BATA 3VMXA 4KC9A 1VOMA 2MKVA 3MZWB 3H1KG 4Q5SF 2ZD9A 3RL0C 4JEAA 1L4AD 1ZR2A 1S5LX 3AEBC 2B88A 1H7IA 4YT8A 5L0IA 1PV3A 4H4KC 4JTAB 3IEEA 1JM0A 3EGXB 1TFOB 1R5LA 4GODA 3LUTB 1PGJA 3KYQA 2ZT9D 3HD7C 2H7HA 2HV6A 4CS8C 2K9JB 1NO4A 2FYUJ 5GTHH 2VASA 1OZHA 4CJOA 5TJHA 1OKKA 5AW0B 5D91A 1SQBD 256BA 3W2WA 2WPSA 3F89A 1JY2O 1UIXA 3E9VA 2E74D 1GK6A 2Y69C 2OJED 5CI8A 1YI2P 5KYYB 2IPPA 1Y9BA 4BG0A 3AGUA 1YJNP 4IOIH 1OR3A 1S4XA 1VYIA 1LVKA 2HS5A 1IK7A 4W7ZA 4Y99C 3H1ID 2LXBA 1RF1B 1T2KC 3AOUA 3JCUH 3FVYA 1BGYE 2WVOA 2H7VC 5DQZA 1SF8A 1WATA 3BRTB 5JRAA 2FFDA 3PH0A 3CXHI 3HUSB 4G7HF 3LAYA 3L73J 1HUCA 1LKXA 4LLEA 3ZTZA 3M0DC 2OYIA 1VQ6P 2YZSA 3V4WA 2QA4P 1RE3C 3HD7D 2ZXRA 4QDLA 1RKEB 1QVGO 1NTZD 4PR9A 1Q82Q 5F28E 3VMZA 3Q2YA 1NTME 3ABVC 2C03A 3U1CA 3VM6A 4IL6E 3M1CB 4JVSA 2IBZI 4PFOA 3AEFC 1SQPE 1RF0A 4KNVA 1WN0A 4PACA 1IC2A 4PJ0H 5KLVK 1F1MA 2OKUA 4WY4B 5APSA 4N6CA 1QVFO 1EDIA 5E3AA 4B86A 1E84A 1S2EA 1R4TA 4E7ZA 5KYXA 3EGDB 2BCCE 1E83A 1T3UA 1GGQA 3OJAB 1MNEA 3VF0A 1SVFA 3RQEA 4MVQA 1Q86Q 2WVQA 1L0NJ 3FAPB 1NHLA 1AQTA 3WUVA 2L6GA 4U5BE 2YLIA 2Q3TA 2XLMA 3CQZA 1PFIA 4H44B 2IDBA 3H1KE 4JF7A 5GTHE 2KB7P 1NU7D 5APWA 1JMBA 4YK5A 3N0TA 2XZRA 4PV1C 2GA1A 4X0RA 2K88A 1M90Q 4N78D 5F5FA 2ZVOB 3S27A 3O6QA 4IFDK 1XTCC 3JCUE 1ZRTE 2KLVA 2ZYGA 1QVXA 1CPRA 3WUUA 1FDIA 1M1JC 2YL1A 3FXDA 2LP4A 2RD9A 5JS5A 3DMDA 1LWUA 2EIKC 3GEIA 1R5SA 2DYRC 4O7GA 3NYMA 1QL1A 2YO3A 1R5ID 1Z6AA 4CS7A 2CNWD 3V2QA 1KNYA 1VMAA 1E2XA 1QSPA 4PJNA 2BL2A 3CCJP 4K7BA 1X22A 2L9JA 3POVA 1Z3IX 1VQ5P 1H9GA 1GDTA 3FWLA 1BDJB 5JT4A 4K0DA 2XV5A 4U7JA 4H13C 2GA0A 1C17M 3GF7A 1NU1J 4PV1D 5TISH 2C9NY 1SQXJ 4PJJA 4D6TD 3MX3A 1N2DC 4Z9JA 2B0HA 2WPVB 5CBNA 1SQBG 1LJ2A 1OFCX 2EPMX 2VRSA 4DVYP 1SQPK 3DI5A 2R05A 1UIIA 3D6YA 5B3SC 1WTYA 2E76C 1PGOA 4MS2A 2RMZA 3H1IG 1LS1A 2M4EA 2OYHA 3BEHA 1K04A 2HUJA 2BEZF 3A7OA 1MMAA 2EPOA 1G4US 3SSUA 4LDKA 2O1JA 3LNMB 5B1AC 3B0VC 4AYCA 1KN7A 2CCYA 3ITFA 1ZHYA 1GZLA 5AW4B 1M56C 2PRRA 4H13D 1JRAA 1M2VA 4GKGA 2FFDB 4WBAA 2Q9CA 1K05A 4GQHA 1NTZG 5C39A 1U7JA 2MYSA 4ULWA 1YBKA 2OYIB 2Y3GA 2KLUA 2JPUA 4GDOA 3DD7A 1RKCA 4JJGA 2GAQA 2HFIA 1FZFA 2J46A 1B68A 1OVUA 4WJ0A 4H54A 4N4WA 2LCHA 3C8VA 4EYYQ 5E79H 4BXLA 2E76D 5JP7A 4HH2A 3AE6C 3NMDA 4U9DA 3T4RA 2N1TA 2M3BA 2JWDA 2OARA 1Q0MA 4O6NA 2WSSH 4NTBA 1SQVJ 2ZVNB 2R7QA 3VYWA 1FC2C 3I5PA 3SYNA 3A5TA 2GWWA 2XLEA 2A06D 1FTSA 2PFDA 4DBRA 4U9EA 1NTKD 1Y47A 3RK3D 2KSFA 2I1KA 3MUDC 1FZGA 5KYXB 5TISE 3QTHA 2HPCA 4U3FJ 3G71P 1CGOA 5JLIA 3H1JD 3HLZA 1YZAA 2EPKX 3JZ0A 3DKAA 5APQA 1JUNA 1SZIA 5CBOA 1LI7A 3A11A 3GW6A 1JTHA 3U2LA 2PP6A 4HB1A 3Q1MA 2PFXA 2J58A 3M9HA 3LEVA 3MIWA 5T3WA 3CL3D 1PCXA 1LTTC 3VMYA 1FS0E 4YT2A 3G6EP 1KILA 3B8EB 1MFZA 1S3JA 3NYJA 3U1AA 1IO4A 1X9VA 3EFFK 3U8VA 5H2FH 2XDJA 5KLIB 3GEHA 1YJWP 4G0HA 4DOZA 2W6JH 3J06A 3O6QB 5HSWA 3H2VA 4JRZA 5B1BC 3AECC 2CPBA 5KTBA 1PIXA 2IXNA 1S72P 1VQPP 3AE5C 4ULVA 4GOFA 1N7SC 1LS4A 1LWUB 3VOPA 1VQ8P 4JEBA 4AQRD 1LM3B 4KBLA 2KK1A 2VB6A 1CGNA 1K9MQ 1T6AA 4XPXA 2Q7CA 3AQCA 4HJGH 2WSCH 4O6MA 3DM5A 3RK2C 3UMIA 4MVSA 2Y0EA 1OWAA 2XLWA 4BJ5A 1IFMA 1MKMA 1D1BA 4D6TG 3S28A 5E79E 3AE4C 5AW9B 4DRJB 4Z1MH 1OW8A 1D1CA 1FZEA 4K3AA 1NTZE 3Q6MA 4YWQA 3LW5H 5KYWA 3ZG1A 4MW8A 2SPZA 3CC7P 5BU8B 3DWWA 1WGWA 3WHNA 1M7LA 3CCEP 2FAPB 1VDFA 2QVAA 3M4BA 4E7SA 2R3CA 3SXMA 3AGTA 1QEXA 1QZXA 4JQ0D 1IFIA 3F46A 2ITAA 1OXKA 2ZXWC 1OIPA 3KYIA 1SLQA 1KYOI 1VQKP 2OYHB 2KYVA 2XLDA 3DXJF 1NH4A 3C8GA 1J1DB 2GUSA 4O9BA 4YL0A 4CIPA 3W67A 1LT9C 1EXIA 1PPJD 5APUA 1W2BO 1L0LD 2B0JA 1Z23A 3W2VA 1BE3D 2GFHA 2HFED 1SFCD 5H2FE 4LDRA 2W45A 3A9CA 2NUPA 1JAFA 1ZW0A 1U6HA 2KI7B 3L8JA 4NPFX 1RF1C 1M2VB 2F22A 1U57A 4N78E 2E87A 3H1LJ 2FXMA 3DZAA 1O3UA 1SQQD 2YO2A 3NFQA 1HF9A 2XM4A 3H6PA 1KFNA 3HUSC 1TWCA 3G9RA 2R7RA 1DX7A 3JSVC 3L74D 2A06G 1UG7A 1VQOP 1NTKG 3PHF2 1MUUA 4F4BA 2N1TB 1YHQP 1T6UA 3MBGA 4I1LA 2D4UA 1BCCD 1JY3N 3EFGA 3CMEP 5KAIH 3IQ6A 3H1JG 2DB4A 3MYIA 3L72E 3TGUD 1FZCA 5FZTA 1DEEG 2A45H 2KK7A 4QMAA 1PD0A 5KLVJ 2AVKA 3BCCJ 2C9LY 4JURI 2YRFA 3G4ZA 3HE4A 3U9MA 3L4FA 2G3AA 2HPCB 1ORJA 2NPSD 3E1IA 1A02F 1QLEC 1Q0KA 5AVVB 2W4BA 4D6TE 1T9KA 3TJ6A 1IK9A 4U5HA 1ZV8A 1JTHB 1Q0FA 1A7VA 5A6BD 5L0GA 3ECSA 3PRJA 1EDJA 4WWIA 1HMDA 1Q2NA 4P9TA 1BSHA 3FOOA 1VK5A 1APCA 3GLMA 2FYUD 1KILB 3B9QA 2Y3DA 3A0HH 4H44C 2J0WA 1VF5B 3E7KA 4RO0A 3DJNB 4XPWA 1M8OB 4DXWA 3AJMA 4PK4A 1VLSA 1KC8Q 3AE7C 4J30B 1GU5A 2DW3A 3AE8C 3EZHA 1YYJA 4I2LC 5AC5A 3CWBD 3RBZA 1NG1A 2AWCA 1PP9E 3DE9A 3CEXA 3KPHA 3LLIA 2LIGA 3HTKA 1OCZC 1O5HA 3L37A 3U5SA 2AU5A 2WQYC 2Y3HA 3SWYA 4N6JA 2K1AA 1HMOA 3ZSUA 1HWTC 3CLQA 1SMYF 1EC5A 3P8CD 3CXHD 4N3YB 5AVSB 2Z15A 3E70C 3S0XA 2J9UA 1GL2A 2V7QH 3K6BA 4XA4A 3AE1C 4I6MC 4CS9C 1EZVD 2J8WA 1HE1A 3KKBA 4ASVA 3OA1A 2JR8A 2K3RA 4AX2A 2MJZA 1BR1A 1NVOA 3M9QA 4H44D 1JR8A 2Y39A 5KYWB 2BE5F 3EPVA 3S90A 5KAIE 1V4AA 3QVZA 5M1BA 2HG5D 5A6AA 1JPNA 1RE4A 2A06E 2R7TA 1NTKE 4DBQA 3RK3E 2E5YA 5CCHA 1D0ZA 3LEOA 3IF4A 1SQPJ 1PPJG 1LE4A 3DJUB 3ABMC 3V5ZA 1L0LG 4AUWA 1TQGA 4N6HA 4Q4ZF 1ORYA 3H1JE 1RY3A 1J8YF 1BE3G 1L0ND 2YMYA 4IWBA 1V55C 2E75B 3C8GB 1FR0A 1YAUO 4U5DE 2KNCA 4LLHA 3TJ5A 2KIKA 2AXTH 3VN0A 1FFTC 1DH3A 3A0HE 2GM4A 4BWNA 4K1OA 4NQFA 1SQQG 2XRHA 2OOCA 5AVYB 2NUPB 1N73A 2OTJP 3FDQA 4ZLDA 1TFKB 2J45A 3PMRA 2KNHA 1BDCA 2YMKA 3EJNA 5KYUA 3L74G 2O01H 1DD3A 2WZGA 3EH2A 4XEVA 2WZ7A 1KMIZ 1USDA 1MQVA 1TU3F 3D6ZA 3G4XA 1S5LE 1FMVA 1BSNA 1YQ3C 4IFFA 3PTZA 1KB9D 1BCCG 3IQTA 4Y28J 3PP5A 1RJ9B 2OYIC 1S05A 3TGUG 3LS1A 3AE9C 2XXAB 1L4AA 1P84D 1G4WR 3L75D 1VB5A 2WMMA 5AC4A 5AVWB 4ZLCA 2HR3A 4DRHB 2D5RB 3ABKC 3ASOC 2WSEH 1FZCB 2LFFA 3CZ6A 5AVQB 1OR2A 1RF0C 1T6QA 3O39A 2J0XA 3HE4B 1KTMA 5AW5B 1NU1D 1YTZT 3LJBA 2WITA 2KXPB 4BJ1A 1SQXD 5JSLA 2FYUG 2IZ1A 3BASA 1JNMA 2IXMA 2ASRA 3TYYA 5B5EE 4HYTB 4G7ZF 3CPWO 1YYCA 1EQ1A 3RL0D 2PX3A 2WWWA 2L5GB 3MLGA 1S1CX 3CWBG 4YT4A 3B0PA 1NGMB 2XNDH 1YARO 2FY8A 2E43A 3GORA 3LESA 4Q7CA 4MW3A 2X0CA 1PPJE 2AXTE 2BASA 3C63A 3UIAA 1L0LE 5KLIC 1ZXGA 3L35A 4C7NA 2QJKC 1BE3E 3RKOF 3KL4A 3K33A 3HTKB 1T3JA 4I7ZB 3SWKA 1KQFB 4E17A 2RSEB 2B9BA 1EZVG 4OD5A 3KQGA 2Q9BA 1VQ7P 1FOSF 1BDDA 1T2KD 3CAXA 1NBBA 3SWFA 1NJIQ 2PP4A 4IL6X 1G1JA 1GL2B 3WG7C 3N2ZB 1LWUC 1J1EB 1SQQE 1C02A 4MVUA 3SXZA 2I15A 1Q7YQ 1ZZPA 3RH3A 2P1AA 1RQVA 3L74E 4HFFB 1LTGC 2Q3IA 3SP1A 1LGHB 1YJ9P 2LD6A 3M06A 4KJMA 4BRYA 3L1MA 1IFPA 4R4MA 1SQVD 3M0DA 3D70A 2ETSA 3B5NB 1L0NG 2R7VA 2J7PD 3TGUE 2IM8A 5B66E 5A6JA 1E79H 4GOEA 1LTJA 2OJQA 1RE3A 3Q5SA 1QL2A 2YWAA 3U9JA 2ZPAA 4U3FD 2HJMA 5KYNA 3V6IA 4XLPF 2JDIH 3VYIA 3I5QA 3UNGC 5COMA 2HZ8A 2A1DD 1LTBC 1JOCA 3JT1A 3CSKA 3DM9B 4JBZA 4PJMA 2QJPB 2OYHC 2KNCB 5T3TA 2R02A 3K66A 2FYUE 3V5BA 2R3SA 3A0BH 4DJGA 2I8DA 2W6BA 2DGJA 4U5FE 3PDMP 3CI9A 1JY3P 2CNWA 5AW2B 1N73B 2KQ9A 2H89C 2KYHA 3C7JA 2QE7H 1ZHZA 3US6A 5KYUB 1M1KQ 4EWCA 4CSAA 4DZOA 1PD1A 1LTIC 3CWBE 4KI2A 3JSEO 3QZCA 1VPCA 4L74A 4MVOA 3X2QC 1NKZB 2PNOA 1U89A 3L75G 1NTMK 4KT0J 2WVNA 1A02J 2YKQA 4YJWA 3S29A 4EI2A 2CYDA 2PX0A 3SXYA 1KB9H 5BU5A 2P67A 3P8CE 3CXHE 3KDPB 2K37A 3HE5A 4XEFA 1L4AB 5K5GB 1RMVA 4J32B 1YIJP 3GWLA 1OCOC 1P84H 5BQGA 3TK0A 1NAYA 1A0BA 3T6GB 2KZJA 1EZVE 1NU1G 2IYLD 4M63A 5IY5C 1SQXG 2ZT9B 2HMQA 2QY9A 1M1JA 2N1TC 2KSJA 2JX0A 3H25A 1XZPA 4R32A 2I8BA 2XKMA 4UB8E 1EDKA 2B87A 2E74B 2KS1A 1MNDA 4AL1A 3B4SA 2L91A 4U5GA 3QWOC 1VQLP 3QH9A 2G3VA 4C3BA 1URQC 2P7VA 1DEBA 3MTUE 3TNUA 3CD6P 1YITP 1RCPA 3P32A 4NY3A 4TLFA 1FNTc 3O10A 2FFHA 1KYOD 4CJGA 4QI2A 3JC22 3QVYA 5F5HA 5CIVA 5AVRB 2D2CC 4WGZA 2YNYA 1XWJA 2YHSA 1KILC 2WT7A 2QRXA 3GODA 2W9YA 3M0AA 3HRNA 4EOTA 3ZQVA 1WMKA 3E1RA 3GHGA 4XQ1A 3PLNA 4C7NB 1HTLC 3A0BE 2L81A 4MVMA
chains in the Genus database with same CATH topology
2FBWC 3L8JA 2V7QJ 1ZOYC 3B71A 1U57A 1DD4A 2G8YA 2WPVB 1KTMA 3EWKA 5F28E 3TULA 2FXPA 3AEGC 3Q2YA 3GF3A 3ABVC 4H0LD 3SFEC 1O3UA 2OQQA 2QJYC 1OW6A 3AEFC 5L8RJ 2H88C 1KILE 1HF9A 3D6YA 1JOGA 3MFNA 3FGAD 2WSFJ 2E75D 4H44D 3U0CA 4OGQB 1WTYA 2E76C 3G9RA 1Q90D 2H89C 1JB0J 1RQUA 3AEAC 2YIUC 1V4AA 3C18A 1VF5C 1S1CX 3RQFA 3AECC 5M1BA 1OMIA 2QIWA 1NYHA 1PIXA 1AJYA 1K04A 2JP3A 3AE5C 2HSBA 2BEZF 1NGMB 3RK3E 3RQGA 4EBKA 2L6FA 3RQEA 3S9OA 1VL2A 1KORA 2QJPC 4KT0J 2D2CB 1WOLA 2L6GA 2D2CD 4H0LB 4YXDC 2KK1A 1YQ4C 2MKVA 5KLIC 1GMJA 2E75B 2P10A 4H44B 2IDBA 2QJKC 3C8GB 4XEFA 4H13B 2LK4A 3C8GD 4OGQC 4H13D 4I7ZB 4TT3H 2G3AA 1S5LX 3AEBC 3IN6A 1KQFB 2WSCJ 3AEDC 3SFDC 3BRJA 4RKUJ 1MKMA 1UFBA 1PV3A 3AE4C 3AE2C 1K05A 1ZMEC 4Z1MH 1OW8A 4PV1C 1DIPA 1K40A 3Q3DA 3JYYA 4EBJA 3GM3A 2ZT9B 4NQFA 2ZT9D 1ZP0C 2FYNC 4IL6X 2JPUA 4GDOA 2JX0A 3H25A 3Q5PA 4R32A 3O6QA 2QSIA 1R8EA 4XEKA 3LW5J 2Q00A 4H0LC 3C8VA 4R4LA 1UIXA 2E74B 1ZRTE 2E74D 2YMKA 3GMAA 3GLMA 1QVXA 1ZZPA 1FDIA 2E76D 3L8IA 3AE6C 2E75C 1DD3A 1RQVA 4H44C 1VF5B 1VF5D 4XEVA 2K9YA 1KMIZ 1KQGB 1Y9BA 3GM2A 2BEQD 4I7ZC 3AJMA 2O01J 1OW7A 2NZ2A 1TU3F 3D6ZA 3RL0g 1EXJA 1YQ3C 1IK7A 3AE7C 3AE3C 3T97B 3AE8C 1FDOA 3AEEC 1KNYA 3K7DA 4Y28J 3IAOA 2ZT9C 4R4MA 3D71A 3D70A 3AE9C 3O10A 3C8GA 4XFJA 1HJ0A 3Q5RA 5KKZC 2JO1A 2PBEA 1PL5A 3GM1A 2WQYC 2D2CC 3U3FA 1EXIA 3Q5SA 2E74C 3R4YA 3JZ0A 2E76B 4OGQD 2YWAA 4YTPC 4U7JA 1WWPA 4H13C 1WMKA 2J5UA 4PV1B 3Q1MA 3GF7A 4PV1D 2L6HA 3AE1C 2WSEJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW C;  3L8J A;  1ZOY C;  3B71 A;  1KTM A;  5F28 E;  3TUL A;  3AEG C;  3ABV C;  3SFE C;  1O3U A;  1OW6 A;  3AEF C;  2H88 C;  1JOG A;  3MFN A;  3U0C A;  1WTY A;  2H89 C;  3AEA C;  1V4A A;  3C18 A;  3RQF A;  3AEC C;  1K04 A;  3AE5 C;  2HSB A;  3RQG A;  4EBK A;  2L6F A;  3RQE A;  3S9O A;  1WOL A;  2L6G A;  2KK1 A;  4YXD C;  1YQ4 C;  3C8G B;  4XEF A;  2LK4 A;  3C8G D;  2G3A A;  3AEB C;  3SFD C;  3AED C;  3BRJ A;  1UFB A;  1PV3 A;  3AE4 C;  3AE2 C;  1K05 A;  1OW8 A;  1K40 A;  3JYY A;  4EBJ A;  3GM3 A;  4NQF A;  1ZP0 C;  2JPU A;  2JX0 A;  4R32 A;  4XEK A;  2Q00 A;  1QVX A;  1ZZP A;  3L8I A;  3AE6 C;  4XEV A;  3GM2 A;  3AJM A;  1OW7 A;  1YQ3 C;  3AE7 C;  3AE3 C;  3AE8 C;  3AEE C;  1KNY A;  3K7D A;  3O10 A;  3AE9 C;  3C8G A;  2PBE A;  3GM1 A;  2WQY C;  3U3F A;  3JZ0 A;  2YWA A;  4YTP C;  1WWP A;  2L6H A;  3AE1 C; 
#chains in the Genus database with same CATH topology
 1CSB A;  1L2P A;  2G8Y A;  3ZDL A;  2QM8 A;  3BRV B;  1VQM P;  3SFE C;  2WSF H;  2OQQ A;  2IFN A;  2QJY C;  4ZKU A;  1EDL A;  1NU9 C;  2J59 M;  3WU2 H;  1N1C A;  1M56 D;  3H1L D;  4JYB A;  2BC5 A;  2YLG A;  5L0J A;  1QGK B;  1URQ D;  4OGQ B;  1AA0 A;  1J8M F;  3AQB A;  4LAC B;  3C18 A;  2B89 A;  2KJG A;  3U59 A;  1V54 C;  1FE6 A;  3U3B A;  1LI5 A;  3FX0 A;  1KB9 E;  3FAJ A;  1CW5 A;  1SQV G;  3JRT A;  4YL1 A;  2FYN B;  1NFO A;  1A41 A;  1YA7 O;  2XU6 A;  1CPQ A;  1KV4 A;  1P84 E;  1ZR4 A;  3L75 E;  1I4Z A;  1SQB E;  2JKV A;  2D2C D;  4H0L B;  4YPC A;  4QI0 A;  4BRY B;  4U3F G;  1M6T A;  5HV9 A;  5AVT B;  1HVV A;  1LPE A;  4TT3 H;  2A6E F;  3K5B A;  3L70 J;  2WSC J;  5KLV D;  2C0X A;  1LTJ B;  2Q6Q A;  3BCC D;  1MV8 A;  5T1D B;  3RF3 A;  1S9K D;  3H1I E;  1JEK A;  5AW7 B;  1I5N A;  2YEV A;  3L0I A;  4A4A A;  1SQX E;  2WPR A;  3L72 J;  5CCG C;  1N86 A;  2JEE A;  4YXW H;  4EHP A;  4XWJ A;  1HH0 A;  3LW5 J;  2Q00 A;  2M8R A;  4U5C E;  1FFH A;  2E75 C;  2CK3 H;  4D6T J;  3KMI A;  1LIH A;  2FYZ A;  3L71 J;  2HJ3 A;  3H1H J;  1EXJ A;  2DI3 A;  3M91 A;  4FWV A;  1SR2 A;  5CHX A;  1TWG A;  1GW3 A;  3QW1 A;  4PD4 D;  2J9W A;  4IB4 A;  2JWA A;  1YLM A;  1YZC A;  3EHM A;  2VCC A;  4XFJ A;  2R7U A;  5KKZ C;  2P2U A;  3TQO A;  3TOL A;  5KJ7 C;  5EK0 A;  3CCU P;  2XNX A;  1GD2 E;  4RJT A;  4EKW A;  4G7O F;  1JY3 O;  4PV1 B;  1PP9 J;  3WU2 E;  3HE5 B;  5GPG B;  1TWH A;  4PFP A;  5CCG D;  1N7S D;  1ZHW A;  3FXH A;  2W8Z A;  3CC2 P;  3GF3 A;  3NMJ A;  2IYP A;  1FZA A;  4L75 A;  2WVR A;  3CX5 D;  1OW6 A;  3ASN C;  2E75 D;  4JIO A;  2YL0 A;  3IR9 A;  3RK2 D;  1Q90 D;  1IZM A;  2W6A A;  1W5C E;  2M64 A;  2CW0 F;  2B87 B;  1HE9 A;  3P8M C;  4UDV A;  1EQ7 A;  2JP3 A;  2OEX A;  2DYS C;  4JTC B;  1SQV E;  3ABL C;  1SQB K;  3S9O A;  2P61 A;  4JCH A;  2LFD A;  3T6J A;  3EZI A;  2O9X A;  1SFC A;  5KJ7 D;  1NKN A;  1YTZ I;  1SQP D;  2Y0C A;  1NAF A;  5AVZ B;  1VLT A;  4U3F E;  3FMS A;  4H13 B;  2A45 I;  2KC3 A;  4D4X A;  5L0D A;  1NTK J;  2KOG A;  4ER9 A;  3NMK A;  5B3I A;  4CPG A;  2WT7 B;  2O01 N;  4K35 A;  1DIP A;  2EIM C;  4XE5 B;  3GM3 A;  4I1O B;  2H43 A;  2L7A A;  3KZI H;  3GHG B;  1W2E A;  3P7K A;  4DRI B;  2WPQ A;  3Q5P A;  3H1L G;  2EPN A;  2QSI A;  4ZNC A;  3ZTM A;  5APV A;  2WL8 A;  4OIR F;  3NKD A;  1GM5 A;  4L6R A;  1XZQ A;  2C04 A;  2BEQ D;  3HTK C;  4I7Z C;  4WY4 C;  1YVI A;  1WT6 A;  2K9J A;  2NZ2 A;  3NXS A;  1LT9 A;  1NTZ K;  2NSG A;  1MMD A;  2AEJ A;  3O8Z A;  3AEE C;  1RHZ B;  3TK1 A;  3RK3 B;  1I4Y A;  3G50 A;  3F47 A;  4WVZ A;  1HGV A;  2UUI A;  4UB6 H;  2VH3 A;  1OXB A;  1EA8 A;  1GL2 C;  4IAR A;  5E33 A;  2NPS A;  1VQ4 P;  3V5X A;  1ZRT D;  5KLV G;  1RF1 A;  3BCC G;  4WGY A;  4I44 A;  1L7C A;  2A6H F;  4BEJ A;  3NKE A;  1ZVZ A;  3RYL A;  2J5U A;  3W8H A;  2L6H A;  2V7Q J;  1KFM A;  4JC7 A;  1DD4 A;  2PAJ A;  4IFM A;  3USS A;  1GU4 A;  1LTS C;  3EWK A;  4FAP B;  3B5N C;  2FKW B;  4PJL A;  5DVW A;  4WAB A;  1RE4 C;  4JW1 A;  5L3V A;  1S5L H;  5CCH C;  3V2P A;  2R5D A;  4CX9 A;  4WY4 D;  1ZW3 A;  3AEA C;  1QLE D;  1OMI A;  1W2W A;  1NYH A;  3FWN A;  5EGY A;  1KZU B;  3L73 D;  1BGY J;  1BBH A;  2LSE A;  2HSB A;  3UGO A;  1D0X A;  1KYO E;  4XPY A;  2KUB A;  2QJP C;  4LGD E;  5AVU B;  3EG9 A;  3ZQY A;  1H0T A;  1DOV A;  1FDM A;  2NG1 A;  2R25 A;  1VQ9 P;  1ZU5 A;  3KZI E;  2IBZ D;  4PD4 H;  3FXE A;  3RVZ A;  2EIJ C;  3SFD C;  3M4C A;  4HKZ H;  3AE2 C;  3K1I A;  1ZME C;  4HE8 D;  1AEP A;  2Q4F A;  3QMK A;  5A69 A;  2KSE A;  3W8I A;  1H9T A;  1NTM J;  4C3D A;  4MTO A;  5B5E H;  1D0Y A;  3B5N D;  2E42 A;  3H32 A;  1ZYR F;  1IFD A;  1SS1 A;  4XEK A;  4C7R A;  3H1L E;  4R4L A;  2QM7 A;  5CJ4 A;  3FOP A;  4UB6 E;  1D7M A;  2AEM A;  2POH A;  1FJP A;  1X8Y A;  1L4A C;  1N8R Q;  1G2C A;  2O01 J;  1OW7 A;  2BCC J;  2H8A A;  5JUA A;  3CX5 H;  2Y9Z A;  1QPU A;  5DJU B;  4YN0 B;  3K7D A;  3KHU A;  2XLV A;  2ZT9 C;  3R7C A;  4BJ6 A;  1SQP G;  3SZR A;  3NMI A;  1V74 B;  1J2J B;  2Q1K A;  3VMA A;  2PBE A;  1FBM A;  2FXO A;  1OVR A;  2P7J A;  3H1K J;  4CS9 A;  2E74 C;  3KXD A;  3CCQ P;  3LIE A;  4IGG A;  3RW0 A;  3V5Y A;  3I5C A;  5KLV E;  2YIU B;  1LT1 A;  3CMA P;  3BCC E;  3IHU A;  1SFC B;  1S9K E;  2GUV A;  1GK4 A;  4KNW A;  2FFD C;  1VQN P;  2WSE J;  1E85 A;  2FBW C;  5L0H A;  5DS4 A;  3V4Q A;  1E5W A;  3R2P A;  2R03 A;  3Q6N A;  3C8Z A;  1CGM E;  1CI6 A;  1MFT A;  3NRH A;  3A2A A;  1FAV A;  3C62 A;  3EQL F;  3WAQ A;  1XTG B;  2ZXP A;  4JE9 A;  1PZQ A;  4NPE A;  4BPM A;  3KYJ A;  3WOD F;  2XL8 A;  4DVZ A;  4FX5 A;  1OKK D;  1LP1 A;  1IW7 F;  1MMG A;  1RXQ A;  3MHV A;  3T9O A;  4JCZ A;  5B66 H;  2WB7 A;  3PCV A;  4I1M A;  4PD4 E;  3JRM O;  3BVH A;  3S1K A;  1VL2 A;  2IOQ A;  1LT9 B;  3ZWI A;  2YXR B;  3HNI A;  5APT A;  3VAY A;  3HJC A;  1RH5 B;  4OIP F;  1KQL A;  2R7W A;  2Q7R A;  4B6I A;  4DJ9 A;  1GQA A;  3S4R A;  4OGQ C;  2YKZ A;  2IFM A;  2NPS B;  3CWB J;  3BRJ A;  4NCQ A;  2HOD A;  2AEF A;  2QNL A;  2ZXX A;  1D1A A;  3MP7 B;  2R32 A;  1CZQ A;  1ZLL A;  3RVY A;  1NTK K;  2IYO A;  1K40 A;  3Q3D A;  4AK9 A;  2FYN C;  2PGD A;  2XS8 A;  3AG1 C;  4I3M A;  3CX5 E;  1G8X A;  1X0T A;  3ZIB A;  4H0L C;  1PGP A;  3I55 P;  1O87 A;  2J9B A;  4CBE A;  2MWQ A;  2NSF A;  3L8I A;  1Q81 Q;  1A7E A;  3OW2 O;  3TF5 A;  2YXQ B;  3HD7 A;  1NZE A;  2IXO A;  2Y9Y A;  4CS8 A;  3L73 G;  1EZV I;  4J7Y A;  2Z5I A;  3VTP C;  4DOJ A;  1LTJ C;  2A0U A;  3TOM A;  3AE3 C;  4BEM J;  1H89 A;  5TJ5 E;  3B0U X;  3O6X A;  1BZ4 A;  3HNL A;  3CXH H;  4JJF A;  3I56 P;  2IX7 C;  1PL5 A;  3JCU Q;  3GM1 A;  2IBZ G;  2V3C C;  5DS6 A;  1QKR A;  2H8P D;  2M3E A;  3R4Y A;  4OIQ F;  4OGQ D;  5K0I A;  4MTF A;  1E86 A;  4E0I A;  3EG9 B;  3PHL A;  3MD0 A;  1H0T B;  1JY2 N;  1S7Z A;  3SEO A;  1OVV A;  3VP8 A;  1ZOY C;  4UB8 H;  3B71 A;  2I1J A;  4XLN F;  1BCC E;  4GIF A;  2N9Y B;  2FXP A;  4GT1 A;  4RD9 A;  4H0L D;  1Q0G A;  2HSQ A;  4CSA C;  4ANJ A;  4MN4 C;  5KAF H;  2XLH A;  4OIO F;  3U0C A;  4DCK A;  3H32 B;  1Y6D A;  1OQC A;  2YL3 A;  3AG3 C;  5EHH A;  1FAP B;  2J7P A;  4E18 A;  2XS1 A;  1FJK A;  2G62 A;  4O79 A;  3L34 A;  3AG4 C;  1G2C B;  2W27 A;  3DAF A;  2CGE A;  1N7L A;  5APY A;  2WTY A;  2EPL X;  4RES B;  5A6K A;  4CDY A;  1J1D C;  2AP3 A;  5AW6 B;  4ZKP A;  1H6G A;  4LC1 A;  2O3J A;  4OD4 A;  3IN6 A;  1K73 Q;  4N06 A;  5DQT A;  1KB9 I;  2KP8 A;  3DE8 A;  2LQG A;  1Z63 A;  2CPS A;  2A69 F;  3EQ2 A;  3L70 D;  3JYY A;  3Q7G A;  3L75 J;  1P84 I;  1SQB J;  2ZFC A;  3NG1 A;  4EIJ A;  1H8A A;  2P6V A;  5FCL A;  2OU6 A;  1SP4 A;  2HV7 A;  1L0L K;  4JTD B;  3L72 D;  2HKV A;  3DAG A;  5CJ0 A;  1CI6 B;  5BUO A;  1ZHX A;  2RN0 A;  3CCL P;  2OCC C;  1TR2 A;  3X1O A;  1U7M A;  2K9Y A;  3H1I J;  4Z9I A;  5BQH A;  2VCB A;  3W68 A;  3L73 E;  4GYT A;  4PJ0 E;  1YYX A;  4C7O A;  4DT0 A;  3L71 D;  2M5A A;  4OVN F;  2UWJ E;  1LP1 B;  3LNR A;  3H1H D;  3OAK A;  1AUE A;  4EIY A;  4GEH A;  1FMW A;  2OTK E;  1NSG B;  1AQ5 A;  1SQQ K;  3GHG C;  4L76 A;  3W4Y A;  4CDA A;  3Q5R A;  1WRG A;  3OEO A;  2JO1 A;  2YQY A;  2ZXO A;  2IBZ E;  1Y8A A;  1ZW2 A;  3RIP A;  2H7O A;  2XL6 A;  1JMM A;  1TWA A;  1DOW A;  4ZMD A;  5BVZ A;  1ORS C;  3NDB B;  1NTZ J;  5KAF E;  5CMZ A;  3LLK A;  4LDQ A;  1HBW A;  2Q9I A;  1ZU4 A;  4JYC A;  4HFK B;  1PP9 D;  2HOD B;  3RK3 C;  3CCR P;  2XSE A;  4YT5 A;  5L0F A;  3RFY A;  1VYK A;  1L0N E;  2R44 A;  2ICW G;  2WSF J;  4IJJ A;  3CCS P;  2QTV A;  3T97 A;  3HNJ A;  3RL0 B;  3S84 A;  2R7S A;  3IFM A;  1C03 A;  1JB0 J;  4EDF A;  1VF5 C;  2NUT A;  2HYN A;  1A7D A;  3CCM P;  4WB4 A;  2P58 A;  2ZYA A;  3HD7 B;  3UMK A;  2N1T D;  4C46 A;  3RGU A;  2LKM A;  1VTM P;  2Z4E A;  3H2U A;  3EH1 A;  4MVR A;  1KOR A;  2C0W A;  1WOL A;  2FYU K;  2YL7 A;  1K8A Q;  1GMJ A;  2Q3E A;  1WAS A;  4LER A;  2AWY A;  4YL3 A;  1Y4C A;  2PF4 E;  4Y99 B;  2AXC A;  1MZ9 A;  3LID A;  2EIN C;  2E5T A;  5JVE A;  3TSI A;  1ZP0 C;  2IBF A;  1URQ A;  1NWQ A;  3V7O A;  4BJ5 C;  2XLO A;  3OWT A;  3GMA A;  5L0C A;  1KIL D;  4FES A;  3TD7 A;  1VF5 D;  1L3P A;  4C3E A;  3SXK A;  3V2R A;  2LR2 A;  1JPJ A;  1LE2 A;  4OH8 B;  5EFW B;  2VCA A;  2A0B A;  4AE4 A;  3GWN A;  2G3K A;  1NU1 E;  3D71 A;  1IJD B;  1OCR C;  4L73 A;  1KQS O;  3K1H A;  1HJ0 A;  3U8P A;  4W8P A;  1OX3 A;  3MYF A;  3JSZ A;  2Y3B A;  2N9B A;  2QJK B;  5AVX B;  4YTP C;  5AGF A;  1WWP A;  4Z9H A;  4D4N A;  3L70 G;  3MUD A;  2EIL C;  5COF A;  2YVK A;  2O1K A;  2H7B A;  1JCC A;  3U2M A;  3M15 A;  3ZVR A;  3F5H A;  3CC4 P;  1BR4 A;  2OEV A;  3L72 G;  3TUL A;  3AEG C;  4M3L A;  1YA9 A;  4XTK A;  1L0N K;  4BJT A;  3TDK A;  4W80 A;  5L8R J;  2H88 C;  3N7N A;  1JOG A;  3MFN A;  4KHX A;  2QEX P;  2RH0 A;  4MVZ A;  2NPU A;  2TMV P;  3EFO A;  5D92 A;  3UR3 C;  1ZHT A;  2R5B A;  3UMH A;  2YIU C;  1HW1 A;  2YKP A;  2VC9 A;  2P1J A;  1SFC C;  3L71 G;  4MND A;  1AJY A;  3H1H G;  4OIN F;  2OGU A;  2CDQ A;  4EBK A;  2L6F A;  4MQ9 F;  1G1I A;  1BGY D;  4NC3 A;  3JYH A;  3JTL O;  3ATP A;  5BQI A;  4YXD C;  4C7O B;  2YKO A;  2Z5H A;  5DS5 A;  4U5E E;  3H65 A;  2M5A B;  1M1J B;  2QG4 A;  1GS9 A;  1HJB A;  3C8G D;  1M2O A;  5CCG A;  1N7S A;  3AED C;  1GTW A;  1UFB A;  3IQ5 A;  3C1L A;  2KS1 B;  2ZXE B;  1FZC C;  1FU1 A;  1PP9 G;  4EBJ A;  1BR2 A;  3B29 A;  4NTF A;  4JPZ B;  2HLO A;  1Z7Q c;  1HGZ A;  1R8E A;  3TNU B;  1AV1 A;  4NPD A;  2QUP A;  1NTM D;  3N4X A;  4EUK B;  3ZC4 A;  3SNH A;  1AVO A;  2W90 A;  3NYL A;  3O55 A;  1OXZ A;  3GM2 A;  2OYO A;  1KYO H;  2NPS C;  1USE A;  3GAN A;  1JO5 A;  5COG A;  4W7Y A;  3T97 B;  2OTL P;  1NU1 K;  2LXC B;  5KJ7 A;  1NLX A;  1SQX K;  2BCC D;  3IAO A;  2KW3 C;  2NUT B;  2KGO A;  3HKK A;  1JY2 P;  2QE9 A;  3H1J J;  5E3C A;  4NTA A;  3ITK A;  1T5O A;  3I4U A;  3IQC A;  3U3F A;  1IFJ A;  4P9F A;  1YJG A;  4O6Y A;  3EGX A;  4IAO A;  2E76 B;  5DJT B;  1PGQ A;  2JJL A;  4E0H A;  2RKL A;  4CDV A;  2A45 G;  1RJ9 A;  3H1K D;  1AVY A;  4IAQ A;  2IXP A;  2XXA A;  2WZF A;  3OA7 A;  3N24 A;  5DLJ A;  3L70 E;  3KPE A;  2GDC A;  3FHD A;  3UGP A;  5KYY A;  5E2Q A;  2Q5U A;  1U0B B;  1J1E C;  1TKN A;  1EI7 A;  3M9B A;  3FGA D;  4W8K A;  5AW3 B;  3RBX A;  5GTI H;  1URQ B;  1T01 A;  1QX8 A;  1Q0D A;  1RQU A;  4IRU A;  2MHR A;  1FZB A;  3RQF A;  5APX A;  5A6B A;  1G5Z A;  2R9R B;  2R7X A;  2WZL A;  3II6 A;  2Y0D A;  3L71 E;  4ONS A;  1HW2 A;  3H1H E;  2V26 A;  3QW0 A;  1IFN A;  4A7P A;  3RQG A;  4RBN A;  5AW8 B;  3HUS A;  2D2C B;  2JD3 A;  3K1I C;  4JZA A;  1AFO A;  1EKY A;  2V4H A;  1YQ4 C;  4AE4 B;  3M79 A;  2P10 A;  3VP9 A;  1YDI A;  5AW1 B;  2LK4 A;  1KD1 Q;  1RKE A;  3IPM O;  4RKU J;  2ZYD A;  3VRC A;  1ZN5 A;  5CI9 A;  4PD4 I;  3AG2 C;  3HNK A;  1SQV K;  1NFN A;  4EBB A;  1KU2 A;  2YLD A;  3T6B A;  1NOH A;  1GL2 D;  3LS0 A;  2QJY B;  4WY4 A;  2XL4 A;  4AL0 A;  2Q9A A;  3EHN A;  2W83 C;  2M0B A;  1JMW A;  4ASW A;  1IZN B;  3EGD A;  4BJ6 C;  2KZI A;  1KQG B;  2ZJS E;  1T6I A;  4LLC A;  1N73 C;  3RL0 g;  2R7O A;  1MMN A;  2NRG A;  3GG2 A;  3EFO B;  1FDO A;  3C9I A;  1BGY G;  1M57 C;  3CCV P;  2UUH A;  2XM0 A;  3A3Y B;  3CX5 I;  1Z5Z A;  4RDA A;  1L0L J;  2OQM A;  5L3Q A;  4A2N B;  3MGN A;  4HEA J;  1BE3 J;  2OG2 A;  5CCH D;  2HMZ A;  3G3Z A;  3WMM 0;  1FOS E;  2A68 F;  3GEE A;  4P6I C;  3ZDM A;  3WUT A;  3KH2 A;  2W4M A;  3B5N A;  2J9V A;  4CIH A;  5GTI E;  1JCD A;  3G4S P;  2FGY A;  1GW4 A;  1ST6 A;  1N7S B;  1SQQ J;  1NTM G;  1LTA C;  1QQ3 A;  1HY5 A;  1KIL E;  3L74 J;  3PJS K;  2QLA A;  4OWF A;  3RK2 B;  1LNQ A;  3NTN A;  1SYQ A;  3L36 A;  1Z56 A;  4J7T A;  4MTG A;  2BCC G;  2QIW A;  4G78 A;  4IL6 H;  1M57 D;  1BCC J;  1AVO B;  3Q7L A;  3V2N A;  4JKV A;  3TGU J;  1X79 B;  5KKZ B;  2X51 A;  1H88 A;  1OCC C;  1T8Z A;  2IZ0 A;  2P0N A;  2ZAE B;  3BAT A;  3VMX A;  4KC9 A;  1VOM A;  2MKV A;  3MZW B;  3H1K G;  4Q5S F;  2ZD9 A;  3RL0 C;  4JEA A;  1L4A D;  1ZR2 A;  1S5L X;  3AEB C;  2B88 A;  1H7I A;  4YT8 A;  5L0I A;  1PV3 A;  4H4K C;  4JTA B;  3IEE A;  1JM0 A;  3EGX B;  1TFO B;  1R5L A;  4GOD A;  3LUT B;  1PGJ A;  3KYQ A;  2ZT9 D;  3HD7 C;  2H7H A;  2HV6 A;  4CS8 C;  2K9J B;  1NO4 A;  2FYU J;  5GTH H;  2VAS A;  1OZH A;  4CJO A;  5TJH A;  1OKK A;  5AW0 B;  5D91 A;  1SQB D;  256B A;  3W2W A;  2WPS A;  3F89 A;  1JY2 O;  1UIX A;  3E9V A;  2E74 D;  1GK6 A;  2Y69 C;  2OJE D;  5CI8 A;  1YI2 P;  5KYY B;  2IPP A;  1Y9B A;  4BG0 A;  3AGU A;  1YJN P;  4IOI H;  1OR3 A;  1S4X A;  1VYI A;  1LVK A;  2HS5 A;  1IK7 A;  4W7Z A;  4Y99 C;  3H1I D;  2LXB A;  1RF1 B;  1T2K C;  3AOU A;  3JCU H;  3FVY A;  1BGY E;  2WVO A;  2H7V C;  5DQZ A;  1SF8 A;  1WAT A;  3BRT B;  5JRA A;  2FFD A;  3PH0 A;  3CXH I;  3HUS B;  4G7H F;  3LAY A;  3L73 J;  1HUC A;  1LKX A;  4LLE A;  3ZTZ A;  3M0D C;  2OYI A;  1VQ6 P;  2YZS A;  3V4W A;  2QA4 P;  1RE3 C;  3HD7 D;  2ZXR A;  4QDL A;  1RKE B;  1QVG O;  1NTZ D;  4PR9 A;  1Q82 Q;  5F28 E;  3VMZ A;  3Q2Y A;  1NTM E;  3ABV C;  2C03 A;  3U1C A;  3VM6 A;  4IL6 E;  3M1C B;  4JVS A;  2IBZ I;  4PFO A;  3AEF C;  1SQP E;  1RF0 A;  4KNV A;  1WN0 A;  4PAC A;  1IC2 A;  4PJ0 H;  5KLV K;  1F1M A;  2OKU A;  4WY4 B;  5APS A;  4N6C A;  1QVF O;  1EDI A;  5E3A A;  4B86 A;  1E84 A;  1S2E A;  1R4T A;  4E7Z A;  5KYX A;  3EGD B;  2BCC E;  1E83 A;  1T3U A;  1GGQ A;  3OJA B;  1MNE A;  3VF0 A;  1SVF A;  3RQE A;  4MVQ A;  1Q86 Q;  2WVQ A;  1L0N J;  3FAP B;  1NHL A;  1AQT A;  3WUV A;  2L6G A;  4U5B E;  2YLI A;  2Q3T A;  2XLM A;  3CQZ A;  1PFI A;  4H44 B;  2IDB A;  3H1K E;  4JF7 A;  5GTH E;  2KB7 P;  1NU7 D;  5APW A;  1JMB A;  4YK5 A;  3N0T A;  2XZR A;  4PV1 C;  2GA1 A;  4X0R A;  2K88 A;  1M90 Q;  4N78 D;  5F5F A;  2ZVO B;  3S27 A;  3O6Q A;  4IFD K;  1XTC C;  3JCU E;  1ZRT E;  2KLV A;  2ZYG A;  1QVX A;  1CPR A;  3WUU A;  1FDI A;  1M1J C;  2YL1 A;  3FXD A;  2LP4 A;  2RD9 A;  5JS5 A;  3DMD A;  1LWU A;  2EIK C;  3GEI A;  1R5S A;  2DYR C;  4O7G A;  3NYM A;  1QL1 A;  2YO3 A;  1R5I D;  1Z6A A;  4CS7 A;  2CNW D;  3V2Q A;  1KNY A;  1VMA A;  1E2X A;  1QSP A;  4PJN A;  2BL2 A;  3CCJ P;  4K7B A;  1X22 A;  2L9J A;  3POV A;  1Z3I X;  1VQ5 P;  1H9G A;  1GDT A;  3FWL A;  1BDJ B;  5JT4 A;  4K0D A;  2XV5 A;  4U7J A;  4H13 C;  2GA0 A;  1C17 M;  3GF7 A;  1NU1 J;  4PV1 D;  5TIS H;  2C9N Y;  1SQX J;  4PJJ A;  4D6T D;  3MX3 A;  1N2D C;  4Z9J A;  2B0H A;  2WPV B;  5CBN A;  1SQB G;  1LJ2 A;  1OFC X;  2EPM X;  2VRS A;  4DVY P;  1SQP K;  3DI5 A;  2R05 A;  1UII A;  3D6Y A;  5B3S C;  1WTY A;  2E76 C;  1PGO A;  4MS2 A;  2RMZ A;  3H1I G;  1LS1 A;  2M4E A;  2OYH A;  3BEH A;  1K04 A;  2HUJ A;  2BEZ F;  3A7O A;  1MMA A;  2EPO A;  1G4U S;  3SSU A;  4LDK A;  2O1J A;  3LNM B;  5B1A C;  3B0V C;  4AYC A;  1KN7 A;  2CCY A;  3ITF A;  1ZHY A;  1GZL A;  5AW4 B;  1M56 C;  2PRR A;  4H13 D;  1JRA A;  1M2V A;  4GKG A;  2FFD B;  4WBA A;  2Q9C A;  1K05 A;  4GQH A;  1NTZ G;  5C39 A;  1U7J A;  2MYS A;  4ULW A;  1YBK A;  2OYI B;  2Y3G A;  2KLU A;  2JPU A;  4GDO A;  3DD7 A;  1RKC A;  4JJG A;  2GAQ A;  2HFI A;  1FZF A;  2J46 A;  1B68 A;  1OVU A;  4WJ0 A;  4H54 A;  4N4W A;  2LCH A;  3C8V A;  4EYY Q;  5E79 H;  4BXL A;  2E76 D;  5JP7 A;  4HH2 A;  3AE6 C;  3NMD A;  4U9D A;  3T4R A;  2N1T A;  2M3B A;  2JWD A;  2OAR A;  1Q0M A;  4O6N A;  2WSS H;  4NTB A;  1SQV J;  2ZVN B;  2R7Q A;  3VYW A;  1FC2 C;  3I5P A;  3SYN A;  3A5T A;  2GWW A;  2XLE A;  2A06 D;  1FTS A;  2PFD A;  4DBR A;  4U9E A;  1NTK D;  1Y47 A;  3RK3 D;  2KSF A;  2I1K A;  3MUD C;  1FZG A;  5KYX B;  5TIS E;  3QTH A;  2HPC A;  4U3F J;  3G71 P;  1CGO A;  5JLI A;  3H1J D;  3HLZ A;  1YZA A;  2EPK X;  3JZ0 A;  3DKA A;  5APQ A;  1JUN A;  1SZI A;  5CBO A;  1LI7 A;  3A11 A;  3GW6 A;  1JTH A;  3U2L A;  2PP6 A;  4HB1 A;  3Q1M A;  2PFX A;  2J58 A;  3M9H A;  3LEV A;  3MIW A;  5T3W A;  3CL3 D;  1PCX A;  1LTT C;  3VMY A;  1FS0 E;  4YT2 A;  3G6E P;  1KIL A;  3B8E B;  1MFZ A;  1S3J A;  3NYJ A;  3U1A A;  1IO4 A;  1X9V A;  3EFF K;  3U8V A;  5H2F H;  2XDJ A;  5KLI B;  3GEH A;  1YJW P;  4G0H A;  4DOZ A;  2W6J H;  3J06 A;  3O6Q B;  5HSW A;  3H2V A;  4JRZ A;  5B1B C;  3AEC C;  2CPB A;  5KTB A;  1PIX A;  2IXN A;  1S72 P;  1VQP P;  3AE5 C;  4ULV A;  4GOF A;  1N7S C;  1LS4 A;  1LWU B;  3VOP A;  1VQ8 P;  4JEB A;  4AQR D;  1LM3 B;  4KBL A;  2KK1 A;  2VB6 A;  1CGN A;  1K9M Q;  1T6A A;  4XPX A;  2Q7C A;  3AQC A;  4HJG H;  2WSC H;  4O6M A;  3DM5 A;  3RK2 C;  3UMI A;  4MVS A;  2Y0E A;  1OWA A;  2XLW A;  4BJ5 A;  1IFM A;  1MKM A;  1D1B A;  4D6T G;  3S28 A;  5E79 E;  3AE4 C;  5AW9 B;  4DRJ B;  4Z1M H;  1OW8 A;  1D1C A;  1FZE A;  4K3A A;  1NTZ E;  3Q6M A;  4YWQ A;  3LW5 H;  5KYW A;  3ZG1 A;  4MW8 A;  2SPZ A;  3CC7 P;  5BU8 B;  3DWW A;  1WGW A;  3WHN A;  1M7L A;  3CCE P;  2FAP B;  1VDF A;  2QVA A;  3M4B A;  4E7S A;  2R3C A;  3SXM A;  3AGT A;  1QEX A;  1QZX A;  4JQ0 D;  1IFI A;  3F46 A;  2ITA A;  1OXK A;  2ZXW C;  1OIP A;  3KYI A;  1SLQ A;  1KYO I;  1VQK P;  2OYH B;  2KYV A;  2XLD A;  3DXJ F;  1NH4 A;  3C8G A;  1J1D B;  2GUS A;  4O9B A;  4YL0 A;  4CIP A;  3W67 A;  1LT9 C;  1EXI A;  1PPJ D;  5APU A;  1W2B O;  1L0L D;  2B0J A;  1Z23 A;  3W2V A;  1BE3 D;  2GFH A;  2HFE D;  1SFC D;  5H2F E;  4LDR A;  2W45 A;  3A9C A;  2NUP A;  1JAF A;  1ZW0 A;  1U6H A;  2KI7 B;  3L8J A;  4NPF X;  1RF1 C;  1M2V B;  2F22 A;  1U57 A;  4N78 E;  2E87 A;  3H1L J;  2FXM A;  3DZA A;  1O3U A;  1SQQ D;  2YO2 A;  3NFQ A;  1HF9 A;  2XM4 A;  3H6P A;  1KFN A;  3HUS C;  1TWC A;  3G9R A;  2R7R A;  1DX7 A;  3JSV C;  3L74 D;  2A06 G;  1UG7 A;  1VQO P;  1NTK G;  3PHF 2;  1MUU A;  4F4B A;  2N1T B;  1YHQ P;  1T6U A;  3MBG A;  4I1L A;  2D4U A;  1BCC D;  1JY3 N;  3EFG A;  3CME P;  5KAI H;  3IQ6 A;  3H1J G;  2DB4 A;  3MYI A;  3L72 E;  3TGU D;  1FZC A;  5FZT A;  1DEE G;  2A45 H;  2KK7 A;  4QMA A;  1PD0 A;  5KLV J;  2AVK A;  3BCC J;  2C9L Y;  4JUR I;  2YRF A;  3G4Z A;  3HE4 A;  3U9M A;  3L4F A;  2G3A A;  2HPC B;  1ORJ A;  2NPS D;  3E1I A;  1A02 F;  1QLE C;  1Q0K A;  5AVV B;  2W4B A;  4D6T E;  1T9K A;  3TJ6 A;  1IK9 A;  4U5H A;  1ZV8 A;  1JTH B;  1Q0F A;  1A7V A;  5A6B D;  5L0G A;  3ECS A;  3PRJ A;  1EDJ A;  4WWI A;  1HMD A;  1Q2N A;  4P9T A;  1BSH A;  3FOO A;  1VK5 A;  1APC A;  3GLM A;  2FYU D;  1KIL B;  3B9Q A;  2Y3D A;  3A0H H;  4H44 C;  2J0W A;  1VF5 B;  3E7K A;  4RO0 A;  3DJN B;  4XPW A;  1M8O B;  4DXW A;  3AJM A;  4PK4 A;  1VLS A;  1KC8 Q;  3AE7 C;  4J30 B;  1GU5 A;  2DW3 A;  3AE8 C;  3EZH A;  1YYJ A;  4I2L C;  5AC5 A;  3CWB D;  3RBZ A;  1NG1 A;  2AWC A;  1PP9 E;  3DE9 A;  3CEX A;  3KPH A;  3LLI A;  2LIG A;  3HTK A;  1OCZ C;  1O5H A;  3L37 A;  3U5S A;  2AU5 A;  2WQY C;  2Y3H A;  3SWY A;  4N6J A;  2K1A A;  1HMO A;  3ZSU A;  1HWT C;  3CLQ A;  1SMY F;  1EC5 A;  3P8C D;  3CXH D;  4N3Y B;  5AVS B;  2Z15 A;  3E70 C;  3S0X A;  2J9U A;  1GL2 A;  2V7Q H;  3K6B A;  4XA4 A;  3AE1 C;  4I6M C;  4CS9 C;  1EZV D;  2J8W A;  1HE1 A;  3KKB A;  4ASV A;  3OA1 A;  2JR8 A;  2K3R A;  4AX2 A;  2MJZ A;  1BR1 A;  1NVO A;  3M9Q A;  4H44 D;  1JR8 A;  2Y39 A;  5KYW B;  2BE5 F;  3EPV A;  3S90 A;  5KAI E;  1V4A A;  3QVZ A;  5M1B A;  2HG5 D;  5A6A A;  1JPN A;  1RE4 A;  2A06 E;  2R7T A;  1NTK E;  4DBQ A;  3RK3 E;  2E5Y A;  5CCH A;  1D0Z A;  3LEO A;  3IF4 A;  1SQP J;  1PPJ G;  1LE4 A;  3DJU B;  3ABM C;  3V5Z A;  1L0L G;  4AUW A;  1TQG A;  4N6H A;  4Q4Z F;  1ORY A;  3H1J E;  1RY3 A;  1J8Y F;  1BE3 G;  1L0N D;  2YMY A;  4IWB A;  1V55 C;  2E75 B;  3C8G B;  1FR0 A;  1YAU O;  4U5D E;  2KNC A;  4LLH A;  3TJ5 A;  2KIK A;  2AXT H;  3VN0 A;  1FFT C;  1DH3 A;  3A0H E;  2GM4 A;  4BWN A;  4K1O A;  4NQF A;  1SQQ G;  2XRH A;  2OOC A;  5AVY B;  2NUP B;  1N73 A;  2OTJ P;  3FDQ A;  4ZLD A;  1TFK B;  2J45 A;  3PMR A;  2KNH A;  1BDC A;  2YMK A;  3EJN A;  5KYU A;  3L74 G;  2O01 H;  1DD3 A;  2WZG A;  3EH2 A;  4XEV A;  2WZ7 A;  1KMI Z;  1USD A;  1MQV A;  1TU3 F;  3D6Z A;  3G4X A;  1S5L E;  1FMV A;  1BSN A;  1YQ3 C;  4IFF A;  3PTZ A;  1KB9 D;  1BCC G;  3IQT A;  4Y28 J;  3PP5 A;  1RJ9 B;  2OYI C;  1S05 A;  3TGU G;  3LS1 A;  3AE9 C;  2XXA B;  1L4A A;  1P84 D;  1G4W R;  3L75 D;  1VB5 A;  2WMM A;  5AC4 A;  5AVW B;  4ZLC A;  2HR3 A;  4DRH B;  2D5R B;  3ABK C;  3ASO C;  2WSE H;  1FZC B;  2LFF A;  3CZ6 A;  5AVQ B;  1OR2 A;  1RF0 C;  1T6Q A;  3O39 A;  2J0X A;  3HE4 B;  1KTM A;  5AW5 B;  1NU1 D;  1YTZ T;  3LJB A;  2WIT A;  2KXP B;  4BJ1 A;  1SQX D;  5JSL A;  2FYU G;  2IZ1 A;  3BAS A;  1JNM A;  2IXM A;  2ASR A;  3TYY A;  5B5E E;  4HYT B;  4G7Z F;  3CPW O;  1YYC A;  1EQ1 A;  3RL0 D;  2PX3 A;  2WWW A;  2L5G B;  3MLG A;  1S1C X;  3CWB G;  4YT4 A;  3B0P A;  1NGM B;  2XND H;  1YAR O;  2FY8 A;  2E43 A;  3GOR A;  3LES A;  4Q7C A;  4MW3 A;  2X0C A;  1PPJ E;  2AXT E;  2BAS A;  3C63 A;  3UIA A;  1L0L E;  5KLI C;  1ZXG A;  3L35 A;  4C7N A;  2QJK C;  1BE3 E;  3RKO F;  3KL4 A;  3K33 A;  3HTK B;  1T3J A;  4I7Z B;  3SWK A;  1KQF B;  4E17 A;  2RSE B;  2B9B A;  1EZV G;  4OD5 A;  3KQG A;  2Q9B A;  1VQ7 P;  1FOS F;  1BDD A;  1T2K D;  3CAX A;  1NBB A;  3SWF A;  1NJI Q;  2PP4 A;  4IL6 X;  1G1J A;  1GL2 B;  3WG7 C;  3N2Z B;  1LWU C;  1J1E B;  1SQQ E;  1C02 A;  4MVU A;  3SXZ A;  2I15 A;  1Q7Y Q;  1ZZP A;  3RH3 A;  2P1A A;  1RQV A;  3L74 E;  4HFF B;  1LTG C;  2Q3I A;  3SP1 A;  1LGH B;  1YJ9 P;  2LD6 A;  3M06 A;  4KJM A;  4BRY A;  3L1M A;  1IFP A;  4R4M A;  1SQV D;  3M0D A;  3D70 A;  2ETS A;  3B5N B;  1L0N G;  2R7V A;  2J7P D;  3TGU E;  2IM8 A;  5B66 E;  5A6J A;  1E79 H;  4GOE A;  1LTJ A;  2OJQ A;  1RE3 A;  3Q5S A;  1QL2 A;  2YWA A;  3U9J A;  2ZPA A;  4U3F D;  2HJM A;  5KYN A;  3V6I A;  4XLP F;  2JDI H;  3VYI A;  3I5Q A;  3UNG C;  5COM A;  2HZ8 A;  2A1D D;  1LTB C;  1JOC A;  3JT1 A;  3CSK A;  3DM9 B;  4JBZ A;  4PJM A;  2QJP B;  2OYH C;  2KNC B;  5T3T A;  2R02 A;  3K66 A;  2FYU E;  3V5B A;  2R3S A;  3A0B H;  4DJG A;  2I8D A;  2W6B A;  2DGJ A;  4U5F E;  3PDM P;  3CI9 A;  1JY3 P;  2CNW A;  5AW2 B;  1N73 B;  2KQ9 A;  2H89 C;  2KYH A;  3C7J A;  2QE7 H;  1ZHZ A;  3US6 A;  5KYU B;  1M1K Q;  4EWC A;  4CSA A;  4DZO A;  1PD1 A;  1LTI C;  3CWB E;  4KI2 A;  3JSE O;  3QZC A;  1VPC A;  4L74 A;  4MVO A;  3X2Q C;  1NKZ B;  2PNO A;  1U89 A;  3L75 G;  1NTM K;  4KT0 J;  2WVN A;  1A02 J;  2YKQ A;  4YJW A;  3S29 A;  4EI2 A;  2CYD A;  2PX0 A;  3SXY A;  1KB9 H;  5BU5 A;  2P67 A;  3P8C E;  3CXH E;  3KDP B;  2K37 A;  3HE5 A;  4XEF A;  1L4A B;  5K5G B;  1RMV A;  4J32 B;  1YIJ P;  3GWL A;  1OCO C;  1P84 H;  5BQG A;  3TK0 A;  1NAY A;  1A0B A;  3T6G B;  2KZJ A;  1EZV E;  1NU1 G;  2IYL D;  4M63 A;  5IY5 C;  1SQX G;  2ZT9 B;  2HMQ A;  2QY9 A;  1M1J A;  2N1T C;  2KSJ A;  2JX0 A;  3H25 A;  1XZP A;  4R32 A;  2I8B A;  2XKM A;  4UB8 E;  1EDK A;  2B87 A;  2E74 B;  2KS1 A;  1MND A;  4AL1 A;  3B4S A;  2L91 A;  4U5G A;  3QWO C;  1VQL P;  3QH9 A;  2G3V A;  4C3B A;  1URQ C;  2P7V A;  1DEB A;  3MTU E;  3TNU A;  3CD6 P;  1YIT P;  1RCP A;  3P32 A;  4NY3 A;  4TLF A;  1FNT c;  3O10 A;  2FFH A;  1KYO D;  4CJG A;  4QI2 A;  3JC2 2;  3QVY A;  5F5H A;  5CIV A;  5AVR B;  2D2C C;  4WGZ A;  2YNY A;  1XWJ A;  2YHS A;  1KIL C;  2WT7 A;  2QRX A;  3GOD A;  2W9Y A;  3M0A A;  3HRN A;  4EOT A;  3ZQV A;  1WMK A;  3E1R A;  3GHG A;  4XQ1 A;  3PLN A;  4C7N B;  1HTL C;  3A0B E;  2L81 A;  4MVM A; 
#chains in the Genus database with same CATH homology
 2FBW C;  3L8J A;  2V7Q J;  1ZOY C;  3B71 A;  1U57 A;  1DD4 A;  2G8Y A;  2WPV B;  1KTM A;  3EWK A;  5F28 E;  3TUL A;  2FXP A;  3AEG C;  3Q2Y A;  3GF3 A;  3ABV C;  4H0L D;  3SFE C;  1O3U A;  2OQQ A;  2QJY C;  1OW6 A;  3AEF C;  5L8R J;  2H88 C;  1KIL E;  1HF9 A;  3D6Y A;  1JOG A;  3MFN A;  3FGA D;  2WSF J;  2E75 D;  4H44 D;  3U0C A;  4OGQ B;  1WTY A;  2E76 C;  3G9R A;  1Q90 D;  2H89 C;  1JB0 J;  1RQU A;  3AEA C;  2YIU C;  1V4A A;  3C18 A;  1VF5 C;  1S1C X;  3RQF A;  3AEC C;  5M1B A;  1OMI A;  2QIW A;  1NYH A;  1PIX A;  1AJY A;  1K04 A;  2JP3 A;  3AE5 C;  2HSB A;  2BEZ F;  1NGM B;  3RK3 E;  3RQG A;  4EBK A;  2L6F A;  3RQE A;  3S9O A;  1VL2 A;  1KOR A;  2QJP C;  4KT0 J;  2D2C B;  1WOL A;  2L6G A;  2D2C D;  4H0L B;  4YXD C;  2KK1 A;  1YQ4 C;  2MKV A;  5KLI C;  1GMJ A;  2E75 B;  2P10 A;  4H44 B;  2IDB A;  2QJK C;  3C8G B;  4XEF A;  4H13 B;  2LK4 A;  3C8G D;  4OGQ C;  4H13 D;  4I7Z B;  4TT3 H;  2G3A A;  1S5L X;  3AEB C;  3IN6 A;  1KQF B;  2WSC J;  3AED C;  3SFD C;  3BRJ A;  4RKU J;  1MKM A;  1UFB A;  1PV3 A;  3AE4 C;  3AE2 C;  1K05 A;  1ZME C;  4Z1M H;  1OW8 A;  4PV1 C;  1DIP A;  1K40 A;  3Q3D A;  3JYY A;  4EBJ A;  3GM3 A;  2ZT9 B;  4NQF A;  2ZT9 D;  1ZP0 C;  2FYN C;  4IL6 X;  2JPU A;  4GDO A;  2JX0 A;  3H25 A;  3Q5P A;  4R32 A;  3O6Q A;  2QSI A;  1R8E A;  4XEK A;  3LW5 J;  2Q00 A;  4H0L C;  3C8V A;  4R4L A;  1UIX A;  2E74 B;  1ZRT E;  2E74 D;  2YMK A;  3GMA A;  3GLM A;  1QVX A;  1ZZP A;  1FDI A;  2E76 D;  3L8I A;  3AE6 C;  2E75 C;  1DD3 A;  1RQV A;  4H44 C;  1VF5 B;  1VF5 D;  4XEV A;  2K9Y A;  1KMI Z;  1KQG B;  1Y9B A;  3GM2 A;  2BEQ D;  4I7Z C;  3AJM A;  2O01 J;  1OW7 A;  2NZ2 A;  1TU3 F;  3D6Z A;  3RL0 g;  1EXJ A;  1YQ3 C;  1IK7 A;  3AE7 C;  3AE3 C;  3T97 B;  3AE8 C;  1FDO A;  3AEE C;  1KNY A;  3K7D A;  4Y28 J;  3IAO A;  2ZT9 C;  4R4M A;  3D71 A;  3D70 A;  3AE9 C;  3O10 A;  3C8G A;  4XFJ A;  1HJ0 A;  3Q5R A;  5KKZ C;  2JO1 A;  2PBE A;  1PL5 A;  3GM1 A;  2WQY C;  2D2C C;  3U3F A;  1EXI A;  3Q5S A;  2E74 C;  3R4Y A;  3JZ0 A;  2E76 B;  4OGQ D;  2YWA A;  4YTP C;  4U7J A;  1WWP A;  4H13 C;  1WMK A;  2J5U A;  4PV1 B;  3Q1M A;  3GF7 A;  4PV1 D;  2L6H A;  3AE1 C;  2WSE J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...