1K05A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
135
structure length
135
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 57
structure length 135
sequence length 135
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k05A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k05A02
1ZP0C 3AE4C 3SFEC 3AE8C 2JX0A 1YQ4C 1ZZPA 4XEKA 3AE9C 3AEBC 2HSBA 4YXDC 1K04A 4YTPC 3AEDC 3AE1C 3S9OA 3B71A 3GM3A 3U3FA 4EBKA 2KK1A 3C18A 3AE6C 1O3UA 1OW7A 3JYYA 1OW8A 3AEFC 3K7DA 3GM1A 1K05A 3AE2C 3C8GB 3BRJA 4XEFA 3AECC 4R32A 2PBEA 3C8GA 3JZ0A 2Q00A 1ZOYC 3RQFA 3AE7C 1WOLA 1OW6A 2L6FA 2G3AA 2YWAA 3L8IA 1QVXA 2L6GA 2H88C 3RQEA 4NQFA 3GM2A 3AEGC 3SFDC 4XEVA 5F28E 3TULA 1K40A 3U0CA 1WTYA 1JOGA 3O10A 3AE3C 3C8GD 3AE5C 1PV3A 3ABVC 2FBWC 1WWPA 2H89C 1UFBA 3RQGA 1YQ3C 3AEAC 2WQYC 3MFNA 2LK4A 3L8JA 3AEEC 1KNYA 1V4AA 2L6HA 3AJMA 1KTMA 4EBJA 2JPUA
chains in the Genus database with same CATH superfamily
4AQRD 1NU1G 2A68F 2VCBA 4YWQA 1GGQA 3CL3D 2EPLX 1Y9BA 5AW7B 3TF5A 1U89A 2P61A 3L74E 3H1LG 3LNMB 3UMIA 3RK3D 3EFOB 2A6EF 1L0ND 4DOJA 2HJ3A 1GD2E 3VAYA 4H13B 1GMJA 2H43A 1RKEA 2VC9A 4JYCA 4P9FA 1LWUA 3T9OA 1Q82Q 4EBKA 2MJZA 1FZCC 1KILA 4G7HF 3CWBJ 3L70E 1NU9C 3IPMO 1OW7A 3CD6P 3SXYA 3NFQA 1BR1A 4Z1MH 4N6CA 1VQNP 256BA 2GWWA 4HFKB 2YL0A 3AE2C 1NKZB 4XLNF 4I6MC 4CDVA 3K1IC 2BCCG 1M90Q 4MW3A 2YRFA 4BWNA 4PJ0H 4OH8B 3ZTZA 2JWAA 1PPJE 1WN0A 1BGYG 5DS4A 1OCCC 2IYOA 1IZMA 1GM5A 5AVZB 3CCLP 4D6TG 1JB0J 4IFDK 3V5XA 3JRMO 2QJYB 3HKKA 2XLMA 2YVKA 3G4XA 3FXEA 4JQ0D 1BDDA 2ZT9B 2B87B 2QVAA 3IFMA 5KLIB 3RK3E 1L0NE 3AG4C 2FBWC 2OU6A 2O01H 1SQXJ 3L75J 1FDIA 2N9YB 1R5ID 1NU1K 5JLIA 1S3JA 3HE5B 4NPDA 4EHPA 2PX0A 2CNWD 3NXSA 1NTKJ 2AEJA 3B0VC 4UB6E 2XZRA 5B66H 1S5LH 1PL5A 2XNDH 3PRJA 3L36A 5E33A 2J59M 1YJ9P 1A02J 4RBNA 3MP7B 3CX5I 1T9KA 1IFIA 3B5ND 1GDTA 3AEEC 1TKNA 1JCDA 4ONSA 3DM9B 2PAJA 2KB7P 3PHLA 1LT9A 3TK0A 1O5HA 2ZAEB 1JNMA 4OD5A 1U7JA 2R7OA 2P7VA 2JPUA 1NOHA 1XWJA 1OKKD 1NTZG 3KDPB 5CCHC 2ZXRA 2QJPB 2JR8A 2WVRA 4YT2A 4I7ZB 4GIFA 3WU2E 2DW3A 4ZLDA 2QA4P 3O6QB 3NYJA 3CC4P 1YYXA 3L73D 1VF5B 1YTZI 3PJSK 4L74A 2IBZG 1NZEA 2YEVA 1RE4C 3S29A 2J9UA 3UMKA 1VYIA 4YL0A 3AG1C 3HLZA 5KYXB 3W2VA 2P10A 3FVYA 2QTVA 3IR9A 4JRZA 3WUTA 1LPEA 3K7DA 3A0HH 5A6JA 1FR0A 4BXLA 2WZGA 1APCA 3HD7D 4FAPB 2A0UA 1ZU5A 3BEHA 5DQZA 1ZOYC 4NPFX 3M0DA 2OYIB 4RJTA 1OW6A 4O7GA 1KILC 2NPUA 3C8ZA 1MMGA 3H1KJ 4CX9A 2Z5IA 2A0BA 1K9MQ 2C0WA 3OWTA 3G3ZA 3P8MC 1LI7A 4K35A 4WWIA 3EHNA 2HSQA 2NUTA 1SQBE 3D71A 3U0CA 3CC7P 1ZW0A 1WTYA 3NDBB 3KYJA 2J7PA 1RKCA 3ABLC 5JRAA 3HE4A 5B5EH 1G2CA 2E75B 2VH3A 2O01J 5D92A 1IK9A 4CS7A 1ZV8A 5KYUB 2KSFA 4Z9HA 1BCCD 3V5YA 1NJIQ 1NTZK 2H89C 1OMIA 4GODA 5E79H 1RF1B 2GFHA 2LIGA 2D2CC 2WPRA 2KXPB 3RK3B 5BUOA 4D4NA 4JF7A 2F22A 3HNLA 3VRCA 1FDOA 1SZIA 2IFNA 3M9HA 5COMA 2FYZA 1M1JA 2ZVOB 4JJGA 3LIEA 4EYYQ 3LLKA 3O55A 2DB4A 2WB7A 1IFNA 1SFCB 3B29A 3Q6MA 1OKKA 3JSVC 2W4BA 4WY4B 4EIYA 1X8YA 5BQIA 3SFEC 3KPEA 3LIDA 1YZAA 3F89A 4OIQF 4DOZA 2A45H 2XLDA 1LT9C 4J7YA 2RD9A 1T2KC 1NTMJ 1RE3A 2KK7A 1VQ7P 3FXHA 4YXDC 4L76A 1BBHA 1IW7F 2CYDA 4CS9A 3SSUA 2C9LY 3VMXA 1FC2C 3CMAP 1N8RQ 2MYSA 4N78D 2IOQA 4A2NB 3T6BA 1NBBA 2IFMA 3ZWIA 3EZHA 4KBLA 4IL6X 1BCCE 4UB6H 3A7OA 2CW0F 1Z5ZA 2FYUE 4BRYA 4C7RA 3AEFC 5CCGA 1H0TA 3CCUP 3GWLA 1AVYA 3W68A 5L8RJ 1JMWA 1ZRTD 3RH3A 3U9JA 5CHXA 2HPCB 2YKPA 3DWWA 2KLVA 3NMIA 3L70G 4AL1A 1HWTC 4DRIB 1OFCX 1H7IA 3M15A 2O01N 1L3PA 2H88C 3KXDA 4U5DE 5KLVD 2WZFA 1OX3A 2FFDA 2QM8A 1HTLC 3FWNA 3E1RA 3WU2H 4RDAA 3CXHH 3M4CA 2OOCA 3H32A 1OXKA 3UR3C 4MVUA 2IXNA 1H8AA 2WSCH 3M0DC 1FMVA 2HODB 4AYCA 2KS1A 2CK3H 2R02A 3B5NB 2VB6A 3C8GD 3NMDA 1PPJG 2OTKE 3GF3A 3T6GB 2YXQB 1KYOI 2KW3C 5APUA 1PP9J 3ABKC 5FCLA 2KC3A 2OTLP 1SQVJ 5HSWA 1GK6A 2N1TD 3EGDB 1S05A 2OEXA 1M1KQ 3CWBD 4N78E 2A6HF 1LI5A 1R5SA 3MZWB 1EA8A 4U5GA 1MQVA 5JUAA 1EC5A 1U7MA 3A0BH 1L0NG 4CDYA 4O9BA 2JKVA 1Y6DA 4WGZA 5A69A 2QJKC 5KAIE 1ZRTE 2IZ1A 1T8ZA 3HJCA 1HE9A 2AEMA 2P67A 1LTSC 4IAOA 3EGXA 4IAQA 5AC5A 2E74D 5HV9A 1RY3A 1L7CA 4LLHA 3AE8C 5KLVE 3SXMA 3SYNA 2YO2A 3K1HA 2Y0CA 3JSZA 4DXWA 3HD7B 3OA7A 3ZDMA 1BE3D 4PFOA 1M1JC 4FX5A 1GW3A 4ZKUA 2KYVA 3CC2P 3T4RA 1NO4A 1GK4A 3N0TA 2KZJA 3QW1A 1VL2A 1E83A 3E7KA 3FAJA 4N06A 1ZHWA 2PP4A 2XXAB 1SQPJ 1VQ6P 2EINC 3MD0A 2HMQA 4JEAA 1U6HA 2YL1A 1RE3C 2KSJA 1T3UA 3QVZA 3LEOA 1LTBC 3MUDA 4CS9C 1RMVA 4N3YB 3FOPA 4U5EE 1OIPA 2GDCA 2R7RA 3GW6A 2Q9BA 1FDMA 1H6GA 1OQCA 3H2VA 4LDKA 5APSA 1HY5A 3ZQYA 4ER9A 3KYQA 3ATPA 5CCGC 3AEGC 1SQQJ 3TNUA 4FESA 3SFDC 1EXJA 2WSCJ 2QE7H 5TISH 5FZTA 4C7NB 1KQGB 2YLDA 4MVQA 1L0LJ 3TD7A 1Q2NA 2D5RB 1L0NK 2XLHA 1IFDA 2ZXWC 4MN4C 1JMBA 2KLUA 4RD9A 4AK9A 2FXOA 1BE3E 4OVNF 3WHNA 2FFDC 5A6AA 3C1LA 3H25A 2EILC 4LGDE 4QMAA 4YPCA 4KT0J 1UFBA 2N1TA 1HW1A 4C7OB 5DQTA 2A06D 1NGMB 3L73G 2Y69C 3I5QA 4U3FJ 1PZQA 3R7CA 1JTHB 4R4LA 1XTGB 4WBAA 2I8DA 3GEIA 4BEMJ 3CMEP 4Q4ZF 5APYA 2WT7A 1VPCA 2AVKA 1M2VA 3O6XA 5CCHD 4GYTA 2OJED 2YIUC 3QVYA 4E7ZA 1FJKA 1NSGB 1IK7A 3JTLO 1LTJB 4JTCB 4CJOA 1MFZA 2QG4A 2R25A 2R5DA 1W2EA 4Y28J 4OINF 2J9WA 3VTPC 4XQ1A 4WJ0A 1FJPA 1KN7A 4LLEA 1OXZA 3M79A 2VASA 1HJ0A 1RF0A 1QPUA 3HTKB 3BCCD 1K8AQ 2V26A 4BJ1A 2OQMA 2CPSA 2AXTE 1FFTC 3H1HD 3F47A 2NRGA 3EQ2A 2A06E 1TFKB 3AGTA 4N6JA 1J2JB 3C8GB 3RVYA 1OVRA 2CDQA 1JEKA 1T3JA 2KNHA 2E43A 4XPYA 1BCCG 1SQBK 5T1DB 3L71J 1KILD 2R3SA 2XDJA 3VMYA 1OCOC 2OYHA 1ZW2A 3M4BA 1J1EC 4OGQD 5F28E 3TULA 5BVZA 3MUDC 3K33A 2PF4E 4NPEA 1W5CE 2Q3IA 1T6QA 4MVMA 4OIRF 3ECSA 2GAQA 4BPMA 4KI2A 3U3BA 3AE5C 3PCVA 1URQB 5APVA 1Q0DA 2JDIH 2FAPB 3RBXA 2JJLA 1EZVD 3SWFA 3DAFA 1CPQA 3Q7GA 5COFA 5BQGA 4C3DA 2NG1A 1LM3B 2E74B 4MNDA 3U8VA 1L4AD 4G7ZF 4LACB 2HS5A 2FYNC 4UB8E 3L72D 1S1CX 1XZQA 3BCCE 1Z6AA 1TU3F 1MUUA 1H89A 5BU5A 3H1HE 4GKGA 4J7TA 4FWVA 2N1TC 2VCCA 3F46A 4MW8A 3WG7C 3DXJF 3FAPB 3R4YA 3AE4C 1FZCB 1QL2A 3C9IA 1KV4A 1PGJA 1KILE 3OA1A 2XSEA 3FHDA 2YKOA 3CLQA 5CBOA 2GUVA 2J9VA 4PD4D 1EZVI 4E7SA 2NZ2A 4L75A 1O87A 3HNJA 1T2KD 4JJFA 1HUCA 2MHRA 2W6JH 2FYUK 1GW4A 1M7LA 3U3FA 3QH9A 2RMZA 5KLVG 4B6IA 2UWJE 1R8EA 1O3UA 1Q0KA 4O6MA 5CJ4A 5D91A 1BDJB 1NKNA 2TMVP 2I1JA 3TJ6A 2EPNA 2HG5D 3LJBA 2W90A 3B8EB 2PX3A 3F5HA 1CGOA 3BRJA 3L72E 4LERA 1RJ9A 3W8IA 5KYWB 2JWDA 4MQ9F 2Q00A 1VQKP 1N7SA 1WATA 3S4RA 1QKRA 1RF0C 3KPHA 4WABA 1KMIZ 3H1JJ 1HGZA 1VQOP 2G3VA 2O3JA 1N2DC 3CWBG 4W8KA 1NU1J 5TJ5E 3H1ID 5L0JA 2M64A 1VB5A 4PD4I 3POVA 4U5CE 4HE8D 3O10A 2WVOA 3RW0A 3KQGA 1ZMEC 3H1LJ 4U5BE 1CGNA 3LEVA 2KNCB 2P1JA 2YMYA 3CCVP 3EZIA 4RO0A 2R5BA 2OYHC 2O9XA 3CX5D 3PH0A 2L91A 2IXMA 2OGUA 3CI9A 2I15A 4C46A 1C17M 4IRUA 2WMMA 2RKLA 3RYLA 2HR3A 1BR2A 2P1AA 3D6YA 1HMOA 1L4AA 1VDFA 4IL6E 2R44A 2J7PD 1AQTA 2GUSA 1LE4A 1BE3G 1V74B 4PV1C 2EPKX 1IO4A 2ZYGA 3G9RA 4W7YA 3L35A 1P84I 3KZIH 5KYYB 2LK4A 2BL2A 5KYNA 2BCCJ 1DEBA 3RKOF 2L6HA 3V4QA 1QQ3A 3RBZA 2XLEA 3AGUA 3G50A 1BGYJ 3TGUD 5KLVK 1U57A 1ZLLA 4ZKPA 5CI9A 2OARA 2MWQA 2GM4A 3IQ6A 2Z15A 5AW6B 1AQ5A 3H1IE 3Q1MA 4OD4A 1YQ4C 4LDRA 1W2BO 4H13C 4DVYP 3MBGA 4XWJA 2H8AA 2J45A 1HW2A 2G8YA 1IFPA 2E76B 4I1LA 1A7DA 4DZOA 1DOVA 1RKEB 3W4YA 1LWUB 1A7VA 4PJLA 4YL3A 5B3SC 5KAFH 2EPMX 3B71A 1KILB 2R32A 5L0FA 2VRSA 3U2LA 1ZW3A 3RIPA 2OG2A 2LQGA 1ZU4A 3CX5E 4IARA 3B0UX 3LAYA 4WB4A 3K6BA 1LTIC 3EH2A 2M4EA 2E5YA 4HH2A 4NTBA 2IPPA 3GM1A 1Y8AA 1Q0GA 1NAYA 3AECC 2B89A 2W9YA 2QUPA 3RQFA 2LCHA 3CXHI 3EPVA 3V7OA 2ETSA 1AFOA 1KB9H 4CS8A 3USSA 1EDKA 2KOGA 4I1MA 5DS6A 2K9JA 3U1AA 3SP1A 2PP6A 3DE9A 3HUSA 1NTZJ 4CBEA 4MVRA 4NQFA 1S5LX 3TJ5A 3TGUE 2IZ0A 2A06G 4I44A 2Y3BA 1CGME 5CCGD 1Q0FA 1AVOA 3I56P 1JOGA 1G1JA 1OR3A 4JYBA 4WGYA 2HV6A 2YL7A 3LW5H 1N7SC 2D2CB 2OQQA 1SP4A 1TWHA 2DYSC 2NUPA 4R4MA 2W8ZA 2N9BA 2J0XA 2ZD9A 2EIJC 5DJTB 3D6ZA 4K1OA 4TLFA 5GPGB 3PDMP 2HLOA 1WWPA 2K37A 3QMKA 4EOTA 2QLAA 3I5PA 3IQ5A 4OGQC 3CEXA 2RSEB 1YDIA 2K88A 3ITKA 4D4XA 1ZN5A 2Y3DA 1VQ4P 2HFED 1WMKA 5F5FA 3U9MA 3VP9A 5JSLA 4GQHA 3ZVRA 2BEZF 4HFFB 2A1DD 1Z56A 4YT8A 3DKAA 2ZXEB 3V6IA 1Q0MA 1LT9B 4MVZA 2WSEH 3L73E 5B1BC 2W6AA 1PD1A 2QJPC 1L4AC 4I7ZC 4N6HA 2ICWG 3BCCG 1LT1A 1WASA 3N2ZB 2R7UA 4JBZA 2SPZA 1GL2A 3RL0C 5AVQB 1E2XA 3I4UA 3CSKA 3H1HG 3JSEO 4M3LA 3G71P 1OR2A 1S7ZA 4YL1A 2Y3HA 2FXPA 5A6KA 2YL3A 4LC1A 5A6BD 3V5BA 2O1KA 3CCSP 2H7HA 3NG1A 1T6AA 1YI2P 1MMDA 2M8RA 2FY8A 4CPGA 1MNEA 1AUEA 2YLGA 1LTTC 3L0IA 4DJGA 1PCXA 2IXPA 5AVRB 3JYYA 1M56C 1FAVA 4IGGA 2HV7A 4L6RA 1K05A 3I55P 4XEFA 2XRHA 2OYIC 2Q9IA 4LLCA 3TDKA 3JCUE 1ZHZA 2Q9AA 1EZVG 5JVEA 1G8XA 3ASOC 4U5HA 1LGHB 2NPSA 1KFMA 2J58A 1YA7O 4PJJA 2LKMA 1FOSE 1KYOD 1IJDB 2NUTB 1S2EA 1T01A 1IFJA 3TYYA 3L72G 3JT1A 3LW5J 3V4WA 3HE4B 1G2CB 4CS8C 2KSEA 5COGA 3D70A 2R7TA 2Y9ZA 2WITA 3HUSC 3BRVB 2G62A 2QJKB 1F1MA 1KC8Q 1G4US 1LP1A 1TR2A 4BJTA 3L74J 4IFFA 1VQ5P 5AVXB 1YJNP 1GS9A 1FZAA 2W45A 3ZQVA 5T3TA 4DRJB 1WRGA 3NMKA 2WSEJ 2M5AA 3NKEA 3KHUA 5GTIE 4K0DA 1M1JB 3N7NA 1HJBA 1I5NA 1OZHA 1D7MA 3L70J 3VN0A 2Y9YA 2WVQA 1XTCC 3RGUA 1D0YA 3SWYA 3BRTB 4IB4A 4DVZA 5L3QA 4DJ9A 4H4KC 2YO3A 1NU7D 3G4ZA 3BASA 3H65A 3FDQA 1KYOE 3K66A 3WODF 1FOSF 3WMM0 1YA9A 3T6JA 1G4WR 2IYLD 2PGDA 5A6BA 1XZPA 4CDAA 2Y0DA 2QE9A 3DZAA 1VQLP 1JY3N 2IXOA 3SNHA 2X51A 3AQBA 5BU8B 1GL2C 3GM3A 3QW0A 2WSFH 4ULVA 3S27A 3H1IG 1YARO 1JPJA 4BRYB 1BSHA 1NWQA 2B88A 1IC2A 4MTFA 1H0TB 4Y99C 2WZLA 2AEFA 4ANJA 5AW5B 4BJ6A 1E85A 4JE9A 1M6TA 4XLPF 3VF0A 3T97A 4JTAB 3GHGA 2XLWA 4G78A 2BE5F 2XL8A 5CMZA 1QEXA 1AEPA 1J8YF 2RH0A 1LP1B 2G3AA 2NSFA 2FFDB 1HVVA 1SQXD 1PIXA 3L75D 1QVXA 3EG9A 1VQPP 3H32B 4H44C 1C02A 1NTKD 4DT0A 2KS1B 1PFIA 3CWBE 2AWCA 3IHUA 4HJGH 2Z4EA 1QVGO 4K3AA 1YZCA 2NPSC 2MKVA 3FX0A 1G5ZA 1DEEG 1RHZB 2OCCC 3DD7A 3RL0g 3TGUG 4P9TA 4I1OB 2VCAA 3ASNC 4O79A 3WUVA 3SXZA 1KQFB 2P7JA 1LE2A 3JC22 4NTFA 1VOMA 3CZ6A 2PFDA 2YIUB 5CBNA 2H8PD 3JCUH 2JO1A 2FFHA 4PFPA 1UIXA 1D0XA 2Q9CA 4PV1D 1KNYA 5AW2B 4EI2A 1TWAA 5AVWB 3EGXB 2HKVA 4QI0A 1QL1A 2R7SA 1MZ9A 5AW4B 3P8CD 1YITP 1D1AA 3EFGA 3CQZA 1FZBA 3CCJP 2GA0A 1SQXE 3L75E 2W83C 3V2NA 3M1CB 1NTKE 2AXCA 5KTBA 3MYIA 2J0WA 1Q90D 2WPSA 2I1KA 3LESA 1D0ZA 3CAXA 2WSFJ 4H13D 2Z5HA 3AE1C 3H1KD 1X22A 2Y0EA 1SQBJ 1YJGA 2ZXXA 2WPQA 3FOOA 5E3AA 2H7BA 1N73A 1J1EB 3JYHA 3IQCA 4QI2A 3RK2C 1YLMA 3H6PA 2PRRA 2WVNA 3RVZA 3II6A 3UNGC 2HFIA 2XNXA 3TK1A 1FMWA 3LS0A 1VYKA 2ASRA 4BEJA 2L6FA 4AUWA 1KORA 2HJMA 2YWAA 5JP7A 2XL4A 2CPBA 2KJGA 1VMAA 3TNUB 1CI6A 2BC5A 4U7JA 4AE4A 3M91A 5DVWA 4BJ6C 1EQ7A 1KYOH 2KIKA 1KU2A 2IBZI 3QWOC 2QEXP 2KYHA 2FYNB 4O6NA 2XU6A 2H7VC 3GHGC 1FZGA 3DAGA 1YAUO 2ZXOA 2Q5UA 1LJ2A 2YKQA 5KAIH 1N7SD 2CCYA 2HMZA 3Q2YA 5KKZC 1JOCA 2Q7CA 4PJ0E 4ASWA 2HZ8A 3ABMC 2N1TB 2C0XA 3VYWA 1A02F 2FGYA 1X79B 3H1KE 1CZQA 1RH5B 3RF3A 4ZMDA 4PACA 2XL6A 2XLOA 2WWWA 1M8OB 2OKUA 1RXQA 4OIPF 3U5SA 2M3BA 5APQA 1JPNA 5B3IA 1NTMD 1OWAA 4JC7A 2Q1KA 2M3EA 5DJUB 2FKWB 4PR9A 4I3MA 4C3BA 1SR2A 1BCCJ 3C62A 3S28A 4BJ5A 2CGEA 2FYUJ 2NSGA 2WT7B 3PMRA 1M2VB 4CIHA 2RN0A 2BEQD 2K3RA 5B66E 2ZFCA 1S5LE 3RL0D 1ZXGA 1ORYA 4YN0B 1UIIA 2QY9A 3SZRA 1Z3IX 3CCEP 3EFOA 1K04A 3S9OA 5APWA 1LTAC 2KGOA 1VTMP 2B0HA 4EWCA 3EJNA 1GQAA 4OWFA 1YIJP 3L74D 2LFDA 2EIKC 3E70C 4JVSA 4EUKB 2X0CA 1J1DC 1QX8A 1G1IA 1KD1Q 3DI5A 1M56D 5L3VA 1T6IA 1LKXA 3AE7C 1JR8A 1WOLA 3UIAA 1USEA 3LS1A 1TWGA 3TOLA 1PP9D 1NTME 2K1AA 1SQVD 2OYHB 3S84A 1FZEA 1N73C 4EBBA 1EZVE 3OEOA 3V2QA 5H2FE 2DYRC 5F5HA 1NFNA 2LXCB 3VYIA 3Q5PA 4H0LC 1N1CA 3E9VA 2R7XA 1NHLA 4TT3H 2W6BA 3JRTA 1KZUB 1ORJA 2PNOA 2QNLA 1URQC 3A0HE 3OJAB 2Q6QA 1DX7A 3AE3C 4HKZH 3S1KA 4PV1B 3Q3DA 3EHMA 1HMDA 4J32B 1BSNA 2B87A 2P2UA 4Q5SF 4QDLA 1FZFA 1DOWA 1P84D 1MV8A 2UUIA 1VLSA 4XPWA 5KLVJ 1L2PA 3L34A 3U59A 3HE5A 1RQVA 4GEHA 1I4YA 2J5UA 3MHVA 1LTGC 4RKUJ 1NAFA 5B5EE 3SEOA 1EI7A 4PD4E 3BATA 4HYTB 1KTMA 3N4XA 3ZG1A 1RQUA 2B0JA 1NG1A 1A7EA 1WGWA 4C3EA 1SFCD 4JKVA 1PP9E 4E17A 1SQVE 4YK5A 4JW1A 4WY4D 1SQPD 1SMYF 5E79E 3IN6A 2AXTH 1D1CA 3VM6A 3O6QA 1FBMA 5AW3B 1JO5A 3US6A 2QSIA 1EXIA 1Y47A 5E3CA 4BJ5C 4YTPC 3LLIA 3I5CA 3AEDC 1PGPA 1S72P 2W4MA 4JURI 1EKYA 1NVOA 2Q4FA 3Q6NA 1YJWP 2D4UA 1SQXG 3L75G 1GZLA 2A45I 3CXHD 3C18A 2H7OA 3AE6C 1GL2D 4JPZB 1P84E 1AJYA 1UG7A 1NTKG 5KYXA 1SQQD 3GORA 1QVFO 5M1BA 4D6TJ 1QZXA 2IBFA 4XTKA 2KI7B 4E0HA 1RJ9B 1L0LD 2IDBA 1JCCA 2YLIA 1BE3J 4DRHB 1H9GA 5B1AC 4KNVA 3OAKA 5E2QA 1N7SB 1WT6A 1SLQA 1T5OA 3U8PA 1HE1A 2OYIA 2IM8A 3AG3C 2ITAA 1FS0E 4N4WA 1U0BB 2V7QH 2YXRB 1BDCA 4OGQB 5AGFA 2R7QA 4XEVA 4UB8H 1J8MF 5KJ7A 5AVVB 1M57D 4H44D 1SF8A 4YJWA 4F4BA 5EFWB 4YT5A 2R03A 2WL8A 1SQPE 3GLMA 4XE5B 3R2PA 4W7ZA 1JY2P 4U3FD 1ZR4A 4JZAA 2YHSA 2NPSD 1KQLA 3HRNA 5KYUA 1HGVA 4IJJA 1SQBD 3KMIA 3A3YB 1Z63A 3VP8A 2E42A 1L4AB 3M9QA 2A69F 5BQHA 3W67A 4KHXA 3CXHE 2QJYC 3KL4A 1S4XA 3RL0B 3NKDA 4XFJA 1RF1A 2ZPAA 3UGPA 1SQQE 2ZT9C 5AVSB 2J8WA 5AW0B 5KLIC 2QIWA 1L0LE 1N86A 5AW9B 3NTNA 3M06A 4O6YA 3H1KG 5IY5C 1SQXK 1FTSA 1YVIA 3B9QA 1TFOB 1ZR2A 1PD0A 2LR2A 5H2FH 3AOUA 1NTKK 3DE8A 1SFCA 2K9YA 1JY3P 4K7BA 2JX0A 4WY4A 3E1IA 4MVSA 2E76C 1DD3A 3A0BE 2YQYA 3CCQP 1LWUC 1I4ZA 2AU5A 1Q7YQ 1YBKA 2Q3TA 3EWKA 1D1BA 4U3FE 4ZNCA 1MKMA 3GEHA 3S90A 1TWCA 4EIJA 3L71D 2KK1A 2IX7C 4U5FE 3S0XA 4X0RA 4JTDB 3L37A 1VF5C 3Q5RA 1GU4A 1C03A 1HF9A 4J30B 1R5LA 1QLEC 1BR4A 3RK2D 3JZ0A 1ZHXA 3AQCA 4PD4H 4G7OF 4XPXA 2K9JB 3A2AA 3GODA 3UMHA 1OVUA 2HPCA 1TQGA 2V7QJ 3HUSB 1KFNA 3IEEA 3V2RA 2FYUD 3P32A 3L8IA 2QRXA 4U9EA 3BCCJ 1HBWA 2V4HA 2CNWA 1AVOB 1VLTA 3B0PA 3Q7LA 4IL6H 3Q5SA 3QZCA 3H1HJ 3G6EP 3V2PA 2R05A 3DMDA 5L0HA 3A9CA 2NUPB 3GANA 1E79H 2HODA 1NTMG 4A7PA 1PV3A 3B5NA 1VQ8P 5KJ7C 1CSBA 2AP3A 1P84H 2LP4A 3RQGA 3EGDA 5TISE 4E0IA 3L71E 1DIPA 1R4TA 4EDFA 2OJQA 3QTHA 2E75C 3SWKA 2LXBA 3N24A 1LIHA 2L9JA 1SYQA 3BVHA 2WZ7A 1E5WA 3AJMA 4EBJA 2G3KA 5JT4A 1GL2B 3CX5H 3IF4A 2LD6A 3L74G 3A11A 2KP8A 1RF1C 1JUNA 4HEAJ 3L72J 1JY2N 1OXBA 3GMAA 4PJNA 3RK3C 1MFTA 3AG2C 5TJHA 1VQMP 1DD4A 1OCRC 5C39A 4Y99B 1ZZPA 4XEKA 1OCZC 3AEBC 4GT1A 2JEEA 3K5BA 4GOFA 3DJUB 5L0CA 5DLJA 3HD7A 4L73A 3M0AA 1M2OA 4JIOA 1PP9G 1B68A 1SQVG 1EDIA 1SFCC 3WUUA 4NY3A 3H1JD 1MNDA 1FU1A 3C8VA 2KUBA 2B9BA 4WY4C 2P58A 1NU1D 1CPRA 3X2QC 4H44B 1OW8A 1LS4A 2XXAA 2DI3A 3H1LD 1NTMK 1MMNA 4R32A 2PBEA 3NYLA 2ZYAA 2W27A 1N7LA 2R3CA 2NPSB 4RESB 3X1OA 1FFHA 1LNQA 4YXWH 2M0BA 2XLVA 1V54C 5EGYA 2HYNA 4CSAA 3SXKA 3MX3A 2XV5A 1K40A 4NTAA 2A45G 2V3CC 5L0DA 4KNWA 3MGNA 2POHA 4C7NA 4Q7CA 4H0LD 3UGOA 5CJ0A 1L0NJ 5DS5A 2HUJA 3H2UA 4PJMA 1URQD 3GG2A 1SS1A 1Y4CA 2BCCD 2GA1A 3TOMA 2QM7A 3O39A 1YYCA 2L5GB 2C04A 5GTHE 1BGYD 2J46A 3H1IJ 1JAFA 4UDVA 3RFYA 2KZIA 1M57C 3H1JE 3TQOA 1LVKA 1SQPG 1ST6A 3A5TA 3AEAC 2WQYC 5AVTB 4D6TD 4C7OA 3W8HA 2Y39A 1E86A 1NU1E 3JCUQ 2M5AB 3B5NC 4IOIH 3ZTMA 2L81A 4KC9A 3V5ZA 3LNRA 1S9KD 2O1JA 1ZYRF 3H1LE 1JTHA 3PHF2 3NMJA 1NLXA 1SQVK 4CJGA 3DM5A 2R9RB 2OYOA 3ITFA 3FMSA 1RCPA 1ZVZA 1ZP0C 1SQQG 2UUHA 2ZJSE 5EK0A 4BG0A 1GU5A 1BZ4A 2JD3A 1EQ1A 1A0BA 1L0LG 2LFFA 4Z9IA 1QGKB 2J9BA 1LS1A 3RK2B 3VMZA 3IQTA 5K0IA 5APTA 1LTJA 3P7KA 1Z7Qc 3KH2A 4JCZA 3TGUJ 4JEBA 1JY2O 2BCCE 3C63A 3O8ZA 3W2WA 1NTZD 3CCMP 1ZHYA 1AV1A 2ZYDA 1BGYE 3MLGA 1H88A 3HTKA 5CI8A 5L0GA 3HD7C 2FXMA 3GEEA 2WPVB 1OVVA 4MVOA 3T97B 4EKWA 4D6TE 3GHGB 4U3FG 3C8GA 2IBZD 4DCKA 1EDJA 2E87A 1PGOA 1KQSO 2WSSH 4MTOA 4Z9JA 1AA0A 3MTUE 3GF7A 1X9VA 1S9KE 3EG9B 5KKZB 1SQBG 4M63A 5AW1B 4IWBA 1IZNB 2BASA 3RQEA 3L1MA 5APXA 2XS8A 3GM2A 1SQPK 1NFOA 1EDLA 1MMAA 3C7JA 3PP5A 2YMKA 3VMAA 3ZIBA 3FGAD 1PGQA 2XM4A 3L73J 3ZSUA 1JY3O 5GTIH 1FNTc 3ABVC 2KQ9A 3FWLA 1CW5A 1URQA 4YT4A 1HH0A 4CSAC 4NC3A 3NYMA 1T6UA 4DBQA 3B4SA 2C9NY 3ZDLA 1SQQK 2XM0A 1X0TA 1ORSC 3MIWA 1YQ3C 1FAPB 1L0LK 3HNKA 1NTZE 1Q81Q 3P8CE 1H9TA 4XA4A 4AX2A 1JRAA 2ZXPA 4GOEA 3DJNB 3L8JA 4ZLCA 3EFFK 2ZT9D 3ZC4A 1Z23A 3VOPA 5K5GB 2IBZE 4H54A 1DH3A 2R7VA 3L71G 1E84A 4P6IC 2XKMA 4ULWA 2IYPA 4NCQA 3PLNA 4W8PA 2R7WA 1FZCA 1W2WA 3EH1A 3U2MA 1J1DB 3AE9C 1NYHA 2HSBA 4JCHA 3U1CA 1KB9D 3KZIE 2Q3EA 4CIPA 2I8BA 2E76D 3TSIA 4WVZA 5GTHH 2LSEA 2FYUG 1A41A 1IFMA 3K1IA 1V55C 4W80A 2L7AA 2Y3GA 1N73B 3KKBA 4E18A 2P0NA 5AVYB 2YNYA 2YKZA 4HB1A 1GTWA 2XS1A 4H0LB 4A4AA 3M9BA 1SVFA 2DGJA 3CCRP 1LTJC 3HNIA 4I2LC 5KYWA 3IAOA 1VF5D 4B86A 3EQLF 3FXDA 2WTYA 4G0HA 1QSPA 1QLED 2C03A 4LDQA 1CI6B 3G4SP 5KAFE 4AE4B 4KJMA 4GDOA 2L6GA 3HTKC 1YYJA 2JP3A 3MYFA 2EIMC 4PK4A 5T3WA 3OW2O 2EPOA 3LUTB 5L0IA 3J06A 1ZHTA 1KB9I 1FE6A 5AVUB 2YZSA 2E5TA 4DBRA 3NRHA 1Q86Q 2D2CD 4ASVA 2KNCA 4AL0A 3KYIA 5EHHA 1KB9E 4IFMA 4MTGA 3L4FA 3L70D 1YTZT 2Q7RA 1K73Q 3WAQA 5AW8B 1USDA 4U9DA 5CIVA 1VK5A 2ZVNB 5KJ7D 3CPWO 1JMMA 5CCHA 2OEVA 3PTZA 2AWYA 3GWNA 1YHQP 1JM0A 1NH4A 3MFNA 1PPJD 1VQ9P 2P6VA 2E75D 1V4AA 5KYYA 2OTJP 2PFXA 2E74C 3H1JG 4OIOF 5JS5A 1RE4A 4MS2A 5AC4A
chains in the Genus database with same CATH topology
1ZP0C 3R4YA 3AE4C 2E74D 4I7ZB 2BEQD 2K9YA 1KILE 3SFEC 3GMAA 3AE8C 1Y9BA 3IN6A 2JX0A 3Q1MA 1DD4A 2YIUC 1YQ4C 1ZZPA 4XEKA 3AE9C 1NYHA 3AEBC 2E76C 1DD3A 3O6QA 2HSBA 4H13C 1IK7A 1Q90D 1VF5B 2NZ2A 2FXPA 2QSIA 1EXIA 2G8YA 2E76B 4YXDC 1K04A 2E76D 2WSFJ 4H13B 4H13D 1GMJA 4Y28J 4YTPC 3EWKA 3AEDC 1MKMA 3AE1C 3S9OA 1VL2A 3B71A 3GM3A 3U3FA 4EBKA 3C8VA 1HJ0A 2KK1A 2P10A 3C18A 4IL6X 1R8EA 3AE6C 1O3UA 1AJYA 1OW7A 3JYYA 5M1BA 4H44B 1OW8A 4Z1MH 3AEFC 3K7DA 4H0LB 3GM1A 1K05A 1VF5C 2IDBA 2WPVB 3Q5RA 1HF9A 3AE2C 3T97B 3BRJA 3C8GB 5L8RJ 3AECC 4XEFA 4R32A 2PBEA 3IAOA 3C8GA 3JZ0A 1VF5D 2Q00A 1ZOYC 3RQFA 3AE7C 1WOLA 1OW6A 2L6FA 3GF7A 2V7QJ 1KMIZ 1KORA 2G3AA 2YWAA 3L8IA 1QVXA 4GDOA 1PIXA 2L6GA 2H88C 2JP3A 3RQEA 4U7JA 4NQFA 1S5LX 3GM2A 3AEGC 4H44C 4OGQB 3SFDC 4OGQD 2WSCJ 1EXJA 4XEVA 5F28E 3Q5PA 4H0LC 1K40A 3TULA 1JB0J 3LW5J 3D71A 1KQGB 3Q5SA 4TT3H 3U0CA 1WTYA 4H44D 1JOGA 2YMKA 3O10A 3FGAD 4H0LD 1ZMEC 3AE3C 2D2CB 3GLMA 2D2CD 2OQQA 3C8GD 4PV1B 2ZT9B 3AE5C 2MKVA 2E75B 3Q3DA 1PV3A 2O01J 3GF3A 3D70A 3ABVC 4R4MA 3RK3E 3Q2YA 5KKZC 3D6ZA 2FBWC 1WWPA 3RL0g 2H89C 3H25A 1OMIA 1FDIA 2E74B 4OGQC 4KT0J 1UFBA 3RQGA 3D6YA 2FYNC 1RQVA 1YQ3C 1WMKA 2QJYC 2WQYC 3AEAC 1PL5A 1KQFB 1DIPA 1S1CX 1NGMB 4XFJA 2J5UA 2D2CC 1TU3F 2BEZF 4PV1C 2ZT9C 2E75C 3G9RA 2WSEJ 4RKUJ 5KLIC 2QIWA 2JO1A 1UIXA 3MFNA 1FDOA 4R4LA 2LK4A 3L8JA 4PV1D 2ZT9D 3AEEC 2E75D 2QJKC 1KNYA 1V4AA 2L6HA 1ZRTE 3AJMA 1KTMA 2E74C 4EBJA 1RQUA 2QJPC 2JPUA 1U57A 4I7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZP0 C;  3AE4 C;  3SFE C;  3AE8 C;  2JX0 A;  1YQ4 C;  1ZZP A;  4XEK A;  3AE9 C;  3AEB C;  2HSB A;  4YXD C;  1K04 A;  4YTP C;  3AED C;  3AE1 C;  3S9O A;  3B71 A;  3GM3 A;  3U3F A;  4EBK A;  2KK1 A;  3C18 A;  3AE6 C;  1O3U A;  1OW7 A;  3JYY A;  1OW8 A;  3AEF C;  3K7D A;  3GM1 A;  1K05 A;  3AE2 C;  3C8G B;  3BRJ A;  4XEF A;  3AEC C;  4R32 A;  2PBE A;  3C8G A;  3JZ0 A;  2Q00 A;  1ZOY C;  3RQF A;  3AE7 C;  1WOL A;  1OW6 A;  2L6F A;  2G3A A;  2YWA A;  3L8I A;  1QVX A;  2L6G A;  2H88 C;  3RQE A;  4NQF A;  3GM2 A;  3AEG C;  3SFD C;  4XEV A;  5F28 E;  3TUL A;  1K40 A;  3U0C A;  1WTY A;  1JOG A;  3O10 A;  3AE3 C;  3C8G D;  3AE5 C;  1PV3 A;  3ABV C;  2FBW C;  1WWP A;  2H89 C;  1UFB A;  3RQG A;  1YQ3 C;  3AEA C;  2WQY C;  3MFN A;  2LK4 A;  3L8J A;  3AEE C;  1KNY A;  1V4A A;  2L6H A;  3AJM A;  1KTM A;  4EBJ A;  2JPU A; 
#chains in the Genus database with same CATH topology
 4AQR D;  1NU1 G;  2A68 F;  2VCB A;  4YWQ A;  1GGQ A;  3CL3 D;  2EPL X;  1Y9B A;  5AW7 B;  3TF5 A;  1U89 A;  2P61 A;  3L74 E;  3H1L G;  3LNM B;  3UMI A;  3RK3 D;  3EFO B;  2A6E F;  1L0N D;  4DOJ A;  2HJ3 A;  1GD2 E;  3VAY A;  4H13 B;  1GMJ A;  2H43 A;  1RKE A;  2VC9 A;  4JYC A;  4P9F A;  1LWU A;  3T9O A;  1Q82 Q;  4EBK A;  2MJZ A;  1FZC C;  1KIL A;  4G7H F;  3CWB J;  3L70 E;  1NU9 C;  3IPM O;  1OW7 A;  3CD6 P;  3SXY A;  3NFQ A;  1BR1 A;  4Z1M H;  4N6C A;  1VQN P;  256B A;  2GWW A;  4HFK B;  2YL0 A;  3AE2 C;  1NKZ B;  4XLN F;  4I6M C;  4CDV A;  3K1I C;  2BCC G;  1M90 Q;  4MW3 A;  2YRF A;  4BWN A;  4PJ0 H;  4OH8 B;  3ZTZ A;  2JWA A;  1PPJ E;  1WN0 A;  1BGY G;  5DS4 A;  1OCC C;  2IYO A;  1IZM A;  1GM5 A;  5AVZ B;  3CCL P;  4D6T G;  1JB0 J;  4IFD K;  3V5X A;  3JRM O;  2QJY B;  3HKK A;  2XLM A;  2YVK A;  3G4X A;  3FXE A;  4JQ0 D;  1BDD A;  2ZT9 B;  2B87 B;  2QVA A;  3IFM A;  5KLI B;  3RK3 E;  1L0N E;  3AG4 C;  2FBW C;  2OU6 A;  2O01 H;  1SQX J;  3L75 J;  1FDI A;  2N9Y B;  1R5I D;  1NU1 K;  5JLI A;  1S3J A;  3HE5 B;  4NPD A;  4EHP A;  2PX0 A;  2CNW D;  3NXS A;  1NTK J;  2AEJ A;  3B0V C;  4UB6 E;  2XZR A;  5B66 H;  1S5L H;  1PL5 A;  2XND H;  3PRJ A;  3L36 A;  5E33 A;  2J59 M;  1YJ9 P;  1A02 J;  4RBN A;  3MP7 B;  3CX5 I;  1T9K A;  1IFI A;  3B5N D;  1GDT A;  3AEE C;  1TKN A;  1JCD A;  4ONS A;  3DM9 B;  2PAJ A;  2KB7 P;  3PHL A;  1LT9 A;  3TK0 A;  1O5H A;  2ZAE B;  1JNM A;  4OD5 A;  1U7J A;  2R7O A;  2P7V A;  2JPU A;  1NOH A;  1XWJ A;  1OKK D;  1NTZ G;  3KDP B;  5CCH C;  2ZXR A;  2QJP B;  2JR8 A;  2WVR A;  4YT2 A;  4I7Z B;  4GIF A;  3WU2 E;  2DW3 A;  4ZLD A;  2QA4 P;  3O6Q B;  3NYJ A;  3CC4 P;  1YYX A;  3L73 D;  1VF5 B;  1YTZ I;  3PJS K;  4L74 A;  2IBZ G;  1NZE A;  2YEV A;  1RE4 C;  3S29 A;  2J9U A;  3UMK A;  1VYI A;  4YL0 A;  3AG1 C;  3HLZ A;  5KYX B;  3W2V A;  2P10 A;  3FVY A;  2QTV A;  3IR9 A;  4JRZ A;  3WUT A;  1LPE A;  3K7D A;  3A0H H;  5A6J A;  1FR0 A;  4BXL A;  2WZG A;  1APC A;  3HD7 D;  4FAP B;  2A0U A;  1ZU5 A;  3BEH A;  5DQZ A;  1ZOY C;  4NPF X;  3M0D A;  2OYI B;  4RJT A;  1OW6 A;  4O7G A;  1KIL C;  2NPU A;  3C8Z A;  1MMG A;  3H1K J;  4CX9 A;  2Z5I A;  2A0B A;  1K9M Q;  2C0W A;  3OWT A;  3G3Z A;  3P8M C;  1LI7 A;  4K35 A;  4WWI A;  3EHN A;  2HSQ A;  2NUT A;  1SQB E;  3D71 A;  3U0C A;  3CC7 P;  1ZW0 A;  1WTY A;  3NDB B;  3KYJ A;  2J7P A;  1RKC A;  3ABL C;  5JRA A;  3HE4 A;  5B5E H;  1G2C A;  2E75 B;  2VH3 A;  2O01 J;  5D92 A;  1IK9 A;  4CS7 A;  1ZV8 A;  5KYU B;  2KSF A;  4Z9H A;  1BCC D;  3V5Y A;  1NJI Q;  1NTZ K;  2H89 C;  1OMI A;  4GOD A;  5E79 H;  1RF1 B;  2GFH A;  2LIG A;  2D2C C;  2WPR A;  2KXP B;  3RK3 B;  5BUO A;  4D4N A;  4JF7 A;  2F22 A;  3HNL A;  3VRC A;  1FDO A;  1SZI A;  2IFN A;  3M9H A;  5COM A;  2FYZ A;  1M1J A;  2ZVO B;  4JJG A;  3LIE A;  4EYY Q;  3LLK A;  3O55 A;  2DB4 A;  2WB7 A;  1IFN A;  1SFC B;  3B29 A;  3Q6M A;  1OKK A;  3JSV C;  2W4B A;  4WY4 B;  4EIY A;  1X8Y A;  5BQI A;  3SFE C;  3KPE A;  3LID A;  1YZA A;  3F89 A;  4OIQ F;  4DOZ A;  2A45 H;  2XLD A;  1LT9 C;  4J7Y A;  2RD9 A;  1T2K C;  1NTM J;  1RE3 A;  2KK7 A;  1VQ7 P;  3FXH A;  4YXD C;  4L76 A;  1BBH A;  1IW7 F;  2CYD A;  4CS9 A;  3SSU A;  2C9L Y;  3VMX A;  1FC2 C;  3CMA P;  1N8R Q;  2MYS A;  4N78 D;  2IOQ A;  4A2N B;  3T6B A;  1NBB A;  2IFM A;  3ZWI A;  3EZH A;  4KBL A;  4IL6 X;  1BCC E;  4UB6 H;  3A7O A;  2CW0 F;  1Z5Z A;  2FYU E;  4BRY A;  4C7R A;  3AEF C;  5CCG A;  1H0T A;  3CCU P;  3GWL A;  1AVY A;  3W68 A;  5L8R J;  1JMW A;  1ZRT D;  3RH3 A;  3U9J A;  5CHX A;  2HPC B;  2YKP A;  3DWW A;  2KLV A;  3NMI A;  3L70 G;  4AL1 A;  1HWT C;  4DRI B;  1OFC X;  1H7I A;  3M15 A;  2O01 N;  1L3P A;  2H88 C;  3KXD A;  4U5D E;  5KLV D;  2WZF A;  1OX3 A;  2FFD A;  2QM8 A;  1HTL C;  3FWN A;  3E1R A;  3WU2 H;  4RDA A;  3CXH H;  3M4C A;  2OOC A;  3H32 A;  1OXK A;  3UR3 C;  4MVU A;  2IXN A;  1H8A A;  2WSC H;  3M0D C;  1FMV A;  2HOD B;  4AYC A;  2KS1 A;  2CK3 H;  2R02 A;  3B5N B;  2VB6 A;  3C8G D;  3NMD A;  1PPJ G;  2OTK E;  3GF3 A;  3T6G B;  2YXQ B;  1KYO I;  2KW3 C;  5APU A;  1PP9 J;  3ABK C;  5FCL A;  2KC3 A;  2OTL P;  1SQV J;  5HSW A;  1GK6 A;  2N1T D;  3EGD B;  1S05 A;  2OEX A;  1M1K Q;  3CWB D;  4N78 E;  2A6H F;  1LI5 A;  1R5S A;  3MZW B;  1EA8 A;  4U5G A;  1MQV A;  5JUA A;  1EC5 A;  1U7M A;  3A0B H;  1L0N G;  4CDY A;  4O9B A;  2JKV A;  1Y6D A;  4WGZ A;  5A69 A;  2QJK C;  5KAI E;  1ZRT E;  2IZ1 A;  1T8Z A;  3HJC A;  1HE9 A;  2AEM A;  2P67 A;  1LTS C;  4IAO A;  3EGX A;  4IAQ A;  5AC5 A;  2E74 D;  5HV9 A;  1RY3 A;  1L7C A;  4LLH A;  3AE8 C;  5KLV E;  3SXM A;  3SYN A;  2YO2 A;  3K1H A;  2Y0C A;  3JSZ A;  4DXW A;  3HD7 B;  3OA7 A;  3ZDM A;  1BE3 D;  4PFO A;  1M1J C;  4FX5 A;  1GW3 A;  4ZKU A;  2KYV A;  3CC2 P;  3T4R A;  1NO4 A;  1GK4 A;  3N0T A;  2KZJ A;  3QW1 A;  1VL2 A;  1E83 A;  3E7K A;  3FAJ A;  4N06 A;  1ZHW A;  2PP4 A;  2XXA B;  1SQP J;  1VQ6 P;  2EIN C;  3MD0 A;  2HMQ A;  4JEA A;  1U6H A;  2YL1 A;  1RE3 C;  2KSJ A;  1T3U A;  3QVZ A;  3LEO A;  1LTB C;  3MUD A;  4CS9 C;  1RMV A;  4N3Y B;  3FOP A;  4U5E E;  1OIP A;  2GDC A;  2R7R A;  3GW6 A;  2Q9B A;  1FDM A;  1H6G A;  1OQC A;  3H2V A;  4LDK A;  5APS A;  1HY5 A;  3ZQY A;  4ER9 A;  3KYQ A;  3ATP A;  5CCG C;  3AEG C;  1SQQ J;  3TNU A;  4FES A;  3SFD C;  1EXJ A;  2WSC J;  2QE7 H;  5TIS H;  5FZT A;  4C7N B;  1KQG B;  2YLD A;  4MVQ A;  1L0L J;  3TD7 A;  1Q2N A;  2D5R B;  1L0N K;  2XLH A;  1IFD A;  2ZXW C;  4MN4 C;  1JMB A;  2KLU A;  4RD9 A;  4AK9 A;  2FXO A;  1BE3 E;  4OVN F;  3WHN A;  2FFD C;  5A6A A;  3C1L A;  3H25 A;  2EIL C;  4LGD E;  4QMA A;  4YPC A;  4KT0 J;  1UFB A;  2N1T A;  1HW1 A;  4C7O B;  5DQT A;  2A06 D;  1NGM B;  3L73 G;  2Y69 C;  3I5Q A;  4U3F J;  1PZQ A;  3R7C A;  1JTH B;  4R4L A;  1XTG B;  4WBA A;  2I8D A;  3GEI A;  4BEM J;  3CME P;  4Q4Z F;  5APY A;  2WT7 A;  1VPC A;  2AVK A;  1M2V A;  3O6X A;  5CCH D;  4GYT A;  2OJE D;  2YIU C;  3QVY A;  4E7Z A;  1FJK A;  1NSG B;  1IK7 A;  3JTL O;  1LTJ B;  4JTC B;  4CJO A;  1MFZ A;  2QG4 A;  2R25 A;  2R5D A;  1W2E A;  4Y28 J;  4OIN F;  2J9W A;  3VTP C;  4XQ1 A;  4WJ0 A;  1FJP A;  1KN7 A;  4LLE A;  1OXZ A;  3M79 A;  2VAS A;  1HJ0 A;  1RF0 A;  1QPU A;  3HTK B;  3BCC D;  1K8A Q;  2V26 A;  4BJ1 A;  2OQM A;  2CPS A;  2AXT E;  1FFT C;  3H1H D;  3F47 A;  2NRG A;  3EQ2 A;  2A06 E;  1TFK B;  3AGT A;  4N6J A;  1J2J B;  3C8G B;  3RVY A;  1OVR A;  2CDQ A;  1JEK A;  1T3J A;  2KNH A;  2E43 A;  4XPY A;  1BCC G;  1SQB K;  5T1D B;  3L71 J;  1KIL D;  2R3S A;  2XDJ A;  3VMY A;  1OCO C;  2OYH A;  1ZW2 A;  3M4B A;  1J1E C;  4OGQ D;  5F28 E;  3TUL A;  5BVZ A;  3MUD C;  3K33 A;  2PF4 E;  4NPE A;  1W5C E;  2Q3I A;  1T6Q A;  4MVM A;  4OIR F;  3ECS A;  2GAQ A;  4BPM A;  4KI2 A;  3U3B A;  3AE5 C;  3PCV A;  1URQ B;  5APV A;  1Q0D A;  2JDI H;  2FAP B;  3RBX A;  2JJL A;  1EZV D;  3SWF A;  3DAF A;  1CPQ A;  3Q7G A;  5COF A;  5BQG A;  4C3D A;  2NG1 A;  1LM3 B;  2E74 B;  4MND A;  3U8V A;  1L4A D;  4G7Z F;  4LAC B;  2HS5 A;  2FYN C;  4UB8 E;  3L72 D;  1S1C X;  1XZQ A;  3BCC E;  1Z6A A;  1TU3 F;  1MUU A;  1H89 A;  5BU5 A;  3H1H E;  4GKG A;  4J7T A;  4FWV A;  2N1T C;  2VCC A;  3F46 A;  4MW8 A;  3WG7 C;  3DXJ F;  3FAP B;  3R4Y A;  3AE4 C;  1FZC B;  1QL2 A;  3C9I A;  1KV4 A;  1PGJ A;  1KIL E;  3OA1 A;  2XSE A;  3FHD A;  2YKO A;  3CLQ A;  5CBO A;  2GUV A;  2J9V A;  4PD4 D;  1EZV I;  4E7S A;  2NZ2 A;  4L75 A;  1O87 A;  3HNJ A;  1T2K D;  4JJF A;  1HUC A;  2MHR A;  2W6J H;  2FYU K;  1GW4 A;  1M7L A;  3U3F A;  3QH9 A;  2RMZ A;  5KLV G;  4B6I A;  2UWJ E;  1R8E A;  1O3U A;  1Q0K A;  4O6M A;  5CJ4 A;  5D91 A;  1BDJ B;  1NKN A;  2TMV P;  2I1J A;  3TJ6 A;  2EPN A;  2HG5 D;  3LJB A;  2W90 A;  3B8E B;  2PX3 A;  3F5H A;  1CGO A;  3BRJ A;  3L72 E;  4LER A;  1RJ9 A;  3W8I A;  5KYW B;  2JWD A;  4MQ9 F;  2Q00 A;  1VQK P;  1N7S A;  1WAT A;  3S4R A;  1QKR A;  1RF0 C;  3KPH A;  4WAB A;  1KMI Z;  3H1J J;  1HGZ A;  1VQO P;  2G3V A;  2O3J A;  1N2D C;  3CWB G;  4W8K A;  1NU1 J;  5TJ5 E;  3H1I D;  5L0J A;  2M64 A;  1VB5 A;  4PD4 I;  3POV A;  4U5C E;  4HE8 D;  3O10 A;  2WVO A;  3RW0 A;  3KQG A;  1ZME C;  3H1L J;  4U5B E;  1CGN A;  3LEV A;  2KNC B;  2P1J A;  2YMY A;  3CCV P;  3EZI A;  4RO0 A;  2R5B A;  2OYH C;  2O9X A;  3CX5 D;  3PH0 A;  2L91 A;  2IXM A;  2OGU A;  3CI9 A;  2I15 A;  4C46 A;  1C17 M;  4IRU A;  2WMM A;  2RKL A;  3RYL A;  2HR3 A;  1BR2 A;  2P1A A;  3D6Y A;  1HMO A;  1L4A A;  1VDF A;  4IL6 E;  2R44 A;  2J7P D;  1AQT A;  2GUS A;  1LE4 A;  1BE3 G;  1V74 B;  4PV1 C;  2EPK X;  1IO4 A;  2ZYG A;  3G9R A;  4W7Y A;  3L35 A;  1P84 I;  3KZI H;  5KYY B;  2LK4 A;  2BL2 A;  5KYN A;  2BCC J;  1DEB A;  3RKO F;  2L6H A;  3V4Q A;  1QQ3 A;  3RBZ A;  2XLE A;  3AGU A;  3G50 A;  1BGY J;  3TGU D;  5KLV K;  1U57 A;  1ZLL A;  4ZKP A;  5CI9 A;  2OAR A;  2MWQ A;  2GM4 A;  3IQ6 A;  2Z15 A;  5AW6 B;  1AQ5 A;  3H1I E;  3Q1M A;  4OD4 A;  1YQ4 C;  4LDR A;  1W2B O;  4H13 C;  4DVY P;  3MBG A;  4XWJ A;  2H8A A;  2J45 A;  1HW2 A;  2G8Y A;  1IFP A;  2E76 B;  4I1L A;  1A7D A;  4DZO A;  1DOV A;  1RKE B;  3W4Y A;  1LWU B;  1A7V A;  4PJL A;  4YL3 A;  5B3S C;  5KAF H;  2EPM X;  3B71 A;  1KIL B;  2R32 A;  5L0F A;  2VRS A;  3U2L A;  1ZW3 A;  3RIP A;  2OG2 A;  2LQG A;  1ZU4 A;  3CX5 E;  4IAR A;  3B0U X;  3LAY A;  4WB4 A;  3K6B A;  1LTI C;  3EH2 A;  2M4E A;  2E5Y A;  4HH2 A;  4NTB A;  2IPP A;  3GM1 A;  1Y8A A;  1Q0G A;  1NAY A;  3AEC C;  2B89 A;  2W9Y A;  2QUP A;  3RQF A;  2LCH A;  3CXH I;  3EPV A;  3V7O A;  2ETS A;  1AFO A;  1KB9 H;  4CS8 A;  3USS A;  1EDK A;  2KOG A;  4I1M A;  5DS6 A;  2K9J A;  3U1A A;  3SP1 A;  2PP6 A;  3DE9 A;  3HUS A;  1NTZ J;  4CBE A;  4MVR A;  4NQF A;  1S5L X;  3TJ5 A;  3TGU E;  2IZ0 A;  2A06 G;  4I44 A;  2Y3B A;  1CGM E;  5CCG D;  1Q0F A;  1AVO A;  3I56 P;  1JOG A;  1G1J A;  1OR3 A;  4JYB A;  4WGY A;  2HV6 A;  2YL7 A;  3LW5 H;  1N7S C;  2D2C B;  2OQQ A;  1SP4 A;  1TWH A;  2DYS C;  2NUP A;  4R4M A;  2W8Z A;  2N9B A;  2J0X A;  2ZD9 A;  2EIJ C;  5DJT B;  3D6Z A;  4K1O A;  4TLF A;  5GPG B;  3PDM P;  2HLO A;  1WWP A;  2K37 A;  3QMK A;  4EOT A;  2QLA A;  3I5P A;  3IQ5 A;  4OGQ C;  3CEX A;  2RSE B;  1YDI A;  2K88 A;  3ITK A;  4D4X A;  1ZN5 A;  2Y3D A;  1VQ4 P;  2HFE D;  1WMK A;  5F5F A;  3U9M A;  3VP9 A;  5JSL A;  4GQH A;  3ZVR A;  2BEZ F;  4HFF B;  2A1D D;  1Z56 A;  4YT8 A;  3DKA A;  2ZXE B;  3V6I A;  1Q0M A;  1LT9 B;  4MVZ A;  2WSE H;  3L73 E;  5B1B C;  2W6A A;  1PD1 A;  2QJP C;  1L4A C;  4I7Z C;  4N6H A;  2ICW G;  3BCC G;  1LT1 A;  1WAS A;  3N2Z B;  2R7U A;  4JBZ A;  2SPZ A;  1GL2 A;  3RL0 C;  5AVQ B;  1E2X A;  3I4U A;  3CSK A;  3H1H G;  3JSE O;  4M3L A;  3G71 P;  1OR2 A;  1S7Z A;  4YL1 A;  2Y3H A;  2FXP A;  5A6K A;  2YL3 A;  4LC1 A;  5A6B D;  3V5B A;  2O1K A;  3CCS P;  2H7H A;  3NG1 A;  1T6A A;  1YI2 P;  1MMD A;  2M8R A;  2FY8 A;  4CPG A;  1MNE A;  1AUE A;  2YLG A;  1LTT C;  3L0I A;  4DJG A;  1PCX A;  2IXP A;  5AVR B;  3JYY A;  1M56 C;  1FAV A;  4IGG A;  2HV7 A;  4L6R A;  1K05 A;  3I55 P;  4XEF A;  2XRH A;  2OYI C;  2Q9I A;  4LLC A;  3TDK A;  3JCU E;  1ZHZ A;  2Q9A A;  1EZV G;  5JVE A;  1G8X A;  3ASO C;  4U5H A;  1LGH B;  2NPS A;  1KFM A;  2J58 A;  1YA7 O;  4PJJ A;  2LKM A;  1FOS E;  1KYO D;  1IJD B;  2NUT B;  1S2E A;  1T01 A;  1IFJ A;  3TYY A;  3L72 G;  3JT1 A;  3LW5 J;  3V4W A;  3HE4 B;  1G2C B;  4CS8 C;  2KSE A;  5COG A;  3D70 A;  2R7T A;  2Y9Z A;  2WIT A;  3HUS C;  3BRV B;  2G62 A;  2QJK B;  1F1M A;  1KC8 Q;  1G4U S;  1LP1 A;  1TR2 A;  4BJT A;  3L74 J;  4IFF A;  1VQ5 P;  5AVX B;  1YJN P;  1GS9 A;  1FZA A;  2W45 A;  3ZQV A;  5T3T A;  4DRJ B;  1WRG A;  3NMK A;  2WSE J;  2M5A A;  3NKE A;  3KHU A;  5GTI E;  4K0D A;  1M1J B;  3N7N A;  1HJB A;  1I5N A;  1OZH A;  1D7M A;  3L70 J;  3VN0 A;  2Y9Y A;  2WVQ A;  1XTC C;  3RGU A;  1D0Y A;  3SWY A;  3BRT B;  4IB4 A;  4DVZ A;  5L3Q A;  4DJ9 A;  4H4K C;  2YO3 A;  1NU7 D;  3G4Z A;  3BAS A;  3H65 A;  3FDQ A;  1KYO E;  3K66 A;  3WOD F;  1FOS F;  3WMM 0;  1YA9 A;  3T6J A;  1G4W R;  2IYL D;  2PGD A;  5A6B A;  1XZP A;  4CDA A;  2Y0D A;  2QE9 A;  3DZA A;  1VQL P;  1JY3 N;  2IXO A;  3SNH A;  2X51 A;  3AQB A;  5BU8 B;  1GL2 C;  3GM3 A;  3QW0 A;  2WSF H;  4ULV A;  3S27 A;  3H1I G;  1YAR O;  1JPJ A;  4BRY B;  1BSH A;  1NWQ A;  2B88 A;  1IC2 A;  4MTF A;  1H0T B;  4Y99 C;  2WZL A;  2AEF A;  4ANJ A;  5AW5 B;  4BJ6 A;  1E85 A;  4JE9 A;  1M6T A;  4XLP F;  3VF0 A;  3T97 A;  4JTA B;  3GHG A;  2XLW A;  4G78 A;  2BE5 F;  2XL8 A;  5CMZ A;  1QEX A;  1AEP A;  1J8Y F;  2RH0 A;  1LP1 B;  2G3A A;  2NSF A;  2FFD B;  1HVV A;  1SQX D;  1PIX A;  3L75 D;  1QVX A;  3EG9 A;  1VQP P;  3H32 B;  4H44 C;  1C02 A;  1NTK D;  4DT0 A;  2KS1 B;  1PFI A;  3CWB E;  2AWC A;  3IHU A;  4HJG H;  2Z4E A;  1QVG O;  4K3A A;  1YZC A;  2NPS C;  2MKV A;  3FX0 A;  1G5Z A;  1DEE G;  1RHZ B;  2OCC C;  3DD7 A;  3RL0 g;  3TGU G;  4P9T A;  4I1O B;  2VCA A;  3ASN C;  4O79 A;  3WUV A;  3SXZ A;  1KQF B;  2P7J A;  1LE2 A;  3JC2 2;  4NTF A;  1VOM A;  3CZ6 A;  2PFD A;  2YIU B;  5CBN A;  2H8P D;  3JCU H;  2JO1 A;  2FFH A;  4PFP A;  1UIX A;  1D0X A;  2Q9C A;  4PV1 D;  1KNY A;  5AW2 B;  4EI2 A;  1TWA A;  5AVW B;  3EGX B;  2HKV A;  4QI0 A;  1QL1 A;  2R7S A;  1MZ9 A;  5AW4 B;  3P8C D;  1YIT P;  1D1A A;  3EFG A;  3CQZ A;  1FZB A;  3CCJ P;  2GA0 A;  1SQX E;  3L75 E;  2W83 C;  3V2N A;  3M1C B;  1NTK E;  2AXC A;  5KTB A;  3MYI A;  2J0W A;  1Q90 D;  2WPS A;  2I1K A;  3LES A;  1D0Z A;  3CAX A;  2WSF J;  4H13 D;  2Z5H A;  3AE1 C;  3H1K D;  1X22 A;  2Y0E A;  1SQB J;  1YJG A;  2ZXX A;  2WPQ A;  3FOO A;  5E3A A;  2H7B A;  1N73 A;  1J1E B;  3JYH A;  3IQC A;  4QI2 A;  3RK2 C;  1YLM A;  3H6P A;  2PRR A;  2WVN A;  3RVZ A;  3II6 A;  3UNG C;  2HFI A;  2XNX A;  3TK1 A;  1FMW A;  3LS0 A;  1VYK A;  2ASR A;  4BEJ A;  2L6F A;  4AUW A;  1KOR A;  2HJM A;  2YWA A;  5JP7 A;  2XL4 A;  2CPB A;  2KJG A;  1VMA A;  3TNU B;  1CI6 A;  2BC5 A;  4U7J A;  4AE4 A;  3M91 A;  5DVW A;  4BJ6 C;  1EQ7 A;  1KYO H;  2KIK A;  1KU2 A;  2IBZ I;  3QWO C;  2QEX P;  2KYH A;  2FYN B;  4O6N A;  2XU6 A;  2H7V C;  3GHG C;  1FZG A;  3DAG A;  1YAU O;  2ZXO A;  2Q5U A;  1LJ2 A;  2YKQ A;  5KAI H;  1N7S D;  2CCY A;  2HMZ A;  3Q2Y A;  5KKZ C;  1JOC A;  2Q7C A;  4PJ0 E;  4ASW A;  2HZ8 A;  3ABM C;  2N1T B;  2C0X A;  3VYW A;  1A02 F;  2FGY A;  1X79 B;  3H1K E;  1CZQ A;  1RH5 B;  3RF3 A;  4ZMD A;  4PAC A;  2XL6 A;  2XLO A;  2WWW A;  1M8O B;  2OKU A;  1RXQ A;  4OIP F;  3U5S A;  2M3B A;  5APQ A;  1JPN A;  5B3I A;  1NTM D;  1OWA A;  4JC7 A;  2Q1K A;  2M3E A;  5DJU B;  2FKW B;  4PR9 A;  4I3M A;  4C3B A;  1SR2 A;  1BCC J;  3C62 A;  3S28 A;  4BJ5 A;  2CGE A;  2FYU J;  2NSG A;  2WT7 B;  3PMR A;  1M2V B;  4CIH A;  2RN0 A;  2BEQ D;  2K3R A;  5B66 E;  2ZFC A;  1S5L E;  3RL0 D;  1ZXG A;  1ORY A;  4YN0 B;  1UII A;  2QY9 A;  3SZR A;  1Z3I X;  3CCE P;  3EFO A;  1K04 A;  3S9O A;  5APW A;  1LTA C;  2KGO A;  1VTM P;  2B0H A;  4EWC A;  3EJN A;  1GQA A;  4OWF A;  1YIJ P;  3L74 D;  2LFD A;  2EIK C;  3E70 C;  4JVS A;  4EUK B;  2X0C A;  1J1D C;  1QX8 A;  1G1I A;  1KD1 Q;  3DI5 A;  1M56 D;  5L3V A;  1T6I A;  1LKX A;  3AE7 C;  1JR8 A;  1WOL A;  3UIA A;  1USE A;  3LS1 A;  1TWG A;  3TOL A;  1PP9 D;  1NTM E;  2K1A A;  1SQV D;  2OYH B;  3S84 A;  1FZE A;  1N73 C;  4EBB A;  1EZV E;  3OEO A;  3V2Q A;  5H2F E;  2DYR C;  5F5H A;  1NFN A;  2LXC B;  3VYI A;  3Q5P A;  4H0L C;  1N1C A;  3E9V A;  2R7X A;  1NHL A;  4TT3 H;  2W6B A;  3JRT A;  1KZU B;  1ORJ A;  2PNO A;  2QNL A;  1URQ C;  3A0H E;  3OJA B;  2Q6Q A;  1DX7 A;  3AE3 C;  4HKZ H;  3S1K A;  4PV1 B;  3Q3D A;  3EHM A;  1HMD A;  4J32 B;  1BSN A;  2B87 A;  2P2U A;  4Q5S F;  4QDL A;  1FZF A;  1DOW A;  1P84 D;  1MV8 A;  2UUI A;  1VLS A;  4XPW A;  5KLV J;  1L2P A;  3L34 A;  3U59 A;  3HE5 A;  1RQV A;  4GEH A;  1I4Y A;  2J5U A;  3MHV A;  1LTG C;  4RKU J;  1NAF A;  5B5E E;  3SEO A;  1EI7 A;  4PD4 E;  3BAT A;  4HYT B;  1KTM A;  3N4X A;  3ZG1 A;  1RQU A;  2B0J A;  1NG1 A;  1A7E A;  1WGW A;  4C3E A;  1SFC D;  4JKV A;  1PP9 E;  4E17 A;  1SQV E;  4YK5 A;  4JW1 A;  4WY4 D;  1SQP D;  1SMY F;  5E79 E;  3IN6 A;  2AXT H;  1D1C A;  3VM6 A;  3O6Q A;  1FBM A;  5AW3 B;  1JO5 A;  3US6 A;  2QSI A;  1EXI A;  1Y47 A;  5E3C A;  4BJ5 C;  4YTP C;  3LLI A;  3I5C A;  3AED C;  1PGP A;  1S72 P;  2W4M A;  4JUR I;  1EKY A;  1NVO A;  2Q4F A;  3Q6N A;  1YJW P;  2D4U A;  1SQX G;  3L75 G;  1GZL A;  2A45 I;  3CXH D;  3C18 A;  2H7O A;  3AE6 C;  1GL2 D;  4JPZ B;  1P84 E;  1AJY A;  1UG7 A;  1NTK G;  5KYX A;  1SQQ D;  3GOR A;  1QVF O;  5M1B A;  4D6T J;  1QZX A;  2IBF A;  4XTK A;  2KI7 B;  4E0H A;  1RJ9 B;  1L0L D;  2IDB A;  1JCC A;  2YLI A;  1BE3 J;  4DRH B;  1H9G A;  5B1A C;  4KNV A;  3OAK A;  5E2Q A;  1N7S B;  1WT6 A;  1SLQ A;  1T5O A;  3U8P A;  1HE1 A;  2OYI A;  2IM8 A;  3AG3 C;  2ITA A;  1FS0 E;  4N4W A;  1U0B B;  2V7Q H;  2YXR B;  1BDC A;  4OGQ B;  5AGF A;  2R7Q A;  4XEV A;  4UB8 H;  1J8M F;  5KJ7 A;  5AVV B;  1M57 D;  4H44 D;  1SF8 A;  4YJW A;  4F4B A;  5EFW B;  4YT5 A;  2R03 A;  2WL8 A;  1SQP E;  3GLM A;  4XE5 B;  3R2P A;  4W7Z A;  1JY2 P;  4U3F D;  1ZR4 A;  4JZA A;  2YHS A;  2NPS D;  1KQL A;  3HRN A;  5KYU A;  1HGV A;  4IJJ A;  1SQB D;  3KMI A;  3A3Y B;  1Z63 A;  3VP8 A;  2E42 A;  1L4A B;  3M9Q A;  2A69 F;  5BQH A;  3W67 A;  4KHX A;  3CXH E;  2QJY C;  3KL4 A;  1S4X A;  3RL0 B;  3NKD A;  4XFJ A;  1RF1 A;  2ZPA A;  3UGP A;  1SQQ E;  2ZT9 C;  5AVS B;  2J8W A;  5AW0 B;  5KLI C;  2QIW A;  1L0L E;  1N86 A;  5AW9 B;  3NTN A;  3M06 A;  4O6Y A;  3H1K G;  5IY5 C;  1SQX K;  1FTS A;  1YVI A;  3B9Q A;  1TFO B;  1ZR2 A;  1PD0 A;  2LR2 A;  5H2F H;  3AOU A;  1NTK K;  3DE8 A;  1SFC A;  2K9Y A;  1JY3 P;  4K7B A;  2JX0 A;  4WY4 A;  3E1I A;  4MVS A;  2E76 C;  1DD3 A;  3A0B E;  2YQY A;  3CCQ P;  1LWU C;  1I4Z A;  2AU5 A;  1Q7Y Q;  1YBK A;  2Q3T A;  3EWK A;  1D1B A;  4U3F E;  4ZNC A;  1MKM A;  3GEH A;  3S90 A;  1TWC A;  4EIJ A;  3L71 D;  2KK1 A;  2IX7 C;  4U5F E;  3S0X A;  4X0R A;  4JTD B;  3L37 A;  1VF5 C;  3Q5R A;  1GU4 A;  1C03 A;  1HF9 A;  4J30 B;  1R5L A;  1QLE C;  1BR4 A;  3RK2 D;  3JZ0 A;  1ZHX A;  3AQC A;  4PD4 H;  4G7O F;  4XPX A;  2K9J B;  3A2A A;  3GOD A;  3UMH A;  1OVU A;  2HPC A;  1TQG A;  2V7Q J;  3HUS B;  1KFN A;  3IEE A;  3V2R A;  2FYU D;  3P32 A;  3L8I A;  2QRX A;  4U9E A;  3BCC J;  1HBW A;  2V4H A;  2CNW A;  1AVO B;  1VLT A;  3B0P A;  3Q7L A;  4IL6 H;  3Q5S A;  3QZC A;  3H1H J;  3G6E P;  3V2P A;  2R05 A;  3DMD A;  5L0H A;  3A9C A;  2NUP B;  3GAN A;  1E79 H;  2HOD A;  1NTM G;  4A7P A;  1PV3 A;  3B5N A;  1VQ8 P;  5KJ7 C;  1CSB A;  2AP3 A;  1P84 H;  2LP4 A;  3RQG A;  3EGD A;  5TIS E;  4E0I A;  3L71 E;  1DIP A;  1R4T A;  4EDF A;  2OJQ A;  3QTH A;  2E75 C;  3SWK A;  2LXB A;  3N24 A;  1LIH A;  2L9J A;  1SYQ A;  3BVH A;  2WZ7 A;  1E5W A;  3AJM A;  4EBJ A;  2G3K A;  5JT4 A;  1GL2 B;  3CX5 H;  3IF4 A;  2LD6 A;  3L74 G;  3A11 A;  2KP8 A;  1RF1 C;  1JUN A;  4HEA J;  3L72 J;  1JY2 N;  1OXB A;  3GMA A;  4PJN A;  3RK3 C;  1MFT A;  3AG2 C;  5TJH A;  1VQM P;  1DD4 A;  1OCR C;  5C39 A;  4Y99 B;  1ZZP A;  4XEK A;  1OCZ C;  3AEB C;  4GT1 A;  2JEE A;  3K5B A;  4GOF A;  3DJU B;  5L0C A;  5DLJ A;  3HD7 A;  4L73 A;  3M0A A;  1M2O A;  4JIO A;  1PP9 G;  1B68 A;  1SQV G;  1EDI A;  1SFC C;  3WUU A;  4NY3 A;  3H1J D;  1MND A;  1FU1 A;  3C8V A;  2KUB A;  2B9B A;  4WY4 C;  2P58 A;  1NU1 D;  1CPR A;  3X2Q C;  4H44 B;  1OW8 A;  1LS4 A;  2XXA A;  2DI3 A;  3H1L D;  1NTM K;  1MMN A;  4R32 A;  2PBE A;  3NYL A;  2ZYA A;  2W27 A;  1N7L A;  2R3C A;  2NPS B;  4RES B;  3X1O A;  1FFH A;  1LNQ A;  4YXW H;  2M0B A;  2XLV A;  1V54 C;  5EGY A;  2HYN A;  4CSA A;  3SXK A;  3MX3 A;  2XV5 A;  1K40 A;  4NTA A;  2A45 G;  2V3C C;  5L0D A;  4KNW A;  3MGN A;  2POH A;  4C7N A;  4Q7C A;  4H0L D;  3UGO A;  5CJ0 A;  1L0N J;  5DS5 A;  2HUJ A;  3H2U A;  4PJM A;  1URQ D;  3GG2 A;  1SS1 A;  1Y4C A;  2BCC D;  2GA1 A;  3TOM A;  2QM7 A;  3O39 A;  1YYC A;  2L5G B;  2C04 A;  5GTH E;  1BGY D;  2J46 A;  3H1I J;  1JAF A;  4UDV A;  3RFY A;  2KZI A;  1M57 C;  3H1J E;  3TQO A;  1LVK A;  1SQP G;  1ST6 A;  3A5T A;  3AEA C;  2WQY C;  5AVT B;  4D6T D;  4C7O A;  3W8H A;  2Y39 A;  1E86 A;  1NU1 E;  3JCU Q;  2M5A B;  3B5N C;  4IOI H;  3ZTM A;  2L81 A;  4KC9 A;  3V5Z A;  3LNR A;  1S9K D;  2O1J A;  1ZYR F;  3H1L E;  1JTH A;  3PHF 2;  3NMJ A;  1NLX A;  1SQV K;  4CJG A;  3DM5 A;  2R9R B;  2OYO A;  3ITF A;  3FMS A;  1RCP A;  1ZVZ A;  1ZP0 C;  1SQQ G;  2UUH A;  2ZJS E;  5EK0 A;  4BG0 A;  1GU5 A;  1BZ4 A;  2JD3 A;  1EQ1 A;  1A0B A;  1L0L G;  2LFF A;  4Z9I A;  1QGK B;  2J9B A;  1LS1 A;  3RK2 B;  3VMZ A;  3IQT A;  5K0I A;  5APT A;  1LTJ A;  3P7K A;  1Z7Q c;  3KH2 A;  4JCZ A;  3TGU J;  4JEB A;  1JY2 O;  2BCC E;  3C63 A;  3O8Z A;  3W2W A;  1NTZ D;  3CCM P;  1ZHY A;  1AV1 A;  2ZYD A;  1BGY E;  3MLG A;  1H88 A;  3HTK A;  5CI8 A;  5L0G A;  3HD7 C;  2FXM A;  3GEE A;  2WPV B;  1OVV A;  4MVO A;  3T97 B;  4EKW A;  4D6T E;  3GHG B;  4U3F G;  3C8G A;  2IBZ D;  4DCK A;  1EDJ A;  2E87 A;  1PGO A;  1KQS O;  2WSS H;  4MTO A;  4Z9J A;  1AA0 A;  3MTU E;  3GF7 A;  1X9V A;  1S9K E;  3EG9 B;  5KKZ B;  1SQB G;  4M63 A;  5AW1 B;  4IWB A;  1IZN B;  2BAS A;  3RQE A;  3L1M A;  5APX A;  2XS8 A;  3GM2 A;  1SQP K;  1NFO A;  1EDL A;  1MMA A;  3C7J A;  3PP5 A;  2YMK A;  3VMA A;  3ZIB A;  3FGA D;  1PGQ A;  2XM4 A;  3L73 J;  3ZSU A;  1JY3 O;  5GTI H;  1FNT c;  3ABV C;  2KQ9 A;  3FWL A;  1CW5 A;  1URQ A;  4YT4 A;  1HH0 A;  4CSA C;  4NC3 A;  3NYM A;  1T6U A;  4DBQ A;  3B4S A;  2C9N Y;  3ZDL A;  1SQQ K;  2XM0 A;  1X0T A;  1ORS C;  3MIW A;  1YQ3 C;  1FAP B;  1L0L K;  3HNK A;  1NTZ E;  1Q81 Q;  3P8C E;  1H9T A;  4XA4 A;  4AX2 A;  1JRA A;  2ZXP A;  4GOE A;  3DJN B;  3L8J A;  4ZLC A;  3EFF K;  2ZT9 D;  3ZC4 A;  1Z23 A;  3VOP A;  5K5G B;  2IBZ E;  4H54 A;  1DH3 A;  2R7V A;  3L71 G;  1E84 A;  4P6I C;  2XKM A;  4ULW A;  2IYP A;  4NCQ A;  3PLN A;  4W8P A;  2R7W A;  1FZC A;  1W2W A;  3EH1 A;  3U2M A;  1J1D B;  3AE9 C;  1NYH A;  2HSB A;  4JCH A;  3U1C A;  1KB9 D;  3KZI E;  2Q3E A;  4CIP A;  2I8B A;  2E76 D;  3TSI A;  4WVZ A;  5GTH H;  2LSE A;  2FYU G;  1A41 A;  1IFM A;  3K1I A;  1V55 C;  4W80 A;  2L7A A;  2Y3G A;  1N73 B;  3KKB A;  4E18 A;  2P0N A;  5AVY B;  2YNY A;  2YKZ A;  4HB1 A;  1GTW A;  2XS1 A;  4H0L B;  4A4A A;  3M9B A;  1SVF A;  2DGJ A;  3CCR P;  1LTJ C;  3HNI A;  4I2L C;  5KYW A;  3IAO A;  1VF5 D;  4B86 A;  3EQL F;  3FXD A;  2WTY A;  4G0H A;  1QSP A;  1QLE D;  2C03 A;  4LDQ A;  1CI6 B;  3G4S P;  5KAF E;  4AE4 B;  4KJM A;  4GDO A;  2L6G A;  3HTK C;  1YYJ A;  2JP3 A;  3MYF A;  2EIM C;  4PK4 A;  5T3W A;  3OW2 O;  2EPO A;  3LUT B;  5L0I A;  3J06 A;  1ZHT A;  1KB9 I;  1FE6 A;  5AVU B;  2YZS A;  2E5T A;  4DBR A;  3NRH A;  1Q86 Q;  2D2C D;  4ASV A;  2KNC A;  4AL0 A;  3KYI A;  5EHH A;  1KB9 E;  4IFM A;  4MTG A;  3L4F A;  3L70 D;  1YTZ T;  2Q7R A;  1K73 Q;  3WAQ A;  5AW8 B;  1USD A;  4U9D A;  5CIV A;  1VK5 A;  2ZVN B;  5KJ7 D;  3CPW O;  1JMM A;  5CCH A;  2OEV A;  3PTZ A;  2AWY A;  3GWN A;  1YHQ P;  1JM0 A;  1NH4 A;  3MFN A;  1PPJ D;  1VQ9 P;  2P6V A;  2E75 D;  1V4A A;  5KYY A;  2OTJ P;  2PFX A;  2E74 C;  3H1J G;  4OIO F;  5JS5 A;  1RE4 A;  4MS2 A;  5AC4 A; 
#chains in the Genus database with same CATH homology
 1ZP0 C;  3R4Y A;  3AE4 C;  2E74 D;  4I7Z B;  2BEQ D;  2K9Y A;  1KIL E;  3SFE C;  3GMA A;  3AE8 C;  1Y9B A;  3IN6 A;  2JX0 A;  3Q1M A;  1DD4 A;  2YIU C;  1YQ4 C;  1ZZP A;  4XEK A;  3AE9 C;  1NYH A;  3AEB C;  2E76 C;  1DD3 A;  3O6Q A;  2HSB A;  4H13 C;  1IK7 A;  1Q90 D;  1VF5 B;  2NZ2 A;  2FXP A;  2QSI A;  1EXI A;  2G8Y A;  2E76 B;  4YXD C;  1K04 A;  2E76 D;  2WSF J;  4H13 B;  4H13 D;  1GMJ A;  4Y28 J;  4YTP C;  3EWK A;  3AED C;  1MKM A;  3AE1 C;  3S9O A;  1VL2 A;  3B71 A;  3GM3 A;  3U3F A;  4EBK A;  3C8V A;  1HJ0 A;  2KK1 A;  2P10 A;  3C18 A;  4IL6 X;  1R8E A;  3AE6 C;  1O3U A;  1AJY A;  1OW7 A;  3JYY A;  5M1B A;  4H44 B;  1OW8 A;  4Z1M H;  3AEF C;  3K7D A;  4H0L B;  3GM1 A;  1K05 A;  1VF5 C;  2IDB A;  2WPV B;  3Q5R A;  1HF9 A;  3AE2 C;  3T97 B;  3BRJ A;  3C8G B;  5L8R J;  3AEC C;  4XEF A;  4R32 A;  2PBE A;  3IAO A;  3C8G A;  3JZ0 A;  1VF5 D;  2Q00 A;  1ZOY C;  3RQF A;  3AE7 C;  1WOL A;  1OW6 A;  2L6F A;  3GF7 A;  2V7Q J;  1KMI Z;  1KOR A;  2G3A A;  2YWA A;  3L8I A;  1QVX A;  4GDO A;  1PIX A;  2L6G A;  2H88 C;  2JP3 A;  3RQE A;  4U7J A;  4NQF A;  1S5L X;  3GM2 A;  3AEG C;  4H44 C;  4OGQ B;  3SFD C;  4OGQ D;  2WSC J;  1EXJ A;  4XEV A;  5F28 E;  3Q5P A;  4H0L C;  1K40 A;  3TUL A;  1JB0 J;  3LW5 J;  3D71 A;  1KQG B;  3Q5S A;  4TT3 H;  3U0C A;  1WTY A;  4H44 D;  1JOG A;  2YMK A;  3O10 A;  3FGA D;  4H0L D;  1ZME C;  3AE3 C;  2D2C B;  3GLM A;  2D2C D;  2OQQ A;  3C8G D;  4PV1 B;  2ZT9 B;  3AE5 C;  2MKV A;  2E75 B;  3Q3D A;  1PV3 A;  2O01 J;  3GF3 A;  3D70 A;  3ABV C;  4R4M A;  3RK3 E;  3Q2Y A;  5KKZ C;  3D6Z A;  2FBW C;  1WWP A;  3RL0 g;  2H89 C;  3H25 A;  1OMI A;  1FDI A;  2E74 B;  4OGQ C;  4KT0 J;  1UFB A;  3RQG A;  3D6Y A;  2FYN C;  1RQV A;  1YQ3 C;  1WMK A;  2QJY C;  2WQY C;  3AEA C;  1PL5 A;  1KQF B;  1DIP A;  1S1C X;  1NGM B;  4XFJ A;  2J5U A;  2D2C C;  1TU3 F;  2BEZ F;  4PV1 C;  2ZT9 C;  2E75 C;  3G9R A;  2WSE J;  4RKU J;  5KLI C;  2QIW A;  2JO1 A;  1UIX A;  3MFN A;  1FDO A;  4R4L A;  2LK4 A;  3L8J A;  4PV1 D;  2ZT9 D;  3AEE C;  2E75 D;  2QJK C;  1KNY A;  1V4A A;  2L6H A;  1ZRT E;  3AJM A;  1KTM A;  2E74 C;  4EBJ A;  1RQU A;  2QJP C;  2JPU A;  1U57 A;  4I7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...