1K05A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
135
structure length
135
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 135
sequence length 135
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k05A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k05A02
4YXDC 4EBKA 1UFBA 5F28E 3AE8C 2PBEA 3C18A 3RQFA 1ZZPA 4NQFA 1O3UA 4EBJA 3AE2C 3AEGC 3RQGA 2YWAA 3AEEC 2KK1A 1KNYA 2L6GA 3O10A 1WWPA 3GM1A 3S9OA 3C8GB 3L8JA 1WOLA 1OW6A 1OW7A 3AEBC 4XEFA 1YQ4C 1K05A 3JZ0A 3RQEA 1PV3A 3AE9C 3AE3C 4XEKA 3AE6C 3GM3A 3AE4C 2G3AA 2HSBA 2WQYC 3AE7C 3MFNA 4YTPC 1V4AA 1KTMA 3AECC 3AEFC 1ZOYC 2JX0A 2H88C 3AJMA 1JOGA 2LK4A 3U0CA 3ABVC 2L6FA 3SFEC 2JPUA 1YQ3C 2FBWC 3GM2A 3C8GA 3B71A 2L6HA 1OW8A 3AE5C 1WTYA 3C8GD 3AEDC 1ZP0C 3SFDC 3JYYA 3L8IA 3AEAC 4XEVA 2Q00A 4R32A 3U3FA 1QVXA 3AE1C 1K04A 3TULA 2H89C 1K40A 3BRJA 3K7DA
chains in the Genus database with same CATH superfamily
2KB7P 3U9JA 1EKYA 1S5LH 3HKKA 1WT6A 4EBKA 3US6A 3G4ZA 3HNKA 3RW0A 3RQFA 1YYJA 2DGJA 4MVOA 5IY5C 4JBZA 2EIKC 1SQQG 1YBKA 5AW9B 3MUDA 3BVHA 2WSCH 1W2WA 2HODB 1GS9A 3WAQA 2YWAA 3L72G 2LSEA 2ASRA 2Y0CA 1X0TA 1WMKA 1XZPA 3BCCJ 1L3PA 3RYLA 4U9DA 1GD2E 2KC3A 2NRGA 2WVRA 5CJ4A 3SWKA 2R7XA 3B4SA 4XEFA 1KB9D 5AVRB 3FOOA 4N06A 2R3CA 1T6UA 2Z5HA 3FHDA 1Q0FA 4LERA 4NC3A 5KYXB 2PFDA 1JR8A 4N4WA 1Z63A 2P1AA 2EILC 3MYFA 3ABLC 1SQQK 1OCOC 1RF1A 4L75A 3BATA 1XWJA 4JPZB 2J0XA 1RE3C 1N7LA 2IXOA 1NTKE 2GM4A 3GHGA 1RHZB 3CCLP 3D71A 2GAQA 4JCZA 1SFCA 3H1HD 2JX0A 4ASVA 5CBOA 1SQQJ 3RL0g 3WMM0 4C7NB 4EIJA 4JJGA 4QDLA 3A11A 3KPHA 1DX7A 2MYSA 4ER9A 2MKVA 1ZHYA 3T97B 2AVKA 1K8AQ 1SQXJ 2YL0A 2M5AB 3BRTB 4YPCA 3TJ5A 3TQOA 2E76B 3KMIA 1NTME 4ULVA 1KILB 2N9BA 4RESB 2XLEA 1Y6DA 3PP5A 3A9CA 3BEHA 3EFFK 3AG2C 2CNWA 5AW5B 1M90Q 3HUSA 2OEXA 2P0NA 3AG3C 1GK6A 3H6PA 2H7OA 2LD6A 3MD0A 1IFNA 2PP6A 4EUKB 5H2FH 4WY4C 4GYTA 1ORJA 1FU1A 1T9KA 3GLMA 4CIHA 2XU6A 3H1LE 1M1KQ 2IZ1A 2PF4E 1K40A 2C0WA 1JTHB 2W83C 3VMZA 1ZR4A 4JCHA 1EXIA 2XL4A 1T3UA 1FZCC 5M1BA 3WUTA 4RDAA 1S3JA 2K3RA 2FXOA 4YT4A 1OXZA 2J0WA 3HTKB 3AE8C 2H8PD 5L0CA 4HE8D 1JUNA 4XPXA 3BASA 5T1DB 2HMZA 4I6MC 1BDDA 1VOMA 1X79B 1MMAA 4PD4H 2QJPC 2NSFA 1JMWA 1VF5C 3SXZA 4LDRA 2A45I 1ST6A 3CXHD 5KAIE 3V4WA 4O9BA 1U89A 1NTKD 2KOGA 1RKEA 1JB0J 2ZVOB 5E79H 1HE1A 1LI5A 1HF9A 3V2QA 2MWQA 3LS0A 4O7GA 3L37A 4YXWH 2GA0A 3GORA 2WSEJ 1OQCA 3QVZA 1T6IA 4JJFA 4ZKPA 5B3SC 1N1CA 3K33A 4N3YB 1XTGB 1NTMD 1C02A 3MFNA 4ZLDA 2QY9A 1FDOA 4E7SA 4NTBA 1W2EA 2G3KA 1RE4A 1KTMA 1TWCA 1M56C 3R4YA 4BJTA 5KYYA 4DZOA 4WBAA 4ONSA 1JY2N 2VRSA 1WATA 1E79H 4K1OA 5DQTA 1L4AA 1RE3A 2WTYA 2JPUA 2CW0F 1Q81Q 3L75D 4JTDB 1BDCA 1BE3D 1OW8A 4PR9A 4OGQB 3K1IC 2Q9BA 2IDBA 1AA0A 2H43A 3H1HG 1NO4A 2J9UA 3L74D 3GF3A 4JKVA 1Q2NA 5CI8A 5CCHC 2PX3A 1FBMA 5AVUB 2BC5A 1FNTc 2AXTH 5COMA 1KQFB 4O79A 4U7JA 2GUVA 4PJMA 3B9QA 3GANA 4WY4D 4PJ0H 5H2FE 3I4UA 4K0DA 1FS0E 1RH5B 5BU5A 4CDYA 4BXLA 1RXQA 4KI2A 3MLGA 1CSBA 3O6QB 4G7HF 1VB5A 5L0FA 2J58A 2W6JH 2WSFH 1AVYA 2L9JA 3UGOA 1YJWP 2GDCA 2HZ8A 4WY4A 5KLVE 1UFBA 3GW6A 4KNVA 2OYIC 1ZZPA 4IJJA 4P6IC 4Q5SF 1SQVE 3NFQA 3TD7A 4ZMDA 1MUUA 1VF5D 1M2VB 2BCCE 3QMKA 1KYOH 3Q7LA 5B3IA 2VCAA 2QJYB 3JSEO 2TMVP 1IFMA 3C1LA 1G4WR 1KQGB 3L35A 2I8BA 3AEBC 5DLJA 3GMAA 3EGDB 3S4RA 3SSUA 2RH0A 5E79E 2I8DA 3RK2B 4MVQA 3IHUA 1BR2A 2YEVA 3RVZA 1PV3A 1GL2B 4LC1A 1CPQA 4N6CA 4XEKA 3MBGA 1OMIA 1EDJA 4TT3H 3B5NB 3P8CD 3IF4A 4Z1MH 1NTKG 2NG1A 3E7KA 2P6VA 1AJYA 2J7PD 1ZVZA 4JEBA 2JO1A 1BBHA 1LS1A 2M4EA 4DRHB 1N8RQ 1M56D 4OD5A 2A6EF 3CD6P 3H1KE 3TYYA 4XTKA 2YQYA 2Q6QA 3H1IE 4AE4B 4DVYP 1M1JA 2NPSC 3CWBD 1SZIA 1NTMG 3CEXA 3JSZA 2NUTB 1H9TA 5GPGB 1JY2P 2L6HA 1BDJB 2B0JA 3V2NA 1BGYE 4G0HA 1T6AA 1K9MQ 3RKOF 4HFFB 1NTKK 3TOMA 4K35A 5CCHD 2Q9AA 1VPCA 2YO2A 3JCUH 4BRYA 3L75G 1GDTA 2HPCA 4I44A 4XA4A 5KLVD 2Q5UA 3LS1A 1BE3G 2ICWG 2HS5A 3V5ZA 3L74G 5CCHA 4U5DE 1OKKD 4N78D 1ZYRF 2BL2A 1SQVD 5DS6A 4DCKA 1NTMK 3G50A 1EDIA 3TK1A 3CCUP 1S2EA 4E7ZA 4PJ0E 4C3BA 4PD4D 4A2NB 1H8AA 3NMIA 3SZRA 3F47A 4YXDC 2GA1A 4IFFA 1GW3A 1O87A 1ZHZA 5AVSB 5CCGC 3LEOA 3A3YB 2IXMA 4N6HA 2YLIA 1FZAA 5KKZB 1NFOA 2R7TA 2POHA 1APCA 1LTJC 2OTKE 2W45A 1NTZE 3S0XA 1LWUB 1D7MA 1Q82Q 1HGZA 1URQB 1KB9I 2XS8A 1KNYA 2LXBA 3V4QA 3UMIA 4HYTB 5EHHA 2OYIA 3L70D 2PX0A 1X22A 3SEOA 3UNGC 1WOLA 2K88A 2WT7A 1HBWA 2QNLA 3BCCE 2OQMA 4YT2A 5GTIE 3TSIA 1G2CA 3H1KD 3VP8A 3Q5SA 2E74C 3H1ID 3AGTA 2UWJE 2Q9IA 3SXMA 2WPRA 1DD3A 1NHLA 2P7VA 1EQ7A 3S29A 4PFOA 2EPKX 2VB6A 1DH3A 2O9XA 3CC7P 1IFPA 3H32B 2XM4A 1YVIA 3TNUB 2K1AA 2OQQA 1H0TA 2XNDH 3RBZA 3HE4A 5GTHH 1JMBA 1YQ3C 3B0PA 4D6TJ 1JY3O 3GM2A 2NPSD 2ZFCA 3KYIA 3C62A 3SXKA 4DJ9A 2KW3C 2OGUA 1NGMB 1FOSE 2J9VA 1P84H 5JRAA 1N73B 3M4BA 3VOPA 2KS1B 1WTYA 1SS1A 4U9EA 2YO3A 4PJLA 3WG7C 1YA9A 2OYHC 3DJNB 3CWBG 2AWYA 1PD1A 3JCUE 4GOFA 3AEAC 4XEVA 1U57A 3IEEA 3GG2A 3RVYA 3T9OA 3C9IA 1KQSO 1EZVE 4OIRF 4CDAA 3TULA 2FYNC 1ZHTA 1NTZD 2FYUJ 2V7QH 2B87A 2NUPA 2FKWB 2IX7C 1ZLLA 3VYIA 3U1AA 1N86A 3TGUD 1VYKA 5KLVG 1NU9C 1Y9BA 2MJZA 1NU1J 5F28E 1OCRC 4JTCB 4HH2A 3U3BA 2XXAB 1CI6A 3CXHI 1SQVG 1QX8A 2IM8A 4PK4A 4KHXA 4BJ5A 2NPSB 1J1EB 1QVFO 1MNDA 1NSGB 2KXPB 3GWLA 5CJ0A 4FX5A 2ZXRA 5A6JA 5EFWB 1YLMA 3QW0A 1PIXA 3V2RA 2ZXEB 2Z15A 3A0BE 3MUDC 3S9OA 3K5BA 2Y9YA 4GODA 5AVZB 3S84A 3X1OA 3GF7A 5KLVK 1OCCC 2OTJP 3NMDA 1M6TA 2KNCA 3M0AA 1JNMA 2NZ2A 3PLNA 3I56P 3AE6C 2E74D 1SQVK 2XNXA 3AE4C 3L70G 3W2WA 1Q0GA 1A02J 1U7MA 1UIXA 5A69A 4JYCA 4Q4ZF 3AE7C 3EGXA 2G62A 3RL0B 2QEXP 3HLZA 3VAYA 2YMYA 4BJ1A 3W67A 3AECC 3H1KG 1RF1C 3H1IG 3AJMA 3ZQYA 3VMYA 4FESA 1CW5A 2G8YA 5D91A 1PGPA 3GHGC 2FBWC 3V6IA 5GTHE 2AXCA 1TWGA 1SQBE 1SFCC 1OR3A 3CCQP 2UUIA 2P61A 1VQ4P 1OIPA 2A1DD 4DRJB 5APUA 1BCCE 4NPDA 5AW3B 2A06D 3FGAD 3M79A 5APVA 2XRHA 3W8HA 2QTVA 1SVFA 2O01H 2LQGA 3NYJA 3DZAA 1L0ND 3LNRA 4NTFA 2CPBA 1RJ9A 3HUSC 4JE9A 1R8EA 3PHLA 4IARA 1JEKA 4H44C 2QJKC 3Q2YA 2OYHA 2QIWA 2W90A 2Y9ZA 1ZMEC 1V55C 3NXSA 2WITA 3ABKC 1FE6A 1Q90D 1Q0DA 1SLQA 5BQIA 4OINF 4MTFA 3E70C 3S27A 2XDJA 4EBJA 1PP9E 4JEAA 1NTZG 4IAOA 3MP7B 3RF3A 1YAUO 3TGUG 2HUJA 3L71J 4WGYA 2AEFA 2R7RA 2Q3IA 2XZRA 4AUWA 1JPJA 4UB8H 3H1JJ 3NKEA 4MVUA 2K9YA 1NZEA 3JRMO 4DT0A 2A69F 2JD3A 4N6JA 2O1JA 5AVTB 5AW0B 2E87A 2FFDA 1T01A 1FOSF 1LT9A 4IAQA 1BSHA 4EBBA 4XLNF 5A6BD 2YRFA 3VMAA 1NTZK 4XLPF 4L73A 5BU8B 5KAIH 3WUUA 2R7SA 1YDIA 1J8YF 4Z9HA 1FMVA 2XLWA 4LLEA 1U6HA 2F22A 3USSA 5A6BA 2ZYAA 2LFFA 1P84D 1JO5A 2CCYA 1RE4C 2M8RA 2DW3A 2WPSA 2C9NY 2N9YB 3C8GA 1SFCD 2P7JA 5KLIC 2IYPA 3S90A 3RK3B 2EPNA 2UUHA 1L4AC 1OCZC 4H0LC 2WL8A 2Q1KA 2QM8A 3FVYA 1A41A 3V7OA 4C3EA 4CSAC 4PACA 3VYWA 3EWKA 4DVZA 1YARO 1LTIC 4MS2A 1YA7O 1RY3A 2E42A 4BJ6C 2HFED 4U3FE 2OEVA 3T4RA 2J9BA 2WVQA 3I55P 4PD4I 4C7OA 3L72J 4NTAA 2CNWD 2YVKA 4IWBA 2H7VC 2A06G 2JP3A 1PP9D 1L0LE 4H13C 1T2KC 4H44D 1ZHWA 3FOPA 5EGYA 5T3WA 3WU2H 5JLIA 4B86A 1JCCA 3K1HA 1L0NG 5APSA 3LW5J 1RF1B 1IFIA 2AP3A 3ASNC 1HJ0A 2QM7A 3C18A 2M0BA 1EDLA 3DM9B 1J1DC 1BSNA 3IFMA 3GHGB 3ZTMA 1O3UA 1R5SA 1WN0A 1D1AA 3AEGC 256BA 3HTKA 1NBBA 1HGVA 5L0DA 3LIDA 2L5GB 2OTLP 3U8PA 3KPEA 3HD7C 1L2PA 2R5DA 3W68A 2VASA 1X9VA 2B89A 1KORA 4UB8E 2C03A 5L8RJ 3QH9A 1L0NK 1FR0A 2AU5A 2XSEA 2M3EA 1ZHXA 4L76A 1JMMA 3EHNA 3AE9C 4LACB 4UDVA 3A5TA 4I7ZB 4Y99C 3MTUE 4ZLCA 3P7KA 2WQYC 4CS7A 2W8ZA 1Z3IX 1A0BA 3GEIA 1DD4A 4C3DA 2HLOA 1XTCC 2SPZA 3QZCA 1YI2P 1SQBG 4U3FD 3M15A 3FWNA 1LIHA 2YNYA 3PTZA 3ABMC 3CX5E 3B71A 1YZCA 3OA1A 5F5HA 3M0DC 1L4AD 4H0LD 2OOCA 1L0LD 1M1JC 1KZUB 1L7CA 4WGZA 1NKNA 1TFKB 2XL6A 3KKBA 2KP8A 1SQPE 2KUBA 3CC2P 2OKUA 5CI9A 1E5WA 3ECSA 5COFA 2QVAA 2ZPAA 2XS1A 2W9YA 1RQUA 1Y8AA 3CCEP 1VQ6P 1BR4A 2ZYGA 2YMKA 2WWWA 4R32A 1N7SC 3AOUA 3E1RA 4CSAA 1SQBK 5AW2B 3IQTA 4MW8A 1RKEB 1K73Q 1ORSC 4Z9JA 2ZVNB 1NJIQ 1KYOI 1V74B 1RKCA 1ORYA 1VQOP 2D2CC 4H13D 4BJ6A 1T2KD 2ZT9C 1VLTA 4YWQA 3H1LD 1BZ4A 4U5CE 1KFNA 2YKOA 3DXJF 4LLHA 1FZEA 3WU2E 1OWAA 2HKVA 1R4TA 2IBZE 1PP9G 3I5CA 3NDBB 2PGDA 1HJBA 3LLIA 3EFGA 2XLHA 3O6XA 1M2OA 2J5UA 2EPOA 5KYYB 3M9HA 5AVVB 5KLIB 2N1TC 1D0ZA 3EQLF 1AVOA 2JR8A 1LTGC 1VL2A 4PV1D 1OXBA 2R9RB 3SWFA 1WWPA 2HR3A 4GOEA 3HD7D 5AC5A 3SWYA 4NPEA 1NKZB 1DEBA 1YHQP 4QI0A 3KH2A 2R32A 3PH0A 3RQEA 3CZ6A 1OZHA 3DJUB 2XLVA 4I2LC 3HD7A 2YIUC 3H1HJ 3HNIA 3K6BA 4JURI 3HRNA 2R44A 4H13B 4B6IA 1QL2A 3IQCA 1V4AA 2KIKA 3CMEP 1Z6AA 1GL2A 4JF7A 3OJAB 4BG0A 4BEJA 2E75C 2V26A 5AW7B 1R5LA 3B5NA 1C17M 3IQ5A 2C0XA 3W4YA 3P32A 5FCLA 5GTIH 2R03A 1SQPD 3U0CA 2H8AA 2GUSA 3GWNA 4K3AA 5KAFE 4J7YA 2DYSC 1V54C 3ZDLA 2PNOA 2YKZA 2HJMA 4AX2A 3EG9A 1NH4A 3OWTA 3EHMA 5DVWA 4WY4B 1DEEG 4DJGA 2VCBA 1QEXA 4JQ0D 1PD0A 1FZGA 4O6MA 1LE2A 3DWWA 3M9BA 2NUTA 3Q3DA 4BEMJ 4U3FG 4R4MA 2FY8A 1ZW0A 1FZCB 1HMDA 1SYQA 1W2BO 5KYWB 5B5EH 2Y3HA 5HV9A 3ITKA 3M0DA 2IBZD 1N7SD 4RD9A 1L0LG 4YL1A 1NYHA 3LIEA 4XPYA 2YHSA 3FAJA 4RO0A 2QJPB 5DS5A 1VF5B 2D2CD 4ULWA 1Z56A 2ZT9D 1S9KE 1LTBC 1IO4A 1KQLA 1MFTA 1N7SA 4NPFX 2QG4A 3UIAA 1Q7YQ 3QVYA 2J9WA 2PBEA 3RGUA 2ZXPA 5CIVA 4DBRA 1NTKJ 3AE2C 4RBNA 3H1LG 4K7BA 1CGNA 3EFOA 4JTAB 3MX3A 1L0LK 2YL7A 3U9MA 2N1TD 4XE5B 5AVXB 4H4KC 2E5TA 1PGOA 5DS4A 2Y69C 1VQKP 3C63A 4BJ5C 1M1JB 1Q86Q 2BCCD 1QL1A 3L71E 1LWUA 1QGKB 1URQA 4NCQA 3L73E 3DAFA 1RMVA 1NTMJ 2N1TA 3II6A 3SYNA 4GQHA 4I1LA 2OU6A 2VCCA 3L1MA 4Q7CA 1P84I 1FTSA 2G3AA 4BRYB 2R7UA 2QE9A 1Y4CA 4RKUJ 2HPCB 3C8ZA 3JTLO 3VF0A 3A0BH 2K9JB 3VN0A 3D6YA 3L75J 2P10A 4P9FA 4GKGA 2E75D 1BE3J 2R7VA 4J7TA 1ZW2A 2R25A 3L74J 2R5BA 4I1OB 2B0HA 2WZGA 5B1BC 4CDVA 4L6RA 3VRCA 2V4HA 1D1CA 3N0TA 2WSEH 1LP1A 2AWCA 1Z7Qc 3ASOC 3EZIA 3Q1MA 1T6QA 2KSEA 2OARA 2W27A 2EIMC 2WVOA 1T3JA 3ZG1A 1HTLC 2LCHA 3CCJP 2JWAA 1SQPG 4OD4A 3E9VA 1HW2A 1BGYD 3E1IA 4QMAA 1G8XA 2Y0DA 2L81A 1ZP0C 1HE9A 4LDQA 3L8IA 5B5EE 4GDOA 2OYIB 2WSCJ 4OIPF 3M06A 1SQQE 3U3FA 3LJBA 2G3VA 2R05A 1GQAA 2OYOA 5CMZA 3L72E 1SQXE 2KI7B 1ZU4A 3VTPC 2L91A 3WODF 3MHVA 1TWAA 1NVOA 3LESA 3LNMB 4EOTA 1EDKA 2HFIA 1PPJE 1SQPK 2JWDA 2IBZG 1JY3N 3PRJA 3EZHA 3FWLA 3DM5A 3L73D 1IC2A 4DBQA 1YJ9P 1MMGA 2GFHA 4U5GA 4DOJA 3EPVA 3T6BA 4A4AA 1VYIA 1VLSA 2XL8A 3DAGA 4BPMA 5BUOA 2C9LY 1I4YA 3RQGA 1PFIA 4MQ9F 4E18A 3HE4B 2XXAA 4AL1A 5DJTB 3MZWB 3EH2A 5JP7A 5AC4A 1HY5A 1PZQA 4E0HA 2J59M 3VM6A 5KYUB 2IXPA 3JZ0A 3BCCD 4EKWA 3C7JA 1LPEA 3U59A 3Q5PA 1A7DA 1JOCA 2BCCG 1OX3A 1ZRTE 2IBFA 2FFDC 3UR3C 1IFJA 1LT9C 4ZNCA 3EQ2A 3CWBJ 3H25A 5CBNA 3D6ZA 2FAPB 3LLKA 4IGGA 2KZJA 1FMWA 5E3CA 5L0GA 2KSJA 2YXQB 1G5ZA 1MKMA 2LK4A 2R02A 1YTZI 2B87B 1VQ5P 1USDA 1NAYA 1OVUA 4JVSA 2Z4EA 3Q5RA 1G4US 4MTGA 3W2VA 3NMJA 1GU4A 5B66E 2QUPA 5KLVJ 3N24A 2WZFA 3AE5C 5F5FA 2O3JA 4D4NA 3H65A 1GMJA 1SQXD 3MGNA 3NG1A 4KNWA 4MTOA 2JKVA 1SQVJ 1IK9A 2W6BA 3JCUQ 2YL1A 2QRXA 1GK4A 1PPJD 2E76C 3HE5A 1AV1A 1KILC 1S7ZA 1QVXA 4OIOF 1VMAA 3NTNA 1LTJB 1BGYG 1SMYF 4JZAA 1AQ5A 2KNCB 1TQGA 4W7ZA 4EYYQ 2XLDA 3B29A 2D5RB 1EZVD 3AGUA 2RKLA 2XLOA 2EPMX 3KDPB 2IYOA 1GW4A 4CBEA 1ZN5A 5TJHA 3EGXB 2EIJC 1D1BA 1KMIZ 3L70J 1KILE 3VP9A 2JJLA 2I1JA 2E74B 3N2ZB 4WB4A 3UGPA 1LVKA 2YLGA 3H1KJ 1U0BB 2CDQA 2P1JA 3NRHA 2WZ7A 1IJDB 3H1IJ 5L0IA 3T6JA 1KB9E 3DE9A 3HTKC 3L73G 1YQ4C 3TOLA 3JRTA 3AE3C 2A0UA 1LKXA 5E33A 4DXWA 2P2UA 3WHNA 3A0HE 1TKNA 1T8ZA 1H88A 2RMZA 4YTPC 1FC2C 1D0XA 4CS9A 1RJ9B 4PJJA 2Y3BA 3U8VA 3ZVRA 1B68A 3N4XA 3JYHA 4IOIH 3SP1A 3IPMO 3RH3A 4RJTA 2HODA 3BCCG 3IN6A 2OYHB 4ASWA 1YJGA 2DYRC 3G9RA 3FXDA 1JCDA 2P58A 1YITP 1NFNA 5TJ5E 1FZBA 1SQBD 2IPPA 4PFPA 1DOVA 2WSFJ 1CGME 4MVMA 4DOZA 1NU7D 3KZIE 2FYNB 1ZU5A 2IBZI 5KYXA 2Y39A 3C8GD 2ITAA 2J8WA 1BCCD 2BEZF 1QQ3A 1FDMA 2FXMA 1BR1A 1FDIA 2KLVA 1NTZJ 4WABA 3M91A 2DI3A 5BVZA 1H89A 3TGUJ 3CX5H 3ZQVA 3UMKA 2E76D 4EWCA 3V5YA 3UMHA 4OGQC 1MQVA 1KILD 1WRGA 4C7NA 1SQXG 2KK7A 4AL0A 4XPWA 2FFDB 3T97A 3OAKA 4CIPA 2M5AA 2WSSH 1LT9B 2YXRB 1PPJG 2ZAEB 4YL3A 3DE8A 2W4MA 1KILA 4CJOA 4OH8B 1E86A 1MNEA 4NQFA 1Y47A 5DJUB 4L74A 1PCXA 1Z5ZA 1EZVG 1E84A 4JYBA 3CXHE 4M3LA 2KSFA 3S28A 1OFCX 3EH1A 1E85A 3QWOC 1SQXK 2L6GA 1DIPA 2L7AA 1HUCA 4LDKA 3JC22 1IW7F 2WB7A 3C8GB 3NYMA 4G78A 3JT1A 3M9QA 3FX0A 2RD9A 5L3VA 1JTHA 4UB6E 4MVZA 1M7LA 5AVQB 3NKDA 2PRRA 3ITFA 4AQRD 5FZTA 3X2QC 1KU2A 3GM3A 1SFCB 1UG7A 5EK0A 4W8PA 4PV1C 1ZV8A 2QJYC 3CQZA 1D0YA 1LTAC 4C7OB 3ZTZA 2FGYA 2XV5A 3LEVA 2H88C 3RK2C 1VK5A 2I1KA 4D4XA 4O6NA 1VTMP 4IL6E 1GTWA 3L75E 1GL2C 3U5SA 1BE3E 3B5NC 4U5BE 2QA4P 2XM0A 1AEPA 3L74E 3HUSB 1HVVA 3ZDMA 2PP4A 2Y0EA 1L0NJ 3GODA 4H44B 2QJKB 3OEOA 4KJMA 2HJ3A 2OJED 3OA7A 1H6GA 4R4LA 1OXKA 2LR2A 2MHRA 2YZSA 2IOQA 1VQ9P 1KV4A 1S5LE 3KQGA 4XWJA 4H54A 5KAFH 3VMXA 1YIJP 2LXCB 4XFJA 3F5HA 2EPLX 2QLAA 5JVEA 1RF0C 3FXEA 1H7IA 2B88A 3F89A 2IFMA 1LNQA 4OGQD 1A7EA 3KYQA 1SF8A 1XZQA 4D6TE 1BCCG 3NMKA 4W7YA 5BQHA 4NY3A 3P8MC 1VQ7P 2FYZA 1OVRA 1YYXA 4GIFA 3NYLA 1QLEC 5COGA 3ZIBA 4E0IA 4J32B 4EI2A 1CPRA 4HFKB 1IK7A 5BQGA 2WVNA 3TF5A 4ANJA 5APQA 4OWFA 1JY2O 2J45A 1M57C 2JEEA 1SP4A 3QTHA 3RFYA 3TK0A 1JPNA 2LIGA 1TR2A 4YJWA 1Z23A 2H7BA 5KYNA 4U5HA 1IFDA 3S1KA 5AVWB 3GM1A 3L8JA 3I5QA 1OW6A 1SQBJ 2FYUE 2QSIA 3DD7A 2W6AA 5L3QA 1HW1A 5KKZC 2LKMA 1EI7A 2QE7H 5AW4B 2NSGA 3O6QA 4IL6X 4HEAJ 4JIOA 4CPGA 4EIYA 5TISH 1BCCJ 5L0HA 1LWUC 3P8CE 1URQC 4IB4A 1NU1E 3TJ6A 1OVVA 1LJ2A 2E5YA 2Z5IA 3G4SP 2KQ9A 1L4AB 4H0LB 1F1MA 3IAOA 2A45H 1GM5A 2CPSA 1FAPB 4IRUA 3CAXA 1TU3F 1HH0A 1YZAA 1M2VA 2HV6A 3RK2D 3ABVC 3CWBE 1EQ1A 5AW1B 4P9TA 3SFEC 1S5LX 1GL2D 3A7OA 3OW2O 3KHUA 4MN4C 5AW8B 2V7QJ 3B5ND 3EGDA 3KL4A 4DRIB 3CX5D 1EA8A 3RIPA 1X8YA 3FMSA 1I5NA 2HSQA 4D6TD 4IFDK 1S1CX 1AFOA 3JSVC 1PP9J 2KGOA 2R3SA 1AVOB 3GEHA 2HG5D 4YT5A 2KLUA 1EZVI 3PDMP 4N78E 3U2LA 3J06A 5AGFA 3C8VA 3WUVA 1J1DB 1TWHA 2KYHA 1FZCA 3AE1C 4PD4E 3MYIA 5KYWA 1K04A 1N73C 4XQ1A 4CJGA 1HMOA 1ZW3A 3PMRA 5E2QA 4PV1B 4AE4A 2P67A 3L36A 3HD7B 1QSPA 2LFDA 3H2UA 4E17A 1RF0A 3SXYA 4CS8C 1J8MF 3CL3D 1QLED 2FYUD 3G6EP 2PFXA 3HJCA 4PJNA 3ATPA 2JDIH 2VH3A 2NPUA 2OG2A 2YL3A 1M57D 4YT8A 2Q7CA 1NU1D 3BRVB 2D4UA 1JRAA 3L70E 4YN0B 2J46A 2X0CA 4Y99B 3O10A 2A6HF 2BE5F 4Y28J 4KBLA 5KJ7C 3U2MA 1MV8A 3EG9B 5JS5A 2VC9A 2O01N 2R7QA 4HB1A 1OR2A 4CX9A 5A6KA 3Q6NA 2HYNA 1I4ZA 1H9GA 2KNHA 1IZNB 1FJPA 3LW5H 1QKRA 2J7PA 1J1EC 4EHPA 5JUAA 3IR9A 1AUEA 2R7WA 2GWWA 1URQD 4HJGH 3CLQA 5TISE 3CC4P 2HSBA 4W80A 1E2XA 1YYCA 4U3FJ 3G4XA 4U5EE 2IZ0A 4MW3A 3SNHA 3IQ6A 2O01J 3AEFC 1ZOYC 1J2JB 4M63A 1JOGA 2AXTE 1L0LJ 4W8KA 2K9JA 3K1IA 3H1JE 2A68F 1KC8Q 1N7SB 4KC9A 3B0VC 5L0JA 3W8IA 3RL0C 1KN7A 2D2CB 1KD1Q 5APWA 1A7VA 2ZT9B 1FZFA 1G1JA 5A6AA 3LUTB 1USEA 5AVYB 1OKKA 2HV7A 3Q7GA 3EFOB 4X0RA 3O8ZA 2V3CC 1NG1A 2KYVA 2ZYDA 4I1MA 1M8OB 3O55A 1KFMA 1LGHB 3H1LJ 3JYYA 3H32A 1S72P 1GU5A 2Q00A 3CCRP 3ZWIA 4G7OF 3TNUA 5B66H 3G3ZA 4D6TG 3TGUE 3A2AA 1YTZT 3TDKA 2N1TB 4YK5A 3K7DA 2Q3EA 2WPQA 1LI7A 2PAJA 1R5ID 1QZXA 2KZIA 1KYOE 1RCPA 2Q3TA 1PL5A 3U1CA 3MIWA 1S9KD 3AQCA 1LTSC 1VQMP 1FFHA 4WJ0A 3V2PA 1N73A 2XKMA 5D92A 4BWNA 2KS1A 2A0BA 5DQZA 4KT0J 2H7HA 2YIUB 2WT7B 1NLXA 5APYA 4C7RA 2CK3H 1QVGO 4AYCA 4CS8A 3B0UX 1G2CB 4C46A 3M1CB 2FYUG 5KJ7D 1LP1B 4MVRA 1GGQA 5T3TA 1OW7A 5C39A 2E75B 4MNDA 3QW1A 3L71D 2R7OA 2RN0A 2EINC 2IXNA 1NU1G 4JC7A 3L4FA 1NAFA 3H1JD 1SR2A 5KJ7A 5KYUA 1H0TB 4JW1A 1SQPJ 4LLCA 1A02F 3DKAA 1W5CE 3FXHA 1KB9H 4GEHA 4JRZA 2NPSA 4WVZA 2CYDA 5HSWA 1VDFA 2BEQD 2FYUK 1MZ9A 3AQBA 4CS9C 2K37A 3POVA 4HKZH 4GT1A 3A0HH 3CCSP 1YJNP 2FXPA 1NU1K 3CPWO 2I15A 3I5PA 2A06E 1CZQA 1VQNP 3KXDA 4O6YA 1VQLP 3RL0D 4FAPB 3M4CA 2YKPA 2WZLA 2ZD9A 3R7CA 2YKQA 2Q4FA 1E83A 3AEDC 1L0NE 2ZXXA 1CGOA 2IYLD 1KYOD 2AEJA 3CCVP 1WGWA 5CCGD 3Q6MA 3SFDC 1FFTC 4F4BA 1GZLA 2NUPB 2RSEB 2W4BA 3GEEA 2OCCC 1U7JA 3RK3C 4U5FE 5E3AA 1LM3B 1VQPP 1S4XA 4TLFA 2H89C 1SQQD 2HMQA 3KZIH 4MVSA 2X51A 5CCGA 2BASA 3F46A 1QPUA 1CI6B 1EXJA 1AQTA 1IZMA 3L72D 2B9BA 4G7ZF 1LTTC 4QI2A 3PJSK 2OJQA 2WMMA 4YL0A 1LTJA 1HWTC 1UIIA 1Q0MA 1TFOB 3L0IA 4I3MA 3R2PA 1JAFA 1WASA 1FJKA 3T6GB 3RK3E 2BCCJ 1PGJA 1PGQA 5KTBA 5JSLA 3K66A 2DB4A 2LP4A 2ZJSE 3AG4C 3HNJA 3LAYA 4J30B 1FAVA 2Q9CA 3AEEC 2KK1A 5B1AC 3H2VA 4OIQF 2Y3DA 4ZKUA 1S05A 3FDQA 1LE4A 1JM0A 2M64A 1MMNA 5K0IA 1DOWA 2Q7RA 2YLDA 1K05A 1EC5A 3CMAP 3D70A 3PHF2 2ETSA 1Q0KA 3CXHH 3HNLA 3PCVA 5APTA 5CHXA 4LGDE 4A7PA 2XLMA 5AW6B 1JY3P 3FAPB 2O1KA 4WWIA 4OVNF 5APXA 1ZR2A 1VQ8P 4EDFA 1G1IA 1NOHA 1P84E 1ZRTD 3L71G 2A45G 1LT1A 1ZXGA 3B8EB 3HE5B 3L34A 4FWVA 1RQVA 4UB6H 2C04A 3CX5I 3H1JG 2KJGA 3AG1C 3V5XA 2L6FA 2WPVB 1C03A 1T5OA 3ZC4A 3DMDA 1BGYJ 2E43A 2Y3GA 4I7ZC 4IFMA 1N2DC 1MFZA 3KYJA 2M3BA 5JT4A 1NWQA 3H1HE 2ZXOA 3CCMP 1LS4A 4AK9A 4IL6H 1MMDA 3EJNA 5K5GB 2IFNA 3RBXA 3V5BA 3DI5A 1O5HA 2CGEA 2AEMA 4Z9IA 3CI9A 3N7NA 3RK3D 2ZXWC 3ZSUA 2FFHA 3BRJA 3CSKA 3G71P 3O39A 3L73J
chains in the Genus database with same CATH topology
2ZT9D 1EXJA 1EXIA 1PL5A 1Q90D 5M1BA 4YXDC 4EBKA 1Y9BA 3LW5J 1UFBA 5F28E 1HJ0A 3AE8C 2PBEA 3C18A 3RQFA 1ZZPA 1IK7A 4NQFA 3RK3E 1KMIZ 1KILE 1O3UA 4EBJA 3AE2C 2E74B 2QJPC 2J5UA 3AEGC 1VF5C 4KT0J 1VF5D 3RQGA 2YWAA 1VL2A 4PV1D 3AEEC 2KK1A 1KNYA 2L6GA 1PIXA 3O10A 1DIPA 1WMKA 1WWPA 4Y28J 3GM1A 3S9OA 1KORA 2K9YA 3C8GB 3L8JA 1JB0J 1WOLA 1KQGB 1OW6A 2QSIA 5L8RJ 1OW7A 3AEBC 3GMAA 3GF7A 4XEFA 5KKZC 1HF9A 2E75B 4PV1B 1YQ4C 1K05A 2WSEJ 3O6QA 3JZ0A 3RQEA 2NZ2A 4IL6X 3Q5SA 2E74C 1PV3A 3AE9C 3AE3C 3D70A 4XEKA 3AE6C 2E74D 2YIUC 1OMIA 3Q5PA 4TT3H 1DD3A 3GM3A 3AE4C 2G3AA 4I7ZB 2HSBA 4PV1C 1UIXA 1ZRTE 4Z1MH 4H13B 4RKUJ 2WQYC 3AE7C 2QJYC 4YTPC 4H0LB 1AJYA 1V4AA 3MFNA 1FDOA 3IAOA 2JO1A 3H25A 3D6ZA 3D6YA 3D71A 1KTMA 2P10A 2O01J 3AECC 3R4YA 3AEFC 1DD4A 1TU3F 1ZOYC 2E75C 2OQQA 1MKMA 2H88C 2JX0A 1RQVA 2E75D 1JOGA 2BEQD 3AJMA 3RL0g 2LK4A 3IN6A 3ABVC 3U0CA 2L6FA 2WPVB 3SFEC 1S5LX 2G8YA 2MKVA 2JPUA 1YQ3C 3G9RA 3T97B 2FBWC 3GM2A 3Q5RA 3C8GA 4I7ZC 2E76B 2FXPA 5KLIC 2V7QJ 3B71A 2L6HA 1OW8A 4H0LC 3Q1MA 4OGQB 1NGMB 2IDBA 4H0LD 2WSFJ 3AE5C 3GF3A 4H44B 2D2CB 3FGAD 1GMJA 3EWKA 2ZT9B 1S1CX 3Q3DA 1WTYA 3C8GD 3AEDC 4R4LA 2BEZF 4R4MA 1ZP0C 1FDIA 3SFDC 1KQFB 1RQUA 4U7JA 4XFJA 3JYYA 3L8IA 3AEAC 4XEVA 2E76C 2YMKA 4GDOA 2Q00A 4R32A 1U57A 2WSCJ 3C8VA 2E76D 3U3FA 4OGQC 1NYHA 3GLMA 1QVXA 2JP3A 3AE1C 4OGQD 4H13C 1R8EA 1K04A 4H44C 2QJKC 3Q2YA 2H89C 1K40A 2D2CC 4H13D 2FYNC 1VF5B 3BRJA 4H44D 3TULA 2QIWA 2D2CD 2ZT9C 1ZMEC 3K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD C;  4EBK A;  1UFB A;  5F28 E;  3AE8 C;  2PBE A;  3C18 A;  3RQF A;  1ZZP A;  4NQF A;  1O3U A;  4EBJ A;  3AE2 C;  3AEG C;  3RQG A;  2YWA A;  3AEE C;  2KK1 A;  1KNY A;  2L6G A;  3O10 A;  1WWP A;  3GM1 A;  3S9O A;  3C8G B;  3L8J A;  1WOL A;  1OW6 A;  1OW7 A;  3AEB C;  4XEF A;  1YQ4 C;  1K05 A;  3JZ0 A;  3RQE A;  1PV3 A;  3AE9 C;  3AE3 C;  4XEK A;  3AE6 C;  3GM3 A;  3AE4 C;  2G3A A;  2HSB A;  2WQY C;  3AE7 C;  3MFN A;  4YTP C;  1V4A A;  1KTM A;  3AEC C;  3AEF C;  1ZOY C;  2JX0 A;  2H88 C;  3AJM A;  1JOG A;  2LK4 A;  3U0C A;  3ABV C;  2L6F A;  3SFE C;  2JPU A;  1YQ3 C;  2FBW C;  3GM2 A;  3C8G A;  3B71 A;  2L6H A;  1OW8 A;  3AE5 C;  1WTY A;  3C8G D;  3AED C;  1ZP0 C;  3SFD C;  3JYY A;  3L8I A;  3AEA C;  4XEV A;  2Q00 A;  4R32 A;  3U3F A;  1QVX A;  3AE1 C;  1K04 A;  3TUL A;  2H89 C;  1K40 A;  3BRJ A;  3K7D A; 
#chains in the Genus database with same CATH topology
 2KB7 P;  3U9J A;  1EKY A;  1S5L H;  3HKK A;  1WT6 A;  4EBK A;  3US6 A;  3G4Z A;  3HNK A;  3RW0 A;  3RQF A;  1YYJ A;  2DGJ A;  4MVO A;  5IY5 C;  4JBZ A;  2EIK C;  1SQQ G;  1YBK A;  5AW9 B;  3MUD A;  3BVH A;  2WSC H;  1W2W A;  2HOD B;  1GS9 A;  3WAQ A;  2YWA A;  3L72 G;  2LSE A;  2ASR A;  2Y0C A;  1X0T A;  1WMK A;  1XZP A;  3BCC J;  1L3P A;  3RYL A;  4U9D A;  1GD2 E;  2KC3 A;  2NRG A;  2WVR A;  5CJ4 A;  3SWK A;  2R7X A;  3B4S A;  4XEF A;  1KB9 D;  5AVR B;  3FOO A;  4N06 A;  2R3C A;  1T6U A;  2Z5H A;  3FHD A;  1Q0F A;  4LER A;  4NC3 A;  5KYX B;  2PFD A;  1JR8 A;  4N4W A;  1Z63 A;  2P1A A;  2EIL C;  3MYF A;  3ABL C;  1SQQ K;  1OCO C;  1RF1 A;  4L75 A;  3BAT A;  1XWJ A;  4JPZ B;  2J0X A;  1RE3 C;  1N7L A;  2IXO A;  1NTK E;  2GM4 A;  3GHG A;  1RHZ B;  3CCL P;  3D71 A;  2GAQ A;  4JCZ A;  1SFC A;  3H1H D;  2JX0 A;  4ASV A;  5CBO A;  1SQQ J;  3RL0 g;  3WMM 0;  4C7N B;  4EIJ A;  4JJG A;  4QDL A;  3A11 A;  3KPH A;  1DX7 A;  2MYS A;  4ER9 A;  2MKV A;  1ZHY A;  3T97 B;  2AVK A;  1K8A Q;  1SQX J;  2YL0 A;  2M5A B;  3BRT B;  4YPC A;  3TJ5 A;  3TQO A;  2E76 B;  3KMI A;  1NTM E;  4ULV A;  1KIL B;  2N9B A;  4RES B;  2XLE A;  1Y6D A;  3PP5 A;  3A9C A;  3BEH A;  3EFF K;  3AG2 C;  2CNW A;  5AW5 B;  1M90 Q;  3HUS A;  2OEX A;  2P0N A;  3AG3 C;  1GK6 A;  3H6P A;  2H7O A;  2LD6 A;  3MD0 A;  1IFN A;  2PP6 A;  4EUK B;  5H2F H;  4WY4 C;  4GYT A;  1ORJ A;  1FU1 A;  1T9K A;  3GLM A;  4CIH A;  2XU6 A;  3H1L E;  1M1K Q;  2IZ1 A;  2PF4 E;  1K40 A;  2C0W A;  1JTH B;  2W83 C;  3VMZ A;  1ZR4 A;  4JCH A;  1EXI A;  2XL4 A;  1T3U A;  1FZC C;  5M1B A;  3WUT A;  4RDA A;  1S3J A;  2K3R A;  2FXO A;  4YT4 A;  1OXZ A;  2J0W A;  3HTK B;  3AE8 C;  2H8P D;  5L0C A;  4HE8 D;  1JUN A;  4XPX A;  3BAS A;  5T1D B;  2HMZ A;  4I6M C;  1BDD A;  1VOM A;  1X79 B;  1MMA A;  4PD4 H;  2QJP C;  2NSF A;  1JMW A;  1VF5 C;  3SXZ A;  4LDR A;  2A45 I;  1ST6 A;  3CXH D;  5KAI E;  3V4W A;  4O9B A;  1U89 A;  1NTK D;  2KOG A;  1RKE A;  1JB0 J;  2ZVO B;  5E79 H;  1HE1 A;  1LI5 A;  1HF9 A;  3V2Q A;  2MWQ A;  3LS0 A;  4O7G A;  3L37 A;  4YXW H;  2GA0 A;  3GOR A;  2WSE J;  1OQC A;  3QVZ A;  1T6I A;  4JJF A;  4ZKP A;  5B3S C;  1N1C A;  3K33 A;  4N3Y B;  1XTG B;  1NTM D;  1C02 A;  3MFN A;  4ZLD A;  2QY9 A;  1FDO A;  4E7S A;  4NTB A;  1W2E A;  2G3K A;  1RE4 A;  1KTM A;  1TWC A;  1M56 C;  3R4Y A;  4BJT A;  5KYY A;  4DZO A;  4WBA A;  4ONS A;  1JY2 N;  2VRS A;  1WAT A;  1E79 H;  4K1O A;  5DQT A;  1L4A A;  1RE3 A;  2WTY A;  2JPU A;  2CW0 F;  1Q81 Q;  3L75 D;  4JTD B;  1BDC A;  1BE3 D;  1OW8 A;  4PR9 A;  4OGQ B;  3K1I C;  2Q9B A;  2IDB A;  1AA0 A;  2H43 A;  3H1H G;  1NO4 A;  2J9U A;  3L74 D;  3GF3 A;  4JKV A;  1Q2N A;  5CI8 A;  5CCH C;  2PX3 A;  1FBM A;  5AVU B;  2BC5 A;  1FNT c;  2AXT H;  5COM A;  1KQF B;  4O79 A;  4U7J A;  2GUV A;  4PJM A;  3B9Q A;  3GAN A;  4WY4 D;  4PJ0 H;  5H2F E;  3I4U A;  4K0D A;  1FS0 E;  1RH5 B;  5BU5 A;  4CDY A;  4BXL A;  1RXQ A;  4KI2 A;  3MLG A;  1CSB A;  3O6Q B;  4G7H F;  1VB5 A;  5L0F A;  2J58 A;  2W6J H;  2WSF H;  1AVY A;  2L9J A;  3UGO A;  1YJW P;  2GDC A;  2HZ8 A;  4WY4 A;  5KLV E;  1UFB A;  3GW6 A;  4KNV A;  2OYI C;  1ZZP A;  4IJJ A;  4P6I C;  4Q5S F;  1SQV E;  3NFQ A;  3TD7 A;  4ZMD A;  1MUU A;  1VF5 D;  1M2V B;  2BCC E;  3QMK A;  1KYO H;  3Q7L A;  5B3I A;  2VCA A;  2QJY B;  3JSE O;  2TMV P;  1IFM A;  3C1L A;  1G4W R;  1KQG B;  3L35 A;  2I8B A;  3AEB C;  5DLJ A;  3GMA A;  3EGD B;  3S4R A;  3SSU A;  2RH0 A;  5E79 E;  2I8D A;  3RK2 B;  4MVQ A;  3IHU A;  1BR2 A;  2YEV A;  3RVZ A;  1PV3 A;  1GL2 B;  4LC1 A;  1CPQ A;  4N6C A;  4XEK A;  3MBG A;  1OMI A;  1EDJ A;  4TT3 H;  3B5N B;  3P8C D;  3IF4 A;  4Z1M H;  1NTK G;  2NG1 A;  3E7K A;  2P6V A;  1AJY A;  2J7P D;  1ZVZ A;  4JEB A;  2JO1 A;  1BBH A;  1LS1 A;  2M4E A;  4DRH B;  1N8R Q;  1M56 D;  4OD5 A;  2A6E F;  3CD6 P;  3H1K E;  3TYY A;  4XTK A;  2YQY A;  2Q6Q A;  3H1I E;  4AE4 B;  4DVY P;  1M1J A;  2NPS C;  3CWB D;  1SZI A;  1NTM G;  3CEX A;  3JSZ A;  2NUT B;  1H9T A;  5GPG B;  1JY2 P;  2L6H A;  1BDJ B;  2B0J A;  3V2N A;  1BGY E;  4G0H A;  1T6A A;  1K9M Q;  3RKO F;  4HFF B;  1NTK K;  3TOM A;  4K35 A;  5CCH D;  2Q9A A;  1VPC A;  2YO2 A;  3JCU H;  4BRY A;  3L75 G;  1GDT A;  2HPC A;  4I44 A;  4XA4 A;  5KLV D;  2Q5U A;  3LS1 A;  1BE3 G;  2ICW G;  2HS5 A;  3V5Z A;  3L74 G;  5CCH A;  4U5D E;  1OKK D;  4N78 D;  1ZYR F;  2BL2 A;  1SQV D;  5DS6 A;  4DCK A;  1NTM K;  3G50 A;  1EDI A;  3TK1 A;  3CCU P;  1S2E A;  4E7Z A;  4PJ0 E;  4C3B A;  4PD4 D;  4A2N B;  1H8A A;  3NMI A;  3SZR A;  3F47 A;  4YXD C;  2GA1 A;  4IFF A;  1GW3 A;  1O87 A;  1ZHZ A;  5AVS B;  5CCG C;  3LEO A;  3A3Y B;  2IXM A;  4N6H A;  2YLI A;  1FZA A;  5KKZ B;  1NFO A;  2R7T A;  2POH A;  1APC A;  1LTJ C;  2OTK E;  2W45 A;  1NTZ E;  3S0X A;  1LWU B;  1D7M A;  1Q82 Q;  1HGZ A;  1URQ B;  1KB9 I;  2XS8 A;  1KNY A;  2LXB A;  3V4Q A;  3UMI A;  4HYT B;  5EHH A;  2OYI A;  3L70 D;  2PX0 A;  1X22 A;  3SEO A;  3UNG C;  1WOL A;  2K88 A;  2WT7 A;  1HBW A;  2QNL A;  3BCC E;  2OQM A;  4YT2 A;  5GTI E;  3TSI A;  1G2C A;  3H1K D;  3VP8 A;  3Q5S A;  2E74 C;  3H1I D;  3AGT A;  2UWJ E;  2Q9I A;  3SXM A;  2WPR A;  1DD3 A;  1NHL A;  2P7V A;  1EQ7 A;  3S29 A;  4PFO A;  2EPK X;  2VB6 A;  1DH3 A;  2O9X A;  3CC7 P;  1IFP A;  3H32 B;  2XM4 A;  1YVI A;  3TNU B;  2K1A A;  2OQQ A;  1H0T A;  2XND H;  3RBZ A;  3HE4 A;  5GTH H;  1JMB A;  1YQ3 C;  3B0P A;  4D6T J;  1JY3 O;  3GM2 A;  2NPS D;  2ZFC A;  3KYI A;  3C62 A;  3SXK A;  4DJ9 A;  2KW3 C;  2OGU A;  1NGM B;  1FOS E;  2J9V A;  1P84 H;  5JRA A;  1N73 B;  3M4B A;  3VOP A;  2KS1 B;  1WTY A;  1SS1 A;  4U9E A;  2YO3 A;  4PJL A;  3WG7 C;  1YA9 A;  2OYH C;  3DJN B;  3CWB G;  2AWY A;  1PD1 A;  3JCU E;  4GOF A;  3AEA C;  4XEV A;  1U57 A;  3IEE A;  3GG2 A;  3RVY A;  3T9O A;  3C9I A;  1KQS O;  1EZV E;  4OIR F;  4CDA A;  3TUL A;  2FYN C;  1ZHT A;  1NTZ D;  2FYU J;  2V7Q H;  2B87 A;  2NUP A;  2FKW B;  2IX7 C;  1ZLL A;  3VYI A;  3U1A A;  1N86 A;  3TGU D;  1VYK A;  5KLV G;  1NU9 C;  1Y9B A;  2MJZ A;  1NU1 J;  5F28 E;  1OCR C;  4JTC B;  4HH2 A;  3U3B A;  2XXA B;  1CI6 A;  3CXH I;  1SQV G;  1QX8 A;  2IM8 A;  4PK4 A;  4KHX A;  4BJ5 A;  2NPS B;  1J1E B;  1QVF O;  1MND A;  1NSG B;  2KXP B;  3GWL A;  5CJ0 A;  4FX5 A;  2ZXR A;  5A6J A;  5EFW B;  1YLM A;  3QW0 A;  1PIX A;  3V2R A;  2ZXE B;  2Z15 A;  3A0B E;  3MUD C;  3S9O A;  3K5B A;  2Y9Y A;  4GOD A;  5AVZ B;  3S84 A;  3X1O A;  3GF7 A;  5KLV K;  1OCC C;  2OTJ P;  3NMD A;  1M6T A;  2KNC A;  3M0A A;  1JNM A;  2NZ2 A;  3PLN A;  3I56 P;  3AE6 C;  2E74 D;  1SQV K;  2XNX A;  3AE4 C;  3L70 G;  3W2W A;  1Q0G A;  1A02 J;  1U7M A;  1UIX A;  5A69 A;  4JYC A;  4Q4Z F;  3AE7 C;  3EGX A;  2G62 A;  3RL0 B;  2QEX P;  3HLZ A;  3VAY A;  2YMY A;  4BJ1 A;  3W67 A;  3AEC C;  3H1K G;  1RF1 C;  3H1I G;  3AJM A;  3ZQY A;  3VMY A;  4FES A;  1CW5 A;  2G8Y A;  5D91 A;  1PGP A;  3GHG C;  2FBW C;  3V6I A;  5GTH E;  2AXC A;  1TWG A;  1SQB E;  1SFC C;  1OR3 A;  3CCQ P;  2UUI A;  2P61 A;  1VQ4 P;  1OIP A;  2A1D D;  4DRJ B;  5APU A;  1BCC E;  4NPD A;  5AW3 B;  2A06 D;  3FGA D;  3M79 A;  5APV A;  2XRH A;  3W8H A;  2QTV A;  1SVF A;  2O01 H;  2LQG A;  3NYJ A;  3DZA A;  1L0N D;  3LNR A;  4NTF A;  2CPB A;  1RJ9 A;  3HUS C;  4JE9 A;  1R8E A;  3PHL A;  4IAR A;  1JEK A;  4H44 C;  2QJK C;  3Q2Y A;  2OYH A;  2QIW A;  2W90 A;  2Y9Z A;  1ZME C;  1V55 C;  3NXS A;  2WIT A;  3ABK C;  1FE6 A;  1Q90 D;  1Q0D A;  1SLQ A;  5BQI A;  4OIN F;  4MTF A;  3E70 C;  3S27 A;  2XDJ A;  4EBJ A;  1PP9 E;  4JEA A;  1NTZ G;  4IAO A;  3MP7 B;  3RF3 A;  1YAU O;  3TGU G;  2HUJ A;  3L71 J;  4WGY A;  2AEF A;  2R7R A;  2Q3I A;  2XZR A;  4AUW A;  1JPJ A;  4UB8 H;  3H1J J;  3NKE A;  4MVU A;  2K9Y A;  1NZE A;  3JRM O;  4DT0 A;  2A69 F;  2JD3 A;  4N6J A;  2O1J A;  5AVT B;  5AW0 B;  2E87 A;  2FFD A;  1T01 A;  1FOS F;  1LT9 A;  4IAQ A;  1BSH A;  4EBB A;  4XLN F;  5A6B D;  2YRF A;  3VMA A;  1NTZ K;  4XLP F;  4L73 A;  5BU8 B;  5KAI H;  3WUU A;  2R7S A;  1YDI A;  1J8Y F;  4Z9H A;  1FMV A;  2XLW A;  4LLE A;  1U6H A;  2F22 A;  3USS A;  5A6B A;  2ZYA A;  2LFF A;  1P84 D;  1JO5 A;  2CCY A;  1RE4 C;  2M8R A;  2DW3 A;  2WPS A;  2C9N Y;  2N9Y B;  3C8G A;  1SFC D;  2P7J A;  5KLI C;  2IYP A;  3S90 A;  3RK3 B;  2EPN A;  2UUH A;  1L4A C;  1OCZ C;  4H0L C;  2WL8 A;  2Q1K A;  2QM8 A;  3FVY A;  1A41 A;  3V7O A;  4C3E A;  4CSA C;  4PAC A;  3VYW A;  3EWK A;  4DVZ A;  1YAR O;  1LTI C;  4MS2 A;  1YA7 O;  1RY3 A;  2E42 A;  4BJ6 C;  2HFE D;  4U3F E;  2OEV A;  3T4R A;  2J9B A;  2WVQ A;  3I55 P;  4PD4 I;  4C7O A;  3L72 J;  4NTA A;  2CNW D;  2YVK A;  4IWB A;  2H7V C;  2A06 G;  2JP3 A;  1PP9 D;  1L0L E;  4H13 C;  1T2K C;  4H44 D;  1ZHW A;  3FOP A;  5EGY A;  5T3W A;  3WU2 H;  5JLI A;  4B86 A;  1JCC A;  3K1H A;  1L0N G;  5APS A;  3LW5 J;  1RF1 B;  1IFI A;  2AP3 A;  3ASN C;  1HJ0 A;  2QM7 A;  3C18 A;  2M0B A;  1EDL A;  3DM9 B;  1J1D C;  1BSN A;  3IFM A;  3GHG B;  3ZTM A;  1O3U A;  1R5S A;  1WN0 A;  1D1A A;  3AEG C;  256B A;  3HTK A;  1NBB A;  1HGV A;  5L0D A;  3LID A;  2L5G B;  2OTL P;  3U8P A;  3KPE A;  3HD7 C;  1L2P A;  2R5D A;  3W68 A;  2VAS A;  1X9V A;  2B89 A;  1KOR A;  4UB8 E;  2C03 A;  5L8R J;  3QH9 A;  1L0N K;  1FR0 A;  2AU5 A;  2XSE A;  2M3E A;  1ZHX A;  4L76 A;  1JMM A;  3EHN A;  3AE9 C;  4LAC B;  4UDV A;  3A5T A;  4I7Z B;  4Y99 C;  3MTU E;  4ZLC A;  3P7K A;  2WQY C;  4CS7 A;  2W8Z A;  1Z3I X;  1A0B A;  3GEI A;  1DD4 A;  4C3D A;  2HLO A;  1XTC C;  2SPZ A;  3QZC A;  1YI2 P;  1SQB G;  4U3F D;  3M15 A;  3FWN A;  1LIH A;  2YNY A;  3PTZ A;  3ABM C;  3CX5 E;  3B71 A;  1YZC A;  3OA1 A;  5F5H A;  3M0D C;  1L4A D;  4H0L D;  2OOC A;  1L0L D;  1M1J C;  1KZU B;  1L7C A;  4WGZ A;  1NKN A;  1TFK B;  2XL6 A;  3KKB A;  2KP8 A;  1SQP E;  2KUB A;  3CC2 P;  2OKU A;  5CI9 A;  1E5W A;  3ECS A;  5COF A;  2QVA A;  2ZPA A;  2XS1 A;  2W9Y A;  1RQU A;  1Y8A A;  3CCE P;  1VQ6 P;  1BR4 A;  2ZYG A;  2YMK A;  2WWW A;  4R32 A;  1N7S C;  3AOU A;  3E1R A;  4CSA A;  1SQB K;  5AW2 B;  3IQT A;  4MW8 A;  1RKE B;  1K73 Q;  1ORS C;  4Z9J A;  2ZVN B;  1NJI Q;  1KYO I;  1V74 B;  1RKC A;  1ORY A;  1VQO P;  2D2C C;  4H13 D;  4BJ6 A;  1T2K D;  2ZT9 C;  1VLT A;  4YWQ A;  3H1L D;  1BZ4 A;  4U5C E;  1KFN A;  2YKO A;  3DXJ F;  4LLH A;  1FZE A;  3WU2 E;  1OWA A;  2HKV A;  1R4T A;  2IBZ E;  1PP9 G;  3I5C A;  3NDB B;  2PGD A;  1HJB A;  3LLI A;  3EFG A;  2XLH A;  3O6X A;  1M2O A;  2J5U A;  2EPO A;  5KYY B;  3M9H A;  5AVV B;  5KLI B;  2N1T C;  1D0Z A;  3EQL F;  1AVO A;  2JR8 A;  1LTG C;  1VL2 A;  4PV1 D;  1OXB A;  2R9R B;  3SWF A;  1WWP A;  2HR3 A;  4GOE A;  3HD7 D;  5AC5 A;  3SWY A;  4NPE A;  1NKZ B;  1DEB A;  1YHQ P;  4QI0 A;  3KH2 A;  2R32 A;  3PH0 A;  3RQE A;  3CZ6 A;  1OZH A;  3DJU B;  2XLV A;  4I2L C;  3HD7 A;  2YIU C;  3H1H J;  3HNI A;  3K6B A;  4JUR I;  3HRN A;  2R44 A;  4H13 B;  4B6I A;  1QL2 A;  3IQC A;  1V4A A;  2KIK A;  3CME P;  1Z6A A;  1GL2 A;  4JF7 A;  3OJA B;  4BG0 A;  4BEJ A;  2E75 C;  2V26 A;  5AW7 B;  1R5L A;  3B5N A;  1C17 M;  3IQ5 A;  2C0X A;  3W4Y A;  3P32 A;  5FCL A;  5GTI H;  2R03 A;  1SQP D;  3U0C A;  2H8A A;  2GUS A;  3GWN A;  4K3A A;  5KAF E;  4J7Y A;  2DYS C;  1V54 C;  3ZDL A;  2PNO A;  2YKZ A;  2HJM A;  4AX2 A;  3EG9 A;  1NH4 A;  3OWT A;  3EHM A;  5DVW A;  4WY4 B;  1DEE G;  4DJG A;  2VCB A;  1QEX A;  4JQ0 D;  1PD0 A;  1FZG A;  4O6M A;  1LE2 A;  3DWW A;  3M9B A;  2NUT A;  3Q3D A;  4BEM J;  4U3F G;  4R4M A;  2FY8 A;  1ZW0 A;  1FZC B;  1HMD A;  1SYQ A;  1W2B O;  5KYW B;  5B5E H;  2Y3H A;  5HV9 A;  3ITK A;  3M0D A;  2IBZ D;  1N7S D;  4RD9 A;  1L0L G;  4YL1 A;  1NYH A;  3LIE A;  4XPY A;  2YHS A;  3FAJ A;  4RO0 A;  2QJP B;  5DS5 A;  1VF5 B;  2D2C D;  4ULW A;  1Z56 A;  2ZT9 D;  1S9K E;  1LTB C;  1IO4 A;  1KQL A;  1MFT A;  1N7S A;  4NPF X;  2QG4 A;  3UIA A;  1Q7Y Q;  3QVY A;  2J9W A;  2PBE A;  3RGU A;  2ZXP A;  5CIV A;  4DBR A;  1NTK J;  3AE2 C;  4RBN A;  3H1L G;  4K7B A;  1CGN A;  3EFO A;  4JTA B;  3MX3 A;  1L0L K;  2YL7 A;  3U9M A;  2N1T D;  4XE5 B;  5AVX B;  4H4K C;  2E5T A;  1PGO A;  5DS4 A;  2Y69 C;  1VQK P;  3C63 A;  4BJ5 C;  1M1J B;  1Q86 Q;  2BCC D;  1QL1 A;  3L71 E;  1LWU A;  1QGK B;  1URQ A;  4NCQ A;  3L73 E;  3DAF A;  1RMV A;  1NTM J;  2N1T A;  3II6 A;  3SYN A;  4GQH A;  4I1L A;  2OU6 A;  2VCC A;  3L1M A;  4Q7C A;  1P84 I;  1FTS A;  2G3A A;  4BRY B;  2R7U A;  2QE9 A;  1Y4C A;  4RKU J;  2HPC B;  3C8Z A;  3JTL O;  3VF0 A;  3A0B H;  2K9J B;  3VN0 A;  3D6Y A;  3L75 J;  2P10 A;  4P9F A;  4GKG A;  2E75 D;  1BE3 J;  2R7V A;  4J7T A;  1ZW2 A;  2R25 A;  3L74 J;  2R5B A;  4I1O B;  2B0H A;  2WZG A;  5B1B C;  4CDV A;  4L6R A;  3VRC A;  2V4H A;  1D1C A;  3N0T A;  2WSE H;  1LP1 A;  2AWC A;  1Z7Q c;  3ASO C;  3EZI A;  3Q1M A;  1T6Q A;  2KSE A;  2OAR A;  2W27 A;  2EIM C;  2WVO A;  1T3J A;  3ZG1 A;  1HTL C;  2LCH A;  3CCJ P;  2JWA A;  1SQP G;  4OD4 A;  3E9V A;  1HW2 A;  1BGY D;  3E1I A;  4QMA A;  1G8X A;  2Y0D A;  2L81 A;  1ZP0 C;  1HE9 A;  4LDQ A;  3L8I A;  5B5E E;  4GDO A;  2OYI B;  2WSC J;  4OIP F;  3M06 A;  1SQQ E;  3U3F A;  3LJB A;  2G3V A;  2R05 A;  1GQA A;  2OYO A;  5CMZ A;  3L72 E;  1SQX E;  2KI7 B;  1ZU4 A;  3VTP C;  2L91 A;  3WOD F;  3MHV A;  1TWA A;  1NVO A;  3LES A;  3LNM B;  4EOT A;  1EDK A;  2HFI A;  1PPJ E;  1SQP K;  2JWD A;  2IBZ G;  1JY3 N;  3PRJ A;  3EZH A;  3FWL A;  3DM5 A;  3L73 D;  1IC2 A;  4DBQ A;  1YJ9 P;  1MMG A;  2GFH A;  4U5G A;  4DOJ A;  3EPV A;  3T6B A;  4A4A A;  1VYI A;  1VLS A;  2XL8 A;  3DAG A;  4BPM A;  5BUO A;  2C9L Y;  1I4Y A;  3RQG A;  1PFI A;  4MQ9 F;  4E18 A;  3HE4 B;  2XXA A;  4AL1 A;  5DJT B;  3MZW B;  3EH2 A;  5JP7 A;  5AC4 A;  1HY5 A;  1PZQ A;  4E0H A;  2J59 M;  3VM6 A;  5KYU B;  2IXP A;  3JZ0 A;  3BCC D;  4EKW A;  3C7J A;  1LPE A;  3U59 A;  3Q5P A;  1A7D A;  1JOC A;  2BCC G;  1OX3 A;  1ZRT E;  2IBF A;  2FFD C;  3UR3 C;  1IFJ A;  1LT9 C;  4ZNC A;  3EQ2 A;  3CWB J;  3H25 A;  5CBN A;  3D6Z A;  2FAP B;  3LLK A;  4IGG A;  2KZJ A;  1FMW A;  5E3C A;  5L0G A;  2KSJ A;  2YXQ B;  1G5Z A;  1MKM A;  2LK4 A;  2R02 A;  1YTZ I;  2B87 B;  1VQ5 P;  1USD A;  1NAY A;  1OVU A;  4JVS A;  2Z4E A;  3Q5R A;  1G4U S;  4MTG A;  3W2V A;  3NMJ A;  1GU4 A;  5B66 E;  2QUP A;  5KLV J;  3N24 A;  2WZF A;  3AE5 C;  5F5F A;  2O3J A;  4D4N A;  3H65 A;  1GMJ A;  1SQX D;  3MGN A;  3NG1 A;  4KNW A;  4MTO A;  2JKV A;  1SQV J;  1IK9 A;  2W6B A;  3JCU Q;  2YL1 A;  2QRX A;  1GK4 A;  1PPJ D;  2E76 C;  3HE5 A;  1AV1 A;  1KIL C;  1S7Z A;  1QVX A;  4OIO F;  1VMA A;  3NTN A;  1LTJ B;  1BGY G;  1SMY F;  4JZA A;  1AQ5 A;  2KNC B;  1TQG A;  4W7Z A;  4EYY Q;  2XLD A;  3B29 A;  2D5R B;  1EZV D;  3AGU A;  2RKL A;  2XLO A;  2EPM X;  3KDP B;  2IYO A;  1GW4 A;  4CBE A;  1ZN5 A;  5TJH A;  3EGX B;  2EIJ C;  1D1B A;  1KMI Z;  3L70 J;  1KIL E;  3VP9 A;  2JJL A;  2I1J A;  2E74 B;  3N2Z B;  4WB4 A;  3UGP A;  1LVK A;  2YLG A;  3H1K J;  1U0B B;  2CDQ A;  2P1J A;  3NRH A;  2WZ7 A;  1IJD B;  3H1I J;  5L0I A;  3T6J A;  1KB9 E;  3DE9 A;  3HTK C;  3L73 G;  1YQ4 C;  3TOL A;  3JRT A;  3AE3 C;  2A0U A;  1LKX A;  5E33 A;  4DXW A;  2P2U A;  3WHN A;  3A0H E;  1TKN A;  1T8Z A;  1H88 A;  2RMZ A;  4YTP C;  1FC2 C;  1D0X A;  4CS9 A;  1RJ9 B;  4PJJ A;  2Y3B A;  3U8V A;  3ZVR A;  1B68 A;  3N4X A;  3JYH A;  4IOI H;  3SP1 A;  3IPM O;  3RH3 A;  4RJT A;  2HOD A;  3BCC G;  3IN6 A;  2OYH B;  4ASW A;  1YJG A;  2DYR C;  3G9R A;  3FXD A;  1JCD A;  2P58 A;  1YIT P;  1NFN A;  5TJ5 E;  1FZB A;  1SQB D;  2IPP A;  4PFP A;  1DOV A;  2WSF J;  1CGM E;  4MVM A;  4DOZ A;  1NU7 D;  3KZI E;  2FYN B;  1ZU5 A;  2IBZ I;  5KYX A;  2Y39 A;  3C8G D;  2ITA A;  2J8W A;  1BCC D;  2BEZ F;  1QQ3 A;  1FDM A;  2FXM A;  1BR1 A;  1FDI A;  2KLV A;  1NTZ J;  4WAB A;  3M91 A;  2DI3 A;  5BVZ A;  1H89 A;  3TGU J;  3CX5 H;  3ZQV A;  3UMK A;  2E76 D;  4EWC A;  3V5Y A;  3UMH A;  4OGQ C;  1MQV A;  1KIL D;  1WRG A;  4C7N A;  1SQX G;  2KK7 A;  4AL0 A;  4XPW A;  2FFD B;  3T97 A;  3OAK A;  4CIP A;  2M5A A;  2WSS H;  1LT9 B;  2YXR B;  1PPJ G;  2ZAE B;  4YL3 A;  3DE8 A;  2W4M A;  1KIL A;  4CJO A;  4OH8 B;  1E86 A;  1MNE A;  4NQF A;  1Y47 A;  5DJU B;  4L74 A;  1PCX A;  1Z5Z A;  1EZV G;  1E84 A;  4JYB A;  3CXH E;  4M3L A;  2KSF A;  3S28 A;  1OFC X;  3EH1 A;  1E85 A;  3QWO C;  1SQX K;  2L6G A;  1DIP A;  2L7A A;  1HUC A;  4LDK A;  3JC2 2;  1IW7 F;  2WB7 A;  3C8G B;  3NYM A;  4G78 A;  3JT1 A;  3M9Q A;  3FX0 A;  2RD9 A;  5L3V A;  1JTH A;  4UB6 E;  4MVZ A;  1M7L A;  5AVQ B;  3NKD A;  2PRR A;  3ITF A;  4AQR D;  5FZT A;  3X2Q C;  1KU2 A;  3GM3 A;  1SFC B;  1UG7 A;  5EK0 A;  4W8P A;  4PV1 C;  1ZV8 A;  2QJY C;  3CQZ A;  1D0Y A;  1LTA C;  4C7O B;  3ZTZ A;  2FGY A;  2XV5 A;  3LEV A;  2H88 C;  3RK2 C;  1VK5 A;  2I1K A;  4D4X A;  4O6N A;  1VTM P;  4IL6 E;  1GTW A;  3L75 E;  1GL2 C;  3U5S A;  1BE3 E;  3B5N C;  4U5B E;  2QA4 P;  2XM0 A;  1AEP A;  3L74 E;  3HUS B;  1HVV A;  3ZDM A;  2PP4 A;  2Y0E A;  1L0N J;  3GOD A;  4H44 B;  2QJK B;  3OEO A;  4KJM A;  2HJ3 A;  2OJE D;  3OA7 A;  1H6G A;  4R4L A;  1OXK A;  2LR2 A;  2MHR A;  2YZS A;  2IOQ A;  1VQ9 P;  1KV4 A;  1S5L E;  3KQG A;  4XWJ A;  4H54 A;  5KAF H;  3VMX A;  1YIJ P;  2LXC B;  4XFJ A;  3F5H A;  2EPL X;  2QLA A;  5JVE A;  1RF0 C;  3FXE A;  1H7I A;  2B88 A;  3F89 A;  2IFM A;  1LNQ A;  4OGQ D;  1A7E A;  3KYQ A;  1SF8 A;  1XZQ A;  4D6T E;  1BCC G;  3NMK A;  4W7Y A;  5BQH A;  4NY3 A;  3P8M C;  1VQ7 P;  2FYZ A;  1OVR A;  1YYX A;  4GIF A;  3NYL A;  1QLE C;  5COG A;  3ZIB A;  4E0I A;  4J32 B;  4EI2 A;  1CPR A;  4HFK B;  1IK7 A;  5BQG A;  2WVN A;  3TF5 A;  4ANJ A;  5APQ A;  4OWF A;  1JY2 O;  2J45 A;  1M57 C;  2JEE A;  1SP4 A;  3QTH A;  3RFY A;  3TK0 A;  1JPN A;  2LIG A;  1TR2 A;  4YJW A;  1Z23 A;  2H7B A;  5KYN A;  4U5H A;  1IFD A;  3S1K A;  5AVW B;  3GM1 A;  3L8J A;  3I5Q A;  1OW6 A;  1SQB J;  2FYU E;  2QSI A;  3DD7 A;  2W6A A;  5L3Q A;  1HW1 A;  5KKZ C;  2LKM A;  1EI7 A;  2QE7 H;  5AW4 B;  2NSG A;  3O6Q A;  4IL6 X;  4HEA J;  4JIO A;  4CPG A;  4EIY A;  5TIS H;  1BCC J;  5L0H A;  1LWU C;  3P8C E;  1URQ C;  4IB4 A;  1NU1 E;  3TJ6 A;  1OVV A;  1LJ2 A;  2E5Y A;  2Z5I A;  3G4S P;  2KQ9 A;  1L4A B;  4H0L B;  1F1M A;  3IAO A;  2A45 H;  1GM5 A;  2CPS A;  1FAP B;  4IRU A;  3CAX A;  1TU3 F;  1HH0 A;  1YZA A;  1M2V A;  2HV6 A;  3RK2 D;  3ABV C;  3CWB E;  1EQ1 A;  5AW1 B;  4P9T A;  3SFE C;  1S5L X;  1GL2 D;  3A7O A;  3OW2 O;  3KHU A;  4MN4 C;  5AW8 B;  2V7Q J;  3B5N D;  3EGD A;  3KL4 A;  4DRI B;  3CX5 D;  1EA8 A;  3RIP A;  1X8Y A;  3FMS A;  1I5N A;  2HSQ A;  4D6T D;  4IFD K;  1S1C X;  1AFO A;  3JSV C;  1PP9 J;  2KGO A;  2R3S A;  1AVO B;  3GEH A;  2HG5 D;  4YT5 A;  2KLU A;  1EZV I;  3PDM P;  4N78 E;  3U2L A;  3J06 A;  5AGF A;  3C8V A;  3WUV A;  1J1D B;  1TWH A;  2KYH A;  1FZC A;  3AE1 C;  4PD4 E;  3MYI A;  5KYW A;  1K04 A;  1N73 C;  4XQ1 A;  4CJG A;  1HMO A;  1ZW3 A;  3PMR A;  5E2Q A;  4PV1 B;  4AE4 A;  2P67 A;  3L36 A;  3HD7 B;  1QSP A;  2LFD A;  3H2U A;  4E17 A;  1RF0 A;  3SXY A;  4CS8 C;  1J8M F;  3CL3 D;  1QLE D;  2FYU D;  3G6E P;  2PFX A;  3HJC A;  4PJN A;  3ATP A;  2JDI H;  2VH3 A;  2NPU A;  2OG2 A;  2YL3 A;  1M57 D;  4YT8 A;  2Q7C A;  1NU1 D;  3BRV B;  2D4U A;  1JRA A;  3L70 E;  4YN0 B;  2J46 A;  2X0C A;  4Y99 B;  3O10 A;  2A6H F;  2BE5 F;  4Y28 J;  4KBL A;  5KJ7 C;  3U2M A;  1MV8 A;  3EG9 B;  5JS5 A;  2VC9 A;  2O01 N;  2R7Q A;  4HB1 A;  1OR2 A;  4CX9 A;  5A6K A;  3Q6N A;  2HYN A;  1I4Z A;  1H9G A;  2KNH A;  1IZN B;  1FJP A;  3LW5 H;  1QKR A;  2J7P A;  1J1E C;  4EHP A;  5JUA A;  3IR9 A;  1AUE A;  2R7W A;  2GWW A;  1URQ D;  4HJG H;  3CLQ A;  5TIS E;  3CC4 P;  2HSB A;  4W80 A;  1E2X A;  1YYC A;  4U3F J;  3G4X A;  4U5E E;  2IZ0 A;  4MW3 A;  3SNH A;  3IQ6 A;  2O01 J;  3AEF C;  1ZOY C;  1J2J B;  4M63 A;  1JOG A;  2AXT E;  1L0L J;  4W8K A;  2K9J A;  3K1I A;  3H1J E;  2A68 F;  1KC8 Q;  1N7S B;  4KC9 A;  3B0V C;  5L0J A;  3W8I A;  3RL0 C;  1KN7 A;  2D2C B;  1KD1 Q;  5APW A;  1A7V A;  2ZT9 B;  1FZF A;  1G1J A;  5A6A A;  3LUT B;  1USE A;  5AVY B;  1OKK A;  2HV7 A;  3Q7G A;  3EFO B;  4X0R A;  3O8Z A;  2V3C C;  1NG1 A;  2KYV A;  2ZYD A;  4I1M A;  1M8O B;  3O55 A;  1KFM A;  1LGH B;  3H1L J;  3JYY A;  3H32 A;  1S72 P;  1GU5 A;  2Q00 A;  3CCR P;  3ZWI A;  4G7O F;  3TNU A;  5B66 H;  3G3Z A;  4D6T G;  3TGU E;  3A2A A;  1YTZ T;  3TDK A;  2N1T B;  4YK5 A;  3K7D A;  2Q3E A;  2WPQ A;  1LI7 A;  2PAJ A;  1R5I D;  1QZX A;  2KZI A;  1KYO E;  1RCP A;  2Q3T A;  1PL5 A;  3U1C A;  3MIW A;  1S9K D;  3AQC A;  1LTS C;  1VQM P;  1FFH A;  4WJ0 A;  3V2P A;  1N73 A;  2XKM A;  5D92 A;  4BWN A;  2KS1 A;  2A0B A;  5DQZ A;  4KT0 J;  2H7H A;  2YIU B;  2WT7 B;  1NLX A;  5APY A;  4C7R A;  2CK3 H;  1QVG O;  4AYC A;  4CS8 A;  3B0U X;  1G2C B;  4C46 A;  3M1C B;  2FYU G;  5KJ7 D;  1LP1 B;  4MVR A;  1GGQ A;  5T3T A;  1OW7 A;  5C39 A;  2E75 B;  4MND A;  3QW1 A;  3L71 D;  2R7O A;  2RN0 A;  2EIN C;  2IXN A;  1NU1 G;  4JC7 A;  3L4F A;  1NAF A;  3H1J D;  1SR2 A;  5KJ7 A;  5KYU A;  1H0T B;  4JW1 A;  1SQP J;  4LLC A;  1A02 F;  3DKA A;  1W5C E;  3FXH A;  1KB9 H;  4GEH A;  4JRZ A;  2NPS A;  4WVZ A;  2CYD A;  5HSW A;  1VDF A;  2BEQ D;  2FYU K;  1MZ9 A;  3AQB A;  4CS9 C;  2K37 A;  3POV A;  4HKZ H;  4GT1 A;  3A0H H;  3CCS P;  1YJN P;  2FXP A;  1NU1 K;  3CPW O;  2I15 A;  3I5P A;  2A06 E;  1CZQ A;  1VQN P;  3KXD A;  4O6Y A;  1VQL P;  3RL0 D;  4FAP B;  3M4C A;  2YKP A;  2WZL A;  2ZD9 A;  3R7C A;  2YKQ A;  2Q4F A;  1E83 A;  3AED C;  1L0N E;  2ZXX A;  1CGO A;  2IYL D;  1KYO D;  2AEJ A;  3CCV P;  1WGW A;  5CCG D;  3Q6M A;  3SFD C;  1FFT C;  4F4B A;  1GZL A;  2NUP B;  2RSE B;  2W4B A;  3GEE A;  2OCC C;  1U7J A;  3RK3 C;  4U5F E;  5E3A A;  1LM3 B;  1VQP P;  1S4X A;  4TLF A;  2H89 C;  1SQQ D;  2HMQ A;  3KZI H;  4MVS A;  2X51 A;  5CCG A;  2BAS A;  3F46 A;  1QPU A;  1CI6 B;  1EXJ A;  1AQT A;  1IZM A;  3L72 D;  2B9B A;  4G7Z F;  1LTT C;  4QI2 A;  3PJS K;  2OJQ A;  2WMM A;  4YL0 A;  1LTJ A;  1HWT C;  1UII A;  1Q0M A;  1TFO B;  3L0I A;  4I3M A;  3R2P A;  1JAF A;  1WAS A;  1FJK A;  3T6G B;  3RK3 E;  2BCC J;  1PGJ A;  1PGQ A;  5KTB A;  5JSL A;  3K66 A;  2DB4 A;  2LP4 A;  2ZJS E;  3AG4 C;  3HNJ A;  3LAY A;  4J30 B;  1FAV A;  2Q9C A;  3AEE C;  2KK1 A;  5B1A C;  3H2V A;  4OIQ F;  2Y3D A;  4ZKU A;  1S05 A;  3FDQ A;  1LE4 A;  1JM0 A;  2M64 A;  1MMN A;  5K0I A;  1DOW A;  2Q7R A;  2YLD A;  1K05 A;  1EC5 A;  3CMA P;  3D70 A;  3PHF 2;  2ETS A;  1Q0K A;  3CXH H;  3HNL A;  3PCV A;  5APT A;  5CHX A;  4LGD E;  4A7P A;  2XLM A;  5AW6 B;  1JY3 P;  3FAP B;  2O1K A;  4WWI A;  4OVN F;  5APX A;  1ZR2 A;  1VQ8 P;  4EDF A;  1G1I A;  1NOH A;  1P84 E;  1ZRT D;  3L71 G;  2A45 G;  1LT1 A;  1ZXG A;  3B8E B;  3HE5 B;  3L34 A;  4FWV A;  1RQV A;  4UB6 H;  2C04 A;  3CX5 I;  3H1J G;  2KJG A;  3AG1 C;  3V5X A;  2L6F A;  2WPV B;  1C03 A;  1T5O A;  3ZC4 A;  3DMD A;  1BGY J;  2E43 A;  2Y3G A;  4I7Z C;  4IFM A;  1N2D C;  1MFZ A;  3KYJ A;  2M3B A;  5JT4 A;  1NWQ A;  3H1H E;  2ZXO A;  3CCM P;  1LS4 A;  4AK9 A;  4IL6 H;  1MMD A;  3EJN A;  5K5G B;  2IFN A;  3RBX A;  3V5B A;  3DI5 A;  1O5H A;  2CGE A;  2AEM A;  4Z9I A;  3CI9 A;  3N7N A;  3RK3 D;  2ZXW C;  3ZSU A;  2FFH A;  3BRJ A;  3CSK A;  3G71 P;  3O39 A;  3L73 J; 
#chains in the Genus database with same CATH homology
 2ZT9 D;  1EXJ A;  1EXI A;  1PL5 A;  1Q90 D;  5M1B A;  4YXD C;  4EBK A;  1Y9B A;  3LW5 J;  1UFB A;  5F28 E;  1HJ0 A;  3AE8 C;  2PBE A;  3C18 A;  3RQF A;  1ZZP A;  1IK7 A;  4NQF A;  3RK3 E;  1KMI Z;  1KIL E;  1O3U A;  4EBJ A;  3AE2 C;  2E74 B;  2QJP C;  2J5U A;  3AEG C;  1VF5 C;  4KT0 J;  1VF5 D;  3RQG A;  2YWA A;  1VL2 A;  4PV1 D;  3AEE C;  2KK1 A;  1KNY A;  2L6G A;  1PIX A;  3O10 A;  1DIP A;  1WMK A;  1WWP A;  4Y28 J;  3GM1 A;  3S9O A;  1KOR A;  2K9Y A;  3C8G B;  3L8J A;  1JB0 J;  1WOL A;  1KQG B;  1OW6 A;  2QSI A;  5L8R J;  1OW7 A;  3AEB C;  3GMA A;  3GF7 A;  4XEF A;  5KKZ C;  1HF9 A;  2E75 B;  4PV1 B;  1YQ4 C;  1K05 A;  2WSE J;  3O6Q A;  3JZ0 A;  3RQE A;  2NZ2 A;  4IL6 X;  3Q5S A;  2E74 C;  1PV3 A;  3AE9 C;  3AE3 C;  3D70 A;  4XEK A;  3AE6 C;  2E74 D;  2YIU C;  1OMI A;  3Q5P A;  4TT3 H;  1DD3 A;  3GM3 A;  3AE4 C;  2G3A A;  4I7Z B;  2HSB A;  4PV1 C;  1UIX A;  1ZRT E;  4Z1M H;  4H13 B;  4RKU J;  2WQY C;  3AE7 C;  2QJY C;  4YTP C;  4H0L B;  1AJY A;  1V4A A;  3MFN A;  1FDO A;  3IAO A;  2JO1 A;  3H25 A;  3D6Z A;  3D6Y A;  3D71 A;  1KTM A;  2P10 A;  2O01 J;  3AEC C;  3R4Y A;  3AEF C;  1DD4 A;  1TU3 F;  1ZOY C;  2E75 C;  2OQQ A;  1MKM A;  2H88 C;  2JX0 A;  1RQV A;  2E75 D;  1JOG A;  2BEQ D;  3AJM A;  3RL0 g;  2LK4 A;  3IN6 A;  3ABV C;  3U0C A;  2L6F A;  2WPV B;  3SFE C;  1S5L X;  2G8Y A;  2MKV A;  2JPU A;  1YQ3 C;  3G9R A;  3T97 B;  2FBW C;  3GM2 A;  3Q5R A;  3C8G A;  4I7Z C;  2E76 B;  2FXP A;  5KLI C;  2V7Q J;  3B71 A;  2L6H A;  1OW8 A;  4H0L C;  3Q1M A;  4OGQ B;  1NGM B;  2IDB A;  4H0L D;  2WSF J;  3AE5 C;  3GF3 A;  4H44 B;  2D2C B;  3FGA D;  1GMJ A;  3EWK A;  2ZT9 B;  1S1C X;  3Q3D A;  1WTY A;  3C8G D;  3AED C;  4R4L A;  2BEZ F;  4R4M A;  1ZP0 C;  1FDI A;  3SFD C;  1KQF B;  1RQU A;  4U7J A;  4XFJ A;  3JYY A;  3L8I A;  3AEA C;  4XEV A;  2E76 C;  2YMK A;  4GDO A;  2Q00 A;  4R32 A;  1U57 A;  2WSC J;  3C8V A;  2E76 D;  3U3F A;  4OGQ C;  1NYH A;  3GLM A;  1QVX A;  2JP3 A;  3AE1 C;  4OGQ D;  4H13 C;  1R8E A;  1K04 A;  4H44 C;  2QJK C;  3Q2Y A;  2H89 C;  1K40 A;  2D2C C;  4H13 D;  2FYN C;  1VF5 B;  3BRJ A;  4H44 D;  3TUL A;  2QIW A;  2D2C D;  2ZT9 C;  1ZME C;  3K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...