1K05A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
135
structure length
135
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 57
structure length 135
sequence length 135
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k05A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k05A02
1YQ4C 3AEBC 1WTYA 3AE3C 3AEAC 1K40A 1K04A 3JYYA 3AE2C 1JOGA 3RQFA 3ABVC 2YWAA 1V4AA 3SFEC 1QVXA 3AE9C 3L8JA 4YXDC 3C8GB 3AEFC 3AJMA 3GM1A 1PV3A 1KTMA 4YTPC 1YQ3C 3S9OA 3O10A 2PBEA 1OW8A 3AE5C 4EBKA 3AEEC 4R32A 1KNYA 2L6FA 1ZOYC 3GM3A 3AE8C 2HSBA 3C8GA 3AE6C 4XEFA 3U3FA 1WWPA 3C8GD 3AE7C 4EBJA 1UFBA 3B71A 2G3AA 3K7DA 2L6HA 1OW6A 4XEVA 1ZZPA 2Q00A 2JX0A 2LK4A 1OW7A 4NQFA 2KK1A 3U0CA 3GM2A 3TULA 3C18A 5F28E 3AECC 4XEKA 3AE4C 3JZ0A 1WOLA 3AEGC 2WQYC 2FBWC 3SFDC 2JPUA 3RQEA 3AEDC 1O3UA 1K05A 3L8IA 1ZP0C 3BRJA 2H88C 3RQGA 3MFNA 2H89C 3AE1C 2L6GA
chains in the Genus database with same CATH superfamily
3JSEO 2OTLP 1YYXA 1YLMA 3H1HE 1FFTC 1GL2B 4BEJA 2WSSH 1SVFA 3JYYA 4PJ0H 2L7AA 4EIYA 1FOSE 3FOOA 3EG9A 1LWUA 3SFEC 1DH3A 2EILC 5KAFH 3KMIA 4AQRD 4BJ6A 1YZCA 1L4AC 2Q3EA 4H44B 4A7PA 3M9HA 4U7JA 3P8CD 5AW3B 1NTMG 2G62A 2ZXEB 4ASVA 1BCCJ 3S27A 3EFOA 4D4XA 5EGYA 3KPHA 3K33A 4C7OA 5CJ0A 1LKXA 1N73A 5E79E 4R32A 3Q7GA 1ZU4A 3L72E 5AW5B 1X0TA 1LM3B 3M9BA 2W83C 3KH2A 5KYNA 2K37A 3KPEA 1MNDA 1SQVG 5JSLA 2BCCG 1W2WA 4HKZH 2R03A 1Q2NA 1WMKA 1VQ9P 4KNVA 3Q5SA 2NPSD 2K9JB 2WVNA 4MS2A 3MUDA 4G7ZF 2E74C 5APSA 3M0DC 2NPUA 5KLVK 2WL8A 4H0LC 3SYNA 2HR3A 4J7YA 1VQKP 2ZYAA 1NSGB 3EFOB 2FFDB 4JC7A 3BCCD 1R5ID 2W4BA 2R7RA 3PHF2 3QW0A 1YBKA 2Q00A 2R5DA 1QVFO 3CXHE 1KU2A 2HFIA 1WATA 2GA0A 1M2VB 256BA 1BBHA 1JMBA 3L35A 2KLVA 1YYJA 2OJQA 2A6EF 3KYIA 3FHDA 1TU3F 1FDMA 1M6TA 2HMZA 4TLFA 5E2QA 4XLPF 2R3CA 4YN0B 2JKVA 3RH3A 3GMAA 2M5AA 1S7ZA 3JSVC 4MTGA 1ZHYA 3EJNA 1ZXGA 3AEDC 4RJTA 1BE3G 2FXMA 2MJZA 2L81A 2IBZE 2H89C 3NMKA 1AVOB 2NSFA 2QE7H 1V54C 3HTKC 4DJGA 4D4NA 2M64A 1PFIA 1S05A 3PTZA 1LT9B 1U7JA 4WGYA 2B87B 3AEAC 2LQGA 3W2VA 5DQZA 1FU1A 4Q5SF 3NFQA 1A7EA 2CCYA 4ASWA 4YWQA 3I56P 1PV3A 4NY3A 1QKRA 2QJYB 1QSPA 2IBZI 3U59A 1YYCA 1PD1A 3AEEC 2J45A 1YZAA 4DVYP 2YKQA 2CYDA 2G3VA 1A0BA 3M15A 4E7ZA 1S1CX 4BXLA 2XM0A 2PF4E 3H1HJ 1FZCC 2KIKA 2Q3TA 5EHHA 4OVNF 3AE6C 2JP3A 4W7YA 2R5BA 2HYNA 2WSCH 1JY2N 1KFNA 1NU1D 3B5NB 4C3BA 1EQ1A 4QI0A 4N78D 4RDAA 3L73D 1L0LK 4KC9A 5TJ5E 1YARO 3ECSA 1FZEA 1E83A 1PP9J 1SQQD 4YL0A 1S2EA 2QY9A 3GG2A 2KNHA 4EI2A 2E43A 2CGEA 3USSA 1VQ7P 1QGKB 3N2ZB 1WT6A 1TWHA 1ZRTE 3NYLA 5A6KA 3KYQA 3K7DA 1OKKA 1VQ4P 2HS5A 5K5GB 4JEBA 3U5SA 2E75C 3HUSC 2QNLA 1J1DC 2D2CC 3GF7A 3TOLA 3NG1A 4QI2A 2H7OA 2NRGA 3T97A 1QQ3A 3DMDA 3L75E 3DAGA 3LLIA 3LUTB 5L0HA 5B5EH 4IGGA 3HD7C 3CCLP 3IF4A 2VCBA 2W45A 5KYWA 4I7ZC 3MYIA 1NU1E 3AE4C 1EDLA 4PFPA 2DGJA 2WPSA 1KQFB 2O9XA 3CCSP 2Y0CA 3BRVB 3GHGA 3MZWB 1Y8AA 1N73B 5HSWA 1J8YF 5KYYB 2YO2A 3FDQA 5A6JA 1QL1A 2WZLA 3HJCA 1ZHXA 3HNIA 1J1EC 2B0JA 2GUVA 3TSIA 2XM4A 2OGUA 2R25A 4OIOF 4NCQA 1TKNA 2LXBA 1AEPA 3VMYA 1VOMA 2P7JA 3TJ6A 1XTCC 1JPNA 1L4AA 5C39A 1FE6A 2YRFA 1CW5A 1PIXA 2XL6A 2AWCA 3PJSK 3P32A 4IB4A 1BGYJ 2YWAA 1V4AA 2YL1A 3NMIA 5L0CA 2I8BA 1IZMA 2EPNA 1GTWA 3AJMA 3GM1A 2IYOA 1GK4A 3TJ5A 2D2CD 5KYUA 1L0NE 1SLQA 3EH2A 3C1LA 3U1CA 2R9RB 2ASRA 4E0HA 4EBKA 3S90A 2IBZD 3PRJA 2IOQA 2YHSA 3SXKA 2A68F 4IJJA 1J8MF 1LTJB 1OX3A 2EPMX 4MVMA 3AE8C 4OGQB 1RXQA 3G6EP 4IAQA 4J30B 1Z7Qc 3ZDMA 2AVKA 2YKZA 2RD9A 3MYFA 4K7BA 3VMZA 2OYHC 3EHNA 1BR4A 2LFDA 2XXAA 4G78A 3CXHI 1OXZA 3JTLO 1LWUC 3B5NC 3RK3C 2KI7B 2I1JA 2KC3A 1S72P 1LWUB 4P9TA 1NKZB 3H25A 1JTHB 4GOFA 3CXHD 1U0BB 3NRHA 5CBNA 2IYLD 1FDOA 3EZIA 2E76D 3K6BA 2JWDA 2Q9CA 4OD5A 1RE4C 5CJ4A 4JE9A 4XA4A 2Q7RA 4OGQD 4U3FG 1RF1B 3KZIH 2QE9A 3U0CA 1HW2A 1QLED 1NYHA 3FXEA 1H9TA 3WODF 3H1LD 5E33A 1GD2E 4UDVA 1FJKA 4D6TE 4JYCA 1HE9A 4RO0A 1YDIA 2C9LY 5JRAA 3IQ6A 1O87A 1FTSA 1O3UA 3JT1A 1N86A 2PAJA 2HODB 1VQPP 3BRJA 3H1KG 2WB7A 5KLIB 3AE1C 2YLGA 1FR0A 4CJGA 4DBQA 3KYJA 1KQLA 1E86A 4AL0A 1FZFA 3PHLA 3AEBC 3C8ZA 3L75J 5TJHA 3M4CA 3A0HH 2GWWA 1T6UA 5AW7B 1NJIQ 4HFFB 4MQ9F 1YAUO 2NSGA 4BG0A 2RMZA 4W7ZA 3L36A 1LS1A 1K9MQ 1PPJG 4U5BE 2C04A 4H54A 1G4WR 1RKEB 3C8VA 1Z6AA 3W2WA 3WU2E 2E74D 3EWKA 2XSEA 4YTPC 2P10A 3H32A 1KILC 1JEKA 3O6QB 2ZYDA 1H0TB 3S1KA 3LLKA 3SXYA 2YIUB 3RL0C 1NTKJ 3B0UX 1KMIZ 3MUDC 2QM8A 4HB1A 2NUPB 5KJ7C 3CCUP 3W67A 1NTKG 5COMA 2LXCB 5KLIC 2V26A 3C8GA 2KLUA 2RSEB 1S4XA 3I55P 2RH0A 1Z3IX 1LS4A 1FMVA 2P6VA 1LGHB 3DI5A 2POHA 4DT0A 3FMSA 2PFXA 1SQVE 2QJPB 1BDJB 2BCCE 1T2KD 5BVZA 5APYA 3WUUA 1MMDA 2OKUA 5B66E 2OCCC 3I4UA 1RQUA 4JBZA 1H0TA 3DJNB 3VP9A 3CPWO 2C0WA 1MMNA 2KNCB 1A7DA 3L72J 2NPSA 3ZWIA 2WT7B 2FYUJ 2FYNB 3KKBA 1BCCD 2FFHA 4JCHA 1GMJA 1Q0FA 3A2AA 2Y9ZA 1HWTC 4I1MA 1SS1A 2IBFA 1L2PA 1IW7F 4WB4A 2XL4A 1LT9A 1SQBK 1MKMA 2QA4P 4BEMJ 1JY3N 1W2BO 4XWJA 4GIFA 2JPUA 1IFDA 1N8RQ 2B0HA 4MVOA 2XLEA 3L8IA 2KJGA 3HUSA 5DVWA 2ZXRA 5DLJA 1BCCG 1PP9D 4OGQC 4KJMA 1VF5B 3K1HA 5KLVD 1JY3O 5AVRB 4A2NB 1ZU5A 3QH9A 1X22A 1S3JA 1LNQA 2YLDA 3AE3C 1N7SD 3HTKB 3GEHA 4KI2A 1SQXD 4PFOA 3M79A 4K3AA 2UUIA 3CCVP 4I3MA 4U5GA 3BATA 1FFHA 2RKLA 1GM5A 2R02A 4PD4I 2JWAA 2DB4A 1ZN5A 4YXDC 1ZHTA 1T6QA 3X1OA 1I4YA 1ZHWA 2JEEA 4H13B 4DVZA 3DAFA 1BGYG 1S5LE 2BEQD 5AW0B 2YEVA 4MN4C 5F5HA 2OOCA 4L76A 1FDIA 2W6JH 3RK3E 1T2KC 2PBEA 3CAXA 3E7KA 3AE5C 1VQ5P 1BSNA 3ZC4A 2OYHA 5TISE 1M1JA 4FWVA 1JR8A 3NDBB 3FGAD 2VRSA 1FBMA 2BC5A 3ITFA 1RF0A 1URQA 4JTCB 4XEFA 4AK9A 3ASNC 3CMEP 4C3DA 1ORSC 1RKEA 1UIIA 2J9UA 3WHNA 3H1ID 3VOPA 4IWBA 1HMOA 1CI6B 2HUJA 2A6HF 4H0LB 1SR2A 1X79B 3B9QA 4L6RA 1OXKA 4EHPA 4PACA 3W68A 4O7GA 1BE3J 4U5DE 1RQVA 2YXRB 4MW3A 3GHGC 2V7QJ 3Q2YA 4DZOA 3L70G 3S84A 1SQPJ 1CGNA 1M1KQ 4BJ5C 1NTMJ 3W8IA 4F4BA 3Q5RA 4WWIA 4OWFA 1JPJA 5JT4A 4E18A 4B6IA 4WY4D 3H1IE 4JJFA 1VLSA 3E1IA 3DM9B 1NH4A 4L75A 1MQVA 3G4XA 1SQVJ 5BQIA 2ETSA 5CCGC 2AEFA 4GKGA 2W4MA 5FCLA 2FFDA 3CD6P 2FYUD 1O5HA 3QTHA 3QWOC 2VASA 2WVOA 3LW5H 2V4HA 4ER9A 5CIVA 1ZR4A 3AG3C 5GTHH 3MFNA 3I5PA 3BVHA 1NTZD 3RK3D 4RD9A 4CDVA 2CDQA 4U3FJ 2R05A 2D4UA 1SF8A 4HE8D 4JQ0D 1VF5D 1SQXG 2IBZG 1NAFA 3EQLF 2ZXOA 5AVSB 3T97B 4PV1D 2YKPA 2KYHA 2VB6A 1HY5A 4MVZA 3RQFA 1KILE 4DRIB 5B5EE 3HNJA 2QG4A 4OINF 2WSFH 3M06A 3RBXA 2K1AA 4Q7CA 4EIJA 1YQ3C 2K88A 4PD4E 4MVRA 1U7MA 3AG1C 4RESB 1OR2A 1LTBC 3CSKA 1JM0A 4WBAA 3TOMA 3B4SA 1JAFA 3CCQP 1IK9A 4UB8E 2YL3A 5AVQB 1GDTA 4IOIH 5CHXA 3L74J 2ICWG 1GU5A 1RE4A 3U9JA 3TF5A 1NZEA 2PFDA 3QVYA 1XZPA 3IEEA 1L0LD 1EC5A 4XQ1A 1Q0KA 1WASA 1YJ9P 2UWJE 1C02A 1APCA 4Y28J 5KAFE 5JVEA 4K0DA 3TNUB 2QTVA 3LW5J 2DI3A 4DXWA 1H8AA 2XZRA 5D92A 1LE4A 3ABLC 2O01H 1E79H 2YMYA 3G71P 4JZAA 3AGTA 3GHGB 3H1JG 3SWYA 3A11A 1ZW0A 1SQQE 2PRRA 5DS5A 2AXCA 3HD7D 1NU9C 2KB7P 2VCCA 1U89A 4AE4B 2E75B 1D1AA 1BGYD 3VN0A 3EFFK 3AECC 1FC2C 3H2UA 5DS4A 2FGYA 3ATPA 1JY2P 3S29A 3SFDC 3CCEP 2R32A 2QLAA 4TT3H 3DXJF 4AL1A 3LIDA 2A06D 3C9IA 5E3AA 3CWBJ 1KILA 1KB9E 4JF7A 1TR2A 5AVZB 2XLHA 1YQ4C 3M0DA 5AW1B 3A0BH 1WTYA 4LGDE 1LJ2A 1EDJA 5DJUB 2WPRA 3V7OA 4D6TJ 1N7SC 2Q4FA 1IFPA 2GAQA 3Q6MA 2VC9A 3ABVC 3O8ZA 2ZT9B 5JS5A 1NTKD 3MLGA 2IFNA 1VQNP 5L3VA 1PD0A 3JRMO 3N4XA 4CIPA 2LKMA 2ZVOB 3S9OA 3C62A 4DCKA 3PMRA 1VQOP 1D1CA 3V2NA 1DD3A 2J7PD 4E7SA 2A1DD 2ZFCA 2PNOA 3TD7A 2A45I 1ORJA 4UB8H 1L0NG 2E76C 4H44D 3GM3A 2I1KA 5F5FA 4GODA 1KYOH 4O6MA 1YI2P 4U5FE 1A41A 4OH8B 4C46A 3L75D 3KQGA 4LC1A 1Q81Q 3N24A 3A3YB 5KYUB 4E0IA 2XKMA 4EDFA 1AJYA 3VTPC 1NWQA 3EGDA 4N6CA 3RK3B 4PJLA 4JPZB 1ZHZA 5BUOA 2KP8A 1PGJA 1GU4A 1PCXA 3Q5PA 3TDKA 5KYXA 3CI9A 3TGUG 2G3AA 1M2VA 2XLDA 1JTHA 2Y0DA 1A02F 2FY8A 2FAPB 3N7NA 1NHLA 2QUPA 3RL0B 3BCCE 3L73E 3AG4C 2QJKB 4BJ6C 2B87A 3L4FA 1LTSC 1SQQG 3RVZA 2HJ3A 1T8ZA 2KXPB 5AC5A 4CPGA 3WUTA 3TULA 1EZVD 2C0XA 1VK5A 3F89A 5BU5A 2H7VC 2R7SA 2BCCJ 3L70D 3EGXB 1VDFA 3HE4A 2ZXPA 4AYCA 2OEXA 3PH0A 4G7OF 3EGXA 1CI6A 2HG5D 5T1DB 3V5BA 1HJ0A 1T3JA 1IFJA 4H0LD 5L0FA 2O3JA 1DIPA 3V5ZA 2E5TA 1KILD 2J9BA 1LTTC 2CW0F 2MYSA 1K73Q 2ZAEB 5A6BA 2KS1A 2ZJSE 1OXBA 3NYJA 1A02J 2H8AA 2WZ7A 1K40A 5CCHA 1IZNB 4PJ0E 3M91A 3FAPB 2ITAA 1TFOB 4IARA 2XLWA 4YL3A 2O1KA 1VL2A 1QEXA 3LJBA 2IPPA 4ZKPA 1ZR2A 2K9YA 5L3QA 2M5AB 1RY3A 3HD7B 2QJKC 3LEVA 4Y99B 3II6A 3L34A 3V4WA 2R7TA 2W6BA 2A06E 1BE3D 4IFMA 4JJGA 3NKEA 2HSBA 1L0LJ 1NLXA 2WPQA 4P6IC 2XV5A 4MW8A 2XS1A 2Y39A 3T6GB 1G2CA 4WGZA 1OQCA 1NO4A 3P8MC 5T3WA 5KYXB 2A69F 1M57C 4EWCA 4YPCA 3DJUB 3M1CB 2C9NY 3IFMA 1KZUB 2IXOA 3SZRA 3TGUE 1LTJC 4MTFA 2H43A 4MTOA 1UIXA 1E84A 1EKYA 1HGZA 3J06A 4WY4A 3Q7LA 4BWNA 2MHRA 2QRXA 3SWFA 2ZPAA 2VCAA 3TNUA 4X0RA 3PLNA 2TMVP 3F5HA 2AP3A 3LAYA 4N78E 5B3SC 3VYIA 4CBEA 3HE5B 2IDBA 3MIWA 3AEGC 1Y47A 4J32B 3KXDA 1FZCA 3RK2B 1NTZJ 3K5BA 5KJ7A 3U2LA 2EPOA 5KJ7D 3SSUA 3Q3DA 1HJBA 1EXIA 3H1JD 3LS1A 2GUSA 5AVUB 3LIEA 1CGOA 3I5QA 3DWWA 2O01J 3BCCJ 1EI7A 1NTME 1Q90D 3NYMA 1NTKE 4CS9A 1M2OA 3H1JJ 2Z5HA 2KQ9A 4OIRF 3HNKA 2H7BA 4DOZA 2XLMA 2KSEA 3F46A 3VMAA 3K1IC 4IFFA 1RMVA 3NKDA 2QIWA 2OTJP 3HE5A 1Z23A 4H13C 4U5CE 3G4ZA 2OEVA 1KB9D 1QVXA 1C03A 3MX3A 1L0LG 2NZ2A 1PP9E 1DOVA 5AVTB 1YIJP 1SQPG 3LNRA 1YTZI 3CMAP 2A45H 1U6HA 1SFCC 4E17A 1JOCA 4U3FE 1SYQA 2CPBA 1EZVG 2B9BA 1PPJD 4JRZA 2FYUE 2BL2A 3L71G 1KQGB 2I8DA 2HV6A 3D6ZA 3HLZA 4MVQA 3HNLA 2IZ0A 1P84D 4N4WA 1JO5A 1QPUA 3ZVRA 3DM5A 2IYPA 3RK2C 1WWPA 1AV1A 1EDIA 4JIOA 3B29A 1IFNA 3U2MA 1GL2D 1QL2A 1NOHA 1Q7YQ 2WT7A 3H1KE 3FWLA 4IRUA 1PGPA 1FMWA 2HFED 2YXQB 1SQVD 1CSBA 2HJMA 4EOTA 4ONSA 2JX0A 2LK4A 4Y99C 1HVVA 5KTBA 3A7OA 4RBNA 3L74E 3CCJP 4CX9A 1L0LE 3W4YA 3ABKC 3T6JA 3TYYA 4WABA 4MNDA 3ZTMA 3G3ZA 1QVGO 3GM2A 1J2JB 3MGNA 2QEXP 3DE8A 3CWBG 3RYLA 1E85A 3IN6A 3JYHA 2YKOA 2FYUK 1HTLC 3O55A 1LE2A 2FYUG 1KC8Q 3BRTB 4PD4D 3UNGC 1KN7A 3L72D 4WVZA 1Q0MA 3DKAA 3WG7C 2XDJA 3NXSA 1N7SB 1MFZA 2KZIA 2JR8A 4L74A 4XPXA 1BZ4A 1NFNA 4BJTA 3IR9A 4FAPB 2X51A 4DRHB 1J1EB 3L70J 1E2XA 5FZTA 1K04A 4BJ1A 5CMZA 5BU8B 1OCOC 1JOGA 2N1TC 3F47A 3QZCA 4U9DA 1SQBE 3MBGA 4DBRA 1YVIA 1SQXE 1NTZE 5KLVG 3L8JA 5HV9A 3GW6A 5CBOA 2PP4A 2MWQA 2J58A 2CNWA 1KTMA 1YHQP 1JRAA 3CWBE 4CIHA 2AEMA 2I15A 3P7KA 2HODA 3H1HG 1LTGC 2Z15A 1TWCA 2Y0EA 1L7CA 1ZW2A 1OZHA 2N1TD 1D0YA 4MVSA 4CDYA 2R44A 3H1LE 1OVVA 5K0IA 1FAPB 1LP1A 2J0WA 2J59M 1S5LX 3OAKA 4CS8A 1ZLLA 2GA1A 4G0HA 3JC22 3FX0A 2ZXXA 1B68A 1MV8A 3B8EB 3G4SP 4ANJA 4O6NA 2DYSC 2M3EA 1BCCE 3O6XA 3JCUE 1CPRA 4HYTB 4W8PA 4C7NA 1YJNP 3A0BE 1Q82Q 4H4KC 5A6AA 3ZDLA 3HE4B 1JMMA 4IAOA 3H65A 4Z9HA 4ZLDA 4NTBA 2OYIA 2OYOA 3X2QC 1LP1B 4PJMA 3KL4A 3MHVA 3C18A 3D71A 1HW1A 1I5NA 4U5EE 1E5WA 1FAVA 3SWKA 3V2RA 1KV4A 5AW9B 1YTZT 2WWWA 2WQYC 2OTKE 4JURI 4DRJB 2GM4A 4EUKB 4AUWA 4XPYA 2FXPA 4W80A 1VB5A 4JTAB 4P9FA 4YT2A 2EIJC 1WRGA 4CJOA 5IY5C 3M9QA 3QMKA 1VF5C 3B5NA 2OQMA 1RKCA 1RH5B 3QVZA 4QDLA 1LVKA 1JNMA 3H2VA 3CZ6A 5B1AC 1HBWA 1SQBD 1OCRC 3U9MA 3AE2C 4KNWA 2L9JA 1L4AB 3SXMA 1NTZG 5KLVE 5JUAA 1XTGB 3CC2P 2XXAB 4WJ0A 1MZ9A 3EHMA 1URQC 2KYVA 5CI9A 3Q1MA 2IXMA 3V6IA 2Z4EA 3ASOC 1Q86Q 2IX7C 2EPLX 1LTIC 4N3YB 5L0GA 2M3BA 1GZLA 3IQCA 4H13D 1EA8A 5L0JA 3FAJA 4Z9JA 3UMIA 4HFKB 2N1TA 1G5ZA 1FOSF 1SQQJ 3FVYA 5KAIE 1N73C 1JY3P 4I2LC 1GQAA 5M1BA 2QJPC 1JCCA 1NVOA 1TWGA 3CX5H 2NG1A 4KBLA 2A06G 3TQOA 1YA9A 2WSCJ 4WY4C 2Q9IA 2J9VA 5L8RJ 1IJDB 4LDRA 1AUEA 1BR2A 1HF9A 3TGUD 3HRNA 3VAYA 3GWNA 3GLMA 2W27A 4XE5B 3D6YA 3IPMO 4XLNF 1YJGA 3HKKA 3CL3D 2BCCD 3ZIBA 1KB9I 2IM8A 1LTAC 2R7XA 2P2UA 2YIUC 1KQSO 3H1KD 4EKWA 1AQ5A 3H1LJ 2BASA 2KK1A 3ZSUA 3VF0A 2PP6A 2X0CA 3FWNA 3V5XA 2YZSA 2Q9BA 3UGOA 3KDPB 3BCCG 1H88A 1HH0A 3SNHA 3SXZA 1OWAA 1EQ7A 1V74B 2NUTA 1AVYA 1RE3C 2KS1B 2W6AA 5APWA 2ZYGA 1PPJE 2L5GB 2IFMA 3TGUJ 2LCHA 2H7HA 3T4RA 4U3FD 2B89A 3SEOA 2W8ZA 5L0DA 2KW3C 2YMKA 3L75G 2J5UA 1VTMP 1VPCA 3U8VA 1SFCA 1VQLP 1MFTA 1NG1A 1XWJA 2P1AA 2L91A 4ZKUA 4AE4A 3UMHA 2WITA 1XZQA 2N9YB 3ZTZA 4LLCA 2HPCA 2Q5UA 1Y9BA 3L37A 3L71D 4NC3A 2P1JA 4O79A 1C17M 2EIMC 3C8GB 5AVXB 1S5LH 1OVRA 3D70A 1BR1A 1L4AD 1AVOA 2ZT9D 1LI7A 2XU6A 2AWYA 4PV1B 2Y3BA 5AW8B 3FXDA 1LT9C 1GK6A 2ZT9C 2YL0A 1PZQA 2R7VA 4IL6H 1SQVK 4FX5A 1ZOYC 3H1JE 5AW6B 2BE5F 4R4MA 1L0NK 4UB6H 3A9CA 1SQPE 2R3SA 4D6TD 2RN0A 2WVQA 2A0BA 3VP8A 2XLOA 2AXTH 3UGPA 3CLQA 2A0UA 4Q4ZF 1N7LA 5KAIH 3EGDB 4A4AA 3H1IJ 4JTDB 1NTMK 5BQHA 1VQ6P 1SQPK 1A7VA 1N2DC 3C8GD 1CPQA 3AE7C 3H1IG 2OJED 5KYWB 1ORYA 4HH2A 3CEXA 1USEA 3RL0D 1Q0GA 3MD0A 4CSAC 3ZG1A 1S9KD 5DQTA 5AGFA 2P58A 1S9KE 3RW0A 1OW7A 4O9BA 4IL6X 5KKZC 1WN0A 2M8RA 1LI5A 3L72G 3RK2D 1OKKD 1G2CB 3G50A 3PP5A 5AW4B 2HPCB 2P7VA 5KKZB 3RL0g 4I6MC 4ZLCA 3WUVA 3RBZA 2EIKC 2OU6A 1TWAA 4OD4A 3L74G 4HEAJ 1WOLA 2O01N 4KHXA 4BRYB 1D1BA 1RF0C 3ITKA 1TQGA 4NPFX 1SZIA 3LESA 1T9KA 3HD7A 1HUCA 1K05A 4IL6E 2E75D 2XNXA 3H6PA 4I44A 1AQTA 3O39A 3GANA 3SP1A 4ZNCA 5AVVB 4L73A 1FJPA 3NMJA 3OA1A 2WZFA 4OIQF 3RIPA 3C63A 3H1HD 1IC2A 1Y4CA 4JYBA 3GF3A 3E1RA 4H44C 3TK0A 1AA0A 3CX5I 4PJNA 4JCZA 2NPSC 3JCUH 1G8XA 1NU1G 2F22A 2Q9AA 4CS8C 5B3IA 4XPWA 3US6A 3S0XA 3LNMB 3EH1A 1QZXA 5H2FH 5JP7A 2K3RA 1Z56A 4YL1A 2FYNC 3CXHH 4CDAA 2L6FA 4LLHA 2B88A 2YNYA 5AVWB 1M90Q 3CC7P 2WMMA 1HE1A 1PGQA 2V3CC 1IFIA 5CCGD 3L70E 4ZMDA 1KYOI 1H6GA 4YK5A 4FESA 3OJAB 1NFOA 1EZVE 1RJ9A 3UIAA 1CGME 4GOEA 1LTJA 5GPGB 3R4YA 1YA7O 4CS9C 3ZQVA 2R7OA 2W90A 3U8PA 2FYZA 1EDKA 1UFBA 5D91A 2DYRC 4DJ9A 1ZRTD 1TFKB 3OWTA 1ZW3A 4YT5A 2NUPA 1P84I 3VRCA 1OW6A 1FZBA 1L3PA 4I1LA 4PD4H 1SQXK 2AU5A 1IK7A 5CCHD 1JY2O 4U5HA 3M0AA 5E79H 1BDDA 3M4BA 1RJ9B 1M7LA 1KILB 2QJYC 4U9EA 4LDQA 2WVRA 1MMAA 1SFCB 4EYYQ 1I4ZA 2AXTE 1SQPD 1OCZC 2IXNA 4ULVA 1PL5A 2GDCA 1KFMA 1V55C 3JRTA 2M4EA 2UUHA 3RQEA 2SPZA 2CPSA 2NPSB 5T3TA 1LIHA 4WY4B 4J7TA 2AEJA 4XTKA 2N9BA 1ZP0C 1D0ZA 3KZIE 3GEIA 1U57A 3R2PA 1SQQK 2LD6A 4JEAA 2JD3A 2Q7CA 1VQ8P 2J0XA 1KYOE 2L6GA 2J46A 3L71E 2JDIH 5A6BD 1CZQA 2YQYA 1OIPA 1OCCC 5EK0A 1SFCD 3ZQYA 4LACB 1H89A 1M56D 4CS7A 1T6AA 2KSFA 4RKUJ 2WZGA 4GEHA 2IZ1A 3AE9C 1QX8A 4BJ5A 2ZVNB 2EINC 2N1TB 2QM7A 3H1KJ 1ZYRF 1RF1C 4W8KA 4NTFA 5AW2B 2KZJA 3R7CA 4R4LA 3CCRP 4K1OA 2FFDC 3RFYA 1MNEA 2C03A 1YITP 2CK3H 3CQZA 2Y3HA 5BQGA 3U3FA 3VYWA 1R8EA 2Y3DA 2KSJA 2QSIA 1BGYE 3EG9B 5AC4A 1DOWA 3JSZA 2E87A 5KLVJ 2E74B 5DS6A 2H8PD 3GWLA 2G8YA 3H1LG 1VYIA 3E70C 1EZVI 4OIPF 1L0NJ 3MP7B 5TISH 1T01A 3EZHA 5JLIA 1N7SA 3B71A 3K1IA 1M1JB 2Q1KA 4NPDA 3I5CA 1RHZB 1BSHA 3Q6NA 4K35A 5CCHC 4Z9IA 3RVYA 3PDMP 4AX2A 4JKVA 2K9JA 1ZZPA 2GFHA 2LP4A 4LLEA 2ZXWC 1SP4A 1FS0E 5EFWB 4NQFA 3GORA 1LPEA 2LFFA 2YLIA 1OMIA 2V7QH 1RE3A 4JW1A 3RGUA 2D5RB 2HV7A 1R5SA 4LERA 2EPKX 2OARA 4B86A 1ZV8A 5F28E 2LIGA 3LEOA 2IXPA 4XEKA 1Y6DA 2XNDH 3JZ0A 2VH3A 1SQBJ 1M1JC 3CX5E 1N1CA 2XS8A 2FBWC 2PGDA 3JCUQ 1BDCA 1OFCX 1SMYF 3KHUA 1VYKA 3GEEA 2OYHB 5APXA 1NU7D 3P8CE 1JUNA 4M3LA 3VM6A 2H88C 3EPVA 5B1BC 1JB0J 3CWBD 4KT0J 1M8OB 1JMWA 5KYYA 3T6BA 4GYTA 2OG2A 3IQTA 1HMDA 2WSEH 3AQBA 1R4TA 2FXOA 1GGQA 2LSEA 1M56C 4GT1A 4D6TG 4I7ZB 2LR2A 1P84H 3PCVA 3OEOA 4IFDK 3NMDA 1IO4A 1D7MA 1DEEG 3DD7A 5COFA 1OW8A 1H7IA 3HUSB 3LS0A 1H9GA 3L71J 2MKVA 1NTKK 2J8WA 4UB6E 2R7UA 3CCMP 4GDOA 4YT4A 4GQHA 3V2QA 3S4RA 1G1JA 1NAYA 4CSAA 4DOJA 5CCGA 2Y9YA 3S28A 3UMKA 1NU1J 4PK4A 4PJJA 1T3UA 1D0XA 5GTHE 2YL7A 5APQA 1NGMB 3L74D 4QMAA 4O6YA 4LDKA 3L0IA 1USDA 2HZ8A 2L6HA 3U3BA 1Z63A 2KK7A 4XEVA 3G9RA 3TK1A 2R7QA 3RKOF 1X9VA 2HSQA 1G4US 3ABMC 1LT1A 4Z1MH 3WAQA 5L0IA 1X8YA 2ZD9A 2P61A 2XL8A 1GW3A 2WSEJ 1P84E 1URQB 3WU2H 4HJGH 4XFJA 3DZAA 1F1MA 3B0VC 3A0HE 3CC4P 2HKVA 1JCDA 1HGVA 3N0TA 1RCPA 2P0NA 2CNWD 2WSFJ 2Z5IA 1Q0DA 3B0PA 1FZGA 2Y3GA 2J9WA 1FZCB 4NPEA 2BEZF 3B5ND 1GL2C 3H32B 1M57D 1W5CE 1QLEC 3V4QA 2HLOA 3OA7A 1DX7A 5APUA 1VQMP 1G1IA 3EQ2A 2KNCA 2FKWB 4PV1C 3A5TA 2E76B 3C7JA 2NUTB 2KUBA 3HTKA 4N06A 2OQQA 3V2PA 2G3KA 2KGOA 1KYOD 1FZAA 4C3EA 1EXJA 5DJTB 3L1MA 5A69A 1MUUA 2WPVB 4NTAA 3AEFC 4YXWH 3DE9A 2QVAA 3OW2O 1OR3A 1Z5ZA 3O10A 2E5YA 1NTMD 3AG2C 3IAOA 3BASA 3GODA 2JJLA 5APTA 1KNYA 1ST6A 1VLTA 4N6JA 2J7PA 3AQCA 3EFGA 1ZVZA 2KOGA 3WMM0 4JVSA 2PX3A 3CX5D 1K8AQ 2DW3A 4PR9A 1T5OA 3O6QA 2OYIB 5APVA 2YO3A 1WGWA 1NU1K 3FOPA 1NTZK 3UR3C 3POVA 2A45G 1NBBA 3MTUE 4C7RA 2HMQA 4EBJA 1OVUA 3U1AA 1MMGA 1NKNA 3VMXA 4ULWA 4N6HA 2XLVA 1GW4A 2OYIC 4BRYA 4MVUA 1AFOA 3AOUA 2P67A 2O1JA 2Q6QA 3V5YA 2JO1A 1KORA 4C7OB 1T6IA 1YJWP 3AGUA 3IHUA 3IQ5A 1URQD 4EBBA 5GTIH 1FNTc 5AVYB 5GTIE 4BPMA 2PX0A 3QW1A 1DEBA 1J1DB 2D2CB 2XRHA 5COGA 2Y69C 3FXHA 2W9YA 1KD1Q 3RF3A 4I1OB 1PGOA 2YVKA 4G7HF 1W2EA 3E9VA 5E3CA 4C7NB 1SQXJ 2M0BA 1IFMA 2R7WA 5H2FE 1GL2A 1R5LA 1UG7A 1SQBG 3K66A 5CI8A 1BE3E 3L73G 3BEHA 1L0ND 2Q3IA 3NTNA 1GS9A 3RQGA 5B66H 3W8HA 1PP9G 2WTYA 4M63A 1KB9H 3L73J 3T9OA 1VMAA 1DD4A 4YT8A 1RF1A 1ZMEC 4YJWA 2E42A
chains in the Genus database with same CATH topology
1YQ4C 3AEBC 1WTYA 1VF5D 3AE3C 4PV1C 2E76B 3AEAC 1K40A 1K04A 3T97B 1PIXA 4PV1D 3GF3A 3JYYA 3AE2C 2QIWA 2OQQA 1JOGA 1Y9BA 4H13C 1KILE 3ABVC 4H44C 4RKUJ 1DIPA 3RQFA 2ZT9B 2YWAA 4I7ZB 1EXJA 1V4AA 3SFEC 1QVXA 3AE9C 3L8JA 2WPVB 4YXDC 3C8GB 1VL2A 3C8VA 2E74D 3AEFC 4H13B 2NZ2A 3EWKA 1PV3A 4H44B 2D2CD 4U7JA 1KTMA 2BEQD 2K9YA 4YTPC 3D70A 2P10A 1YQ3C 3S9OA 2ZT9D 3O10A 1FDIA 3RK3E 1DD3A 4PV1B 3Q1MA 2PBEA 2ZT9C 2FYNC 2QJKC 1OW8A 3AE5C 3IAOA 4EBKA 3AEEC 4R32A 1KNYA 1KMIZ 2L6FA 1ZOYC 2MKVA 4R4MA 1S1CX 2E76C 3FGAD 4H13D 4H44D 4R4LA 3GM3A 4GDOA 5KLIC 3AE8C 2HSBA 3C8GA 1KQGB 4OGQB 3AE6C 2JP3A 3D6ZA 4XEFA 1WMKA 5M1BA 3Q5SA 2QJPC 3U3FA 3O6QA 1R8EA 2QSIA 1S5LX 2E74C 1WWPA 3C8GD 2E74B 1AJYA 2WSCJ 3AE7C 2G8YA 3R4YA 4H0LC 4H0LB 5L8RJ 4Y28J 3AJMA 3GM1A 3H25A 1HF9A 4EBJA 1NGMB 1UFBA 1RQUA 3Q5PA 1ZRTE 3GLMA 3B71A 3D6YA 2G3AA 3K7DA 2L6HA 1RQVA 1FDOA 1OW6A 1UIXA 3LW5J 2E76D 4XEVA 2V7QJ 3G9RA 3Q2YA 1ZZPA 2Q00A 1IK7A 1KORA 2JO1A 2JX0A 2E75C 2LK4A 1OW7A 2D2CC 3GF7A 2YIUC 4IL6X 4OGQD 5KKZC 4NQFA 1GMJA 3Q5RA 1OMIA 2KK1A 3U0CA 4Z1MH 1NYHA 2QJYC 3GM2A 2D2CB 3TULA 3RL0g 1TU3F 2E75B 2WSEJ 3C18A 3D71A 5F28E 4I7ZC 1MKMA 3AECC 3IN6A 4XFJA 4XEKA 1PL5A 3GMAA 3AE4C 3JZ0A 2IDBA 1WOLA 3AEGC 2WQYC 2FBWC 3SFDC 2JPUA 1KQFB 3RQEA 2WSFJ 3AEDC 4TT3H 2L6GA 1O3UA 3Q3DA 1EXIA 1K05A 3L8IA 1ZP0C 2E75D 3BRJA 2H88C 2FXPA 3RQGA 3MFNA 4OGQC 1VF5B 2H89C 1U57A 2O01J 3AE1C 1JB0J 1HJ0A 2YMKA 2BEZF 4KT0J 2J5UA 4H0LD 1ZMEC 1Q90D 1DD4A 1VF5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ4 C;  3AEB C;  1WTY A;  3AE3 C;  3AEA C;  1K40 A;  1K04 A;  3JYY A;  3AE2 C;  1JOG A;  3RQF A;  3ABV C;  2YWA A;  1V4A A;  3SFE C;  1QVX A;  3AE9 C;  3L8J A;  4YXD C;  3C8G B;  3AEF C;  3AJM A;  3GM1 A;  1PV3 A;  1KTM A;  4YTP C;  1YQ3 C;  3S9O A;  3O10 A;  2PBE A;  1OW8 A;  3AE5 C;  4EBK A;  3AEE C;  4R32 A;  1KNY A;  2L6F A;  1ZOY C;  3GM3 A;  3AE8 C;  2HSB A;  3C8G A;  3AE6 C;  4XEF A;  3U3F A;  1WWP A;  3C8G D;  3AE7 C;  4EBJ A;  1UFB A;  3B71 A;  2G3A A;  3K7D A;  2L6H A;  1OW6 A;  4XEV A;  1ZZP A;  2Q00 A;  2JX0 A;  2LK4 A;  1OW7 A;  4NQF A;  2KK1 A;  3U0C A;  3GM2 A;  3TUL A;  3C18 A;  5F28 E;  3AEC C;  4XEK A;  3AE4 C;  3JZ0 A;  1WOL A;  3AEG C;  2WQY C;  2FBW C;  3SFD C;  2JPU A;  3RQE A;  3AED C;  1O3U A;  1K05 A;  3L8I A;  1ZP0 C;  3BRJ A;  2H88 C;  3RQG A;  3MFN A;  2H89 C;  3AE1 C;  2L6G A; 
#chains in the Genus database with same CATH topology
 3JSE O;  2OTL P;  1YYX A;  1YLM A;  3H1H E;  1FFT C;  1GL2 B;  4BEJ A;  2WSS H;  1SVF A;  3JYY A;  4PJ0 H;  2L7A A;  4EIY A;  1FOS E;  3FOO A;  3EG9 A;  1LWU A;  3SFE C;  1DH3 A;  2EIL C;  5KAF H;  3KMI A;  4AQR D;  4BJ6 A;  1YZC A;  1L4A C;  2Q3E A;  4H44 B;  4A7P A;  3M9H A;  4U7J A;  3P8C D;  5AW3 B;  1NTM G;  2G62 A;  2ZXE B;  4ASV A;  1BCC J;  3S27 A;  3EFO A;  4D4X A;  5EGY A;  3KPH A;  3K33 A;  4C7O A;  5CJ0 A;  1LKX A;  1N73 A;  5E79 E;  4R32 A;  3Q7G A;  1ZU4 A;  3L72 E;  5AW5 B;  1X0T A;  1LM3 B;  3M9B A;  2W83 C;  3KH2 A;  5KYN A;  2K37 A;  3KPE A;  1MND A;  1SQV G;  5JSL A;  2BCC G;  1W2W A;  4HKZ H;  2R03 A;  1Q2N A;  1WMK A;  1VQ9 P;  4KNV A;  3Q5S A;  2NPS D;  2K9J B;  2WVN A;  4MS2 A;  3MUD A;  4G7Z F;  2E74 C;  5APS A;  3M0D C;  2NPU A;  5KLV K;  2WL8 A;  4H0L C;  3SYN A;  2HR3 A;  4J7Y A;  1VQK P;  2ZYA A;  1NSG B;  3EFO B;  2FFD B;  4JC7 A;  3BCC D;  1R5I D;  2W4B A;  2R7R A;  3PHF 2;  3QW0 A;  1YBK A;  2Q00 A;  2R5D A;  1QVF O;  3CXH E;  1KU2 A;  2HFI A;  1WAT A;  2GA0 A;  1M2V B;  256B A;  1BBH A;  1JMB A;  3L35 A;  2KLV A;  1YYJ A;  2OJQ A;  2A6E F;  3KYI A;  3FHD A;  1TU3 F;  1FDM A;  1M6T A;  2HMZ A;  4TLF A;  5E2Q A;  4XLP F;  2R3C A;  4YN0 B;  2JKV A;  3RH3 A;  3GMA A;  2M5A A;  1S7Z A;  3JSV C;  4MTG A;  1ZHY A;  3EJN A;  1ZXG A;  3AED C;  4RJT A;  1BE3 G;  2FXM A;  2MJZ A;  2L81 A;  2IBZ E;  2H89 C;  3NMK A;  1AVO B;  2NSF A;  2QE7 H;  1V54 C;  3HTK C;  4DJG A;  4D4N A;  2M64 A;  1PFI A;  1S05 A;  3PTZ A;  1LT9 B;  1U7J A;  4WGY A;  2B87 B;  3AEA C;  2LQG A;  3W2V A;  5DQZ A;  1FU1 A;  4Q5S F;  3NFQ A;  1A7E A;  2CCY A;  4ASW A;  4YWQ A;  3I56 P;  1PV3 A;  4NY3 A;  1QKR A;  2QJY B;  1QSP A;  2IBZ I;  3U59 A;  1YYC A;  1PD1 A;  3AEE C;  2J45 A;  1YZA A;  4DVY P;  2YKQ A;  2CYD A;  2G3V A;  1A0B A;  3M15 A;  4E7Z A;  1S1C X;  4BXL A;  2XM0 A;  2PF4 E;  3H1H J;  1FZC C;  2KIK A;  2Q3T A;  5EHH A;  4OVN F;  3AE6 C;  2JP3 A;  4W7Y A;  2R5B A;  2HYN A;  2WSC H;  1JY2 N;  1KFN A;  1NU1 D;  3B5N B;  4C3B A;  1EQ1 A;  4QI0 A;  4N78 D;  4RDA A;  3L73 D;  1L0L K;  4KC9 A;  5TJ5 E;  1YAR O;  3ECS A;  1FZE A;  1E83 A;  1PP9 J;  1SQQ D;  4YL0 A;  1S2E A;  2QY9 A;  3GG2 A;  2KNH A;  4EI2 A;  2E43 A;  2CGE A;  3USS A;  1VQ7 P;  1QGK B;  3N2Z B;  1WT6 A;  1TWH A;  1ZRT E;  3NYL A;  5A6K A;  3KYQ A;  3K7D A;  1OKK A;  1VQ4 P;  2HS5 A;  5K5G B;  4JEB A;  3U5S A;  2E75 C;  3HUS C;  2QNL A;  1J1D C;  2D2C C;  3GF7 A;  3TOL A;  3NG1 A;  4QI2 A;  2H7O A;  2NRG A;  3T97 A;  1QQ3 A;  3DMD A;  3L75 E;  3DAG A;  3LLI A;  3LUT B;  5L0H A;  5B5E H;  4IGG A;  3HD7 C;  3CCL P;  3IF4 A;  2VCB A;  2W45 A;  5KYW A;  4I7Z C;  3MYI A;  1NU1 E;  3AE4 C;  1EDL A;  4PFP A;  2DGJ A;  2WPS A;  1KQF B;  2O9X A;  3CCS P;  2Y0C A;  3BRV B;  3GHG A;  3MZW B;  1Y8A A;  1N73 B;  5HSW A;  1J8Y F;  5KYY B;  2YO2 A;  3FDQ A;  5A6J A;  1QL1 A;  2WZL A;  3HJC A;  1ZHX A;  3HNI A;  1J1E C;  2B0J A;  2GUV A;  3TSI A;  2XM4 A;  2OGU A;  2R25 A;  4OIO F;  4NCQ A;  1TKN A;  2LXB A;  1AEP A;  3VMY A;  1VOM A;  2P7J A;  3TJ6 A;  1XTC C;  1JPN A;  1L4A A;  5C39 A;  1FE6 A;  2YRF A;  1CW5 A;  1PIX A;  2XL6 A;  2AWC A;  3PJS K;  3P32 A;  4IB4 A;  1BGY J;  2YWA A;  1V4A A;  2YL1 A;  3NMI A;  5L0C A;  2I8B A;  1IZM A;  2EPN A;  1GTW A;  3AJM A;  3GM1 A;  2IYO A;  1GK4 A;  3TJ5 A;  2D2C D;  5KYU A;  1L0N E;  1SLQ A;  3EH2 A;  3C1L A;  3U1C A;  2R9R B;  2ASR A;  4E0H A;  4EBK A;  3S90 A;  2IBZ D;  3PRJ A;  2IOQ A;  2YHS A;  3SXK A;  2A68 F;  4IJJ A;  1J8M F;  1LTJ B;  1OX3 A;  2EPM X;  4MVM A;  3AE8 C;  4OGQ B;  1RXQ A;  3G6E P;  4IAQ A;  4J30 B;  1Z7Q c;  3ZDM A;  2AVK A;  2YKZ A;  2RD9 A;  3MYF A;  4K7B A;  3VMZ A;  2OYH C;  3EHN A;  1BR4 A;  2LFD A;  2XXA A;  4G78 A;  3CXH I;  1OXZ A;  3JTL O;  1LWU C;  3B5N C;  3RK3 C;  2KI7 B;  2I1J A;  2KC3 A;  1S72 P;  1LWU B;  4P9T A;  1NKZ B;  3H25 A;  1JTH B;  4GOF A;  3CXH D;  1U0B B;  3NRH A;  5CBN A;  2IYL D;  1FDO A;  3EZI A;  2E76 D;  3K6B A;  2JWD A;  2Q9C A;  4OD5 A;  1RE4 C;  5CJ4 A;  4JE9 A;  4XA4 A;  2Q7R A;  4OGQ D;  4U3F G;  1RF1 B;  3KZI H;  2QE9 A;  3U0C A;  1HW2 A;  1QLE D;  1NYH A;  3FXE A;  1H9T A;  3WOD F;  3H1L D;  5E33 A;  1GD2 E;  4UDV A;  1FJK A;  4D6T E;  4JYC A;  1HE9 A;  4RO0 A;  1YDI A;  2C9L Y;  5JRA A;  3IQ6 A;  1O87 A;  1FTS A;  1O3U A;  3JT1 A;  1N86 A;  2PAJ A;  2HOD B;  1VQP P;  3BRJ A;  3H1K G;  2WB7 A;  5KLI B;  3AE1 C;  2YLG A;  1FR0 A;  4CJG A;  4DBQ A;  3KYJ A;  1KQL A;  1E86 A;  4AL0 A;  1FZF A;  3PHL A;  3AEB C;  3C8Z A;  3L75 J;  5TJH A;  3M4C A;  3A0H H;  2GWW A;  1T6U A;  5AW7 B;  1NJI Q;  4HFF B;  4MQ9 F;  1YAU O;  2NSG A;  4BG0 A;  2RMZ A;  4W7Z A;  3L36 A;  1LS1 A;  1K9M Q;  1PPJ G;  4U5B E;  2C04 A;  4H54 A;  1G4W R;  1RKE B;  3C8V A;  1Z6A A;  3W2W A;  3WU2 E;  2E74 D;  3EWK A;  2XSE A;  4YTP C;  2P10 A;  3H32 A;  1KIL C;  1JEK A;  3O6Q B;  2ZYD A;  1H0T B;  3S1K A;  3LLK A;  3SXY A;  2YIU B;  3RL0 C;  1NTK J;  3B0U X;  1KMI Z;  3MUD C;  2QM8 A;  4HB1 A;  2NUP B;  5KJ7 C;  3CCU P;  3W67 A;  1NTK G;  5COM A;  2LXC B;  5KLI C;  2V26 A;  3C8G A;  2KLU A;  2RSE B;  1S4X A;  3I55 P;  2RH0 A;  1Z3I X;  1LS4 A;  1FMV A;  2P6V A;  1LGH B;  3DI5 A;  2POH A;  4DT0 A;  3FMS A;  2PFX A;  1SQV E;  2QJP B;  1BDJ B;  2BCC E;  1T2K D;  5BVZ A;  5APY A;  3WUU A;  1MMD A;  2OKU A;  5B66 E;  2OCC C;  3I4U A;  1RQU A;  4JBZ A;  1H0T A;  3DJN B;  3VP9 A;  3CPW O;  2C0W A;  1MMN A;  2KNC B;  1A7D A;  3L72 J;  2NPS A;  3ZWI A;  2WT7 B;  2FYU J;  2FYN B;  3KKB A;  1BCC D;  2FFH A;  4JCH A;  1GMJ A;  1Q0F A;  3A2A A;  2Y9Z A;  1HWT C;  4I1M A;  1SS1 A;  2IBF A;  1L2P A;  1IW7 F;  4WB4 A;  2XL4 A;  1LT9 A;  1SQB K;  1MKM A;  2QA4 P;  4BEM J;  1JY3 N;  1W2B O;  4XWJ A;  4GIF A;  2JPU A;  1IFD A;  1N8R Q;  2B0H A;  4MVO A;  2XLE A;  3L8I A;  2KJG A;  3HUS A;  5DVW A;  2ZXR A;  5DLJ A;  1BCC G;  1PP9 D;  4OGQ C;  4KJM A;  1VF5 B;  3K1H A;  5KLV D;  1JY3 O;  5AVR B;  4A2N B;  1ZU5 A;  3QH9 A;  1X22 A;  1S3J A;  1LNQ A;  2YLD A;  3AE3 C;  1N7S D;  3HTK B;  3GEH A;  4KI2 A;  1SQX D;  4PFO A;  3M79 A;  4K3A A;  2UUI A;  3CCV P;  4I3M A;  4U5G A;  3BAT A;  1FFH A;  2RKL A;  1GM5 A;  2R02 A;  4PD4 I;  2JWA A;  2DB4 A;  1ZN5 A;  4YXD C;  1ZHT A;  1T6Q A;  3X1O A;  1I4Y A;  1ZHW A;  2JEE A;  4H13 B;  4DVZ A;  3DAF A;  1BGY G;  1S5L E;  2BEQ D;  5AW0 B;  2YEV A;  4MN4 C;  5F5H A;  2OOC A;  4L76 A;  1FDI A;  2W6J H;  3RK3 E;  1T2K C;  2PBE A;  3CAX A;  3E7K A;  3AE5 C;  1VQ5 P;  1BSN A;  3ZC4 A;  2OYH A;  5TIS E;  1M1J A;  4FWV A;  1JR8 A;  3NDB B;  3FGA D;  2VRS A;  1FBM A;  2BC5 A;  3ITF A;  1RF0 A;  1URQ A;  4JTC B;  4XEF A;  4AK9 A;  3ASN C;  3CME P;  4C3D A;  1ORS C;  1RKE A;  1UII A;  2J9U A;  3WHN A;  3H1I D;  3VOP A;  4IWB A;  1HMO A;  1CI6 B;  2HUJ A;  2A6H F;  4H0L B;  1SR2 A;  1X79 B;  3B9Q A;  4L6R A;  1OXK A;  4EHP A;  4PAC A;  3W68 A;  4O7G A;  1BE3 J;  4U5D E;  1RQV A;  2YXR B;  4MW3 A;  3GHG C;  2V7Q J;  3Q2Y A;  4DZO A;  3L70 G;  3S84 A;  1SQP J;  1CGN A;  1M1K Q;  4BJ5 C;  1NTM J;  3W8I A;  4F4B A;  3Q5R A;  4WWI A;  4OWF A;  1JPJ A;  5JT4 A;  4E18 A;  4B6I A;  4WY4 D;  3H1I E;  4JJF A;  1VLS A;  3E1I A;  3DM9 B;  1NH4 A;  4L75 A;  1MQV A;  3G4X A;  1SQV J;  5BQI A;  2ETS A;  5CCG C;  2AEF A;  4GKG A;  2W4M A;  5FCL A;  2FFD A;  3CD6 P;  2FYU D;  1O5H A;  3QTH A;  3QWO C;  2VAS A;  2WVO A;  3LW5 H;  2V4H A;  4ER9 A;  5CIV A;  1ZR4 A;  3AG3 C;  5GTH H;  3MFN A;  3I5P A;  3BVH A;  1NTZ D;  3RK3 D;  4RD9 A;  4CDV A;  2CDQ A;  4U3F J;  2R05 A;  2D4U A;  1SF8 A;  4HE8 D;  4JQ0 D;  1VF5 D;  1SQX G;  2IBZ G;  1NAF A;  3EQL F;  2ZXO A;  5AVS B;  3T97 B;  4PV1 D;  2YKP A;  2KYH A;  2VB6 A;  1HY5 A;  4MVZ A;  3RQF A;  1KIL E;  4DRI B;  5B5E E;  3HNJ A;  2QG4 A;  4OIN F;  2WSF H;  3M06 A;  3RBX A;  2K1A A;  4Q7C A;  4EIJ A;  1YQ3 C;  2K88 A;  4PD4 E;  4MVR A;  1U7M A;  3AG1 C;  4RES B;  1OR2 A;  1LTB C;  3CSK A;  1JM0 A;  4WBA A;  3TOM A;  3B4S A;  1JAF A;  3CCQ P;  1IK9 A;  4UB8 E;  2YL3 A;  5AVQ B;  1GDT A;  4IOI H;  5CHX A;  3L74 J;  2ICW G;  1GU5 A;  1RE4 A;  3U9J A;  3TF5 A;  1NZE A;  2PFD A;  3QVY A;  1XZP A;  3IEE A;  1L0L D;  1EC5 A;  4XQ1 A;  1Q0K A;  1WAS A;  1YJ9 P;  2UWJ E;  1C02 A;  1APC A;  4Y28 J;  5KAF E;  5JVE A;  4K0D A;  3TNU B;  2QTV A;  3LW5 J;  2DI3 A;  4DXW A;  1H8A A;  2XZR A;  5D92 A;  1LE4 A;  3ABL C;  2O01 H;  1E79 H;  2YMY A;  3G71 P;  4JZA A;  3AGT A;  3GHG B;  3H1J G;  3SWY A;  3A11 A;  1ZW0 A;  1SQQ E;  2PRR A;  5DS5 A;  2AXC A;  3HD7 D;  1NU9 C;  2KB7 P;  2VCC A;  1U89 A;  4AE4 B;  2E75 B;  1D1A A;  1BGY D;  3VN0 A;  3EFF K;  3AEC C;  1FC2 C;  3H2U A;  5DS4 A;  2FGY A;  3ATP A;  1JY2 P;  3S29 A;  3SFD C;  3CCE P;  2R32 A;  2QLA A;  4TT3 H;  3DXJ F;  4AL1 A;  3LID A;  2A06 D;  3C9I A;  5E3A A;  3CWB J;  1KIL A;  1KB9 E;  4JF7 A;  1TR2 A;  5AVZ B;  2XLH A;  1YQ4 C;  3M0D A;  5AW1 B;  3A0B H;  1WTY A;  4LGD E;  1LJ2 A;  1EDJ A;  5DJU B;  2WPR A;  3V7O A;  4D6T J;  1N7S C;  2Q4F A;  1IFP A;  2GAQ A;  3Q6M A;  2VC9 A;  3ABV C;  3O8Z A;  2ZT9 B;  5JS5 A;  1NTK D;  3MLG A;  2IFN A;  1VQN P;  5L3V A;  1PD0 A;  3JRM O;  3N4X A;  4CIP A;  2LKM A;  2ZVO B;  3S9O A;  3C62 A;  4DCK A;  3PMR A;  1VQO P;  1D1C A;  3V2N A;  1DD3 A;  2J7P D;  4E7S A;  2A1D D;  2ZFC A;  2PNO A;  3TD7 A;  2A45 I;  1ORJ A;  4UB8 H;  1L0N G;  2E76 C;  4H44 D;  3GM3 A;  2I1K A;  5F5F A;  4GOD A;  1KYO H;  4O6M A;  1YI2 P;  4U5F E;  1A41 A;  4OH8 B;  4C46 A;  3L75 D;  3KQG A;  4LC1 A;  1Q81 Q;  3N24 A;  3A3Y B;  5KYU B;  4E0I A;  2XKM A;  4EDF A;  1AJY A;  3VTP C;  1NWQ A;  3EGD A;  4N6C A;  3RK3 B;  4PJL A;  4JPZ B;  1ZHZ A;  5BUO A;  2KP8 A;  1PGJ A;  1GU4 A;  1PCX A;  3Q5P A;  3TDK A;  5KYX A;  3CI9 A;  3TGU G;  2G3A A;  1M2V A;  2XLD A;  1JTH A;  2Y0D A;  1A02 F;  2FY8 A;  2FAP B;  3N7N A;  1NHL A;  2QUP A;  3RL0 B;  3BCC E;  3L73 E;  3AG4 C;  2QJK B;  4BJ6 C;  2B87 A;  3L4F A;  1LTS C;  1SQQ G;  3RVZ A;  2HJ3 A;  1T8Z A;  2KXP B;  5AC5 A;  4CPG A;  3WUT A;  3TUL A;  1EZV D;  2C0X A;  1VK5 A;  3F89 A;  5BU5 A;  2H7V C;  2R7S A;  2BCC J;  3L70 D;  3EGX B;  1VDF A;  3HE4 A;  2ZXP A;  4AYC A;  2OEX A;  3PH0 A;  4G7O F;  3EGX A;  1CI6 A;  2HG5 D;  5T1D B;  3V5B A;  1HJ0 A;  1T3J A;  1IFJ A;  4H0L D;  5L0F A;  2O3J A;  1DIP A;  3V5Z A;  2E5T A;  1KIL D;  2J9B A;  1LTT C;  2CW0 F;  2MYS A;  1K73 Q;  2ZAE B;  5A6B A;  2KS1 A;  2ZJS E;  1OXB A;  3NYJ A;  1A02 J;  2H8A A;  2WZ7 A;  1K40 A;  5CCH A;  1IZN B;  4PJ0 E;  3M91 A;  3FAP B;  2ITA A;  1TFO B;  4IAR A;  2XLW A;  4YL3 A;  2O1K A;  1VL2 A;  1QEX A;  3LJB A;  2IPP A;  4ZKP A;  1ZR2 A;  2K9Y A;  5L3Q A;  2M5A B;  1RY3 A;  3HD7 B;  2QJK C;  3LEV A;  4Y99 B;  3II6 A;  3L34 A;  3V4W A;  2R7T A;  2W6B A;  2A06 E;  1BE3 D;  4IFM A;  4JJG A;  3NKE A;  2HSB A;  1L0L J;  1NLX A;  2WPQ A;  4P6I C;  2XV5 A;  4MW8 A;  2XS1 A;  2Y39 A;  3T6G B;  1G2C A;  4WGZ A;  1OQC A;  1NO4 A;  3P8M C;  5T3W A;  5KYX B;  2A69 F;  1M57 C;  4EWC A;  4YPC A;  3DJU B;  3M1C B;  2C9N Y;  3IFM A;  1KZU B;  2IXO A;  3SZR A;  3TGU E;  1LTJ C;  4MTF A;  2H43 A;  4MTO A;  1UIX A;  1E84 A;  1EKY A;  1HGZ A;  3J06 A;  4WY4 A;  3Q7L A;  4BWN A;  2MHR A;  2QRX A;  3SWF A;  2ZPA A;  2VCA A;  3TNU A;  4X0R A;  3PLN A;  2TMV P;  3F5H A;  2AP3 A;  3LAY A;  4N78 E;  5B3S C;  3VYI A;  4CBE A;  3HE5 B;  2IDB A;  3MIW A;  3AEG C;  1Y47 A;  4J32 B;  3KXD A;  1FZC A;  3RK2 B;  1NTZ J;  3K5B A;  5KJ7 A;  3U2L A;  2EPO A;  5KJ7 D;  3SSU A;  3Q3D A;  1HJB A;  1EXI A;  3H1J D;  3LS1 A;  2GUS A;  5AVU B;  3LIE A;  1CGO A;  3I5Q A;  3DWW A;  2O01 J;  3BCC J;  1EI7 A;  1NTM E;  1Q90 D;  3NYM A;  1NTK E;  4CS9 A;  1M2O A;  3H1J J;  2Z5H A;  2KQ9 A;  4OIR F;  3HNK A;  2H7B A;  4DOZ A;  2XLM A;  2KSE A;  3F46 A;  3VMA A;  3K1I C;  4IFF A;  1RMV A;  3NKD A;  2QIW A;  2OTJ P;  3HE5 A;  1Z23 A;  4H13 C;  4U5C E;  3G4Z A;  2OEV A;  1KB9 D;  1QVX A;  1C03 A;  3MX3 A;  1L0L G;  2NZ2 A;  1PP9 E;  1DOV A;  5AVT B;  1YIJ P;  1SQP G;  3LNR A;  1YTZ I;  3CMA P;  2A45 H;  1U6H A;  1SFC C;  4E17 A;  1JOC A;  4U3F E;  1SYQ A;  2CPB A;  1EZV G;  2B9B A;  1PPJ D;  4JRZ A;  2FYU E;  2BL2 A;  3L71 G;  1KQG B;  2I8D A;  2HV6 A;  3D6Z A;  3HLZ A;  4MVQ A;  3HNL A;  2IZ0 A;  1P84 D;  4N4W A;  1JO5 A;  1QPU A;  3ZVR A;  3DM5 A;  2IYP A;  3RK2 C;  1WWP A;  1AV1 A;  1EDI A;  4JIO A;  3B29 A;  1IFN A;  3U2M A;  1GL2 D;  1QL2 A;  1NOH A;  1Q7Y Q;  2WT7 A;  3H1K E;  3FWL A;  4IRU A;  1PGP A;  1FMW A;  2HFE D;  2YXQ B;  1SQV D;  1CSB A;  2HJM A;  4EOT A;  4ONS A;  2JX0 A;  2LK4 A;  4Y99 C;  1HVV A;  5KTB A;  3A7O A;  4RBN A;  3L74 E;  3CCJ P;  4CX9 A;  1L0L E;  3W4Y A;  3ABK C;  3T6J A;  3TYY A;  4WAB A;  4MND A;  3ZTM A;  3G3Z A;  1QVG O;  3GM2 A;  1J2J B;  3MGN A;  2QEX P;  3DE8 A;  3CWB G;  3RYL A;  1E85 A;  3IN6 A;  3JYH A;  2YKO A;  2FYU K;  1HTL C;  3O55 A;  1LE2 A;  2FYU G;  1KC8 Q;  3BRT B;  4PD4 D;  3UNG C;  1KN7 A;  3L72 D;  4WVZ A;  1Q0M A;  3DKA A;  3WG7 C;  2XDJ A;  3NXS A;  1N7S B;  1MFZ A;  2KZI A;  2JR8 A;  4L74 A;  4XPX A;  1BZ4 A;  1NFN A;  4BJT A;  3IR9 A;  4FAP B;  2X51 A;  4DRH B;  1J1E B;  3L70 J;  1E2X A;  5FZT A;  1K04 A;  4BJ1 A;  5CMZ A;  5BU8 B;  1OCO C;  1JOG A;  2N1T C;  3F47 A;  3QZC A;  4U9D A;  1SQB E;  3MBG A;  4DBR A;  1YVI A;  1SQX E;  1NTZ E;  5KLV G;  3L8J A;  5HV9 A;  3GW6 A;  5CBO A;  2PP4 A;  2MWQ A;  2J58 A;  2CNW A;  1KTM A;  1YHQ P;  1JRA A;  3CWB E;  4CIH A;  2AEM A;  2I15 A;  3P7K A;  2HOD A;  3H1H G;  1LTG C;  2Z15 A;  1TWC A;  2Y0E A;  1L7C A;  1ZW2 A;  1OZH A;  2N1T D;  1D0Y A;  4MVS A;  4CDY A;  2R44 A;  3H1L E;  1OVV A;  5K0I A;  1FAP B;  1LP1 A;  2J0W A;  2J59 M;  1S5L X;  3OAK A;  4CS8 A;  1ZLL A;  2GA1 A;  4G0H A;  3JC2 2;  3FX0 A;  2ZXX A;  1B68 A;  1MV8 A;  3B8E B;  3G4S P;  4ANJ A;  4O6N A;  2DYS C;  2M3E A;  1BCC E;  3O6X A;  3JCU E;  1CPR A;  4HYT B;  4W8P A;  4C7N A;  1YJN P;  3A0B E;  1Q82 Q;  4H4K C;  5A6A A;  3ZDL A;  3HE4 B;  1JMM A;  4IAO A;  3H65 A;  4Z9H A;  4ZLD A;  4NTB A;  2OYI A;  2OYO A;  3X2Q C;  1LP1 B;  4PJM A;  3KL4 A;  3MHV A;  3C18 A;  3D71 A;  1HW1 A;  1I5N A;  4U5E E;  1E5W A;  1FAV A;  3SWK A;  3V2R A;  1KV4 A;  5AW9 B;  1YTZ T;  2WWW A;  2WQY C;  2OTK E;  4JUR I;  4DRJ B;  2GM4 A;  4EUK B;  4AUW A;  4XPY A;  2FXP A;  4W80 A;  1VB5 A;  4JTA B;  4P9F A;  4YT2 A;  2EIJ C;  1WRG A;  4CJO A;  5IY5 C;  3M9Q A;  3QMK A;  1VF5 C;  3B5N A;  2OQM A;  1RKC A;  1RH5 B;  3QVZ A;  4QDL A;  1LVK A;  1JNM A;  3H2V A;  3CZ6 A;  5B1A C;  1HBW A;  1SQB D;  1OCR C;  3U9M A;  3AE2 C;  4KNW A;  2L9J A;  1L4A B;  3SXM A;  1NTZ G;  5KLV E;  5JUA A;  1XTG B;  3CC2 P;  2XXA B;  4WJ0 A;  1MZ9 A;  3EHM A;  1URQ C;  2KYV A;  5CI9 A;  3Q1M A;  2IXM A;  3V6I A;  2Z4E A;  3ASO C;  1Q86 Q;  2IX7 C;  2EPL X;  1LTI C;  4N3Y B;  5L0G A;  2M3B A;  1GZL A;  3IQC A;  4H13 D;  1EA8 A;  5L0J A;  3FAJ A;  4Z9J A;  3UMI A;  4HFK B;  2N1T A;  1G5Z A;  1FOS F;  1SQQ J;  3FVY A;  5KAI E;  1N73 C;  1JY3 P;  4I2L C;  1GQA A;  5M1B A;  2QJP C;  1JCC A;  1NVO A;  1TWG A;  3CX5 H;  2NG1 A;  4KBL A;  2A06 G;  3TQO A;  1YA9 A;  2WSC J;  4WY4 C;  2Q9I A;  2J9V A;  5L8R J;  1IJD B;  4LDR A;  1AUE A;  1BR2 A;  1HF9 A;  3TGU D;  3HRN A;  3VAY A;  3GWN A;  3GLM A;  2W27 A;  4XE5 B;  3D6Y A;  3IPM O;  4XLN F;  1YJG A;  3HKK A;  3CL3 D;  2BCC D;  3ZIB A;  1KB9 I;  2IM8 A;  1LTA C;  2R7X A;  2P2U A;  2YIU C;  1KQS O;  3H1K D;  4EKW A;  1AQ5 A;  3H1L J;  2BAS A;  2KK1 A;  3ZSU A;  3VF0 A;  2PP6 A;  2X0C A;  3FWN A;  3V5X A;  2YZS A;  2Q9B A;  3UGO A;  3KDP B;  3BCC G;  1H88 A;  1HH0 A;  3SNH A;  3SXZ A;  1OWA A;  1EQ7 A;  1V74 B;  2NUT A;  1AVY A;  1RE3 C;  2KS1 B;  2W6A A;  5APW A;  2ZYG A;  1PPJ E;  2L5G B;  2IFM A;  3TGU J;  2LCH A;  2H7H A;  3T4R A;  4U3F D;  2B89 A;  3SEO A;  2W8Z A;  5L0D A;  2KW3 C;  2YMK A;  3L75 G;  2J5U A;  1VTM P;  1VPC A;  3U8V A;  1SFC A;  1VQL P;  1MFT A;  1NG1 A;  1XWJ A;  2P1A A;  2L91 A;  4ZKU A;  4AE4 A;  3UMH A;  2WIT A;  1XZQ A;  2N9Y B;  3ZTZ A;  4LLC A;  2HPC A;  2Q5U A;  1Y9B A;  3L37 A;  3L71 D;  4NC3 A;  2P1J A;  4O79 A;  1C17 M;  2EIM C;  3C8G B;  5AVX B;  1S5L H;  1OVR A;  3D70 A;  1BR1 A;  1L4A D;  1AVO A;  2ZT9 D;  1LI7 A;  2XU6 A;  2AWY A;  4PV1 B;  2Y3B A;  5AW8 B;  3FXD A;  1LT9 C;  1GK6 A;  2ZT9 C;  2YL0 A;  1PZQ A;  2R7V A;  4IL6 H;  1SQV K;  4FX5 A;  1ZOY C;  3H1J E;  5AW6 B;  2BE5 F;  4R4M A;  1L0N K;  4UB6 H;  3A9C A;  1SQP E;  2R3S A;  4D6T D;  2RN0 A;  2WVQ A;  2A0B A;  3VP8 A;  2XLO A;  2AXT H;  3UGP A;  3CLQ A;  2A0U A;  4Q4Z F;  1N7L A;  5KAI H;  3EGD B;  4A4A A;  3H1I J;  4JTD B;  1NTM K;  5BQH A;  1VQ6 P;  1SQP K;  1A7V A;  1N2D C;  3C8G D;  1CPQ A;  3AE7 C;  3H1I G;  2OJE D;  5KYW B;  1ORY A;  4HH2 A;  3CEX A;  1USE A;  3RL0 D;  1Q0G A;  3MD0 A;  4CSA C;  3ZG1 A;  1S9K D;  5DQT A;  5AGF A;  2P58 A;  1S9K E;  3RW0 A;  1OW7 A;  4O9B A;  4IL6 X;  5KKZ C;  1WN0 A;  2M8R A;  1LI5 A;  3L72 G;  3RK2 D;  1OKK D;  1G2C B;  3G50 A;  3PP5 A;  5AW4 B;  2HPC B;  2P7V A;  5KKZ B;  3RL0 g;  4I6M C;  4ZLC A;  3WUV A;  3RBZ A;  2EIK C;  2OU6 A;  1TWA A;  4OD4 A;  3L74 G;  4HEA J;  1WOL A;  2O01 N;  4KHX A;  4BRY B;  1D1B A;  1RF0 C;  3ITK A;  1TQG A;  4NPF X;  1SZI A;  3LES A;  1T9K A;  3HD7 A;  1HUC A;  1K05 A;  4IL6 E;  2E75 D;  2XNX A;  3H6P A;  4I44 A;  1AQT A;  3O39 A;  3GAN A;  3SP1 A;  4ZNC A;  5AVV B;  4L73 A;  1FJP A;  3NMJ A;  3OA1 A;  2WZF A;  4OIQ F;  3RIP A;  3C63 A;  3H1H D;  1IC2 A;  1Y4C A;  4JYB A;  3GF3 A;  3E1R A;  4H44 C;  3TK0 A;  1AA0 A;  3CX5 I;  4PJN A;  4JCZ A;  2NPS C;  3JCU H;  1G8X A;  1NU1 G;  2F22 A;  2Q9A A;  4CS8 C;  5B3I A;  4XPW A;  3US6 A;  3S0X A;  3LNM B;  3EH1 A;  1QZX A;  5H2F H;  5JP7 A;  2K3R A;  1Z56 A;  4YL1 A;  2FYN C;  3CXH H;  4CDA A;  2L6F A;  4LLH A;  2B88 A;  2YNY A;  5AVW B;  1M90 Q;  3CC7 P;  2WMM A;  1HE1 A;  1PGQ A;  2V3C C;  1IFI A;  5CCG D;  3L70 E;  4ZMD A;  1KYO I;  1H6G A;  4YK5 A;  4FES A;  3OJA B;  1NFO A;  1EZV E;  1RJ9 A;  3UIA A;  1CGM E;  4GOE A;  1LTJ A;  5GPG B;  3R4Y A;  1YA7 O;  4CS9 C;  3ZQV A;  2R7O A;  2W90 A;  3U8P A;  2FYZ A;  1EDK A;  1UFB A;  5D91 A;  2DYR C;  4DJ9 A;  1ZRT D;  1TFK B;  3OWT A;  1ZW3 A;  4YT5 A;  2NUP A;  1P84 I;  3VRC A;  1OW6 A;  1FZB A;  1L3P A;  4I1L A;  4PD4 H;  1SQX K;  2AU5 A;  1IK7 A;  5CCH D;  1JY2 O;  4U5H A;  3M0A A;  5E79 H;  1BDD A;  3M4B A;  1RJ9 B;  1M7L A;  1KIL B;  2QJY C;  4U9E A;  4LDQ A;  2WVR A;  1MMA A;  1SFC B;  4EYY Q;  1I4Z A;  2AXT E;  1SQP D;  1OCZ C;  2IXN A;  4ULV A;  1PL5 A;  2GDC A;  1KFM A;  1V55 C;  3JRT A;  2M4E A;  2UUH A;  3RQE A;  2SPZ A;  2CPS A;  2NPS B;  5T3T A;  1LIH A;  4WY4 B;  4J7T A;  2AEJ A;  4XTK A;  2N9B A;  1ZP0 C;  1D0Z A;  3KZI E;  3GEI A;  1U57 A;  3R2P A;  1SQQ K;  2LD6 A;  4JEA A;  2JD3 A;  2Q7C A;  1VQ8 P;  2J0X A;  1KYO E;  2L6G A;  2J46 A;  3L71 E;  2JDI H;  5A6B D;  1CZQ A;  2YQY A;  1OIP A;  1OCC C;  5EK0 A;  1SFC D;  3ZQY A;  4LAC B;  1H89 A;  1M56 D;  4CS7 A;  1T6A A;  2KSF A;  4RKU J;  2WZG A;  4GEH A;  2IZ1 A;  3AE9 C;  1QX8 A;  4BJ5 A;  2ZVN B;  2EIN C;  2N1T B;  2QM7 A;  3H1K J;  1ZYR F;  1RF1 C;  4W8K A;  4NTF A;  5AW2 B;  2KZJ A;  3R7C A;  4R4L A;  3CCR P;  4K1O A;  2FFD C;  3RFY A;  1MNE A;  2C03 A;  1YIT P;  2CK3 H;  3CQZ A;  2Y3H A;  5BQG A;  3U3F A;  3VYW A;  1R8E A;  2Y3D A;  2KSJ A;  2QSI A;  1BGY E;  3EG9 B;  5AC4 A;  1DOW A;  3JSZ A;  2E87 A;  5KLV J;  2E74 B;  5DS6 A;  2H8P D;  3GWL A;  2G8Y A;  3H1L G;  1VYI A;  3E70 C;  1EZV I;  4OIP F;  1L0N J;  3MP7 B;  5TIS H;  1T01 A;  3EZH A;  5JLI A;  1N7S A;  3B71 A;  3K1I A;  1M1J B;  2Q1K A;  4NPD A;  3I5C A;  1RHZ B;  1BSH A;  3Q6N A;  4K35 A;  5CCH C;  4Z9I A;  3RVY A;  3PDM P;  4AX2 A;  4JKV A;  2K9J A;  1ZZP A;  2GFH A;  2LP4 A;  4LLE A;  2ZXW C;  1SP4 A;  1FS0 E;  5EFW B;  4NQF A;  3GOR A;  1LPE A;  2LFF A;  2YLI A;  1OMI A;  2V7Q H;  1RE3 A;  4JW1 A;  3RGU A;  2D5R B;  2HV7 A;  1R5S A;  4LER A;  2EPK X;  2OAR A;  4B86 A;  1ZV8 A;  5F28 E;  2LIG A;  3LEO A;  2IXP A;  4XEK A;  1Y6D A;  2XND H;  3JZ0 A;  2VH3 A;  1SQB J;  1M1J C;  3CX5 E;  1N1C A;  2XS8 A;  2FBW C;  2PGD A;  3JCU Q;  1BDC A;  1OFC X;  1SMY F;  3KHU A;  1VYK A;  3GEE A;  2OYH B;  5APX A;  1NU7 D;  3P8C E;  1JUN A;  4M3L A;  3VM6 A;  2H88 C;  3EPV A;  5B1B C;  1JB0 J;  3CWB D;  4KT0 J;  1M8O B;  1JMW A;  5KYY A;  3T6B A;  4GYT A;  2OG2 A;  3IQT A;  1HMD A;  2WSE H;  3AQB A;  1R4T A;  2FXO A;  1GGQ A;  2LSE A;  1M56 C;  4GT1 A;  4D6T G;  4I7Z B;  2LR2 A;  1P84 H;  3PCV A;  3OEO A;  4IFD K;  3NMD A;  1IO4 A;  1D7M A;  1DEE G;  3DD7 A;  5COF A;  1OW8 A;  1H7I A;  3HUS B;  3LS0 A;  1H9G A;  3L71 J;  2MKV A;  1NTK K;  2J8W A;  4UB6 E;  2R7U A;  3CCM P;  4GDO A;  4YT4 A;  4GQH A;  3V2Q A;  3S4R A;  1G1J A;  1NAY A;  4CSA A;  4DOJ A;  5CCG A;  2Y9Y A;  3S28 A;  3UMK A;  1NU1 J;  4PK4 A;  4PJJ A;  1T3U A;  1D0X A;  5GTH E;  2YL7 A;  5APQ A;  1NGM B;  3L74 D;  4QMA A;  4O6Y A;  4LDK A;  3L0I A;  1USD A;  2HZ8 A;  2L6H A;  3U3B A;  1Z63 A;  2KK7 A;  4XEV A;  3G9R A;  3TK1 A;  2R7Q A;  3RKO F;  1X9V A;  2HSQ A;  1G4U S;  3ABM C;  1LT1 A;  4Z1M H;  3WAQ A;  5L0I A;  1X8Y A;  2ZD9 A;  2P61 A;  2XL8 A;  1GW3 A;  2WSE J;  1P84 E;  1URQ B;  3WU2 H;  4HJG H;  4XFJ A;  3DZA A;  1F1M A;  3B0V C;  3A0H E;  3CC4 P;  2HKV A;  1JCD A;  1HGV A;  3N0T A;  1RCP A;  2P0N A;  2CNW D;  2WSF J;  2Z5I A;  1Q0D A;  3B0P A;  1FZG A;  2Y3G A;  2J9W A;  1FZC B;  4NPE A;  2BEZ F;  3B5N D;  1GL2 C;  3H32 B;  1M57 D;  1W5C E;  1QLE C;  3V4Q A;  2HLO A;  3OA7 A;  1DX7 A;  5APU A;  1VQM P;  1G1I A;  3EQ2 A;  2KNC A;  2FKW B;  4PV1 C;  3A5T A;  2E76 B;  3C7J A;  2NUT B;  2KUB A;  3HTK A;  4N06 A;  2OQQ A;  3V2P A;  2G3K A;  2KGO A;  1KYO D;  1FZA A;  4C3E A;  1EXJ A;  5DJT B;  3L1M A;  5A69 A;  1MUU A;  2WPV B;  4NTA A;  3AEF C;  4YXW H;  3DE9 A;  2QVA A;  3OW2 O;  1OR3 A;  1Z5Z A;  3O10 A;  2E5Y A;  1NTM D;  3AG2 C;  3IAO A;  3BAS A;  3GOD A;  2JJL A;  5APT A;  1KNY A;  1ST6 A;  1VLT A;  4N6J A;  2J7P A;  3AQC A;  3EFG A;  1ZVZ A;  2KOG A;  3WMM 0;  4JVS A;  2PX3 A;  3CX5 D;  1K8A Q;  2DW3 A;  4PR9 A;  1T5O A;  3O6Q A;  2OYI B;  5APV A;  2YO3 A;  1WGW A;  1NU1 K;  3FOP A;  1NTZ K;  3UR3 C;  3POV A;  2A45 G;  1NBB A;  3MTU E;  4C7R A;  2HMQ A;  4EBJ A;  1OVU A;  3U1A A;  1MMG A;  1NKN A;  3VMX A;  4ULW A;  4N6H A;  2XLV A;  1GW4 A;  2OYI C;  4BRY A;  4MVU A;  1AFO A;  3AOU A;  2P67 A;  2O1J A;  2Q6Q A;  3V5Y A;  2JO1 A;  1KOR A;  4C7O B;  1T6I A;  1YJW P;  3AGU A;  3IHU A;  3IQ5 A;  1URQ D;  4EBB A;  5GTI H;  1FNT c;  5AVY B;  5GTI E;  4BPM A;  2PX0 A;  3QW1 A;  1DEB A;  1J1D B;  2D2C B;  2XRH A;  5COG A;  2Y69 C;  3FXH A;  2W9Y A;  1KD1 Q;  3RF3 A;  4I1O B;  1PGO A;  2YVK A;  4G7H F;  1W2E A;  3E9V A;  5E3C A;  4C7N B;  1SQX J;  2M0B A;  1IFM A;  2R7W A;  5H2F E;  1GL2 A;  1R5L A;  1UG7 A;  1SQB G;  3K66 A;  5CI8 A;  1BE3 E;  3L73 G;  3BEH A;  1L0N D;  2Q3I A;  3NTN A;  1GS9 A;  3RQG A;  5B66 H;  3W8H A;  1PP9 G;  2WTY A;  4M63 A;  1KB9 H;  3L73 J;  3T9O A;  1VMA A;  1DD4 A;  4YT8 A;  1RF1 A;  1ZME C;  4YJW A;  2E42 A; 
#chains in the Genus database with same CATH homology
 1YQ4 C;  3AEB C;  1WTY A;  1VF5 D;  3AE3 C;  4PV1 C;  2E76 B;  3AEA C;  1K40 A;  1K04 A;  3T97 B;  1PIX A;  4PV1 D;  3GF3 A;  3JYY A;  3AE2 C;  2QIW A;  2OQQ A;  1JOG A;  1Y9B A;  4H13 C;  1KIL E;  3ABV C;  4H44 C;  4RKU J;  1DIP A;  3RQF A;  2ZT9 B;  2YWA A;  4I7Z B;  1EXJ A;  1V4A A;  3SFE C;  1QVX A;  3AE9 C;  3L8J A;  2WPV B;  4YXD C;  3C8G B;  1VL2 A;  3C8V A;  2E74 D;  3AEF C;  4H13 B;  2NZ2 A;  3EWK A;  1PV3 A;  4H44 B;  2D2C D;  4U7J A;  1KTM A;  2BEQ D;  2K9Y A;  4YTP C;  3D70 A;  2P10 A;  1YQ3 C;  3S9O A;  2ZT9 D;  3O10 A;  1FDI A;  3RK3 E;  1DD3 A;  4PV1 B;  3Q1M A;  2PBE A;  2ZT9 C;  2FYN C;  2QJK C;  1OW8 A;  3AE5 C;  3IAO A;  4EBK A;  3AEE C;  4R32 A;  1KNY A;  1KMI Z;  2L6F A;  1ZOY C;  2MKV A;  4R4M A;  1S1C X;  2E76 C;  3FGA D;  4H13 D;  4H44 D;  4R4L A;  3GM3 A;  4GDO A;  5KLI C;  3AE8 C;  2HSB A;  3C8G A;  1KQG B;  4OGQ B;  3AE6 C;  2JP3 A;  3D6Z A;  4XEF A;  1WMK A;  5M1B A;  3Q5S A;  2QJP C;  3U3F A;  3O6Q A;  1R8E A;  2QSI A;  1S5L X;  2E74 C;  1WWP A;  3C8G D;  2E74 B;  1AJY A;  2WSC J;  3AE7 C;  2G8Y A;  3R4Y A;  4H0L C;  4H0L B;  5L8R J;  4Y28 J;  3AJM A;  3GM1 A;  3H25 A;  1HF9 A;  4EBJ A;  1NGM B;  1UFB A;  1RQU A;  3Q5P A;  1ZRT E;  3GLM A;  3B71 A;  3D6Y A;  2G3A A;  3K7D A;  2L6H A;  1RQV A;  1FDO A;  1OW6 A;  1UIX A;  3LW5 J;  2E76 D;  4XEV A;  2V7Q J;  3G9R A;  3Q2Y A;  1ZZP A;  2Q00 A;  1IK7 A;  1KOR A;  2JO1 A;  2JX0 A;  2E75 C;  2LK4 A;  1OW7 A;  2D2C C;  3GF7 A;  2YIU C;  4IL6 X;  4OGQ D;  5KKZ C;  4NQF A;  1GMJ A;  3Q5R A;  1OMI A;  2KK1 A;  3U0C A;  4Z1M H;  1NYH A;  2QJY C;  3GM2 A;  2D2C B;  3TUL A;  3RL0 g;  1TU3 F;  2E75 B;  2WSE J;  3C18 A;  3D71 A;  5F28 E;  4I7Z C;  1MKM A;  3AEC C;  3IN6 A;  4XFJ A;  4XEK A;  1PL5 A;  3GMA A;  3AE4 C;  3JZ0 A;  2IDB A;  1WOL A;  3AEG C;  2WQY C;  2FBW C;  3SFD C;  2JPU A;  1KQF B;  3RQE A;  2WSF J;  3AED C;  4TT3 H;  2L6G A;  1O3U A;  3Q3D A;  1EXI A;  1K05 A;  3L8I A;  1ZP0 C;  2E75 D;  3BRJ A;  2H88 C;  2FXP A;  3RQG A;  3MFN A;  4OGQ C;  1VF5 B;  2H89 C;  1U57 A;  2O01 J;  3AE1 C;  1JB0 J;  1HJ0 A;  2YMK A;  2BEZ F;  4KT0 J;  2J5U A;  4H0L D;  1ZME C;  1Q90 D;  1DD4 A;  1VF5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...