4YK5A

Crystal structures of mpges-1 inhibitor complexes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
146
structure length
146
Chain Sequence
b'VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Crystal Structures of mPGES-1 Inhibitor Complexes Form a Basis for the Rational Design of Potent Analgesic and Anti-Inflammatory Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 64
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4yk5A00
4NTFA 3DWWA 4JRZA 4YK5A 4YL1A 5BQIA 3PCVA 3LEOA 5K0IA 3HKKA 5HV9A 4YL0A 4AL0A 4NTBA 4NTAA 4YL3A 2Q7RA 5BQHA 4BPMA 4J7YA 2UUIA 4JCZA 4J7TA 2UUHA 4JC7A 4AL1A 2PNOA 3B29A 5BQGA 2H8AA 4WABA
chains in the Genus database with same CATH superfamily
2BL2A 3HTKC 5DS4A 2G3KA 4JW1A 4OIQF 2EPNA 3WAQA 4G0HA 3RQGA 1CGNA 1A41A 2J9VA 3ITFA 5GPGB 2P0NA 3WODF 1WASA 2R7RA 2G3VA 2DYSC 2OEXA 3AGTA 1SMYF 4K7BA 1J8MF 2LSEA 4KNWA 2J45A 4EBBA 4OIRF 5JRAA 3N24A 3VF0A 2HFIA 1PD1A 3T9OA 1XZQA 5L0DA 1VLTA 3MLGA 4I1MA 1VLSA 2WL8A 5D91A 5BQHA 2JD3A 4YT5A 4LLCA 4YWQA 2ZXRA 1ORJA 5DVWA 2J9BA 4IRUA 2W9YA 3M4CA 3UMHA 4CS8A 4Z9IA 3BEHA 3HJCA 1PV3A 4DOZA 3GM3A 5CIVA 1CPQA 2R7XA 3U3FA 4JRZA 2GWWA 3US6A 1JAFA 2B0HA 1OW8A 2Y3HA 1ORSC 4LDRA 3FOOA 4LERA 1KNYA 1ZYRF 2WB7A 3I5PA 1WOLA 3KH2A 2IYLD 5KYYB 2R03A 4B6IA 1FNTc 2L81A 4MQ9F 4IGGA 2HV6A 2J0WA 2FFHA 2HV7A 2M4EA 1T6QA 2XL4A 3HNLA 4GEHA 4KBLA 2NUPB 3UGOA 3GODA 1NG1A 4AE4A 4DVZA 4DBQA 4AL0A 1ZHZA 1TQGA 1W2WA 4JIOA 2IXNA 3C18A 3U3BA 1TWGA 4E7ZA 2R9RB 3DM5A 1JOGA 4IAQA 3O39A 4JCZA 3VYWA 5E2QA 1WN0A 4IWBA 3I4UA 4LDQA 5TJ5E 4JKVA 4X0RA 3V5YA 3B29A 1A7VA 3F47A 3KMIA 1Q0DA 3M1CB 3NRHA 3RVYA 4LLEA 3G4XA 4D4NA 1NFOA 4XQ1A 5JSLA 2CYDA 3MYFA 3FDQA 2XS1A 3C63A 3JYYA 1DOVA 1FMWA 2CGEA 3EGXA 1M2VB 1WWPA 2WZLA 3QVZA 3O6XA 1FTSA 1U0BB 4C7OA 1F1MA 1OCZC 4HFKB 1Z3IX 4AX2A 3SXKA 4U5FE 2WZGA 3WG7C 4OD5A 2YWAA 1M2VA 4JCHA 4BG0A 4BJ1A 2EILC 5F28E 2MWQA 2L7AA 2AWYA 2OEVA 3GM1A 4YL0A 3AOUA 5JS5A 4NTBA 3FXHA 3FMSA 4JEBA 2IXPA 4N4WA 5A6KA 2XLHA 3JYHA 1D0ZA 4I44A 3RVZA 4DJ9A 1Z5ZA 2YEVA 4XLPF 1RXQA 2Q9BA 2Q3TA 1WGWA 2UUHA 3EHNA 1OCOC 3SP1A 4MTOA 3T6BA 1JPNA 4C3DA 1K40A 4OD4A 3SXMA 1R5ID 1UFBA 2Q9CA 4BJ5A 2H8AA 2XL6A 1Y6DA 2YZSA 1C17M 1RCPA 3H2UA 3H65A 4JJGA 5E3CA 3SYNA 3U0CA 4EHPA 3IHUA 1M2OA 3O55A 1VK5A 2NSFA 1WATA 4FAPB 1TKNA 2WVOA 1NFNA 4J30B 2R25A 1S7ZA 3TULA 1NBBA 3GWLA 3DXJF 1LVKA 1QLEC 3U8PA 1FMVA 4PJMA 1RKCA 1TWCA 2X0CA 3TK0A 5KYNA 1BR2A 3UMIA 1VYKA 4EBJA 1BR4A 5T3WA 1WTYA 2A6HF 3ABLC 3HNIA 4NTAA 4U5CE 2HJMA 1NU9C 5JP7A 1ZU5A 4HE8D 2OJQA 3G50A 4BEJA 1HMOA 3TOMA 5A6AA 5JT4A 1I5NA 2VCBA 2XRHA 4A2NB 1CGME 4AL1A 3IQ6A 2W45A 2C04A 3FVYA 2P7VA 2HSBA 4XEFA 1OCCC 3VRCA 3NKEA 1HW2A 4RD9A 3X1OA 3M79A 3K6BA 5L0FA 1Z6AA 3M15A 2NUTB 4CX9A 3JTLO 1A7EA 2Y69C 3EG9B 3KYJA 4N6HA 4ULWA 1C02A 3LAYA 3RIPA 1G4WR 2YL1A 1GQAA 1LE4A 3EGDB 2R7SA 3ASOC 2ICWG 4Q5SF 2LP4A 1FAPB 1ZHTA 2M64A 1H6GA 3GEIA 1YA7O 3EG9A 2ASRA 3V5XA 3WHNA 3L8IA 1ZVZA 1GS9A 4XPWA 4DRIB 1KU2A 4YT8A 2XXAB 4OIPF 4BJ6A 5HV9A 1Z63A 2AVKA 1O5HA 4GQHA 1RJ9B 4IARA 4NCQA 5COMA 5A69A 3C62A 1R4TA 3JRTA 3DAGA 4H4KC 3ZQVA 3W8IA 1A0BA 2ZXWC 2AU5A 3JSZA 3IEEA 2HKVA 4KC9A 3SXZA 5BUOA 3MFNA 2B0JA 2CDQA 2XL8A 3KYIA 5BQGA 1FFHA 1BR1A 3C8ZA 4MVUA 2OQMA 2NSGA 1ST6A 3N2ZB 2V3CC 1TFKB 1TFOB 2C03A 2RD9A 5F5HA 5COGA 1GM5A 4ANJA 1MMGA 4NQFA 1LI5A 1YA9A 2KSFA 3K1IA 4CDYA 1OR2A 2Y3BA 1ZU4A 2KQ9A 3L34A 4PFPA 2LCHA 4K0DA 1EQ1A 2A1DD 2Q00A 4PFOA 2VCCA 3SZRA 3QMKA 3J06A 1M56C 4FWVA 4IAOA 1G4US 4W8PA 4BPMA 2LQGA 2DB4A 5DLJA 4XEVA 4UDVA 3LUTB 3AGUA 1JMWA 3I5QA 3UGPA 2Z15A 4U9EA 3LJBA 4CIPA 4DRHB 1I4ZA 1OKKD 2GFHA 3HKKA 3O10A 4CJOA 2XLDA 1C03A 5A6JA 1JR8A 1PD0A 3ABKC 1LKXA 2OKUA 3NG1A 4ZLDA 4YT2A 1EA8A 4QI0A 4JTAB 4HEAJ 4BJ5C 4FX5A 1SR2A 2OU6A 1LIHA 1V74B 4U5BE 4PACA 2XM0A 2J7PD 3B71A 5KYUA 2J9UA 4KNVA 2P1AA 1VB5A 2XS8A 3MX3A 4I1OB 4PJNA 3SNHA 2ETSA 2Y39A 2QUPA 3IPMO 3U9MA 5KYYA 3S90A 2PX0A 2XLMA 2HUJA 5IY5C 4JTCB 4J7YA 1DOWA 2NUPA 3PMRA 1YJGA 3F46A 3GANA 3NMKA 3GWNA 3LESA 4NY3A 1Z7Qc 3ZTZA 1EI7A 3ZWIA 1GGQA 4CSAA 3H2VA 1OCRC 4IJJA 2J46A 2XLVA 1T5OA 5AC5A 2H7VC 2WVNA 3AG3C 4G78A 4CBEA 5L3QA 3AG4C 3FOPA 4PR9A 4YL1A 1AEPA 3FHDA 3K7DA 3B0PA 3PDMP 1G5ZA 4EKWA 3OEOA 4XPYA 5L0HA 4RBNA 1MNEA 1MMNA 3GORA 3V5ZA 2YRFA 4HFFB 4EIYA 2IOQA 4M63A 1D0YA 2A6EF 4BEMJ 4XWJA 1T9KA 1ZW2A 1VMAA 1ZHXA 3E70C 3ZG1A 5KYWB 3JSEO 1FFTC 4JZAA 3W4YA 2MYSA 4I3MA 4BJ6C 1QPUA 3ECSA 3NDBB 3MBGA 1YAUO 4WABA 3JRMO 1HE9A 4XPXA 2HJ3A 3IQTA 1L7CA 1MMDA 2H7OA 2QTVA 2VB6A 1SYQA 2HZ8A 4Q7CA 2XLWA 1T6UA 3EHMA 1VOMA 5B3SC 5L0JA 2IBFA 3DM9B 5T1DB 3AG1C 3K66A 1QKRA 4JE9A 4CJGA 1Q0KA 4F4BA 3A11A 1CGOA 2CCYA 4EUKB 3Q6MA 3W2WA 3S84A 4KI2A 3L0IA 4OIOF 1D1BA 1SZIA 1D1AA 1Q0MA 2GA0A 1APCA 2NPUA 2UUIA 1NLXA 3TJ6A 1TWHA 2AP3A 4Q4ZF 1Q0GA 1D0XA 1OKKA 4MVOA 2LIGA 3ASNC 5D92A 5EK0A 2BE5F 4DRJB 3JCUQ 3X2QC 2H7BA 3DAFA 2A69F 4WGZA 4NC3A 3POVA 2Q9AA 1Z23A 2QLAA 2WZFA 3DZAA 1YZAA 3E9VA 3GM2A 4P9TA 5B1AC 3S27A 3NMJA 3PCVA 3EFOB 1ORYA 3N0TA 4MNDA 4OINF 3CZ6A 3HNKA 1B68A 1I4YA 2CW0F 3NYLA 2J7PA 4JVSA 4U5EE 2NUTA 4CS8C 5EHHA 2D4UA 3R2PA 3T4RA 1H9GA 2EIJC 2KNHA 1VYIA 2YKZA 2NG1A 2HMZA 3FAPB 3DMDA 1AUEA 3EGDA 2W4MA 3DI5A 3OWTA 4DBRA 2YL3A 3Q7LA 1U89A 2R7OA 5A6BA 1YZCA 2PBEA 1U6HA 3AQCA 4J7TA 1SF8A 1AVOB 3HLZA 2ZD9A 2FGYA 4JC7A 4ULVA 2PNOA 1TWAA 4XTKA 3UNGC 1E2XA 2YL0A 3L1MA 3AJMA 4AK9A 1RJ9A 3NYJA 3U5SA 1HY5A 1NU7D 1ZHYA 2O9XA 4E0HA 5L0CA 1RMVA 2EIMC 3T6JA 2R7TA 4Z9JA 5E33A 1OW7A 2HMQA 3CEXA 5DQTA 1H9TA 2RSEB 5AC4A 2EPMX 2XSEA 5B1BC 2XLOA 4C3BA 3FAJA 3ZTMA 4WGYA 2AWCA 1O87A 3LS0A 3DJUB 2ZXOA 1S05A 2EPOA 5K0IA 1OQCA 1LE2A 1M6TA 2F22A 4FESA 2I15A 3GEEA 2R7WA 2A0BA 4O7GA 2Q7RA 1E86A 1L3PA 1YLMA 2CNWD 3BRJA 5KYXB 3S0XA 1FR0A 3EJNA 1V54C 2JPUA 2KW3C 5AGFA 3TOLA 4N6CA 3JT1A 4EWCA 3ATPA 2YVKA 3SEOA 3U8VA 1E83A 3CQZA 4XEKA 3RYLA 3TQOA 1O3UA 2YLDA 5KYXA 1G8XA 2VC9A 3LEVA 2I8BA 3DWWA 4YK5A 2ZXPA 3Q7GA 5B3IA 5CI9A 4MVRA 2GAQA 1K04A 2KGOA 2W4BA 4MVSA 5FCLA 5CI8A 5T3TA 1V55C 2V26A 1K05A 2YQYA 3KPHA 4IB4A 3RW0A 3ZIBA 1EKYA 2P61A 1HW1A 1LPEA 2J8WA 3U9JA 1D1CA 2OOCA 3IQCA 3M4BA 2LFFA 2FAPB 2KK1A 4YL3A 4D4XA 4DVYP 2WVQA 5JLIA 5FZTA 3L8JA 3CSKA 2ZPAA 4G7ZF 3MYIA 3KKBA 1LI7A 3CAXA 4WJ0A 1T01A 3LNRA 2A0UA 5JVEA 2OJED 5DS6A 1QZXA 4MTGA 4NTFA 2R7VA 3QTHA 3RQFA 3GEHA 2R7QA 2EINC 3EH2A 4AE4B 4DXWA 4RDAA 3B0UX 1HE1A 4BJTA 1N1CA 2YLIA 2J0XA 3EPVA 3JZ0A 3NMIA 3R7CA 3B0VC 4G7OF 3A9CA 3UMKA 3S28A 3DE9A 4CS9A 2KC3A 3UR3C 5F5FA 1ZW3A 3TD7A 5DQZA 4YJWA 4XLNF 4CDAA 4Z9HA 3EGXB 2P6VA 2Y3GA 1YYXA 3ZVRA 3EZHA 3C8GD 1QVXA 1QQ3A 1V4AA 1BBHA 2GDCA 2YLGA 2VCAA 3LLIA 4C7OB 1H7IA 3LLKA 4MTFA 4O6MA 2OCCC 3AG2C 4QDLA 1J8YF 2LD6A 3V7OA 5KYWA 4H54A 1ZHWA 4ZLCA 4R32A 2D5RB 3NYMA 3QW1A 4YN0B 5BQIA 4MVZA 2DYRC 1NSGB 5EGYA 2VASA 1ZZPA 4U5GA 4G7HF 3IQ5A 2EIKC 2LK4A 4JEAA 4E17A 1E85A 2PFDA 1Q0FA 2J9WA 2OG2A 2DGJA 4GYTA 2LFDA 1T6IA 2CNWA 2MHRA 2L9JA 1YYJA 1JRAA 2L6GA 3EH1A 5E3AA 3RH3A 4K1OA 3QVYA 2IXOA 3K1IC 3LS1A 1UG7A 4N06A 4C3EA 1JPJA 1M57C 1E84A 3W2VA 4CS7A 4A4AA 4PK4A 4MVMA 3OA1A 3QZCA 2PF4E 2KYHA 3DKAA 2QY9A 3DJNB 1Y4CA 3K1HA 1HMDA 4L6RA 3U2MA 3ZQYA 4LACB 3S29A 4E18A 2TMVP 2X51A 2JX0A 4JTDB 4ONSA 4LDKA 3S9OA 2G62A 3ZDLA 3ZSUA 1IW7F 2R7UA 3RKOF 2XXAA 4P6IC 4ER9A 1NZEA 5DS5A 4JJFA 4O6NA 4JURI 1YVIA 1BZ4A 1OXKA 2L6HA 3ABMC 1OW6A 2EPLX 2IM8A 4MW3A 4U9DA 3SXYA 3DE8A 5A6BD 5L0IA 2A68F 1OXBA 1BDJB 3EFOA 1LS1A 2YHSA 3EZIA 256BA 1VTMP 1KTMA 5KYUB 4E0IA 3AQBA 4MS2A 1OR3A 2PX3A 4O6YA 1MNDA 1TR2A 4J32B 2VH3A 1QSPA 1LS4A 3T6GB 2KJGA 3QW0A 2L6FA 3HNJA 3KL4A 4U5HA 2EPKX 4MVQA 4W8KA 3VM6A 5HSWA 2HS5A 3NKDA 2QNLA 3LNMB 2R02A 4MW8A 4PJLA 3ZC4A 3K33A 4E7SA 3TJ5A 4EBKA 4U5DE 1IZMA 4CIHA 4CSAC 3PHF2 3LEOA 1YARO 2QE9A 2PP4A 2IXMA 5L3VA 2Q4FA 4P9FA 2E87A 3C7JA 2Y3DA 3C8GB 2R05A 3EQLF 1MQVA 1XWJA 1RKEB 3B9QA 1PCXA 3U2LA 2BC5A 3G4ZA 1CPRA 1LM3B 4CDVA 2XM4A 1A7DA 3RF3A 2HSQA 4O79A 2XLEA 2YL7A 4CS9C 3C8GA 3Q6NA 5COFA 3W8HA 4YT4A 4QI2A 3VAYA 1MMAA 1RKEA 5L0GA 3RQEA 1XZPA 1YDIA 3RFYA 2DI3A 4PJJA 3DD7A 5JUAA
chains in the Genus database with same CATH topology
4NTFA 3DWWA 4JRZA 4YK5A 4YL1A 5BQIA 3PCVA 3LEOA 5K0IA 3HKKA 5HV9A 4YL0A 4AL0A 4NTBA 4NTAA 4YL3A 2Q7RA 5BQHA 4BPMA 4J7YA 2UUIA 4JCZA 4J7TA 2UUHA 4JC7A 4AL1A 2PNOA 3B29A 5BQGA 2H8AA 4WABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTF A;  3DWW A;  4JRZ A;  4YK5 A;  4YL1 A;  5BQI A;  3PCV A;  3LEO A;  5K0I A;  3HKK A;  5HV9 A;  4YL0 A;  4AL0 A;  4NTB A;  4NTA A;  4YL3 A;  2Q7R A;  5BQH A;  4BPM A;  4J7Y A;  2UUI A;  4JCZ A;  4J7T A;  2UUH A;  4JC7 A;  4AL1 A;  2PNO A;  3B29 A;  5BQG A;  2H8A A;  4WAB A; 
#chains in the Genus database with same CATH topology
 2BL2 A;  3HTK C;  5DS4 A;  2G3K A;  4JW1 A;  4OIQ F;  2EPN A;  3WAQ A;  4G0H A;  3RQG A;  1CGN A;  1A41 A;  2J9V A;  3ITF A;  5GPG B;  2P0N A;  3WOD F;  1WAS A;  2R7R A;  2G3V A;  2DYS C;  2OEX A;  3AGT A;  1SMY F;  4K7B A;  1J8M F;  2LSE A;  4KNW A;  2J45 A;  4EBB A;  4OIR F;  5JRA A;  3N24 A;  3VF0 A;  2HFI A;  1PD1 A;  3T9O A;  1XZQ A;  5L0D A;  1VLT A;  3MLG A;  4I1M A;  1VLS A;  2WL8 A;  5D91 A;  5BQH A;  2JD3 A;  4YT5 A;  4LLC A;  4YWQ A;  2ZXR A;  1ORJ A;  5DVW A;  2J9B A;  4IRU A;  2W9Y A;  3M4C A;  3UMH A;  4CS8 A;  4Z9I A;  3BEH A;  3HJC A;  1PV3 A;  4DOZ A;  3GM3 A;  5CIV A;  1CPQ A;  2R7X A;  3U3F A;  4JRZ A;  2GWW A;  3US6 A;  1JAF A;  2B0H A;  1OW8 A;  2Y3H A;  1ORS C;  4LDR A;  3FOO A;  4LER A;  1KNY A;  1ZYR F;  2WB7 A;  3I5P A;  1WOL A;  3KH2 A;  2IYL D;  5KYY B;  2R03 A;  4B6I A;  1FNT c;  2L81 A;  4MQ9 F;  4IGG A;  2HV6 A;  2J0W A;  2FFH A;  2HV7 A;  2M4E A;  1T6Q A;  2XL4 A;  3HNL A;  4GEH A;  4KBL A;  2NUP B;  3UGO A;  3GOD A;  1NG1 A;  4AE4 A;  4DVZ A;  4DBQ A;  4AL0 A;  1ZHZ A;  1TQG A;  1W2W A;  4JIO A;  2IXN A;  3C18 A;  3U3B A;  1TWG A;  4E7Z A;  2R9R B;  3DM5 A;  1JOG A;  4IAQ A;  3O39 A;  4JCZ A;  3VYW A;  5E2Q A;  1WN0 A;  4IWB A;  3I4U A;  4LDQ A;  5TJ5 E;  4JKV A;  4X0R A;  3V5Y A;  3B29 A;  1A7V A;  3F47 A;  3KMI A;  1Q0D A;  3M1C B;  3NRH A;  3RVY A;  4LLE A;  3G4X A;  4D4N A;  1NFO A;  4XQ1 A;  5JSL A;  2CYD A;  3MYF A;  3FDQ A;  2XS1 A;  3C63 A;  3JYY A;  1DOV A;  1FMW A;  2CGE A;  3EGX A;  1M2V B;  1WWP A;  2WZL A;  3QVZ A;  3O6X A;  1FTS A;  1U0B B;  4C7O A;  1F1M A;  1OCZ C;  4HFK B;  1Z3I X;  4AX2 A;  3SXK A;  4U5F E;  2WZG A;  3WG7 C;  4OD5 A;  2YWA A;  1M2V A;  4JCH A;  4BG0 A;  4BJ1 A;  2EIL C;  5F28 E;  2MWQ A;  2L7A A;  2AWY A;  2OEV A;  3GM1 A;  4YL0 A;  3AOU A;  5JS5 A;  4NTB A;  3FXH A;  3FMS A;  4JEB A;  2IXP A;  4N4W A;  5A6K A;  2XLH A;  3JYH A;  1D0Z A;  4I44 A;  3RVZ A;  4DJ9 A;  1Z5Z A;  2YEV A;  4XLP F;  1RXQ A;  2Q9B A;  2Q3T A;  1WGW A;  2UUH A;  3EHN A;  1OCO C;  3SP1 A;  4MTO A;  3T6B A;  1JPN A;  4C3D A;  1K40 A;  4OD4 A;  3SXM A;  1R5I D;  1UFB A;  2Q9C A;  4BJ5 A;  2H8A A;  2XL6 A;  1Y6D A;  2YZS A;  1C17 M;  1RCP A;  3H2U A;  3H65 A;  4JJG A;  5E3C A;  3SYN A;  3U0C A;  4EHP A;  3IHU A;  1M2O A;  3O55 A;  1VK5 A;  2NSF A;  1WAT A;  4FAP B;  1TKN A;  2WVO A;  1NFN A;  4J30 B;  2R25 A;  1S7Z A;  3TUL A;  1NBB A;  3GWL A;  3DXJ F;  1LVK A;  1QLE C;  3U8P A;  1FMV A;  4PJM A;  1RKC A;  1TWC A;  2X0C A;  3TK0 A;  5KYN A;  1BR2 A;  3UMI A;  1VYK A;  4EBJ A;  1BR4 A;  5T3W A;  1WTY A;  2A6H F;  3ABL C;  3HNI A;  4NTA A;  4U5C E;  2HJM A;  1NU9 C;  5JP7 A;  1ZU5 A;  4HE8 D;  2OJQ A;  3G50 A;  4BEJ A;  1HMO A;  3TOM A;  5A6A A;  5JT4 A;  1I5N A;  2VCB A;  2XRH A;  4A2N B;  1CGM E;  4AL1 A;  3IQ6 A;  2W45 A;  2C04 A;  3FVY A;  2P7V A;  2HSB A;  4XEF A;  1OCC C;  3VRC A;  3NKE A;  1HW2 A;  4RD9 A;  3X1O A;  3M79 A;  3K6B A;  5L0F A;  1Z6A A;  3M15 A;  2NUT B;  4CX9 A;  3JTL O;  1A7E A;  2Y69 C;  3EG9 B;  3KYJ A;  4N6H A;  4ULW A;  1C02 A;  3LAY A;  3RIP A;  1G4W R;  2YL1 A;  1GQA A;  1LE4 A;  3EGD B;  2R7S A;  3ASO C;  2ICW G;  4Q5S F;  2LP4 A;  1FAP B;  1ZHT A;  2M64 A;  1H6G A;  3GEI A;  1YA7 O;  3EG9 A;  2ASR A;  3V5X A;  3WHN A;  3L8I A;  1ZVZ A;  1GS9 A;  4XPW A;  4DRI B;  1KU2 A;  4YT8 A;  2XXA B;  4OIP F;  4BJ6 A;  5HV9 A;  1Z63 A;  2AVK A;  1O5H A;  4GQH A;  1RJ9 B;  4IAR A;  4NCQ A;  5COM A;  5A69 A;  3C62 A;  1R4T A;  3JRT A;  3DAG A;  4H4K C;  3ZQV A;  3W8I A;  1A0B A;  2ZXW C;  2AU5 A;  3JSZ A;  3IEE A;  2HKV A;  4KC9 A;  3SXZ A;  5BUO A;  3MFN A;  2B0J A;  2CDQ A;  2XL8 A;  3KYI A;  5BQG A;  1FFH A;  1BR1 A;  3C8Z A;  4MVU A;  2OQM A;  2NSG A;  1ST6 A;  3N2Z B;  2V3C C;  1TFK B;  1TFO B;  2C03 A;  2RD9 A;  5F5H A;  5COG A;  1GM5 A;  4ANJ A;  1MMG A;  4NQF A;  1LI5 A;  1YA9 A;  2KSF A;  3K1I A;  4CDY A;  1OR2 A;  2Y3B A;  1ZU4 A;  2KQ9 A;  3L34 A;  4PFP A;  2LCH A;  4K0D A;  1EQ1 A;  2A1D D;  2Q00 A;  4PFO A;  2VCC A;  3SZR A;  3QMK A;  3J06 A;  1M56 C;  4FWV A;  4IAO A;  1G4U S;  4W8P A;  4BPM A;  2LQG A;  2DB4 A;  5DLJ A;  4XEV A;  4UDV A;  3LUT B;  3AGU A;  1JMW A;  3I5Q A;  3UGP A;  2Z15 A;  4U9E A;  3LJB A;  4CIP A;  4DRH B;  1I4Z A;  1OKK D;  2GFH A;  3HKK A;  3O10 A;  4CJO A;  2XLD A;  1C03 A;  5A6J A;  1JR8 A;  1PD0 A;  3ABK C;  1LKX A;  2OKU A;  3NG1 A;  4ZLD A;  4YT2 A;  1EA8 A;  4QI0 A;  4JTA B;  4HEA J;  4BJ5 C;  4FX5 A;  1SR2 A;  2OU6 A;  1LIH A;  1V74 B;  4U5B E;  4PAC A;  2XM0 A;  2J7P D;  3B71 A;  5KYU A;  2J9U A;  4KNV A;  2P1A A;  1VB5 A;  2XS8 A;  3MX3 A;  4I1O B;  4PJN A;  3SNH A;  2ETS A;  2Y39 A;  2QUP A;  3IPM O;  3U9M A;  5KYY A;  3S90 A;  2PX0 A;  2XLM A;  2HUJ A;  5IY5 C;  4JTC B;  4J7Y A;  1DOW A;  2NUP A;  3PMR A;  1YJG A;  3F46 A;  3GAN A;  3NMK A;  3GWN A;  3LES A;  4NY3 A;  1Z7Q c;  3ZTZ A;  1EI7 A;  3ZWI A;  1GGQ A;  4CSA A;  3H2V A;  1OCR C;  4IJJ A;  2J46 A;  2XLV A;  1T5O A;  5AC5 A;  2H7V C;  2WVN A;  3AG3 C;  4G78 A;  4CBE A;  5L3Q A;  3AG4 C;  3FOP A;  4PR9 A;  4YL1 A;  1AEP A;  3FHD A;  3K7D A;  3B0P A;  3PDM P;  1G5Z A;  4EKW A;  3OEO A;  4XPY A;  5L0H A;  4RBN A;  1MNE A;  1MMN A;  3GOR A;  3V5Z A;  2YRF A;  4HFF B;  4EIY A;  2IOQ A;  4M63 A;  1D0Y A;  2A6E F;  4BEM J;  4XWJ A;  1T9K A;  1ZW2 A;  1VMA A;  1ZHX A;  3E70 C;  3ZG1 A;  5KYW B;  3JSE O;  1FFT C;  4JZA A;  3W4Y A;  2MYS A;  4I3M A;  4BJ6 C;  1QPU A;  3ECS A;  3NDB B;  3MBG A;  1YAU O;  4WAB A;  3JRM O;  1HE9 A;  4XPX A;  2HJ3 A;  3IQT A;  1L7C A;  1MMD A;  2H7O A;  2QTV A;  2VB6 A;  1SYQ A;  2HZ8 A;  4Q7C A;  2XLW A;  1T6U A;  3EHM A;  1VOM A;  5B3S C;  5L0J A;  2IBF A;  3DM9 B;  5T1D B;  3AG1 C;  3K66 A;  1QKR A;  4JE9 A;  4CJG A;  1Q0K A;  4F4B A;  3A11 A;  1CGO A;  2CCY A;  4EUK B;  3Q6M A;  3W2W A;  3S84 A;  4KI2 A;  3L0I A;  4OIO F;  1D1B A;  1SZI A;  1D1A A;  1Q0M A;  2GA0 A;  1APC A;  2NPU A;  2UUI A;  1NLX A;  3TJ6 A;  1TWH A;  2AP3 A;  4Q4Z F;  1Q0G A;  1D0X A;  1OKK A;  4MVO A;  2LIG A;  3ASN C;  5D92 A;  5EK0 A;  2BE5 F;  4DRJ B;  3JCU Q;  3X2Q C;  2H7B A;  3DAF A;  2A69 F;  4WGZ A;  4NC3 A;  3POV A;  2Q9A A;  1Z23 A;  2QLA A;  2WZF A;  3DZA A;  1YZA A;  3E9V A;  3GM2 A;  4P9T A;  5B1A C;  3S27 A;  3NMJ A;  3PCV A;  3EFO B;  1ORY A;  3N0T A;  4MND A;  4OIN F;  3CZ6 A;  3HNK A;  1B68 A;  1I4Y A;  2CW0 F;  3NYL A;  2J7P A;  4JVS A;  4U5E E;  2NUT A;  4CS8 C;  5EHH A;  2D4U A;  3R2P A;  3T4R A;  1H9G A;  2EIJ C;  2KNH A;  1VYI A;  2YKZ A;  2NG1 A;  2HMZ A;  3FAP B;  3DMD A;  1AUE A;  3EGD A;  2W4M A;  3DI5 A;  3OWT A;  4DBR A;  2YL3 A;  3Q7L A;  1U89 A;  2R7O A;  5A6B A;  1YZC A;  2PBE A;  1U6H A;  3AQC A;  4J7T A;  1SF8 A;  1AVO B;  3HLZ A;  2ZD9 A;  2FGY A;  4JC7 A;  4ULV A;  2PNO A;  1TWA A;  4XTK A;  3UNG C;  1E2X A;  2YL0 A;  3L1M A;  3AJM A;  4AK9 A;  1RJ9 A;  3NYJ A;  3U5S A;  1HY5 A;  1NU7 D;  1ZHY A;  2O9X A;  4E0H A;  5L0C A;  1RMV A;  2EIM C;  3T6J A;  2R7T A;  4Z9J A;  5E33 A;  1OW7 A;  2HMQ A;  3CEX A;  5DQT A;  1H9T A;  2RSE B;  5AC4 A;  2EPM X;  2XSE A;  5B1B C;  2XLO A;  4C3B A;  3FAJ A;  3ZTM A;  4WGY A;  2AWC A;  1O87 A;  3LS0 A;  3DJU B;  2ZXO A;  1S05 A;  2EPO A;  5K0I A;  1OQC A;  1LE2 A;  1M6T A;  2F22 A;  4FES A;  2I15 A;  3GEE A;  2R7W A;  2A0B A;  4O7G A;  2Q7R A;  1E86 A;  1L3P A;  1YLM A;  2CNW D;  3BRJ A;  5KYX B;  3S0X A;  1FR0 A;  3EJN A;  1V54 C;  2JPU A;  2KW3 C;  5AGF A;  3TOL A;  4N6C A;  3JT1 A;  4EWC A;  3ATP A;  2YVK A;  3SEO A;  3U8V A;  1E83 A;  3CQZ A;  4XEK A;  3RYL A;  3TQO A;  1O3U A;  2YLD A;  5KYX A;  1G8X A;  2VC9 A;  3LEV A;  2I8B A;  3DWW A;  4YK5 A;  2ZXP A;  3Q7G A;  5B3I A;  5CI9 A;  4MVR A;  2GAQ A;  1K04 A;  2KGO A;  2W4B A;  4MVS A;  5FCL A;  5CI8 A;  5T3T A;  1V55 C;  2V26 A;  1K05 A;  2YQY A;  3KPH A;  4IB4 A;  3RW0 A;  3ZIB A;  1EKY A;  2P61 A;  1HW1 A;  1LPE A;  2J8W A;  3U9J A;  1D1C A;  2OOC A;  3IQC A;  3M4B A;  2LFF A;  2FAP B;  2KK1 A;  4YL3 A;  4D4X A;  4DVY P;  2WVQ A;  5JLI A;  5FZT A;  3L8J A;  3CSK A;  2ZPA A;  4G7Z F;  3MYI A;  3KKB A;  1LI7 A;  3CAX A;  4WJ0 A;  1T01 A;  3LNR A;  2A0U A;  5JVE A;  2OJE D;  5DS6 A;  1QZX A;  4MTG A;  4NTF A;  2R7V A;  3QTH A;  3RQF A;  3GEH A;  2R7Q A;  2EIN C;  3EH2 A;  4AE4 B;  4DXW A;  4RDA A;  3B0U X;  1HE1 A;  4BJT A;  1N1C A;  2YLI A;  2J0X A;  3EPV A;  3JZ0 A;  3NMI A;  3R7C A;  3B0V C;  4G7O F;  3A9C A;  3UMK A;  3S28 A;  3DE9 A;  4CS9 A;  2KC3 A;  3UR3 C;  5F5F A;  1ZW3 A;  3TD7 A;  5DQZ A;  4YJW A;  4XLN F;  4CDA A;  4Z9H A;  3EGX B;  2P6V A;  2Y3G A;  1YYX A;  3ZVR A;  3EZH A;  3C8G D;  1QVX A;  1QQ3 A;  1V4A A;  1BBH A;  2GDC A;  2YLG A;  2VCA A;  3LLI A;  4C7O B;  1H7I A;  3LLK A;  4MTF A;  4O6M A;  2OCC C;  3AG2 C;  4QDL A;  1J8Y F;  2LD6 A;  3V7O A;  5KYW A;  4H54 A;  1ZHW A;  4ZLC A;  4R32 A;  2D5R B;  3NYM A;  3QW1 A;  4YN0 B;  5BQI A;  4MVZ A;  2DYR C;  1NSG B;  5EGY A;  2VAS A;  1ZZP A;  4U5G A;  4G7H F;  3IQ5 A;  2EIK C;  2LK4 A;  4JEA A;  4E17 A;  1E85 A;  2PFD A;  1Q0F A;  2J9W A;  2OG2 A;  2DGJ A;  4GYT A;  2LFD A;  1T6I A;  2CNW A;  2MHR A;  2L9J A;  1YYJ A;  1JRA A;  2L6G A;  3EH1 A;  5E3A A;  3RH3 A;  4K1O A;  3QVY A;  2IXO A;  3K1I C;  3LS1 A;  1UG7 A;  4N06 A;  4C3E A;  1JPJ A;  1M57 C;  1E84 A;  3W2V A;  4CS7 A;  4A4A A;  4PK4 A;  4MVM A;  3OA1 A;  3QZC A;  2PF4 E;  2KYH A;  3DKA A;  2QY9 A;  3DJN B;  1Y4C A;  3K1H A;  1HMD A;  4L6R A;  3U2M A;  3ZQY A;  4LAC B;  3S29 A;  4E18 A;  2TMV P;  2X51 A;  2JX0 A;  4JTD B;  4ONS A;  4LDK A;  3S9O A;  2G62 A;  3ZDL A;  3ZSU A;  1IW7 F;  2R7U A;  3RKO F;  2XXA A;  4P6I C;  4ER9 A;  1NZE A;  5DS5 A;  4JJF A;  4O6N A;  4JUR I;  1YVI A;  1BZ4 A;  1OXK A;  2L6H A;  3ABM C;  1OW6 A;  2EPL X;  2IM8 A;  4MW3 A;  4U9D A;  3SXY A;  3DE8 A;  5A6B D;  5L0I A;  2A68 F;  1OXB A;  1BDJ B;  3EFO A;  1LS1 A;  2YHS A;  3EZI A;  256B A;  1VTM P;  1KTM A;  5KYU B;  4E0I A;  3AQB A;  4MS2 A;  1OR3 A;  2PX3 A;  4O6Y A;  1MND A;  1TR2 A;  4J32 B;  2VH3 A;  1QSP A;  1LS4 A;  3T6G B;  2KJG A;  3QW0 A;  2L6F A;  3HNJ A;  3KL4 A;  4U5H A;  2EPK X;  4MVQ A;  4W8K A;  3VM6 A;  5HSW A;  2HS5 A;  3NKD A;  2QNL A;  3LNM B;  2R02 A;  4MW8 A;  4PJL A;  3ZC4 A;  3K33 A;  4E7S A;  3TJ5 A;  4EBK A;  4U5D E;  1IZM A;  4CIH A;  4CSA C;  3PHF 2;  3LEO A;  1YAR O;  2QE9 A;  2PP4 A;  2IXM A;  5L3V A;  2Q4F A;  4P9F A;  2E87 A;  3C7J A;  2Y3D A;  3C8G B;  2R05 A;  3EQL F;  1MQV A;  1XWJ A;  1RKE B;  3B9Q A;  1PCX A;  3U2L A;  2BC5 A;  3G4Z A;  1CPR A;  1LM3 B;  4CDV A;  2XM4 A;  1A7D A;  3RF3 A;  2HSQ A;  4O79 A;  2XLE A;  2YL7 A;  4CS9 C;  3C8G A;  3Q6N A;  5COF A;  3W8H A;  4YT4 A;  4QI2 A;  3VAY A;  1MMA A;  1RKE A;  5L0G A;  3RQE A;  1XZP A;  1YDI A;  3RFY A;  2DI3 A;  4PJJ A;  3DD7 A;  5JUA A; 
#chains in the Genus database with same CATH homology
 4NTF A;  3DWW A;  4JRZ A;  4YK5 A;  4YL1 A;  5BQI A;  3PCV A;  3LEO A;  5K0I A;  3HKK A;  5HV9 A;  4YL0 A;  4AL0 A;  4NTB A;  4NTA A;  4YL3 A;  2Q7R A;  5BQH A;  4BPM A;  4J7Y A;  2UUI A;  4JCZ A;  4J7T A;  2UUH A;  4JC7 A;  4AL1 A;  2PNO A;  3B29 A;  5BQG A;  2H8A A;  4WAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...