4YK5A

Crystal structures of mpges-1 inhibitor complexes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
146
structure length
146
Chain Sequence
VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Prostaglandin E synthase
publication title Crystal Structures of mPGES-1 Inhibitor Complexes Form a Basis for the Rational Design of Potent Analgesic and Anti-Inflammatory Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4yk5A00
5BQHA 4WABA 4BPMA 3DWWA 4YL3A 3LEOA 4NTAA 2UUHA 3B29A 4JC7A 4JRZA 4YL0A 4YL1A 5BQIA 3HKKA 2UUIA 2H8AA 4YK5A 4NTFA 5HV9A 4J7TA 4AL1A 5K0IA 4JCZA 2PNOA 4J7YA 4NTBA 2Q7RA 5BQGA 4AL0A 3PCVA
chains in the Genus database with same CATH superfamily
4OD5A 4ER9A 5DS6A 2YQYA 2B0JA 2XSEA 4I1MA 4KI2A 4C3EA 3HTKC 1YYXA 3E70C 4RDAA 1YJGA 3W2WA 2OKUA 5D91A 2CYDA 1M57C 1MMAA 2R02A 1NU7D 4U5BE 1NFNA 1D0XA 5F5HA 4N6CA 2EPLX 1N1CA 2QNLA 3S9OA 3RVYA 1QLEC 1YAUO 1S05A 3R2PA 2YLIA 3MYFA 2HKVA 2QE9A 2LQGA 4U5DE 4ULWA 1ZHXA 3EJNA 1LE2A 4PFPA 1H9GA 3QTHA 4U5CE 2R7TA 3NG1A 2XLMA 1E83A 1HMDA 1WASA 1HMOA 4JEBA 4MNDA 2EIJC 5KYXA 1YA7O 1HE9A 1VB5A 3K1HA 4F4BA 4MTGA 4YT5A 4J7YA 1T9KA 4NTBA 1OQCA 2R7WA 3O39A 3PCVA 3B9QA 4EUKB 4XEVA 4J30B 1F1MA 1L3PA 4PFOA 2W9YA 1ZU5A 2OJED 3SNHA 1R5ID 2IXNA 3LJBA 2OEXA 1ZYRF 4YN0B 3RH3A 4OD4A 4JIOA 2LSEA 2C03A 1OKKD 2TMVP 2QLAA 3EHMA 3OEOA 4KNVA 4LDQA 3W4YA 4MVOA 3ZQYA 3HKKA 2V3CC 1FAPB 2XL8A 2MWQA 4XPXA 4N06A 3POVA 1JRAA 3W2VA 1L7CA 5B1AC 1EI7A 1SF8A 1PD1A 4Q4ZF 256BA 3TJ5A 1YZCA 5L0CA 1HY5A 1YA9A 4JKVA 4FESA 4IGGA 5BUOA 5KYUB 2WVNA 2AWCA 3FOPA 3SXZA 3ASNC 3US6A 3ZC4A 4E7SA 1Q0GA 2OG2A 3UMIA 5DS4A 1BBHA 3KMIA 3C8ZA 4ULVA 2BC5A 1Y6DA 2HZ8A 1SMYF 2C04A 3DMDA 3QW0A 1LVKA 3JSZA 3NMJA 4E18A 3KPHA 5KYYA 3O6XA 1R4TA 2UUHA 4JEAA 3RQFA 3CAXA 5L0IA 1QKRA 4BEJA 2DYSC 1SYQA 3QZCA 3S84A 1GQAA 2M4EA 5A6JA 1FMWA 3M1CB 5JSLA 1LI7A 2NG1A 2R03A 4G78A 5KYWA 3JYHA 5B3IA 1M2VB 1M6TA 1A7DA 4Q7CA 3NYMA 4U5HA 4U9EA 3RF3A 3C63A 4DXWA 3O10A 1XZQA 2ASRA 4C7OA 3KYIA 4IB4A 4HE8D 2O9XA 2CW0F 3CQZA 3N24A 3WG7C 2Q3TA 1AVOB 2W45A 3DZAA 5A6BD 1NLXA 2L6FA 1OCCC 4DBQA 5T1DB 1ORJA 2ICWG 5EK0A 1NU9C 4AK9A 2YLGA 4MTFA 4DVYP 3NRHA 4D4XA 1H9TA 1PV3A 2X51A 2HV6A 1JPNA 5KYUA 3U2MA 4YT2A 5IY5C 3U2LA 2HSBA 4E0IA 1ZVZA 2YEVA 3LLIA 3NKDA 2MYSA 1UG7A 2KSFA 3JT1A 2BL2A 3EH2A 4CIHA 4E0HA 4U5FE 4XTKA 4CSAC 4IWBA 1GM5A 2VH3A 3HLZA 3TOMA 4DOZA 1ZZPA 4EHPA 3T6GB 1LI5A 5BQGA 2NPUA 1A0BA 1CGNA 1G4WR 2J8WA 4NY3A 3X1OA 4CS8A 1LM3B 2VCAA 4IAOA 5A6KA 4Q5SF 1FR0A 2I15A 3FAPB 4K0DA 3SXMA 3QVZA 2FAPB 4BJ5C 3T9OA 1V4AA 1SZIA 2OJQA 2YZSA 2ZXPA 3T6JA 3FMSA 2YVKA 2MHRA 2XLOA 1OW7A 4XWJA 4MVRA 2M64A 1V55C 5KYNA 2PF4E 1D0ZA 3PHF2 4MS2A 3ZG1A 4LLEA 4K1OA 1M2OA 5BQIA 5JLIA 3VYWA 4MTOA 3EQLF 1JPJA 3T4RA 2PBEA 3GEIA 3LUTB 2LIGA 4CS9A 1OW6A 3B0VC 2XLVA 3K66A 3HNJA 4YJWA 3RFYA 3S28A 2XM4A 4DBRA 2NSGA 1HW1A 2L6HA 2DB4A 2LCHA 5E3AA 4LERA 1Y4CA 4XQ1A 5AGFA 4H54A 4DVZA 3OWTA 2FFHA 2LK4A 3K1IC 3QVYA 4J32B 2Q7RA 3JRMO 1RMVA 3AJMA 2PX0A 3CZ6A 5L3QA 2R7VA 3Q7LA 2AU5A 1B68A 2IXMA 3M79A 3L1MA 2CNWA 2YL1A 2LFFA 3BEHA 3I5PA 3U9JA 1J8MF 1U89A 3JRTA 3QW1A 4DRHB 3U3BA 3DAGA 1Z6AA 2P7VA 1CGME 4BEMJ 1JR8A 2VC9A 4JRZA 3MBGA 3GEEA 2G62A 3K6BA 4CBEA 1E86A 2H7OA 3L8IA 2PFDA 3AGTA 3S29A 5EHHA 4WGYA 1O5HA 1AUEA 1D1CA 3GODA 1OXKA 3GORA 3RKOF 4G7OF 4HEAJ 3B71A 3I5QA 2L6GA 2XLWA 3H65A 2J7PD 3EFOA 2XRHA 1TWGA 2WB7A 1BR1A 4O6NA 3LNMB 1FFHA 3I4UA 1IZMA 4W8KA 2KK1A 4O7GA 3ZIBA 3UMHA 2YLDA 1ZW2A 3C8GD 2VCBA 1S7ZA 1XWJA 1YLMA 2P6VA 4WJ0A 1ZHYA 1O3UA 4MVSA 5E33A 2E87A 2X0CA 5DQTA 4JE9A 1BDJB 2EINC 2L7AA 5JRAA 1U0BB 4CJGA 1ORYA 1MQVA 1WWPA 3HNLA 3W8IA 4KNWA 2XLDA 2H8AA 1GS9A 3EGDB 4Z9IA 4NTFA 1I4ZA 2AP3A 1RKCA 3V5XA 1C02A 4J7TA 3R7CA 5A69A 2Y3GA 1QSPA 3C62A 5K0IA 4JCZA 2ZXWC 4PJMA 3UNGC 2AWYA 4ZLDA 5D92A 2Q9AA 3NYJA 2J9BA 3AQBA 1KU2A 2XLHA 4JZAA 4MVZA 4MVQA 4PACA 3ZWIA 3GEHA 4WABA 4UDVA 4YT8A 2P0NA 3Q7GA 1E85A 3AG2C 3N2ZB 4YWQA 3LS0A 3M4CA 3A9CA 4PR9A 4RD9A 1YZAA 3V5YA 1OW8A 2NUTB 2ETSA 4A2NB 1T6IA 5L0GA 1I5NA 1SR2A 4MQ9F 5COGA 4C3DA 2EPNA 1G8XA 2A69F 2NUPB 4ONSA 1LPEA 3JSEO 4PK4A 4X0RA 2AVKA 5CI8A 2WZFA 3SEOA 2WVQA 1J8YF 4XPYA 2R7XA 1FFTC 2A0UA 2R7OA 4BJTA 1Q0FA 3M15A 2ZXOA 5E2QA 2YL0A 4AL1A 5HSWA 1NFOA 4EBKA 4AE4B 1VYIA 2HJMA 3UR3C 3UGPA 2ZPAA 4QI0A 4JCHA 5JVEA 4I3MA 3TD7A 3B0PA 1RJ9B 2OCCC 4EKWA 3DI5A 4I44A 3C7JA 4PJJA 2OQMA 4BJ6C 2J9VA 4HFFB 1XZPA 2DI3A 3DE8A 4P9FA 1Z7Qc 3UMKA 5COMA 1PCXA 1A7EA 1WOLA 1QPUA 4JTAB 2HV7A 5F28E 3W8HA 2ZD9A 1YARO 4GYTA 4KC9A 4YL0A 2RD9A 2XS1A 1WTYA 1T6QA 3AG4C 5CI9A 4EWCA 1OR3A 4IAQA 4LACB 1TWAA 2FGYA 3K7DA 4P6IC 2R7SA 3JYYA 4CX9A 1K40A 2IXPA 3F47A 4DRIB 3DE9A 2EPKX 4BJ1A 3IHUA 4OIPF 1TWCA 3NKEA 2XXAB 4IARA 4G7ZF 2PNOA 2H7VC 3FAJA 1TWHA 2YL7A 3FVYA 3VF0A 4JVSA 1LS1A 3C18A 3TOLA 3UGOA 3ECSA 1MMNA 4JURI 2QY9A 1OCZC 3EGXB 1VLSA 3EG9B 4G0HA 5E3CA 4AL0A 2NUPA 4BPMA 2B0HA 2Q4FA 4JW1A 3FOOA 1O87A 3EZHA 2J9UA 1NG1A 2KQ9A 3HJCA 4E17A 2R05A 4DRJB 1D1AA 1M2VA 2HMQA 1Q0MA 3GM1A 3RYLA 3ATPA 4C3BA 3TK0A 5L0FA 2L9JA 2R7RA 1Z5ZA 2CCYA 4AE4A 4OIQF 3SXYA 2QTVA 2A68F 2EPOA 2LFDA 3MX3A 5EGYA 1FTSA 1C17M 2CGEA 4LLCA 1ZHTA 2EIMC 3GWLA 3DM9B 4U5EE 5JS5A 2J0WA 2IOQA 4GEHA 4XPWA 4CDAA 3LESA 5BQHA 4CSAA 4MW8A 5KYXB 1G4US 4U9DA 1V74B 1MNEA 3LEVA 4U5GA 1ZU4A 4CS8C 3AG3C 2GWWA 3H2UA 3DJNB 3HNIA 4JTDB 4XEKA 2HSQA 2LP4A 4JC7A 2XXAA 2V26A 2A6HF 3DJUB 4PJNA 3ABLC 3GANA 4BJ5A 4YK5A 1WGWA 2CDQA 2YKZA 3TJ6A 1Z23A 3IQ5A 4YT4A 2P61A 3KKBA 1APCA 2BE5F 3EGXA 3L8JA 3S90A 3OA1A 2KC3A 2HS5A 3ABKC 4I1OB 2IBFA 1ST6A 3QMKA 1TKNA 2J9WA 2XM0A 4XLPF 2XLEA 3H2VA 3U0CA 3FXHA 2HJ3A 1KTMA 1ZHWA 1LKXA 2Q00A 4OIOF 3K33A 2WL8A 3ZQVA 3V7OA 3Q6MA 1NBBA 1OKKA 2KGOA 2Y3DA 5DQZA 1ZHZA 3E9VA 3G4ZA 3K1IA 1V54C 3J06A 1BR4A 1TFKB 1VLTA 4NCQA 1A41A 1HW2A 3LLKA 2W4BA 3LNRA 4EBJA 2CNWD 4JJGA 1ORSC 4H4KC 2JPUA 2OOCA 1RXQA 2UUIA 3ABMC 1U6HA 4CIPA 3MYIA 4WGZA 5KYYB 5AC5A 3EPVA 1T5OA 1TFOB 3EHNA 3KYJA 1OCRC 3SP1A 2KNHA 1GGQA 2WZLA 5DLJA 1WN0A 2XL6A 4ZLCA 1C03A 2H7BA 2KJGA 2Q9BA 1FNTc 1MMGA 1JOGA 4OIRF 2A6EF 3IQCA 1MNDA 4MVUA 3DXJF 4P9TA 4RBNA 3EH1A 2R7QA 5KYWB 3IPMO 5CIVA 1QQ3A 2J0XA 4CDVA 5L3VA 1EKYA 2VASA 1NZEA 4FX5A 4NC3A 3CEXA 4YL3A 5JT4A 2G3KA 4B6IA 4C7OB 1Q0DA 4GQHA 4NTAA 5L0HA 3KL4A 4CS7A 2I8BA 2D5RB 2WVOA 2HUJA 1BZ4A 1MMDA 2OU6A 2YRFA 3DD7A 4L6RA 2Y69C 3TQOA 4ANJA 4DJ9A 4N4WA 1OCOC 5JUAA 3DAFA 3MFNA 3AG1C 2L81A 5GPGB 1D1BA 2JX0A 2LD6A 3ZSUA 2G3VA 4IJJA 3JZ0A 1QVXA 1K04A 4BG0A 2VCCA 3JCUQ 3JTLO 3IQ6A 4O6MA 3SYNA 4W8PA 4CDYA 5A6BA 4G7HF 5B3SC 5FZTA 1RCPA 1CGOA 1JAFA 3NMIA 3SZRA 1DOWA 2R7UA 1ZW3A 4JTCB 3VAYA 1VK5A 2YL3A 2EILC 3AQCA 3PMRA 4FWVA 3PDMP 2PX3A 5F5FA 1TQGA 4XEFA 1VTMP 1D0YA 5TJ5E 4Z9HA 2HFIA 4N6HA 3MLGA 2YHSA 3IEEA 3RW0A 3NDBB 1CPRA 3EGDA 3LAYA 4M63A 4AX2A 1HE1A 1LE4A 1E2XA 4IRUA 2J46A 3RQEA 3B29A 1E84A 4HFKB 2A1DD 4A4AA 3Q6NA 2DYRC 2GFHA 4EBBA 2GA0A 3ASOC 5B1BC 3DKAA 2P1AA 3X2QC 3O55A 3RIPA 5L0JA 2IXOA 4MVMA 1T01A 1IW7F 4NQFA 1RKEB 2XL4A 1I4YA 4LDRA 1KNYA 3AOUA 1BR2A 2NUTA 3FDQA 3CSKA 3L0IA 5FCLA 1YDIA 3F46A 4EIYA 1EA8A 3A11A 1Q0KA 2W4MA 3DWWA 1LIHA 3GWNA 4QDLA 3WAQA 3LEOA 3S27A 1YVIA 2PP4A 3C8GB 3G4XA 2GDCA 4K7BA 3TULA 3WODF 3EZIA 5L0DA 2J45A 3SXKA 4QI2A 2HMZA 3VM6A 3T6BA 1H7IA 1PD0A 1UFBA 2EPMX 2JD3A 4LDKA 3RVZA 4CS9C 2RSEB 1WATA 2GAQA 3NMKA 4YL1A 4BJ6A 5COFA 1OR2A 2Z15A 3U5SA 5DS5A 1Z63A 1FMVA 1VMAA 1W2WA 1VOMA 3ITFA 1QZXA 1T6UA 4E7ZA 1RJ9A 3WHNA 3AGUA 3ZDLA 3U8VA 2D4UA 2DGJA 3FHDA 3ZTZA 3KH2A 4OINF 5A6AA 4O79A 3U8PA 1H6GA 1TR2A 4JJFA 2OEVA 4KBLA 3B0UX 2NSFA 1Z3IX 4FAPB 2IM8A 3U9MA 1OXBA 2R9RB 2YWAA 1DOVA 3M4BA 3GM3A 1CPQA 3IQTA 4XLNF 1JMWA 3EFOB 3GM2A 3BRJA 4CJOA 3V5ZA 1K05A 5AC4A 3VRCA 4D4NA 2XS8A 4R32A 3DM5A 2Y3HA 4PJLA 5T3WA 3G50A 2KYHA 1RKEA 2QUPA 2KW3C 2Y39A 5T3TA 3U3FA 3LS1A 5JP7A 4Z9JA 1G5ZA 3ZTMA 2J7PA 5DVWA 5HV9A 3ZVRA 1EQ1A 3HNKA 2F22A 3N0TA 3S0XA 1VYKA 1NSGB 3EG9A 2Q9CA 3NYLA 4MW3A 3RQGA 1M56C 1A7VA 1YYJA 2IYLD 2A0BA 2ZXRA 3C8GA 3L34A 2WZGA 2Y3BA 1LS4A 2EIKC 2VB6A 1AEPA 2R25A 4O6YA
chains in the Genus database with same CATH topology
5BQHA 4WABA 4BPMA 3DWWA 4YL3A 3LEOA 4NTAA 2UUHA 3B29A 4JC7A 4JRZA 4YL0A 4YL1A 5BQIA 3HKKA 2UUIA 2H8AA 4YK5A 4NTFA 5HV9A 4J7TA 4AL1A 5K0IA 4JCZA 2PNOA 4J7YA 4NTBA 2Q7RA 5BQGA 4AL0A 3PCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQH A;  4WAB A;  4BPM A;  3DWW A;  4YL3 A;  3LEO A;  4NTA A;  2UUH A;  3B29 A;  4JC7 A;  4JRZ A;  4YL0 A;  4YL1 A;  5BQI A;  3HKK A;  2UUI A;  2H8A A;  4YK5 A;  4NTF A;  5HV9 A;  4J7T A;  4AL1 A;  5K0I A;  4JCZ A;  2PNO A;  4J7Y A;  4NTB A;  2Q7R A;  5BQG A;  4AL0 A;  3PCV A; 
#chains in the Genus database with same CATH topology
 4OD5 A;  4ER9 A;  5DS6 A;  2YQY A;  2B0J A;  2XSE A;  4I1M A;  4KI2 A;  4C3E A;  3HTK C;  1YYX A;  3E70 C;  4RDA A;  1YJG A;  3W2W A;  2OKU A;  5D91 A;  2CYD A;  1M57 C;  1MMA A;  2R02 A;  1NU7 D;  4U5B E;  1NFN A;  1D0X A;  5F5H A;  4N6C A;  2EPL X;  1N1C A;  2QNL A;  3S9O A;  3RVY A;  1QLE C;  1YAU O;  1S05 A;  3R2P A;  2YLI A;  3MYF A;  2HKV A;  2QE9 A;  2LQG A;  4U5D E;  4ULW A;  1ZHX A;  3EJN A;  1LE2 A;  4PFP A;  1H9G A;  3QTH A;  4U5C E;  2R7T A;  3NG1 A;  2XLM A;  1E83 A;  1HMD A;  1WAS A;  1HMO A;  4JEB A;  4MND A;  2EIJ C;  5KYX A;  1YA7 O;  1HE9 A;  1VB5 A;  3K1H A;  4F4B A;  4MTG A;  4YT5 A;  4J7Y A;  1T9K A;  4NTB A;  1OQC A;  2R7W A;  3O39 A;  3PCV A;  3B9Q A;  4EUK B;  4XEV A;  4J30 B;  1F1M A;  1L3P A;  4PFO A;  2W9Y A;  1ZU5 A;  2OJE D;  3SNH A;  1R5I D;  2IXN A;  3LJB A;  2OEX A;  1ZYR F;  4YN0 B;  3RH3 A;  4OD4 A;  4JIO A;  2LSE A;  2C03 A;  1OKK D;  2TMV P;  2QLA A;  3EHM A;  3OEO A;  4KNV A;  4LDQ A;  3W4Y A;  4MVO A;  3ZQY A;  3HKK A;  2V3C C;  1FAP B;  2XL8 A;  2MWQ A;  4XPX A;  4N06 A;  3POV A;  1JRA A;  3W2V A;  1L7C A;  5B1A C;  1EI7 A;  1SF8 A;  1PD1 A;  4Q4Z F;  256B A;  3TJ5 A;  1YZC A;  5L0C A;  1HY5 A;  1YA9 A;  4JKV A;  4FES A;  4IGG A;  5BUO A;  5KYU B;  2WVN A;  2AWC A;  3FOP A;  3SXZ A;  3ASN C;  3US6 A;  3ZC4 A;  4E7S A;  1Q0G A;  2OG2 A;  3UMI A;  5DS4 A;  1BBH A;  3KMI A;  3C8Z A;  4ULV A;  2BC5 A;  1Y6D A;  2HZ8 A;  1SMY F;  2C04 A;  3DMD A;  3QW0 A;  1LVK A;  3JSZ A;  3NMJ A;  4E18 A;  3KPH A;  5KYY A;  3O6X A;  1R4T A;  2UUH A;  4JEA A;  3RQF A;  3CAX A;  5L0I A;  1QKR A;  4BEJ A;  2DYS C;  1SYQ A;  3QZC A;  3S84 A;  1GQA A;  2M4E A;  5A6J A;  1FMW A;  3M1C B;  5JSL A;  1LI7 A;  2NG1 A;  2R03 A;  4G78 A;  5KYW A;  3JYH A;  5B3I A;  1M2V B;  1M6T A;  1A7D A;  4Q7C A;  3NYM A;  4U5H A;  4U9E A;  3RF3 A;  3C63 A;  4DXW A;  3O10 A;  1XZQ A;  2ASR A;  4C7O A;  3KYI A;  4IB4 A;  4HE8 D;  2O9X A;  2CW0 F;  3CQZ A;  3N24 A;  3WG7 C;  2Q3T A;  1AVO B;  2W45 A;  3DZA A;  5A6B D;  1NLX A;  2L6F A;  1OCC C;  4DBQ A;  5T1D B;  1ORJ A;  2ICW G;  5EK0 A;  1NU9 C;  4AK9 A;  2YLG A;  4MTF A;  4DVY P;  3NRH A;  4D4X A;  1H9T A;  1PV3 A;  2X51 A;  2HV6 A;  1JPN A;  5KYU A;  3U2M A;  4YT2 A;  5IY5 C;  3U2L A;  2HSB A;  4E0I A;  1ZVZ A;  2YEV A;  3LLI A;  3NKD A;  2MYS A;  1UG7 A;  2KSF A;  3JT1 A;  2BL2 A;  3EH2 A;  4CIH A;  4E0H A;  4U5F E;  4XTK A;  4CSA C;  4IWB A;  1GM5 A;  2VH3 A;  3HLZ A;  3TOM A;  4DOZ A;  1ZZP A;  4EHP A;  3T6G B;  1LI5 A;  5BQG A;  2NPU A;  1A0B A;  1CGN A;  1G4W R;  2J8W A;  4NY3 A;  3X1O A;  4CS8 A;  1LM3 B;  2VCA A;  4IAO A;  5A6K A;  4Q5S F;  1FR0 A;  2I15 A;  3FAP B;  4K0D A;  3SXM A;  3QVZ A;  2FAP B;  4BJ5 C;  3T9O A;  1V4A A;  1SZI A;  2OJQ A;  2YZS A;  2ZXP A;  3T6J A;  3FMS A;  2YVK A;  2MHR A;  2XLO A;  1OW7 A;  4XWJ A;  4MVR A;  2M64 A;  1V55 C;  5KYN A;  2PF4 E;  1D0Z A;  3PHF 2;  4MS2 A;  3ZG1 A;  4LLE A;  4K1O A;  1M2O A;  5BQI A;  5JLI A;  3VYW A;  4MTO A;  3EQL F;  1JPJ A;  3T4R A;  2PBE A;  3GEI A;  3LUT B;  2LIG A;  4CS9 A;  1OW6 A;  3B0V C;  2XLV A;  3K66 A;  3HNJ A;  4YJW A;  3RFY A;  3S28 A;  2XM4 A;  4DBR A;  2NSG A;  1HW1 A;  2L6H A;  2DB4 A;  2LCH A;  5E3A A;  4LER A;  1Y4C A;  4XQ1 A;  5AGF A;  4H54 A;  4DVZ A;  3OWT A;  2FFH A;  2LK4 A;  3K1I C;  3QVY A;  4J32 B;  2Q7R A;  3JRM O;  1RMV A;  3AJM A;  2PX0 A;  3CZ6 A;  5L3Q A;  2R7V A;  3Q7L A;  2AU5 A;  1B68 A;  2IXM A;  3M79 A;  3L1M A;  2CNW A;  2YL1 A;  2LFF A;  3BEH A;  3I5P A;  3U9J A;  1J8M F;  1U89 A;  3JRT A;  3QW1 A;  4DRH B;  3U3B A;  3DAG A;  1Z6A A;  2P7V A;  1CGM E;  4BEM J;  1JR8 A;  2VC9 A;  4JRZ A;  3MBG A;  3GEE A;  2G62 A;  3K6B A;  4CBE A;  1E86 A;  2H7O A;  3L8I A;  2PFD A;  3AGT A;  3S29 A;  5EHH A;  4WGY A;  1O5H A;  1AUE A;  1D1C A;  3GOD A;  1OXK A;  3GOR A;  3RKO F;  4G7O F;  4HEA J;  3B71 A;  3I5Q A;  2L6G A;  2XLW A;  3H65 A;  2J7P D;  3EFO A;  2XRH A;  1TWG A;  2WB7 A;  1BR1 A;  4O6N A;  3LNM B;  1FFH A;  3I4U A;  1IZM A;  4W8K A;  2KK1 A;  4O7G A;  3ZIB A;  3UMH A;  2YLD A;  1ZW2 A;  3C8G D;  2VCB A;  1S7Z A;  1XWJ A;  1YLM A;  2P6V A;  4WJ0 A;  1ZHY A;  1O3U A;  4MVS A;  5E33 A;  2E87 A;  2X0C A;  5DQT A;  4JE9 A;  1BDJ B;  2EIN C;  2L7A A;  5JRA A;  1U0B B;  4CJG A;  1ORY A;  1MQV A;  1WWP A;  3HNL A;  3W8I A;  4KNW A;  2XLD A;  2H8A A;  1GS9 A;  3EGD B;  4Z9I A;  4NTF A;  1I4Z A;  2AP3 A;  1RKC A;  3V5X A;  1C02 A;  4J7T A;  3R7C A;  5A69 A;  2Y3G A;  1QSP A;  3C62 A;  5K0I A;  4JCZ A;  2ZXW C;  4PJM A;  3UNG C;  2AWY A;  4ZLD A;  5D92 A;  2Q9A A;  3NYJ A;  2J9B A;  3AQB A;  1KU2 A;  2XLH A;  4JZA A;  4MVZ A;  4MVQ A;  4PAC A;  3ZWI A;  3GEH A;  4WAB A;  4UDV A;  4YT8 A;  2P0N A;  3Q7G A;  1E85 A;  3AG2 C;  3N2Z B;  4YWQ A;  3LS0 A;  3M4C A;  3A9C A;  4PR9 A;  4RD9 A;  1YZA A;  3V5Y A;  1OW8 A;  2NUT B;  2ETS A;  4A2N B;  1T6I A;  5L0G A;  1I5N A;  1SR2 A;  4MQ9 F;  5COG A;  4C3D A;  2EPN A;  1G8X A;  2A69 F;  2NUP B;  4ONS A;  1LPE A;  3JSE O;  4PK4 A;  4X0R A;  2AVK A;  5CI8 A;  2WZF A;  3SEO A;  2WVQ A;  1J8Y F;  4XPY A;  2R7X A;  1FFT C;  2A0U A;  2R7O A;  4BJT A;  1Q0F A;  3M15 A;  2ZXO A;  5E2Q A;  2YL0 A;  4AL1 A;  5HSW A;  1NFO A;  4EBK A;  4AE4 B;  1VYI A;  2HJM A;  3UR3 C;  3UGP A;  2ZPA A;  4QI0 A;  4JCH A;  5JVE A;  4I3M A;  3TD7 A;  3B0P A;  1RJ9 B;  2OCC C;  4EKW A;  3DI5 A;  4I44 A;  3C7J A;  4PJJ A;  2OQM A;  4BJ6 C;  2J9V A;  4HFF B;  1XZP A;  2DI3 A;  3DE8 A;  4P9F A;  1Z7Q c;  3UMK A;  5COM A;  1PCX A;  1A7E A;  1WOL A;  1QPU A;  4JTA B;  2HV7 A;  5F28 E;  3W8H A;  2ZD9 A;  1YAR O;  4GYT A;  4KC9 A;  4YL0 A;  2RD9 A;  2XS1 A;  1WTY A;  1T6Q A;  3AG4 C;  5CI9 A;  4EWC A;  1OR3 A;  4IAQ A;  4LAC B;  1TWA A;  2FGY A;  3K7D A;  4P6I C;  2R7S A;  3JYY A;  4CX9 A;  1K40 A;  2IXP A;  3F47 A;  4DRI B;  3DE9 A;  2EPK X;  4BJ1 A;  3IHU A;  4OIP F;  1TWC A;  3NKE A;  2XXA B;  4IAR A;  4G7Z F;  2PNO A;  2H7V C;  3FAJ A;  1TWH A;  2YL7 A;  3FVY A;  3VF0 A;  4JVS A;  1LS1 A;  3C18 A;  3TOL A;  3UGO A;  3ECS A;  1MMN A;  4JUR I;  2QY9 A;  1OCZ C;  3EGX B;  1VLS A;  3EG9 B;  4G0H A;  5E3C A;  4AL0 A;  2NUP A;  4BPM A;  2B0H A;  2Q4F A;  4JW1 A;  3FOO A;  1O87 A;  3EZH A;  2J9U A;  1NG1 A;  2KQ9 A;  3HJC A;  4E17 A;  2R05 A;  4DRJ B;  1D1A A;  1M2V A;  2HMQ A;  1Q0M A;  3GM1 A;  3RYL A;  3ATP A;  4C3B A;  3TK0 A;  5L0F A;  2L9J A;  2R7R A;  1Z5Z A;  2CCY A;  4AE4 A;  4OIQ F;  3SXY A;  2QTV A;  2A68 F;  2EPO A;  2LFD A;  3MX3 A;  5EGY A;  1FTS A;  1C17 M;  2CGE A;  4LLC A;  1ZHT A;  2EIM C;  3GWL A;  3DM9 B;  4U5E E;  5JS5 A;  2J0W A;  2IOQ A;  4GEH A;  4XPW A;  4CDA A;  3LES A;  5BQH A;  4CSA A;  4MW8 A;  5KYX B;  1G4U S;  4U9D A;  1V74 B;  1MNE A;  3LEV A;  4U5G A;  1ZU4 A;  4CS8 C;  3AG3 C;  2GWW A;  3H2U A;  3DJN B;  3HNI A;  4JTD B;  4XEK A;  2HSQ A;  2LP4 A;  4JC7 A;  2XXA A;  2V26 A;  2A6H F;  3DJU B;  4PJN A;  3ABL C;  3GAN A;  4BJ5 A;  4YK5 A;  1WGW A;  2CDQ A;  2YKZ A;  3TJ6 A;  1Z23 A;  3IQ5 A;  4YT4 A;  2P61 A;  3KKB A;  1APC A;  2BE5 F;  3EGX A;  3L8J A;  3S90 A;  3OA1 A;  2KC3 A;  2HS5 A;  3ABK C;  4I1O B;  2IBF A;  1ST6 A;  3QMK A;  1TKN A;  2J9W A;  2XM0 A;  4XLP F;  2XLE A;  3H2V A;  3U0C A;  3FXH A;  2HJ3 A;  1KTM A;  1ZHW A;  1LKX A;  2Q00 A;  4OIO F;  3K33 A;  2WL8 A;  3ZQV A;  3V7O A;  3Q6M A;  1NBB A;  1OKK A;  2KGO A;  2Y3D A;  5DQZ A;  1ZHZ A;  3E9V A;  3G4Z A;  3K1I A;  1V54 C;  3J06 A;  1BR4 A;  1TFK B;  1VLT A;  4NCQ A;  1A41 A;  1HW2 A;  3LLK A;  2W4B A;  3LNR A;  4EBJ A;  2CNW D;  4JJG A;  1ORS C;  4H4K C;  2JPU A;  2OOC A;  1RXQ A;  2UUI A;  3ABM C;  1U6H A;  4CIP A;  3MYI A;  4WGZ A;  5KYY B;  5AC5 A;  3EPV A;  1T5O A;  1TFO B;  3EHN A;  3KYJ A;  1OCR C;  3SP1 A;  2KNH A;  1GGQ A;  2WZL A;  5DLJ A;  1WN0 A;  2XL6 A;  4ZLC A;  1C03 A;  2H7B A;  2KJG A;  2Q9B A;  1FNT c;  1MMG A;  1JOG A;  4OIR F;  2A6E F;  3IQC A;  1MND A;  4MVU A;  3DXJ F;  4P9T A;  4RBN A;  3EH1 A;  2R7Q A;  5KYW B;  3IPM O;  5CIV A;  1QQ3 A;  2J0X A;  4CDV A;  5L3V A;  1EKY A;  2VAS A;  1NZE A;  4FX5 A;  4NC3 A;  3CEX A;  4YL3 A;  5JT4 A;  2G3K A;  4B6I A;  4C7O B;  1Q0D A;  4GQH A;  4NTA A;  5L0H A;  3KL4 A;  4CS7 A;  2I8B A;  2D5R B;  2WVO A;  2HUJ A;  1BZ4 A;  1MMD A;  2OU6 A;  2YRF A;  3DD7 A;  4L6R A;  2Y69 C;  3TQO A;  4ANJ A;  4DJ9 A;  4N4W A;  1OCO C;  5JUA A;  3DAF A;  3MFN A;  3AG1 C;  2L81 A;  5GPG B;  1D1B A;  2JX0 A;  2LD6 A;  3ZSU A;  2G3V A;  4IJJ A;  3JZ0 A;  1QVX A;  1K04 A;  4BG0 A;  2VCC A;  3JCU Q;  3JTL O;  3IQ6 A;  4O6M A;  3SYN A;  4W8P A;  4CDY A;  5A6B A;  4G7H F;  5B3S C;  5FZT A;  1RCP A;  1CGO A;  1JAF A;  3NMI A;  3SZR A;  1DOW A;  2R7U A;  1ZW3 A;  4JTC B;  3VAY A;  1VK5 A;  2YL3 A;  2EIL C;  3AQC A;  3PMR A;  4FWV A;  3PDM P;  2PX3 A;  5F5F A;  1TQG A;  4XEF A;  1VTM P;  1D0Y A;  5TJ5 E;  4Z9H A;  2HFI A;  4N6H A;  3MLG A;  2YHS A;  3IEE A;  3RW0 A;  3NDB B;  1CPR A;  3EGD A;  3LAY A;  4M63 A;  4AX2 A;  1HE1 A;  1LE4 A;  1E2X A;  4IRU A;  2J46 A;  3RQE A;  3B29 A;  1E84 A;  4HFK B;  2A1D D;  4A4A A;  3Q6N A;  2DYR C;  2GFH A;  4EBB A;  2GA0 A;  3ASO C;  5B1B C;  3DKA A;  2P1A A;  3X2Q C;  3O55 A;  3RIP A;  5L0J A;  2IXO A;  4MVM A;  1T01 A;  1IW7 F;  4NQF A;  1RKE B;  2XL4 A;  1I4Y A;  4LDR A;  1KNY A;  3AOU A;  1BR2 A;  2NUT A;  3FDQ A;  3CSK A;  3L0I A;  5FCL A;  1YDI A;  3F46 A;  4EIY A;  1EA8 A;  3A11 A;  1Q0K A;  2W4M A;  3DWW A;  1LIH A;  3GWN A;  4QDL A;  3WAQ A;  3LEO A;  3S27 A;  1YVI A;  2PP4 A;  3C8G B;  3G4X A;  2GDC A;  4K7B A;  3TUL A;  3WOD F;  3EZI A;  5L0D A;  2J45 A;  3SXK A;  4QI2 A;  2HMZ A;  3VM6 A;  3T6B A;  1H7I A;  1PD0 A;  1UFB A;  2EPM X;  2JD3 A;  4LDK A;  3RVZ A;  4CS9 C;  2RSE B;  1WAT A;  2GAQ A;  3NMK A;  4YL1 A;  4BJ6 A;  5COF A;  1OR2 A;  2Z15 A;  3U5S A;  5DS5 A;  1Z63 A;  1FMV A;  1VMA A;  1W2W A;  1VOM A;  3ITF A;  1QZX A;  1T6U A;  4E7Z A;  1RJ9 A;  3WHN A;  3AGU A;  3ZDL A;  3U8V A;  2D4U A;  2DGJ A;  3FHD A;  3ZTZ A;  3KH2 A;  4OIN F;  5A6A A;  4O79 A;  3U8P A;  1H6G A;  1TR2 A;  4JJF A;  2OEV A;  4KBL A;  3B0U X;  2NSF A;  1Z3I X;  4FAP B;  2IM8 A;  3U9M A;  1OXB A;  2R9R B;  2YWA A;  1DOV A;  3M4B A;  3GM3 A;  1CPQ A;  3IQT A;  4XLN F;  1JMW A;  3EFO B;  3GM2 A;  3BRJ A;  4CJO A;  3V5Z A;  1K05 A;  5AC4 A;  3VRC A;  4D4N A;  2XS8 A;  4R32 A;  3DM5 A;  2Y3H A;  4PJL A;  5T3W A;  3G50 A;  2KYH A;  1RKE A;  2QUP A;  2KW3 C;  2Y39 A;  5T3T A;  3U3F A;  3LS1 A;  5JP7 A;  4Z9J A;  1G5Z A;  3ZTM A;  2J7P A;  5DVW A;  5HV9 A;  3ZVR A;  1EQ1 A;  3HNK A;  2F22 A;  3N0T A;  3S0X A;  1VYK A;  1NSG B;  3EG9 A;  2Q9C A;  3NYL A;  4MW3 A;  3RQG A;  1M56 C;  1A7V A;  1YYJ A;  2IYL D;  2A0B A;  2ZXR A;  3C8G A;  3L34 A;  2WZG A;  2Y3B A;  1LS4 A;  2EIK C;  2VB6 A;  1AEP A;  2R25 A;  4O6Y A; 
#chains in the Genus database with same CATH homology
 5BQH A;  4WAB A;  4BPM A;  3DWW A;  4YL3 A;  3LEO A;  4NTA A;  2UUH A;  3B29 A;  4JC7 A;  4JRZ A;  4YL0 A;  4YL1 A;  5BQI A;  3HKK A;  2UUI A;  2H8A A;  4YK5 A;  4NTF A;  5HV9 A;  4J7T A;  4AL1 A;  5K0I A;  4JCZ A;  2PNO A;  4J7Y A;  4NTB A;  2Q7R A;  5BQG A;  4AL0 A;  3PCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...