4Z9JA

Apo-tar from e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
158
structure length
158
Chain Sequence
SQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
molecule keywords Methyl-accepting chemotaxis protein II
total genus 70
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9jA00
1VLTA 1WATA 3ATPA 2ASRA 1VLSA 1LIHA 3T9OA 1JMWA 1WASA 4H54A 2D4UA 2LIGA 4Z9JA 4Z9IA 4Z9HA
chains in the Genus database with same CATH superfamily
1PD0A 1YYJA 3IHUA 5KYYB 2J9WA 2ICWG 2LD6A 2H7BA 2NUTB 3ZTZA 1M2OA 3JRTA 2Y3BA 3M1CB 1BR4A 4JE9A 1RKEB 4MVRA 4JCHA 4CDVA 1M56C 2EPMX 3G4XA 3F47A 2B0HA 4JEAA 3W8HA 2EPOA 3GEIA 3TOMA 3ZIBA 4AL0A 3GEHA 2ZD9A 3UGPA 3DJNB 2LK4A 3C8GB 5B3SC 1YZAA 1YYXA 1NBBA 3RVZA 2G3VA 2LP4A 2P0NA 1A0BA 3B0PA 3MYIA 4N6CA 4BJ5A 1ZHYA 4EHPA 3L8JA 2WVQA 1FTSA 4JC7A 4NTBA 4IAQA 2XS8A 2OOCA 4IWBA 2Y3DA 4JJGA 4NQFA 4E18A 1RJ9A 2R7SA 3SZRA 3IEEA 4I1OB 3TJ6A 5K0IA 2Q9AA 2J7PD 1EA8A 4YK5A 1KU2A 3C8ZA 2R7TA 4DRJB 5JRAA 4BJ5C 1K40A 4XLNF 1N1CA 5A6AA 4MS2A 4DVYP 4XPYA 2P7VA 3C8GA 1I4YA 2P1AA 1AVOB 2Y3HA 3IQTA 2DGJA 3KMIA 4FX5A 4RD9A 2YEVA 3EH1A 2HJMA 2PBEA 3G50A 3ZQYA 4YWQA 4XEKA 3RKOF 5DVWA 2L6GA 3U9JA 1GGQA 1YA9A 2OKUA 2Q00A 3KKBA 3W4YA 4HEAJ 4O6MA 1MNDA 5L0HA 3H2VA 4JZAA 1ZVZA 2AU5A 3JSZA 4U5DE 3V5XA 3B29A 1LIHA 4MQ9F 1G4WR 3CQZA 3KYIA 3GODA 2EIMC 2MWQA 3EQLF 2OU6A 2G3KA 3NMKA 3JSEO 3DE8A 4PACA 3DWWA 1FFHA 4MVSA 1HW1A 4MTOA 2Q3TA 2YZSA 1SR2A 3U3FA 2ASRA 2KYHA 3PCVA 3X1OA 3AG3C 4ZLDA 4G0HA 3TD7A 3ZTMA 3K1IA 1M2VA 1YZCA 3SXKA 1O3UA 1ORJA 3CEXA 4OIQF 4P9TA 2HKVA 2LSEA 5B3IA 1RMVA 3N24A 2IXPA 3FMSA 3LNRA 5KYXA 2ZXOA 1H9GA 2H7VC 5FZTA 3Q7LA 3SXZA 3RQGA 1A7VA 1OCCC 1SZIA 3ATPA 4U5CE 2NUPB 1LS1A 3N0TA 3RIPA 5DQTA 1JAFA 5DS4A 3LAYA 2L6FA 4NTAA 2R7UA 1TWHA 4I44A 3IQ6A 2VASA 4ULWA 3F46A 5JVEA 4YL0A 3ABKC 2FAPB 3R7CA 1DOVA 1H7IA 1OW7A 1CGNA 4AK9A 4G7ZF 3ZVRA 3L0IA 5KYYA 3POVA 1RJ9B 1VMAA 3ABMC 3DKAA 3EGXB 3HNJA 2MYSA 4PFOA 4W8PA 4DOZA 3S0XA 4MTFA 1BR2A 1EI7A 1VK5A 4W8KA 4C7OB 1YVIA 1J8YF 1YDIA 1MMGA 1QVXA 2A68F 3W2WA 1XWJA 4O7GA 4A2NB 4Q4ZF 2NG1A 3DJUB 1H9TA 1ZHXA 1WGWA 4JIOA 3NMIA 3LS1A 5FCLA 3ASNC 1JRAA 2KSFA 1RCPA 5B1BC 4BEMJ 4DRIB 1EQ1A 4XQ1A 3UMIA 5D91A 2QE9A 3OA1A 3DM9B 3NDBB 3SEOA 4U5EE 4CJGA 4NTFA 1VYKA 3O55A 4OIPF 1OR3A 1LI7A 1OQCA 3EH2A 4IJJA 4K1OA 4N4WA 4O6YA 4XEVA 3UMHA 3U2LA 1TWCA 4ONSA 1Q0DA 2LFFA 1L3PA 2YLGA 2XLDA 3OWTA 1XZQA 1E2XA 3JT1A 2BC5A 3E70C 4MTGA 5CIVA 2G62A 2WB7A 3U5SA 1DOWA 2VC9A 1BDJB 1M6TA 2AP3A 2QLAA 2VCCA 4PJLA 4M63A 4NY3A 2PP4A 3Q7GA 5AC5A 3LEOA 3PMRA 2R05A 4K0DA 1Z7Qc 5F5HA 2EPKX 2LQGA 3OEOA 3LEVA 1U6HA 4YL1A 1YAUO 2NUTA 4CS9A 3CAXA 1PV3A 2KQ9A 2PFDA 2Z15A 3AG1C 3ITFA 4IARA 3NYJA 3S90A 1MMAA 2ETSA 1TFOB 3B71A 1VOMA 2XLOA 1T01A 2X51A 4C7OA 1NU7D 4UDVA 2XL4A 3MBGA 2OJQA 2GA0A 3U3BA 2J45A 2UUHA 1BR1A 4N06A 3H65A 1QKRA 4LACB 4WGYA 4YN0B 3U9MA 4WJ0A 2EILC 5TJ5E 4DRHB 4J30B 5KYNA 3JZ0A 1OXKA 4JCZA 3T6BA 2R7XA 1JR8A 2IXMA 4PJMA 4QDLA 4OD5A 2GWWA 4DVZA 1LM3B 2XL8A 3EJNA 3MYFA 5F28E 4EUKB 3RQEA 2LFDA 4YT4A 1RKEA 4C3BA 1OCOC 2W4BA 2YVKA 2R02A 2V3CC 4MNDA 1WOLA 2Y39A 1VLTA 5DLJA 3S28A 3CSKA 4I3MA 3UNGC 1YLMA 3FAPB 4X0RA 2L6HA 4A4AA 4ZLCA 5L0JA 2LIGA 3QTHA 2R7QA 5E33A 4CDYA 3AOUA 4BPMA 3KPHA 1OKKD 3C63A 1QZXA 2CNWA 2J8WA 4BJ6C 4EBKA 3RQFA 1ORYA 4JTAB 5JS5A 2C03A 4QI0A 256BA 2FFHA 3M79A 3UR3C 1HY5A 1FNTc 1ZHTA 3IPMO 4MVZA 5JSLA 1CGOA 3WHNA 5L3QA 2OEVA 2YL1A 4O6NA 4IRUA 3VF0A 3NG1A 1R4TA 1TFKB 2DB4A 1RKCA 5A6JA 3RH3A 2ZPAA 5A6BD 3NYLA 1HMOA 1WASA 3FAJA 2Y3GA 4WGZA 3AGUA 3ZWIA 4CS9C 1GQAA 1OW6A 1O5HA 2VB6A 1V74B 4IAOA 2XLWA 3TJ5A 3DZAA 3Q6MA 3EFOB 2A1DD 5L3VA 3GANA 4IB4A 2H7OA 2P6VA 2AVKA 3B0UX 2NSGA 2ZXPA 4CBEA 1OCRC 2L7AA 2F22A 2HJ3A 2VH3A 2YQYA 3ZDLA 5BUOA 5F5FA 1TQGA 3U8VA 4GYTA 2J0XA 3QW0A 2R7RA 4U9DA 1RXQA 2A0BA 4HFKB 2NPUA 1PD1A 1A7DA 2Q9BA 2RD9A 3K1IC 2WVNA 1CPRA 4J7YA 2CDQA 3ASOC 4E0HA 2EIKC 4OD4A 1MMNA 4CS7A 3I5QA 4EWCA 2NUPA 2R9RB 2R7WA 1JOGA 1NLXA 3M4BA 2MHRA 3EGDA 4O79A 2ZXWC 2XM4A 4U5HA 3EPVA 4CX9A 4I1MA 1WWPA 3LS0A 3US6A 5BQIA 4KNVA 4Q5SF 2BE5F 1QPUA 1Q0GA 3M15A 4ER9A 4IGGA 2E87A 4KI2A 1G5ZA 2L9JA 1JMWA 2J9VA 2KW3C 2X0CA 5COFA 2Y69C 4BG0A 4QI2A 3HKKA 4C3EA 4KC9A 3W2VA 1VTMP 3U8PA 2J0WA 4CJOA 2W45A 4CSAC 1R5ID 2GDCA 3VYWA 5DS5A 5CI8A 2I8BA 3V5ZA 4D4NA 1AEPA 2XS1A 3K1HA 3AG4C 2XXAB 1ZU4A 3RW0A 2YLIA 2CGEA 2B0JA 5L0IA 1Z5ZA 4XLPF 3GM1A 4Z9JA 1E83A 2WL8A 5HV9A 1H6GA 3J06A 4NC3A 3M4CA 1T9KA 3JRMO 4XPXA 3HNKA 3WAQA 2HFIA 4AE4A 3N2ZB 1LS4A 4R32A 2NSFA 3I4UA 4ANJA 4CSAA 1OXBA 3EGDB 1QLEC 5A69A 4N6HA 3EZIA 1GS9A 5L0GA 1NG1A 2VCAA 1QSPA 1OR2A 4H4KC 2CCYA 1TWGA 2XLMA 1T5OA 3AGTA 3FXHA 3S27A 5JLIA 4U5GA 3BRJA 2KC3A 3DMDA 3EG9B 1T6UA 4JTCB 3ECSA 2EPLX 4AX2A 4ULVA 4EKWA 5BQHA 1BBHA 3DD7A 1I5NA 5JUAA 3AQCA 2XL6A 2J9UA 4YL3A 4EBBA 5DS6A 3QVYA 4DJ9A 2D5RB 2W9YA 2O9XA 3EHMA 4OIOF 2QNLA 2FGYA 2XSEA 1APCA 4E7SA 5EGYA 5L0DA 4U5BE 1MNEA 1MQVA 3EG9A 1LE2A 3GWLA 5KYXB 3MFNA 2KGOA 3UGOA 3LLKA 2HV6A 2A0UA 1V55C 1K05A 1O87A 1IW7F 4AE4B 2J46A 2V26A 3HNLA 3GM3A 2QY9A 3K6BA 3GEEA 3O39A 1Y4CA 4LERA 4Q7CA 1WN0A 1G8XA 3HTKC 5T1DB 1F1MA 1ZYRF 1HW2A 3S9OA 3SYNA 3ZQVA 3B9QA 5D92A 1JPJA 1E86A 4PJJA 4Z9HA 1D1BA 3HNIA 4PFPA 3ZSUA 3EZHA 1VLSA 2OG2A 4G7HF 3QZCA 1SYQA 1YJGA 2IXOA 3HLZA 1SMYF 1Z6AA 2M4EA 2OCCC 1B68A 4DXWA 1EKYA 3JYHA 3TOLA 3X2QC 4YT5A 2CNWD 2H8AA 2JPUA 2M64A 5E2QA 5IY5C 3K66A 3PHF2 2R03A 2IXNA 2HZ8A 2HMQA 1G4US 2KK1A 4MVMA 5AC4A 1U0BB 1T6QA 3DM5A 4JEBA 1CGME 3O10A 3SXYA 1OW8A 3IQ5A 2HV7A 3TQOA 4BJTA 2A6EF 1HE9A 3DE9A 2WZLA 1K04A 5JT4A 4NCQA 4EIYA 1J8MF 3DI5A 3H2UA 1LPEA 3VAYA 1YARO 3IQCA 1M57C 4FESA 4JW1A 4P9FA 4AL1A 3EFOA 5EK0A 3WG7C 4BJ6A 1FMWA 1E85A 5L0CA 1ORSC 5KYUA 3LJBA 1VB5A 3NKEA 3T6JA 3L8IA 3LUTB 1M2VB 2EINC 3V7OA 3ZC4A 4C3DA 3RFYA 2IOQA 2TMVP 1W2WA 2XXAA 1U89A 1HMDA 4P6IC 4YT8A 2QUPA 2R7VA 4XEFA 2A6HF 1C03A 3QW1A 3EHNA 3RVYA 1OKKA 2L81A 4KBLA 2W4MA 4LDRA 4CIPA 4G78A 1LKXA 1C02A 5COMA 3VM6A 5CI9A 3NKDA 2CW0F 2OEXA 5B1AC 4K7BA 1D1CA 1D0YA 4EBJA 4CIHA 1ZHZA 5HSWA 3AJMA 2EIJC 3GM2A 4E0IA 3C8GD 3FDQA 5DQZA 3T4RA 1S7ZA 2KNHA 1C17M 3JYYA 4CS8A 3W8IA 5GPGB 4LLEA 2JX0A 2CYDA 4LLCA 4MVUA 2UUIA 1NU9C 4Z9IA 1OCZC 2A69F 3S84A 1WATA 1CPQA 1V54C 2IBFA 3RYLA 3FHDA 3QVZA 4MVQA 4E7ZA 5EHHA 3NRHA 3LNMB 2GAQA 2YL3A 3MLGA 1L7CA 1VYIA 1IZMA 4WABA 1NSGB 2WZGA 2PX3A 4HE8D 1FR0A 3C62A 3DAFA 4JRZA 4XWJA 3T9OA 1ZW3A 2XLVA 1ST6A 2XRHA 2KJGA 1T6IA 2YHSA 3SP1A 2YL7A 4PR9A 1Z3IX 3K33A 3AQBA 1BZ4A 2DYRC 2HSBA 2JD3A 2ZXRA 3NMJA 4FWVA 3DAGA 1Z23A 4B6IA 2J7PA 1UG7A 4BEJA 4CDAA 4RBNA 1ZZPA 4MW8A 3UMKA 1D1AA 2IM8A 3CZ6A 3KL4A 4JVSA 4E17A 2OQMA 1Q0FA 3LESA 3T6GB 3Q6NA 3SNHA 2GFHA 2WVOA 2P61A 1JPNA 2HMZA 4DBRA 3JCUQ 4YT2A 1YA7O 2R7OA 2Q4FA 3V5YA 1SF8A 2PX0A 2AWYA 2C04A 4YJWA 5A6KA 2DYSC 1AUEA 1LI5A 3TK0A 2YKZA 1NFNA 1NZEA 5COGA 4KNWA 5E3AA 3GORA 3FOOA 3A11A 4XTKA 3TULA 3EGXA 2D4UA 2PF4E 4MW3A 3KYJA 3C18A 4RDAA 3B0VC 1S05A 4PK4A 4D4XA 1FAPB 4L6RA 4GQHA 3WODF 2AWCA 3C7JA 2IYLD 3GWNA 3I5PA 1A41A 4JKVA 4G7OF 2VCBA 3FOPA 3A9CA 1Y6DA 4GEHA 2Q7RA 1Q0MA 3QMKA 4MVOA 1ZU5A 4FAPB 1LVKA 2HSQA 2I15A 4LDQA 5AGFA 1ZHWA 5L0FA 1TKNA 1TWAA 4J7TA 2YRFA 1Z63A 2Q9CA 1QQ3A 2XLHA 1HE1A 1WTYA 2J9BA 1E84A 1D0ZA 2DI3A 3LLIA 2RSEB 2XLEA 4F4BA 2YLDA 3PDMP 1GM5A 5BQGA 2WZFA 3ABLC 3K7DA 4JURI 1A7EA 2HS5A 1NFOA 3BEHA 4JTDB 1KNYA 4H54A 5KYUB 1I4ZA 2YWAA 2PNOA 3FVYA 1FFTC 3RF3A 3U2MA 4J32B 4U5FE 4LDKA 5T3TA 5T3WA 3L34A 5JP7A 3S29A 5KYWB 1PCXA 4HFFB 1KTMA 3E9VA 5A6BA 1UFBA 3L1MA 1Q0KA 2YL0A 3G4ZA 2R25A 2HUJA 3U0CA 3AG2C 1ZW2A 2BL2A 3SXMA 1TR2A 2EPNA 1D0XA 3R2PA 4XPWA 2XM0A 3VRCA 3JTLO 1MMDA 1XZPA 4U9EA 4OIRF 3HJCA 4BJ1A 3O6XA 4DBQA 2LCHA 1FMVA 4JJFA 2QTVA 3MX3A 3NYMA 4PJNA 3ZG1A 4CS8C 2OJED 1LE4A 5E3CA 4OINF 1V4AA 3KH2A 3DXJF 5KYWA
chains in the Genus database with same CATH topology
1VLTA 1WATA 3ATPA 2ASRA 1VLSA 1LIHA 3T9OA 1JMWA 1WASA 4H54A 2D4UA 2LIGA 4Z9JA 4Z9IA 4Z9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLT A;  1WAT A;  3ATP A;  2ASR A;  1VLS A;  1LIH A;  3T9O A;  1JMW A;  1WAS A;  4H54 A;  2D4U A;  2LIG A;  4Z9J A;  4Z9I A;  4Z9H A; 
#chains in the Genus database with same CATH topology
 1PD0 A;  1YYJ A;  3IHU A;  5KYY B;  2J9W A;  2ICW G;  2LD6 A;  2H7B A;  2NUT B;  3ZTZ A;  1M2O A;  3JRT A;  2Y3B A;  3M1C B;  1BR4 A;  4JE9 A;  1RKE B;  4MVR A;  4JCH A;  4CDV A;  1M56 C;  2EPM X;  3G4X A;  3F47 A;  2B0H A;  4JEA A;  3W8H A;  2EPO A;  3GEI A;  3TOM A;  3ZIB A;  4AL0 A;  3GEH A;  2ZD9 A;  3UGP A;  3DJN B;  2LK4 A;  3C8G B;  5B3S C;  1YZA A;  1YYX A;  1NBB A;  3RVZ A;  2G3V A;  2LP4 A;  2P0N A;  1A0B A;  3B0P A;  3MYI A;  4N6C A;  4BJ5 A;  1ZHY A;  4EHP A;  3L8J A;  2WVQ A;  1FTS A;  4JC7 A;  4NTB A;  4IAQ A;  2XS8 A;  2OOC A;  4IWB A;  2Y3D A;  4JJG A;  4NQF A;  4E18 A;  1RJ9 A;  2R7S A;  3SZR A;  3IEE A;  4I1O B;  3TJ6 A;  5K0I A;  2Q9A A;  2J7P D;  1EA8 A;  4YK5 A;  1KU2 A;  3C8Z A;  2R7T A;  4DRJ B;  5JRA A;  4BJ5 C;  1K40 A;  4XLN F;  1N1C A;  5A6A A;  4MS2 A;  4DVY P;  4XPY A;  2P7V A;  3C8G A;  1I4Y A;  2P1A A;  1AVO B;  2Y3H A;  3IQT A;  2DGJ A;  3KMI A;  4FX5 A;  4RD9 A;  2YEV A;  3EH1 A;  2HJM A;  2PBE A;  3G50 A;  3ZQY A;  4YWQ A;  4XEK A;  3RKO F;  5DVW A;  2L6G A;  3U9J A;  1GGQ A;  1YA9 A;  2OKU A;  2Q00 A;  3KKB A;  3W4Y A;  4HEA J;  4O6M A;  1MND A;  5L0H A;  3H2V A;  4JZA A;  1ZVZ A;  2AU5 A;  3JSZ A;  4U5D E;  3V5X A;  3B29 A;  1LIH A;  4MQ9 F;  1G4W R;  3CQZ A;  3KYI A;  3GOD A;  2EIM C;  2MWQ A;  3EQL F;  2OU6 A;  2G3K A;  3NMK A;  3JSE O;  3DE8 A;  4PAC A;  3DWW A;  1FFH A;  4MVS A;  1HW1 A;  4MTO A;  2Q3T A;  2YZS A;  1SR2 A;  3U3F A;  2ASR A;  2KYH A;  3PCV A;  3X1O A;  3AG3 C;  4ZLD A;  4G0H A;  3TD7 A;  3ZTM A;  3K1I A;  1M2V A;  1YZC A;  3SXK A;  1O3U A;  1ORJ A;  3CEX A;  4OIQ F;  4P9T A;  2HKV A;  2LSE A;  5B3I A;  1RMV A;  3N24 A;  2IXP A;  3FMS A;  3LNR A;  5KYX A;  2ZXO A;  1H9G A;  2H7V C;  5FZT A;  3Q7L A;  3SXZ A;  3RQG A;  1A7V A;  1OCC C;  1SZI A;  3ATP A;  4U5C E;  2NUP B;  1LS1 A;  3N0T A;  3RIP A;  5DQT A;  1JAF A;  5DS4 A;  3LAY A;  2L6F A;  4NTA A;  2R7U A;  1TWH A;  4I44 A;  3IQ6 A;  2VAS A;  4ULW A;  3F46 A;  5JVE A;  4YL0 A;  3ABK C;  2FAP B;  3R7C A;  1DOV A;  1H7I A;  1OW7 A;  1CGN A;  4AK9 A;  4G7Z F;  3ZVR A;  3L0I A;  5KYY A;  3POV A;  1RJ9 B;  1VMA A;  3ABM C;  3DKA A;  3EGX B;  3HNJ A;  2MYS A;  4PFO A;  4W8P A;  4DOZ A;  3S0X A;  4MTF A;  1BR2 A;  1EI7 A;  1VK5 A;  4W8K A;  4C7O B;  1YVI A;  1J8Y F;  1YDI A;  1MMG A;  1QVX A;  2A68 F;  3W2W A;  1XWJ A;  4O7G A;  4A2N B;  4Q4Z F;  2NG1 A;  3DJU B;  1H9T A;  1ZHX A;  1WGW A;  4JIO A;  3NMI A;  3LS1 A;  5FCL A;  3ASN C;  1JRA A;  2KSF A;  1RCP A;  5B1B C;  4BEM J;  4DRI B;  1EQ1 A;  4XQ1 A;  3UMI A;  5D91 A;  2QE9 A;  3OA1 A;  3DM9 B;  3NDB B;  3SEO A;  4U5E E;  4CJG A;  4NTF A;  1VYK A;  3O55 A;  4OIP F;  1OR3 A;  1LI7 A;  1OQC A;  3EH2 A;  4IJJ A;  4K1O A;  4N4W A;  4O6Y A;  4XEV A;  3UMH A;  3U2L A;  1TWC A;  4ONS A;  1Q0D A;  2LFF A;  1L3P A;  2YLG A;  2XLD A;  3OWT A;  1XZQ A;  1E2X A;  3JT1 A;  2BC5 A;  3E70 C;  4MTG A;  5CIV A;  2G62 A;  2WB7 A;  3U5S A;  1DOW A;  2VC9 A;  1BDJ B;  1M6T A;  2AP3 A;  2QLA A;  2VCC A;  4PJL A;  4M63 A;  4NY3 A;  2PP4 A;  3Q7G A;  5AC5 A;  3LEO A;  3PMR A;  2R05 A;  4K0D A;  1Z7Q c;  5F5H A;  2EPK X;  2LQG A;  3OEO A;  3LEV A;  1U6H A;  4YL1 A;  1YAU O;  2NUT A;  4CS9 A;  3CAX A;  1PV3 A;  2KQ9 A;  2PFD A;  2Z15 A;  3AG1 C;  3ITF A;  4IAR A;  3NYJ A;  3S90 A;  1MMA A;  2ETS A;  1TFO B;  3B71 A;  1VOM A;  2XLO A;  1T01 A;  2X51 A;  4C7O A;  1NU7 D;  4UDV A;  2XL4 A;  3MBG A;  2OJQ A;  2GA0 A;  3U3B A;  2J45 A;  2UUH A;  1BR1 A;  4N06 A;  3H65 A;  1QKR A;  4LAC B;  4WGY A;  4YN0 B;  3U9M A;  4WJ0 A;  2EIL C;  5TJ5 E;  4DRH B;  4J30 B;  5KYN A;  3JZ0 A;  1OXK A;  4JCZ A;  3T6B A;  2R7X A;  1JR8 A;  2IXM A;  4PJM A;  4QDL A;  4OD5 A;  2GWW A;  4DVZ A;  1LM3 B;  2XL8 A;  3EJN A;  3MYF A;  5F28 E;  4EUK B;  3RQE A;  2LFD A;  4YT4 A;  1RKE A;  4C3B A;  1OCO C;  2W4B A;  2YVK A;  2R02 A;  2V3C C;  4MND A;  1WOL A;  2Y39 A;  1VLT A;  5DLJ A;  3S28 A;  3CSK A;  4I3M A;  3UNG C;  1YLM A;  3FAP B;  4X0R A;  2L6H A;  4A4A A;  4ZLC A;  5L0J A;  2LIG A;  3QTH A;  2R7Q A;  5E33 A;  4CDY A;  3AOU A;  4BPM A;  3KPH A;  1OKK D;  3C63 A;  1QZX A;  2CNW A;  2J8W A;  4BJ6 C;  4EBK A;  3RQF A;  1ORY A;  4JTA B;  5JS5 A;  2C03 A;  4QI0 A;  256B A;  2FFH A;  3M79 A;  3UR3 C;  1HY5 A;  1FNT c;  1ZHT A;  3IPM O;  4MVZ A;  5JSL A;  1CGO A;  3WHN A;  5L3Q A;  2OEV A;  2YL1 A;  4O6N A;  4IRU A;  3VF0 A;  3NG1 A;  1R4T A;  1TFK B;  2DB4 A;  1RKC A;  5A6J A;  3RH3 A;  2ZPA A;  5A6B D;  3NYL A;  1HMO A;  1WAS A;  3FAJ A;  2Y3G A;  4WGZ A;  3AGU A;  3ZWI A;  4CS9 C;  1GQA A;  1OW6 A;  1O5H A;  2VB6 A;  1V74 B;  4IAO A;  2XLW A;  3TJ5 A;  3DZA A;  3Q6M A;  3EFO B;  2A1D D;  5L3V A;  3GAN A;  4IB4 A;  2H7O A;  2P6V A;  2AVK A;  3B0U X;  2NSG A;  2ZXP A;  4CBE A;  1OCR C;  2L7A A;  2F22 A;  2HJ3 A;  2VH3 A;  2YQY A;  3ZDL A;  5BUO A;  5F5F A;  1TQG A;  3U8V A;  4GYT A;  2J0X A;  3QW0 A;  2R7R A;  4U9D A;  1RXQ A;  2A0B A;  4HFK B;  2NPU A;  1PD1 A;  1A7D A;  2Q9B A;  2RD9 A;  3K1I C;  2WVN A;  1CPR A;  4J7Y A;  2CDQ A;  3ASO C;  4E0H A;  2EIK C;  4OD4 A;  1MMN A;  4CS7 A;  3I5Q A;  4EWC A;  2NUP A;  2R9R B;  2R7W A;  1JOG A;  1NLX A;  3M4B A;  2MHR A;  3EGD A;  4O79 A;  2ZXW C;  2XM4 A;  4U5H A;  3EPV A;  4CX9 A;  4I1M A;  1WWP A;  3LS0 A;  3US6 A;  5BQI A;  4KNV A;  4Q5S F;  2BE5 F;  1QPU A;  1Q0G A;  3M15 A;  4ER9 A;  4IGG A;  2E87 A;  4KI2 A;  1G5Z A;  2L9J A;  1JMW A;  2J9V A;  2KW3 C;  2X0C A;  5COF A;  2Y69 C;  4BG0 A;  4QI2 A;  3HKK A;  4C3E A;  4KC9 A;  3W2V A;  1VTM P;  3U8P A;  2J0W A;  4CJO A;  2W45 A;  4CSA C;  1R5I D;  2GDC A;  3VYW A;  5DS5 A;  5CI8 A;  2I8B A;  3V5Z A;  4D4N A;  1AEP A;  2XS1 A;  3K1H A;  3AG4 C;  2XXA B;  1ZU4 A;  3RW0 A;  2YLI A;  2CGE A;  2B0J A;  5L0I A;  1Z5Z A;  4XLP F;  3GM1 A;  4Z9J A;  1E83 A;  2WL8 A;  5HV9 A;  1H6G A;  3J06 A;  4NC3 A;  3M4C A;  1T9K A;  3JRM O;  4XPX A;  3HNK A;  3WAQ A;  2HFI A;  4AE4 A;  3N2Z B;  1LS4 A;  4R32 A;  2NSF A;  3I4U A;  4ANJ A;  4CSA A;  1OXB A;  3EGD B;  1QLE C;  5A69 A;  4N6H A;  3EZI A;  1GS9 A;  5L0G A;  1NG1 A;  2VCA A;  1QSP A;  1OR2 A;  4H4K C;  2CCY A;  1TWG A;  2XLM A;  1T5O A;  3AGT A;  3FXH A;  3S27 A;  5JLI A;  4U5G A;  3BRJ A;  2KC3 A;  3DMD A;  3EG9 B;  1T6U A;  4JTC B;  3ECS A;  2EPL X;  4AX2 A;  4ULV A;  4EKW A;  5BQH A;  1BBH A;  3DD7 A;  1I5N A;  5JUA A;  3AQC A;  2XL6 A;  2J9U A;  4YL3 A;  4EBB A;  5DS6 A;  3QVY A;  4DJ9 A;  2D5R B;  2W9Y A;  2O9X A;  3EHM A;  4OIO F;  2QNL A;  2FGY A;  2XSE A;  1APC A;  4E7S A;  5EGY A;  5L0D A;  4U5B E;  1MNE A;  1MQV A;  3EG9 A;  1LE2 A;  3GWL A;  5KYX B;  3MFN A;  2KGO A;  3UGO A;  3LLK A;  2HV6 A;  2A0U A;  1V55 C;  1K05 A;  1O87 A;  1IW7 F;  4AE4 B;  2J46 A;  2V26 A;  3HNL A;  3GM3 A;  2QY9 A;  3K6B A;  3GEE A;  3O39 A;  1Y4C A;  4LER A;  4Q7C A;  1WN0 A;  1G8X A;  3HTK C;  5T1D B;  1F1M A;  1ZYR F;  1HW2 A;  3S9O A;  3SYN A;  3ZQV A;  3B9Q A;  5D92 A;  1JPJ A;  1E86 A;  4PJJ A;  4Z9H A;  1D1B A;  3HNI A;  4PFP A;  3ZSU A;  3EZH A;  1VLS A;  2OG2 A;  4G7H F;  3QZC A;  1SYQ A;  1YJG A;  2IXO A;  3HLZ A;  1SMY F;  1Z6A A;  2M4E A;  2OCC C;  1B68 A;  4DXW A;  1EKY A;  3JYH A;  3TOL A;  3X2Q C;  4YT5 A;  2CNW D;  2H8A A;  2JPU A;  2M64 A;  5E2Q A;  5IY5 C;  3K66 A;  3PHF 2;  2R03 A;  2IXN A;  2HZ8 A;  2HMQ A;  1G4U S;  2KK1 A;  4MVM A;  5AC4 A;  1U0B B;  1T6Q A;  3DM5 A;  4JEB A;  1CGM E;  3O10 A;  3SXY A;  1OW8 A;  3IQ5 A;  2HV7 A;  3TQO A;  4BJT A;  2A6E F;  1HE9 A;  3DE9 A;  2WZL A;  1K04 A;  5JT4 A;  4NCQ A;  4EIY A;  1J8M F;  3DI5 A;  3H2U A;  1LPE A;  3VAY A;  1YAR O;  3IQC A;  1M57 C;  4FES A;  4JW1 A;  4P9F A;  4AL1 A;  3EFO A;  5EK0 A;  3WG7 C;  4BJ6 A;  1FMW A;  1E85 A;  5L0C A;  1ORS C;  5KYU A;  3LJB A;  1VB5 A;  3NKE A;  3T6J A;  3L8I A;  3LUT B;  1M2V B;  2EIN C;  3V7O A;  3ZC4 A;  4C3D A;  3RFY A;  2IOQ A;  2TMV P;  1W2W A;  2XXA A;  1U89 A;  1HMD A;  4P6I C;  4YT8 A;  2QUP A;  2R7V A;  4XEF A;  2A6H F;  1C03 A;  3QW1 A;  3EHN A;  3RVY A;  1OKK A;  2L81 A;  4KBL A;  2W4M A;  4LDR A;  4CIP A;  4G78 A;  1LKX A;  1C02 A;  5COM A;  3VM6 A;  5CI9 A;  3NKD A;  2CW0 F;  2OEX A;  5B1A C;  4K7B A;  1D1C A;  1D0Y A;  4EBJ A;  4CIH A;  1ZHZ A;  5HSW A;  3AJM A;  2EIJ C;  3GM2 A;  4E0I A;  3C8G D;  3FDQ A;  5DQZ A;  3T4R A;  1S7Z A;  2KNH A;  1C17 M;  3JYY A;  4CS8 A;  3W8I A;  5GPG B;  4LLE A;  2JX0 A;  2CYD A;  4LLC A;  4MVU A;  2UUI A;  1NU9 C;  4Z9I A;  1OCZ C;  2A69 F;  3S84 A;  1WAT A;  1CPQ A;  1V54 C;  2IBF A;  3RYL A;  3FHD A;  3QVZ A;  4MVQ A;  4E7Z A;  5EHH A;  3NRH A;  3LNM B;  2GAQ A;  2YL3 A;  3MLG A;  1L7C A;  1VYI A;  1IZM A;  4WAB A;  1NSG B;  2WZG A;  2PX3 A;  4HE8 D;  1FR0 A;  3C62 A;  3DAF A;  4JRZ A;  4XWJ A;  3T9O A;  1ZW3 A;  2XLV A;  1ST6 A;  2XRH A;  2KJG A;  1T6I A;  2YHS A;  3SP1 A;  2YL7 A;  4PR9 A;  1Z3I X;  3K33 A;  3AQB A;  1BZ4 A;  2DYR C;  2HSB A;  2JD3 A;  2ZXR A;  3NMJ A;  4FWV A;  3DAG A;  1Z23 A;  4B6I A;  2J7P A;  1UG7 A;  4BEJ A;  4CDA A;  4RBN A;  1ZZP A;  4MW8 A;  3UMK A;  1D1A A;  2IM8 A;  3CZ6 A;  3KL4 A;  4JVS A;  4E17 A;  2OQM A;  1Q0F A;  3LES A;  3T6G B;  3Q6N A;  3SNH A;  2GFH A;  2WVO A;  2P61 A;  1JPN A;  2HMZ A;  4DBR A;  3JCU Q;  4YT2 A;  1YA7 O;  2R7O A;  2Q4F A;  3V5Y A;  1SF8 A;  2PX0 A;  2AWY A;  2C04 A;  4YJW A;  5A6K A;  2DYS C;  1AUE A;  1LI5 A;  3TK0 A;  2YKZ A;  1NFN A;  1NZE A;  5COG A;  4KNW A;  5E3A A;  3GOR A;  3FOO A;  3A11 A;  4XTK A;  3TUL A;  3EGX A;  2D4U A;  2PF4 E;  4MW3 A;  3KYJ A;  3C18 A;  4RDA A;  3B0V C;  1S05 A;  4PK4 A;  4D4X A;  1FAP B;  4L6R A;  4GQH A;  3WOD F;  2AWC A;  3C7J A;  2IYL D;  3GWN A;  3I5P A;  1A41 A;  4JKV A;  4G7O F;  2VCB A;  3FOP A;  3A9C A;  1Y6D A;  4GEH A;  2Q7R A;  1Q0M A;  3QMK A;  4MVO A;  1ZU5 A;  4FAP B;  1LVK A;  2HSQ A;  2I15 A;  4LDQ A;  5AGF A;  1ZHW A;  5L0F A;  1TKN A;  1TWA A;  4J7T A;  2YRF A;  1Z63 A;  2Q9C A;  1QQ3 A;  2XLH A;  1HE1 A;  1WTY A;  2J9B A;  1E84 A;  1D0Z A;  2DI3 A;  3LLI A;  2RSE B;  2XLE A;  4F4B A;  2YLD A;  3PDM P;  1GM5 A;  5BQG A;  2WZF A;  3ABL C;  3K7D A;  4JUR I;  1A7E A;  2HS5 A;  1NFO A;  3BEH A;  4JTD B;  1KNY A;  4H54 A;  5KYU B;  1I4Z A;  2YWA A;  2PNO A;  3FVY A;  1FFT C;  3RF3 A;  3U2M A;  4J32 B;  4U5F E;  4LDK A;  5T3T A;  5T3W A;  3L34 A;  5JP7 A;  3S29 A;  5KYW B;  1PCX A;  4HFF B;  1KTM A;  3E9V A;  5A6B A;  1UFB A;  3L1M A;  1Q0K A;  2YL0 A;  3G4Z A;  2R25 A;  2HUJ A;  3U0C A;  3AG2 C;  1ZW2 A;  2BL2 A;  3SXM A;  1TR2 A;  2EPN A;  1D0X A;  3R2P A;  4XPW A;  2XM0 A;  3VRC A;  3JTL O;  1MMD A;  1XZP A;  4U9E A;  4OIR F;  3HJC A;  4BJ1 A;  3O6X A;  4DBQ A;  2LCH A;  1FMV A;  4JJF A;  2QTV A;  3MX3 A;  3NYM A;  4PJN A;  3ZG1 A;  4CS8 C;  2OJE D;  1LE4 A;  5E3C A;  4OIN F;  1V4A A;  3KH2 A;  3DXJ F;  5KYW A; 
#chains in the Genus database with same CATH homology
 1VLT A;  1WAT A;  3ATP A;  2ASR A;  1VLS A;  1LIH A;  3T9O A;  1JMW A;  1WAS A;  4H54 A;  2D4U A;  2LIG A;  4Z9J A;  4Z9I A;  4Z9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...