4Z9JA

Apo-tar from e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
158
structure length
158
Chain Sequence
SQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Methyl-accepting chemotaxis protein II
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 70
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9jA00
4H54A 1LIHA 2LIGA 4Z9IA 3T9OA 1VLTA 1VLSA 3ATPA 4Z9HA 4Z9JA 1WASA 1JMWA 1WATA 2D4UA 2ASRA
chains in the Genus database with same CATH superfamily
3IHUA 3B9QA 3G4XA 4YT8A 1GQAA 3HKKA 2Q4FA 1MMAA 3WG7C 1R5ID 2Q9AA 3AGUA 3B29A 1WASA 5DS4A 1ZU5A 3JYHA 3TOLA 3C8GB 3H2VA 2R05A 3AJMA 3EGDA 3HNJA 1LKXA 3ITFA 1ZW2A 2IYLD 3KH2A 5DS5A 2LQGA 1C17M 2OEVA 1D1CA 1VYKA 1Q0GA 1ZHYA 4CS9C 2ZXWC 2BL2A 2F22A 5L0GA 4MTOA 3TULA 1WGWA 4W8PA 1FNTc 2W4BA 1ZHTA 3UGOA 2AVKA 4F4BA 1YVIA 3AG4C 4I3MA 1M6TA 4J7YA 4O6MA 2LK4A 2NUTA 4ANJA 4A4AA 2KK1A 3NMIA 2XLOA 2J7PA 1T9KA 2A0UA 3JZ0A 3SXZA 5A6JA 2PX3A 1EI7A 3LNMB 3Q7GA 3ABLC 4KC9A 3NRHA 3GODA 2A68F 2UUIA 2C04A 2PFDA 2ZPAA 5E3CA 1E83A 2R7XA 2EPMX 1YYJA 2IBFA 1CGNA 2JD3A 4N06A 4XEKA 2BC5A 3C18A 3G4ZA 4AL1A 1ZU4A 2NUPA 1BR4A 4I44A 1BBHA 3SZRA 1OXBA 5FCLA 3NDBB 2HMQA 3V7OA 4LLEA 3MYIA 3O10A 1O87A 3C8ZA 4FX5A 4JTCB 4IRUA 3LS1A 3AG3C 3C63A 3V5XA 1WN0A 1ZHWA 3NYJA 2W45A 4MVOA 4JIOA 4NTAA 1YA9A 4FWVA 2L7AA 1FMVA 2MWQA 1JOGA 3U9JA 3VM6A 2WB7A 4EBBA 3IQTA 3VYWA 2XXAB 4OIQF 5B1AC 1O5HA 4I1OB 1OCOC 3I5PA 2VCAA 2M4EA 3DM5A 3IQ6A 1I4ZA 1HE9A 3UNGC 5A69A 3DXJF 3M15A 5KYYA 2L6GA 4OIOF 3LEVA 4XPYA 2WVOA 4LDKA 4BJTA 1APCA 4DXWA 3CSKA 4DBQA 2CYDA 3VF0A 2NSGA 2XRHA 2ZD9A 5K0IA 1FFHA 3RW0A 4EBKA 2C03A 2ETSA 3NMKA 2P61A 4C3EA 2OJQA 3QZCA 2R7UA 4MVRA 2HV7A 4BJ6A 2H7BA 2R7SA 2WL8A 4N6CA 3HLZA 3EFOA 4LERA 2CCYA 3R2PA 5KYXA 3C8GD 4IAQA 5KYWB 2JPUA 2P6VA 5B3SC 2R02A 3S29A 4I1MA 3M4BA 3AG2C 3TJ5A 3U8PA 2HJMA 3AQCA 2MHRA 2P7VA 1JPJA 4NTBA 1LM3B 4BJ6C 3EH1A 5D91A 3S27A 1RMVA 1KU2A 1A7VA 3O6XA 4ULWA 3EQLF 1YJGA 4YWQA 1FMWA 4KNWA 4Q4ZF 1TWGA 1Z7Qc 2WZLA 5EGYA 4YT2A 3SNHA 3RQEA 2AP3A 1U89A 5COGA 4CX9A 1E86A 4BG0A 1WWPA 4JKVA 4XPWA 4U9EA 1MNDA 2P1AA 2QY9A 1M2VA 2H7OA 4DRIB 5KYUB 1T5OA 4XEFA 4JC7A 1ZZPA 2Z15A 2MYSA 3EG9B 3N0TA 4MS2A 2XS8A 2R9RB 3CAXA 4IARA 4R32A 5A6BA 4P6IC 4U5DE 4XLPF 2V3CC 1LE2A 3LESA 3U2MA 3S90A 2QE9A 3LS0A 2IOQA 1L7CA 1MMGA 3O55A 4FAPB 2OQMA 1A7EA 4RD9A 5DQTA 3WAQA 3ATPA 1TFOB 1V55C 5BQHA 1R4TA 3U0CA 1WTYA 2J9UA 3E9VA 4N6HA 1TWHA 3QTHA 4PR9A 5DVWA 3X2QC 2Y3HA 3U5SA 3IQCA 3ZWIA 4JCZA 3DI5A 3JSEO 3KMIA 3OA1A 3QVZA 1TFKB 3B0PA 1OW6A 4WGZA 1Y6DA 4EKWA 5L0CA 3PCVA 1OCCC 1LIHA 3R7CA 1YA7O 5EHHA 2VCBA 3UMIA 5F5FA 1NLXA 1KNYA 2R7QA 4AL0A 2HUJA 5JUAA 3PHF2 2LCHA 2A6HF 3BEHA 3T4RA 3U8VA 3W4YA 5HV9A 1VB5A 1LS4A 3HNIA 3I5QA 3KYJA 4U5CE 4DRJB 5KYNA 1XZPA 1OW7A 1VOMA 5L3VA 3ECSA 3SXYA 2GFHA 4O6NA 3GWLA 1MMNA 2KSFA 1Z5ZA 1YLMA 2D5RB 2CNWA 3W2WA 4C3DA 4CIHA 2Q00A 2Y3GA 1AEPA 2Y69C 3Q6MA 4H54A 1EKYA 3LJBA 5DLJA 3L1MA 3MFNA 3ZQVA 4D4NA 1VLSA 2EIKC 2R7WA 4EUKB 4MTFA 2RSEB 4NTFA 5JT4A 2D4UA 1CGOA 1NFOA 3DE8A 3UMHA 3ZC4A 5L0DA 2YEVA 4YL0A 2DYRC 3OWTA 4B6IA 3PDMP 2XLEA 3PMRA 3AGTA 2HSQA 1G5ZA 1ORYA 1RXQA 3EGDB 3DD7A 1OXKA 4JRZA 1RJ9A 2IXNA 3IQ5A 3LNRA 3EGXA 5CI9A 2IM8A 2XM0A 3E70C 4KBLA 3DE9A 2YL7A 1LVKA 1YZAA 2G3VA 3MLGA 1JPNA 4U5HA 4U9DA 3J06A 3VAYA 3U9MA 3ZG1A 4BEMJ 5T3TA 2EPNA 4WJ0A 1AVOB 5L0IA 4XQ1A 4MW3A 4G7ZF 4DVZA 2XLWA 3FHDA 1OKKA 2OG2A 3N24A 2L6FA 2NUTB 4P9FA 4YT4A 3AG1C 4E17A 2KC3A 4MVZA 1GGQA 3TJ6A 3G50A 4U5FE 2LD6A 4HE8D 1QKRA 1UFBA 1V54C 4RBNA 3DAGA 3DKAA 3FVYA 2A0BA 1SR2A 4RDAA 1TR2A 1ORJA 2OJED 2A6EF 3GM2A 5BUOA 3EZHA 1CPQA 4YT5A 5L0HA 1BR1A 1JRAA 1G8XA 3SP1A 5JLIA 1SF8A 2NUPB 2J9WA 2ICWG 4CSAC 4NQFA 1E2XA 3L34A 5DQZA 4ZLCA 2I15A 3GEIA 1RKCA 3CQZA 2OOCA 3I4UA 3NKDA 5JVEA 5L0JA 1NU9C 2L9JA 1T01A 2JX0A 2KW3C 4J30B 4YL1A 5GPGB 5CIVA 1K05A 1E85A 1Z63A 1XWJA 2FAPB 4PJJA 4X0RA 2WZGA 4HEAJ 3GORA 5T1DB 4OIRF 1Q0KA 4GEHA 2XLDA 4CDAA 2H7VC 1ORSC 2CDQA 2BE5F 3JT1A 3FOPA 5KYYB 1TKNA 3ABKC 4PJMA 4U5BE 2YL1A 1FTSA 2XL4A 3US6A 4YJWA 1PCXA 2HV6A 3KYIA 4JW1A 4G7HF 3ABMC 4U5GA 1Q0DA 2J9VA 4G7OF 1D0XA 2Q3TA 5JP7A 2YLGA 4MVQA 1SZIA 2Y39A 4CS8A 3LAYA 1RKEA 1NG1A 3S9OA 1LS1A 3EFOB 4HFKB 2YVKA 3RYLA 5KYXB 4IWBA 4MQ9F 3MYFA 2IXMA 3KKBA 2PBEA 1Q0FA 3TQOA 1ST6A 3K7DA 4MW8A 2R7VA 4YN0B 3F46A 2W9YA 2YZSA 3T9OA 3CZ6A 4YK5A 3TK0A 2YLDA 4XLNF 3Q7LA 3C7JA 4DBRA 2HKVA 1ZVZA 2ZXPA 1TWCA 4HFFB 5AGFA 1IZMA 3TOMA 2A69F 4J32B 4WGYA 3WHNA 4CIPA 2NPUA 2PX0A 3M1CB 4H4KC 1QSPA 4BJ1A 4KNVA 4ONSA 3RIPA 4BEJA 4C7OA 4CSAA 5JRAA 1CPRA 4MTGA 3W8HA 3JTLO 2J7PD 3K1IA 5FZTA 1M2VB 1HE1A 5A6AA 1BZ4A 3GEEA 4M63A 4MVSA 4JJGA 1D1BA 3RFYA 3ZTZA 4EIYA 1A7DA 1YYXA 4OD5A 3RQGA 3EJNA 3ASNC 3LEOA 3LLIA 5EK0A 4DRHB 1OR2A 3MBGA 2Q7RA 4E0IA 3FDQA 4G78A 2P0NA 2UUHA 4LDQA 4KI2A 2EIJC 3NKEA 4L6RA 4OD4A 4AE4A 1V4AA 2YHSA 2ASRA 2YL3A 3U3FA 2DB4A 3ZTMA 1YARO 2DGJA 2XSEA 1UG7A 5A6KA 1CGME 4E7ZA 1VMAA 1VK5A 2LFFA 2KYHA 1H9TA 1QQ3A 4JURI 4K7BA 2PF4E 3H65A 5L0FA 2W4MA 4E7SA 1H6GA 2ZXRA 3L8IA 1HMDA 1FAPB 4YL3A 1Z23A 4O7GA 2J8WA 2LFDA 4IAOA 4PK4A 3IPMO 3L8JA 5D92A 2WVQA 5E33A 3LUTB 1SMYF 1K40A 3IEEA 1EA8A 3Q6NA 1NFNA 1Q0MA 3GM3A 5B1BC 4D4XA 5AC4A 3UGPA 3POVA 4ZLDA 3EPVA 1NZEA 4PACA 4JEBA 2FGYA 2R7TA 2J9BA 2Y3BA 3GWNA 3AOUA 3HNKA 3A11A 3JCUQ 1A0BA 1MNEA 3M79A 1I4YA 3RVYA 3VRCA 3DM9B 4CS7A 1B68A 4E0HA 3RF3A 5JS5A 2R7RA 1NBBA 4BPMA 4UDVA 3DAFA 2HSBA 2XL8A 3QW1A 4MNDA 3RQFA 1W2WA 5HSWA 4JZAA 1OQCA 3C8GA 1EQ1A 3NYMA 3ASOC 2HJ3A 4NCQA 1LE4A 3SEOA 4CDVA 3DWWA 2R7OA 1VLTA 1LPEA 3JRMO 4Q7CA 4Z9JA 3N2ZB 1VTMP 4ER9A 4CJGA 3KL4A 1C02A 3ZSUA 4CS9A 1TWAA 1IW7F 3DZAA 5E3AA 2G3KA 3UMKA 5B3IA 1JR8A 2M64A 3BRJA 4JEAA 2NG1A 3RH3A 2FFHA 1K04A 1HY5A 1RCPA 1C03A 1S05A 3EHNA 2OEXA 4JE9A 1RJ9B 4JTDB 2I8BA 1T6UA 2KJGA 3GM1A 3EGXB 4Z9IA 3ZQYA 1G4WR 3U3BA 1HW2A 4JCHA 2EILC 4XWJA 2QTVA 1D1AA 2XM4A 3ZDLA 2YQYA 4Z9HA 2TMVP 4XTKA 4A2NB 3JYYA 2VASA 2X51A 4W8KA 3RKOF 3NYLA 3CEXA 4LLCA 5A6BD 3EHMA 1O3UA 1VYIA 1Z6AA 3WODF 2QUPA 4ULVA 2B0HA 1S7ZA 1DOWA 2Y3DA 3S84A 4JTAB 2PP4A 2G62A 2KGOA 1Z3IX 4AK9A 1Y4CA 1FFTC 2EPLX 3FOOA 2PNOA 3RVZA 1M56C 3ZVRA 1H7IA 1NSGB 4N4WA 3DJNB 1OCRC 4K1OA 4QDLA 2NSFA 4OINF 1PD1A 1DOVA 3JSZA 5BQIA 4Q5SF 2OCCC 5CI8A 3ZIBA 2XXAA 1F1MA 1D0YA 2XLMA 2EPOA 2V26A 1YDIA 3QVYA 5DS6A 2WVNA 5COMA 1AUEA 4JJFA 1E84A 2KNHA 1MQVA 3K6BA 4PFPA 2LP4A 2QNLA 5L3QA 2AU5A 1MMDA 3EH2A 1YZCA 3TD7A 1A41A 4PJNA 1NU7D 3LLKA 3HJCA 3OEOA 4GYTA 3U2LA 3T6GB 4MVMA 4QI2A 4WABA 4EHPA 3L0IA 4U5EE 1QPUA 2CNWD 3GEHA 3M4CA 1QVXA 4NY3A 3FXHA 5COFA 2YLIA 1T6IA 2J46A 3NMJA 3JRTA 2L81A 2J0WA 1OCZC 4FESA 3W2VA 5KYWA 3AQBA 1WOLA 4J7TA 1ZHXA 2CW0F 1LI5A 2ZXOA 4IB4A 3DJUB 4CS8C 3HTKC 3C62A 2R25A 1RKEB 2OU6A 1PD0A 3S0XA 1FR0A 2AWYA 2HFIA 5JSLA 2HZ8A 4CJOA 3O39A 4GQHA 3DMDA 5AC5A 1OW8A 2J45A 1GM5A 2IXOA 2EINC 5BQGA 4AX2A 1BDJB 2X0CA 2XS1A 3KPHA 4BJ5A 3NG1A 1QLEC 2E87A 2J0XA 4DJ9A 4O6YA 1TQGA 4P9TA 5KYUA 4DVYP 2OKUA 2AWCA 2XLHA 1OR3A 1J8YF 3SYNA 3EG9A 2DYSC 4IJJA 2YWAA 3QW0A 2DI3A 1OKKD 2GWWA 3B0UX 2HS5A 3FAPB 1N1CA 2Q9CA 2XLVA 5T3WA 4C7OB 256BA 4BJ5C 2KQ9A 2GA0A 1U6HA 2WZFA 2L6HA 1HMOA 1HW1A 2O9XA 2XL6A 3H2UA 3K1IC 3MX3A 4LACB 1ZW3A 4G0HA 1GS9A 1D0ZA 2GDCA 1QZXA 2R03A 2VCCA 2H8AA 2LSEA 4PFOA 3HNLA 1LI7A 4MVUA 4EWCA 2RD9A 3FMSA 1BR2A 2EIMC 1SYQA 2YRFA 5F28E 3T6JA 1ZYRF 2YKZA 3A9CA 4LDRA 3SXMA 2LIGA 1M2OA 2VC9A 2IXPA 4AE4B 4CDYA 3QMKA 1V74B 4PJLA 4E18A 2A1DD 2YL0A 2Q9BA 4QI0A 4IGGA 2VB6A 3K66A 1G4US 2HMZA 2EPKX 2CGEA 1WATA 3FAJA 3GANA 4EBJA 1YAUO 3EZIA 5F5HA 4OIPF 1T6QA 4DOZA 3SXKA 1L3PA 3X1OA 5E2QA 3UR3C 3F47A 3W8IA 4C3BA 1M57C 2VH3A 1JAFA 4XPXA 3S28A 1XZQA 1ZHZA 3T6BA 1H9GA 3K1HA 1KTMA 4K0DA 3V5YA 4JVSA 4XEVA 1J8MF 2GAQA 1U0BB 3V5ZA 4NC3A 3B71A 3K33A 2B0JA 1JMWA 1I5NA 4O79A 5IY5C 5TJ5E 4CBEA 3B0VC 1PV3A 2QLAA
chains in the Genus database with same CATH topology
4H54A 1LIHA 2LIGA 4Z9IA 3T9OA 1VLTA 1VLSA 3ATPA 4Z9HA 4Z9JA 1WASA 1JMWA 1WATA 2D4UA 2ASRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H54 A;  1LIH A;  2LIG A;  4Z9I A;  3T9O A;  1VLT A;  1VLS A;  3ATP A;  4Z9H A;  4Z9J A;  1WAS A;  1JMW A;  1WAT A;  2D4U A;  2ASR A; 
#chains in the Genus database with same CATH topology
 3IHU A;  3B9Q A;  3G4X A;  4YT8 A;  1GQA A;  3HKK A;  2Q4F A;  1MMA A;  3WG7 C;  1R5I D;  2Q9A A;  3AGU A;  3B29 A;  1WAS A;  5DS4 A;  1ZU5 A;  3JYH A;  3TOL A;  3C8G B;  3H2V A;  2R05 A;  3AJM A;  3EGD A;  3HNJ A;  1LKX A;  3ITF A;  1ZW2 A;  2IYL D;  3KH2 A;  5DS5 A;  2LQG A;  1C17 M;  2OEV A;  1D1C A;  1VYK A;  1Q0G A;  1ZHY A;  4CS9 C;  2ZXW C;  2BL2 A;  2F22 A;  5L0G A;  4MTO A;  3TUL A;  1WGW A;  4W8P A;  1FNT c;  2W4B A;  1ZHT A;  3UGO A;  2AVK A;  4F4B A;  1YVI A;  3AG4 C;  4I3M A;  1M6T A;  4J7Y A;  4O6M A;  2LK4 A;  2NUT A;  4ANJ A;  4A4A A;  2KK1 A;  3NMI A;  2XLO A;  2J7P A;  1T9K A;  2A0U A;  3JZ0 A;  3SXZ A;  5A6J A;  2PX3 A;  1EI7 A;  3LNM B;  3Q7G A;  3ABL C;  4KC9 A;  3NRH A;  3GOD A;  2A68 F;  2UUI A;  2C04 A;  2PFD A;  2ZPA A;  5E3C A;  1E83 A;  2R7X A;  2EPM X;  1YYJ A;  2IBF A;  1CGN A;  2JD3 A;  4N06 A;  4XEK A;  2BC5 A;  3C18 A;  3G4Z A;  4AL1 A;  1ZU4 A;  2NUP A;  1BR4 A;  4I44 A;  1BBH A;  3SZR A;  1OXB A;  5FCL A;  3NDB B;  2HMQ A;  3V7O A;  4LLE A;  3MYI A;  3O10 A;  1O87 A;  3C8Z A;  4FX5 A;  4JTC B;  4IRU A;  3LS1 A;  3AG3 C;  3C63 A;  3V5X A;  1WN0 A;  1ZHW A;  3NYJ A;  2W45 A;  4MVO A;  4JIO A;  4NTA A;  1YA9 A;  4FWV A;  2L7A A;  1FMV A;  2MWQ A;  1JOG A;  3U9J A;  3VM6 A;  2WB7 A;  4EBB A;  3IQT A;  3VYW A;  2XXA B;  4OIQ F;  5B1A C;  1O5H A;  4I1O B;  1OCO C;  3I5P A;  2VCA A;  2M4E A;  3DM5 A;  3IQ6 A;  1I4Z A;  1HE9 A;  3UNG C;  5A69 A;  3DXJ F;  3M15 A;  5KYY A;  2L6G A;  4OIO F;  3LEV A;  4XPY A;  2WVO A;  4LDK A;  4BJT A;  1APC A;  4DXW A;  3CSK A;  4DBQ A;  2CYD A;  3VF0 A;  2NSG A;  2XRH A;  2ZD9 A;  5K0I A;  1FFH A;  3RW0 A;  4EBK A;  2C03 A;  2ETS A;  3NMK A;  2P61 A;  4C3E A;  2OJQ A;  3QZC A;  2R7U A;  4MVR A;  2HV7 A;  4BJ6 A;  2H7B A;  2R7S A;  2WL8 A;  4N6C A;  3HLZ A;  3EFO A;  4LER A;  2CCY A;  3R2P A;  5KYX A;  3C8G D;  4IAQ A;  5KYW B;  2JPU A;  2P6V A;  5B3S C;  2R02 A;  3S29 A;  4I1M A;  3M4B A;  3AG2 C;  3TJ5 A;  3U8P A;  2HJM A;  3AQC A;  2MHR A;  2P7V A;  1JPJ A;  4NTB A;  1LM3 B;  4BJ6 C;  3EH1 A;  5D91 A;  3S27 A;  1RMV A;  1KU2 A;  1A7V A;  3O6X A;  4ULW A;  3EQL F;  1YJG A;  4YWQ A;  1FMW A;  4KNW A;  4Q4Z F;  1TWG A;  1Z7Q c;  2WZL A;  5EGY A;  4YT2 A;  3SNH A;  3RQE A;  2AP3 A;  1U89 A;  5COG A;  4CX9 A;  1E86 A;  4BG0 A;  1WWP A;  4JKV A;  4XPW A;  4U9E A;  1MND A;  2P1A A;  2QY9 A;  1M2V A;  2H7O A;  4DRI B;  5KYU B;  1T5O A;  4XEF A;  4JC7 A;  1ZZP A;  2Z15 A;  2MYS A;  3EG9 B;  3N0T A;  4MS2 A;  2XS8 A;  2R9R B;  3CAX A;  4IAR A;  4R32 A;  5A6B A;  4P6I C;  4U5D E;  4XLP F;  2V3C C;  1LE2 A;  3LES A;  3U2M A;  3S90 A;  2QE9 A;  3LS0 A;  2IOQ A;  1L7C A;  1MMG A;  3O55 A;  4FAP B;  2OQM A;  1A7E A;  4RD9 A;  5DQT A;  3WAQ A;  3ATP A;  1TFO B;  1V55 C;  5BQH A;  1R4T A;  3U0C A;  1WTY A;  2J9U A;  3E9V A;  4N6H A;  1TWH A;  3QTH A;  4PR9 A;  5DVW A;  3X2Q C;  2Y3H A;  3U5S A;  3IQC A;  3ZWI A;  4JCZ A;  3DI5 A;  3JSE O;  3KMI A;  3OA1 A;  3QVZ A;  1TFK B;  3B0P A;  1OW6 A;  4WGZ A;  1Y6D A;  4EKW A;  5L0C A;  3PCV A;  1OCC C;  1LIH A;  3R7C A;  1YA7 O;  5EHH A;  2VCB A;  3UMI A;  5F5F A;  1NLX A;  1KNY A;  2R7Q A;  4AL0 A;  2HUJ A;  5JUA A;  3PHF 2;  2LCH A;  2A6H F;  3BEH A;  3T4R A;  3U8V A;  3W4Y A;  5HV9 A;  1VB5 A;  1LS4 A;  3HNI A;  3I5Q A;  3KYJ A;  4U5C E;  4DRJ B;  5KYN A;  1XZP A;  1OW7 A;  1VOM A;  5L3V A;  3ECS A;  3SXY A;  2GFH A;  4O6N A;  3GWL A;  1MMN A;  2KSF A;  1Z5Z A;  1YLM A;  2D5R B;  2CNW A;  3W2W A;  4C3D A;  4CIH A;  2Q00 A;  2Y3G A;  1AEP A;  2Y69 C;  3Q6M A;  4H54 A;  1EKY A;  3LJB A;  5DLJ A;  3L1M A;  3MFN A;  3ZQV A;  4D4N A;  1VLS A;  2EIK C;  2R7W A;  4EUK B;  4MTF A;  2RSE B;  4NTF A;  5JT4 A;  2D4U A;  1CGO A;  1NFO A;  3DE8 A;  3UMH A;  3ZC4 A;  5L0D A;  2YEV A;  4YL0 A;  2DYR C;  3OWT A;  4B6I A;  3PDM P;  2XLE A;  3PMR A;  3AGT A;  2HSQ A;  1G5Z A;  1ORY A;  1RXQ A;  3EGD B;  3DD7 A;  1OXK A;  4JRZ A;  1RJ9 A;  2IXN A;  3IQ5 A;  3LNR A;  3EGX A;  5CI9 A;  2IM8 A;  2XM0 A;  3E70 C;  4KBL A;  3DE9 A;  2YL7 A;  1LVK A;  1YZA A;  2G3V A;  3MLG A;  1JPN A;  4U5H A;  4U9D A;  3J06 A;  3VAY A;  3U9M A;  3ZG1 A;  4BEM J;  5T3T A;  2EPN A;  4WJ0 A;  1AVO B;  5L0I A;  4XQ1 A;  4MW3 A;  4G7Z F;  4DVZ A;  2XLW A;  3FHD A;  1OKK A;  2OG2 A;  3N24 A;  2L6F A;  2NUT B;  4P9F A;  4YT4 A;  3AG1 C;  4E17 A;  2KC3 A;  4MVZ A;  1GGQ A;  3TJ6 A;  3G50 A;  4U5F E;  2LD6 A;  4HE8 D;  1QKR A;  1UFB A;  1V54 C;  4RBN A;  3DAG A;  3DKA A;  3FVY A;  2A0B A;  1SR2 A;  4RDA A;  1TR2 A;  1ORJ A;  2OJE D;  2A6E F;  3GM2 A;  5BUO A;  3EZH A;  1CPQ A;  4YT5 A;  5L0H A;  1BR1 A;  1JRA A;  1G8X A;  3SP1 A;  5JLI A;  1SF8 A;  2NUP B;  2J9W A;  2ICW G;  4CSA C;  4NQF A;  1E2X A;  3L34 A;  5DQZ A;  4ZLC A;  2I15 A;  3GEI A;  1RKC A;  3CQZ A;  2OOC A;  3I4U A;  3NKD A;  5JVE A;  5L0J A;  1NU9 C;  2L9J A;  1T01 A;  2JX0 A;  2KW3 C;  4J30 B;  4YL1 A;  5GPG B;  5CIV A;  1K05 A;  1E85 A;  1Z63 A;  1XWJ A;  2FAP B;  4PJJ A;  4X0R A;  2WZG A;  4HEA J;  3GOR A;  5T1D B;  4OIR F;  1Q0K A;  4GEH A;  2XLD A;  4CDA A;  2H7V C;  1ORS C;  2CDQ A;  2BE5 F;  3JT1 A;  3FOP A;  5KYY B;  1TKN A;  3ABK C;  4PJM A;  4U5B E;  2YL1 A;  1FTS A;  2XL4 A;  3US6 A;  4YJW A;  1PCX A;  2HV6 A;  3KYI A;  4JW1 A;  4G7H F;  3ABM C;  4U5G A;  1Q0D A;  2J9V A;  4G7O F;  1D0X A;  2Q3T A;  5JP7 A;  2YLG A;  4MVQ A;  1SZI A;  2Y39 A;  4CS8 A;  3LAY A;  1RKE A;  1NG1 A;  3S9O A;  1LS1 A;  3EFO B;  4HFK B;  2YVK A;  3RYL A;  5KYX B;  4IWB A;  4MQ9 F;  3MYF A;  2IXM A;  3KKB A;  2PBE A;  1Q0F A;  3TQO A;  1ST6 A;  3K7D A;  4MW8 A;  2R7V A;  4YN0 B;  3F46 A;  2W9Y A;  2YZS A;  3T9O A;  3CZ6 A;  4YK5 A;  3TK0 A;  2YLD A;  4XLN F;  3Q7L A;  3C7J A;  4DBR A;  2HKV A;  1ZVZ A;  2ZXP A;  1TWC A;  4HFF B;  5AGF A;  1IZM A;  3TOM A;  2A69 F;  4J32 B;  4WGY A;  3WHN A;  4CIP A;  2NPU A;  2PX0 A;  3M1C B;  4H4K C;  1QSP A;  4BJ1 A;  4KNV A;  4ONS A;  3RIP A;  4BEJ A;  4C7O A;  4CSA A;  5JRA A;  1CPR A;  4MTG A;  3W8H A;  3JTL O;  2J7P D;  3K1I A;  5FZT A;  1M2V B;  1HE1 A;  5A6A A;  1BZ4 A;  3GEE A;  4M63 A;  4MVS A;  4JJG A;  1D1B A;  3RFY A;  3ZTZ A;  4EIY A;  1A7D A;  1YYX A;  4OD5 A;  3RQG A;  3EJN A;  3ASN C;  3LEO A;  3LLI A;  5EK0 A;  4DRH B;  1OR2 A;  3MBG A;  2Q7R A;  4E0I A;  3FDQ A;  4G78 A;  2P0N A;  2UUH A;  4LDQ A;  4KI2 A;  2EIJ C;  3NKE A;  4L6R A;  4OD4 A;  4AE4 A;  1V4A A;  2YHS A;  2ASR A;  2YL3 A;  3U3F A;  2DB4 A;  3ZTM A;  1YAR O;  2DGJ A;  2XSE A;  1UG7 A;  5A6K A;  1CGM E;  4E7Z A;  1VMA A;  1VK5 A;  2LFF A;  2KYH A;  1H9T A;  1QQ3 A;  4JUR I;  4K7B A;  2PF4 E;  3H65 A;  5L0F A;  2W4M A;  4E7S A;  1H6G A;  2ZXR A;  3L8I A;  1HMD A;  1FAP B;  4YL3 A;  1Z23 A;  4O7G A;  2J8W A;  2LFD A;  4IAO A;  4PK4 A;  3IPM O;  3L8J A;  5D92 A;  2WVQ A;  5E33 A;  3LUT B;  1SMY F;  1K40 A;  3IEE A;  1EA8 A;  3Q6N A;  1NFN A;  1Q0M A;  3GM3 A;  5B1B C;  4D4X A;  5AC4 A;  3UGP A;  3POV A;  4ZLD A;  3EPV A;  1NZE A;  4PAC A;  4JEB A;  2FGY A;  2R7T A;  2J9B A;  2Y3B A;  3GWN A;  3AOU A;  3HNK A;  3A11 A;  3JCU Q;  1A0B A;  1MNE A;  3M79 A;  1I4Y A;  3RVY A;  3VRC A;  3DM9 B;  4CS7 A;  1B68 A;  4E0H A;  3RF3 A;  5JS5 A;  2R7R A;  1NBB A;  4BPM A;  4UDV A;  3DAF A;  2HSB A;  2XL8 A;  3QW1 A;  4MND A;  3RQF A;  1W2W A;  5HSW A;  4JZA A;  1OQC A;  3C8G A;  1EQ1 A;  3NYM A;  3ASO C;  2HJ3 A;  4NCQ A;  1LE4 A;  3SEO A;  4CDV A;  3DWW A;  2R7O A;  1VLT A;  1LPE A;  3JRM O;  4Q7C A;  4Z9J A;  3N2Z B;  1VTM P;  4ER9 A;  4CJG A;  3KL4 A;  1C02 A;  3ZSU A;  4CS9 A;  1TWA A;  1IW7 F;  3DZA A;  5E3A A;  2G3K A;  3UMK A;  5B3I A;  1JR8 A;  2M64 A;  3BRJ A;  4JEA A;  2NG1 A;  3RH3 A;  2FFH A;  1K04 A;  1HY5 A;  1RCP A;  1C03 A;  1S05 A;  3EHN A;  2OEX A;  4JE9 A;  1RJ9 B;  4JTD B;  2I8B A;  1T6U A;  2KJG A;  3GM1 A;  3EGX B;  4Z9I A;  3ZQY A;  1G4W R;  3U3B A;  1HW2 A;  4JCH A;  2EIL C;  4XWJ A;  2QTV A;  1D1A A;  2XM4 A;  3ZDL A;  2YQY A;  4Z9H A;  2TMV P;  4XTK A;  4A2N B;  3JYY A;  2VAS A;  2X51 A;  4W8K A;  3RKO F;  3NYL A;  3CEX A;  4LLC A;  5A6B D;  3EHM A;  1O3U A;  1VYI A;  1Z6A A;  3WOD F;  2QUP A;  4ULV A;  2B0H A;  1S7Z A;  1DOW A;  2Y3D A;  3S84 A;  4JTA B;  2PP4 A;  2G62 A;  2KGO A;  1Z3I X;  4AK9 A;  1Y4C A;  1FFT C;  2EPL X;  3FOO A;  2PNO A;  3RVZ A;  1M56 C;  3ZVR A;  1H7I A;  1NSG B;  4N4W A;  3DJN B;  1OCR C;  4K1O A;  4QDL A;  2NSF A;  4OIN F;  1PD1 A;  1DOV A;  3JSZ A;  5BQI A;  4Q5S F;  2OCC C;  5CI8 A;  3ZIB A;  2XXA A;  1F1M A;  1D0Y A;  2XLM A;  2EPO A;  2V26 A;  1YDI A;  3QVY A;  5DS6 A;  2WVN A;  5COM A;  1AUE A;  4JJF A;  1E84 A;  2KNH A;  1MQV A;  3K6B A;  4PFP A;  2LP4 A;  2QNL A;  5L3Q A;  2AU5 A;  1MMD A;  3EH2 A;  1YZC A;  3TD7 A;  1A41 A;  4PJN A;  1NU7 D;  3LLK A;  3HJC A;  3OEO A;  4GYT A;  3U2L A;  3T6G B;  4MVM A;  4QI2 A;  4WAB A;  4EHP A;  3L0I A;  4U5E E;  1QPU A;  2CNW D;  3GEH A;  3M4C A;  1QVX A;  4NY3 A;  3FXH A;  5COF A;  2YLI A;  1T6I A;  2J46 A;  3NMJ A;  3JRT A;  2L81 A;  2J0W A;  1OCZ C;  4FES A;  3W2V A;  5KYW A;  3AQB A;  1WOL A;  4J7T A;  1ZHX A;  2CW0 F;  1LI5 A;  2ZXO A;  4IB4 A;  3DJU B;  4CS8 C;  3HTK C;  3C62 A;  2R25 A;  1RKE B;  2OU6 A;  1PD0 A;  3S0X A;  1FR0 A;  2AWY A;  2HFI A;  5JSL A;  2HZ8 A;  4CJO A;  3O39 A;  4GQH A;  3DMD A;  5AC5 A;  1OW8 A;  2J45 A;  1GM5 A;  2IXO A;  2EIN C;  5BQG A;  4AX2 A;  1BDJ B;  2X0C A;  2XS1 A;  3KPH A;  4BJ5 A;  3NG1 A;  1QLE C;  2E87 A;  2J0X A;  4DJ9 A;  4O6Y A;  1TQG A;  4P9T A;  5KYU A;  4DVY P;  2OKU A;  2AWC A;  2XLH A;  1OR3 A;  1J8Y F;  3SYN A;  3EG9 A;  2DYS C;  4IJJ A;  2YWA A;  3QW0 A;  2DI3 A;  1OKK D;  2GWW A;  3B0U X;  2HS5 A;  3FAP B;  1N1C A;  2Q9C A;  2XLV A;  5T3W A;  4C7O B;  256B A;  4BJ5 C;  2KQ9 A;  2GA0 A;  1U6H A;  2WZF A;  2L6H A;  1HMO A;  1HW1 A;  2O9X A;  2XL6 A;  3H2U A;  3K1I C;  3MX3 A;  4LAC B;  1ZW3 A;  4G0H A;  1GS9 A;  1D0Z A;  2GDC A;  1QZX A;  2R03 A;  2VCC A;  2H8A A;  2LSE A;  4PFO A;  3HNL A;  1LI7 A;  4MVU A;  4EWC A;  2RD9 A;  3FMS A;  1BR2 A;  2EIM C;  1SYQ A;  2YRF A;  5F28 E;  3T6J A;  1ZYR F;  2YKZ A;  3A9C A;  4LDR A;  3SXM A;  2LIG A;  1M2O A;  2VC9 A;  2IXP A;  4AE4 B;  4CDY A;  3QMK A;  1V74 B;  4PJL A;  4E18 A;  2A1D D;  2YL0 A;  2Q9B A;  4QI0 A;  4IGG A;  2VB6 A;  3K66 A;  1G4U S;  2HMZ A;  2EPK X;  2CGE A;  1WAT A;  3FAJ A;  3GAN A;  4EBJ A;  1YAU O;  3EZI A;  5F5H A;  4OIP F;  1T6Q A;  4DOZ A;  3SXK A;  1L3P A;  3X1O A;  5E2Q A;  3UR3 C;  3F47 A;  3W8I A;  4C3B A;  1M57 C;  2VH3 A;  1JAF A;  4XPX A;  3S28 A;  1XZQ A;  1ZHZ A;  3T6B A;  1H9G A;  3K1H A;  1KTM A;  4K0D A;  3V5Y A;  4JVS A;  4XEV A;  1J8M F;  2GAQ A;  1U0B B;  3V5Z A;  4NC3 A;  3B71 A;  3K33 A;  2B0J A;  1JMW A;  1I5N A;  4O79 A;  5IY5 C;  5TJ5 E;  4CBE A;  3B0V C;  1PV3 A;  2QLA A; 
#chains in the Genus database with same CATH homology
 4H54 A;  1LIH A;  2LIG A;  4Z9I A;  3T9O A;  1VLT A;  1VLS A;  3ATP A;  4Z9H A;  4Z9J A;  1WAS A;  1JMW A;  1WAT A;  2D4U A;  2ASR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...