4Z9JA

Apo-tar from e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
158
structure length
158
Chain Sequence
SQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein II
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
total genus 70
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9jA00
1WATA 3T9OA 4Z9JA 2ASRA 1JMWA 1WASA 1VLSA 3ATPA 4Z9HA 1VLTA 4H54A 4Z9IA 2LIGA 2D4UA 1LIHA
chains in the Genus database with same CATH superfamily
4I44A 1HE9A 1PCXA 3LAYA 4MVOA 3U5SA 4PK4A 5E2QA 4BJ5C 5KYWB 1ZU4A 4JVSA 3EGXA 2Q3TA 4A4AA 3NMIA 5EHHA 1I5NA 1TWCA 1TWHA 4G0HA 2RD9A 3Q7GA 256BA 5CI8A 4DRHB 2A0BA 4O7GA 1MMNA 1QLEC 2BC5A 2NSFA 3HKKA 4C7OB 3EQLF 5DQTA 3JSZA 4FAPB 3FMSA 4FWVA 2R03A 4U5BE 3KH2A 3RQGA 2Q00A 2NUTA 2DGJA 4EBKA 2FGYA 4CDAA 2MWQA 2A6HF 3EH1A 3L0IA 3I4UA 3RIPA 4CX9A 3RQEA 2YLDA 3UMIA 4EIYA 4KI2A 4MVSA 1OW6A 2LK4A 3GEHA 4MQ9F 4NTAA 4BPMA 1RKEA 2J45A 2R9RB 2EIJC 4O79A 3GEIA 3QW0A 2R7WA 3FDQA 3C8GA 3JRTA 3L1MA 1V4AA 3UGPA 3J06A 3RQFA 2W4BA 4KNWA 2HFIA 4N06A 3V5YA 1YA9A 3G4XA 3UR3C 1NSGB 2AP3A 3NKEA 1M6TA 3V5ZA 1O5HA 1VYKA 2EIKC 1Z3IX 1LIHA 3IQCA 2KQ9A 3KYIA 5KYYB 3FXHA 1RCPA 5E3AA 3PHF2 4NTFA 3GM2A 4JTCB 4YJWA 3WAQA 4AK9A 2G3VA 3V7OA 2H7VC 3RFYA 3ZSUA 4CS9A 1I4ZA 2C03A 3HTKC 3MFNA 5BQIA 4U5EE 2WB7A 1T6QA 3TULA 3DD7A 5JLIA 4XPXA 2R7XA 2YL7A 3SYNA 2ASRA 4HFFB 1RJ9A 1HE1A 1D0YA 4NQFA 3T6GB 4B6IA 1JAFA 1WTYA 2J9BA 4OIRF 1G5ZA 3DI5A 3H65A 4MVZA 1TFOB 1VYIA 3GODA 4JJFA 3U9MA 2XL4A 4CS8A 4E18A 1XWJA 3KMIA 1D1AA 2WZFA 1RXQA 4JIOA 5CI9A 2HJ3A 2QLAA 2M64A 5JS5A 3GM1A 4KBLA 2HS5A 1MNDA 3FHDA 2XLEA 2VC9A 2J9UA 2GDCA 1ZZPA 3O10A 3M4BA 1ZVZA 4J7TA 4JE9A 3NYMA 3W8HA 4Q4ZF 4YL3A 2HSQA 2PX0A 2IXNA 2PFDA 4XEFA 4OIQF 2UUHA 4NCQA 3S0XA 3EZIA 3E9VA 4LDKA 5KYXB 4G7ZF 1KTMA 2DB4A 2EIMC 3B0VC 1Z5ZA 2HMQA 1DOVA 3ZQVA 1EKYA 1LE4A 1Q0GA 5AGFA 5CIVA 2A69F 2AVKA 3OWTA 1MQVA 4XPWA 3AGUA 1J8YF 3EGXB 3K33A 2LQGA 3L34A 4LERA 3ZVRA 4ONSA 3SP1A 2P7VA 4MW3A 3TQOA 2XXAB 2R7QA 4QI0A 3RH3A 2R7TA 2KC3A 3Q6NA 2KK1A 3U9JA 2Y39A 1VTMP 3TOLA 2JX0A 2EPMX 4IWBA 2R25A 1WATA 1YA7O 4H4KC 4NC3A 2X0CA 1ZHZA 2VB6A 1TR2A 2NUTB 4MVRA 4JCZA 4U5HA 5L0FA 1FFTC 2JPUA 4OIPF 1T6IA 1ORYA 2GA0A 2ZXPA 4KNVA 1APCA 4JURI 4MTOA 4E17A 4Q5SF 2A1DD 1CGNA 1PV3A 3H2UA 4P6IC 4PFPA 1WASA 1Y6DA 3CAXA 1OCCC 3BEHA 1LS1A 3EPVA 1MMGA 4IARA 3EHNA 2OU6A 3VAYA 2YQYA 1WOLA 5F5FA 3S90A 2J7PD 3GORA 3ZQYA 4NY3A 5COFA 2C04A 3C8GB 2XRHA 3K7DA 1D1BA 4U9EA 2QNLA 2OEVA 2P6VA 3DE8A 2R02A 5GPGB 4YN0B 4YT4A 3UNGC 2J46A 4IRUA 2HUJA 2Y69C 1M56C 1A41A 2GAQA 1U6HA 3L8IA 2P0NA 1Y4CA 3IQTA 3JCUQ 5D92A 5T3WA 3KL4A 5K0IA 1EA8A 2CW0F 1NBBA 4J7YA 1ZHYA 4EUKB 5DS4A 2XLMA 4C3DA 3WHNA 3E70C 2R7SA 3AQBA 2ZPAA 3MYIA 3OEOA 2J0WA 2W45A 3K66A 1Z23A 2IXOA 3SEOA 3U8VA 1AEPA 3W8IA 3TOMA 1LE2A 1RJ9B 3U3BA 1QKRA 3EHMA 4LACB 3VF0A 1MNEA 2XLVA 2GWWA 3L8JA 5JSLA 3MBGA 3W4YA 3KYJA 5F5HA 3Q6MA 3U8PA 1SYQA 3FAJA 4LDQA 3M79A 1TQGA 3S84A 4JEAA 3EZHA 3X1OA 1V54C 2EILC 3EFOB 3IQ6A 4E0IA 3DWWA 4CSAA 2L81A 4PJNA 4G78A 2Q9CA 3A9CA 4J30B 3K1HA 5DVWA 2V3CC 3R2PA 2IXMA 2VCCA 1QPUA 3CZ6A 1YZCA 2KNHA 3TJ5A 1Q0KA 4JEBA 4BJ6A 1BR4A 1ZHXA 4CBEA 1JOGA 3B0PA 4PR9A 2R7UA 3HNJA 3G50A 3EG9B 3FOOA 1CGME 3NYLA 4CDYA 2XSEA 4BJ5A 5IY5C 1Q0MA 4P9TA 1JRAA 2DYSC 3NRHA 1GS9A 3ASNC 1GM5A 3LLKA 4OD4A 2Q9AA 3G4ZA 1LI7A 1O87A 1V55C 1F1MA 4IAOA 1OR3A 3IHUA 2QUPA 2O9XA 2LP4A 3TJ6A 3PMRA 3TK0A 2OQMA 2EINC 1HW2A 4WGYA 1A7VA 4ZLDA 3NMKA 2Y3HA 3N0TA 2LSEA 1NU7D 2D4UA 2X51A 4U5DE 5B3IA 2PNOA 3C63A 4PACA 3H2VA 3W2VA 2HJMA 2Q9BA 2R05A 1QZXA 3K1IA 4MVUA 4L6RA 1YAUO 3HNIA 4AE4A 3RW0A 3ABLC 4XTKA 2J7PA 5A6KA 4K0DA 2XLOA 2LFFA 3CSKA 1HMOA 2HV6A 5T3TA 4CIPA 1M2OA 2YRFA 4D4XA 3FVYA 1NG1A 5JRAA 1VLSA 3T4RA 5KYUA 1E84A 1GGQA 2A68F 4IJJA 1QQ3A 4IAQA 2MYSA 1A7EA 2QY9A 1H7IA 2W9YA 4CS7A 4ULWA 3LNMB 2B0JA 1JR8A 1JPJA 2I8BA 1HW1A 1K40A 5AC5A 5FCLA 5D91A 2H7BA 5L0GA 3ITFA 3MYFA 3AG4C 4HEAJ 1EQ1A 4YL1A 3WODF 5COGA 1YVIA 3AQCA 3JSEO 4MW8A 2Q4FA 1S7ZA 2HV7A 3I5QA 4OD5A 3US6A 1NFNA 1FMVA 2W4MA 2Y3DA 3LEOA 4GEHA 4YWQA 2VCBA 4UDVA 2KGOA 2LCHA 4AL0A 2HZ8A 3T9OA 4LLEA 3U3FA 2Q7RA 1TFKB 4O6NA 5L0DA 1J8MF 2ZXOA 1MMAA 1ZHWA 2J9WA 4JZAA 4RBNA 4N6HA 4BJ1A 2NUPA 3C8ZA 2P61A 3Q7LA 4JTDB 3UGOA 1S05A 5KYWA 1DOWA 2ZXRA 3UMHA 4BEJA 3RYLA 2VASA 1NFOA 3ZIBA 4W8PA 4PFOA 5EGYA 3C18A 5JVEA 3DXJF 1TKNA 1RMVA 1C03A 5B1AC 3VYWA 2YL0A 2YKZA 5L0CA 2EPOA 1SF8A 5A69A 5BQHA 4C7OA 1OXKA 1OKKD 4RD9A 3VRCA 4CDVA 4IGGA 1JMWA 4G7HF 2YEVA 4E0HA 5HSWA 2PX3A 2YL1A 4JCHA 2YHSA 3AG1C 5A6JA 1K04A 3DZAA 1D0XA 1H6GA 4I1MA 4DXWA 1R4TA 3AG2C 1OCRC 2RSEB 3MLGA 5JT4A 1L7CA 1VOMA 5FZTA 1RKEB 3QVYA 3GANA 4R32A 5T1DB 3EH2A 3I5PA 2UUIA 2PF4E 1BR2A 3HNLA 1XZQA 5L0HA 3PDMP 1Z63A 1OQCA 4LDRA 1BBHA 5A6AA 4P9FA 1TWGA 1ORSC 1ZW3A 2LFDA 3CEXA 2L6FA 4BG0A 4XQ1A 1T5OA 2FAPB 1G4US 3F46A 3A11A 3NYJA 4AE4B 1C17M 2H7OA 3LJBA 2Y3GA 2EPKX 3OA1A 3C62A 4I3MA 3VM6A 1M2VA 2YL3A 3W2WA 1T6UA 1D0ZA 1Z6AA 1U0BB 2E87A 4D4NA 1A7DA 5E33A 3QTHA 1LVKA 4O6MA 4MTGA 2IYLD 3EGDA 2IXPA 5KYUB 2PP4A 1CPQA 2CGEA 3POVA 2Z15A 2XL8A 3ZC4A 4DRJB 2XM4A 4ZLCA 3U0CA 3DAFA 4DJ9A 3NDBB 2I15A 2J0XA 1R5ID 1T9KA 4K1OA 1ORJA 1D1CA 2ZXWC 4EHPA 2WZLA 1O3UA 3N24A 1YYJA 2A6EF 4FX5A 4OINF 3T6JA 3WG7C 3S28A 3SXYA 3ZWIA 1E85A 3O55A 4U5CE 1WGWA 3JYYA 4A2NB 3ABKC 3BRJA 2G3KA 4WJ0A 1XZPA 3RVYA 1KNYA 3SZRA 3ECSA 1YYXA 2L6GA 2XL6A 4CSAC 4GYTA 1G8XA 2HSBA 1PD1A 2P1AA 3NMJA 3GWNA 4DBRA 5A6BD 4BJ6C 1GQAA 4JKVA 3LEVA 3LUTB 3ZTZA 2IOQA 3ATPA 4MTFA 2AU5A 2NUPB 2OG2A 4E7SA 4XPYA 4BJTA 4QI2A 1I4YA 1OKKA 2XLWA 2IM8A 3O6XA 4NTBA 2HKVA 3T6BA 3NG1A 1VMAA 2R7RA 4EBBA 2AWYA 1OXBA 2OEXA 4EWCA 4DVZA 5KYNA 3ABMC 3GEEA 3QW1A 1W2WA 2XXAA 3B9QA 1NLXA 4YT5A 4G7OF 3IQ5A 3JT1A 3U2LA 3UMKA 1WN0A 1ZW2A 4ANJA 4W8KA 1LI5A 4RDAA 1N1CA 3QMKA 1Q0FA 4FESA 3DMDA 3IEEA 4Q7CA 4IB4A 5B3SC 1OCOC 4JC7A 1LS4A 2AWCA 4HE8D 1SMYF 4DBQA 2NG1A 1OR2A 1OW8A 1E86A 4DOZA 1YLMA 1ZU5A 2BE5F 3K1IC 2KW3C 3KPHA 3PCVA 4QDLA 2CNWD 4CJOA 4XEKA 1H9TA 3JRMO 5L0JA 2QTVA 4JTAB 4XEVA 5L0IA 1U89A 1VK5A 1V74B 2M4EA 2OOCA 2HMZA 2FFHA 4PJMA 4U5GA 4CS9C 2YLIA 5AC4A 2EPLX 2KYHA 3SXZA 1RKCA 1VLTA 2DYRC 4I1OB 4Z9HA 4XLPF 2BL2A 2PBEA 1SR2A 2F22A 4C3BA 3MX3A 4PJLA 4LLCA 4Z9IA 3S9OA 1M2VB 4HFKB 3U2MA 1OW7A 5L3VA 1OCZC 4CS8C 3M15A 2J8WA 1YDIA 1LKXA 3AGTA 3HJCA 3F47A 1B68A 3N2ZB 4O6YA 3M1CB 3AOUA 2KJGA 4PJJA 3FAPB 3NKDA 3EGDB 4DVYP 4EKWA 1FMWA 1CGOA 1Q0DA 1UFBA 2NSGA 1A0BA 4F4BA 1BDJB 2D5RB 3TD7A 4ER9A 2IBFA 3DE9A 3RKOF 1T01A 2DI3A 2QE9A 3JZ0A 2NPUA 2VCAA 1MMDA 2XM0A 3C7JA 5TJ5E 1NZEA 4ULVA 2LIGA 3AG3C 4X0RA 1BZ4A 4OIOF 4JW1A 5L3QA 5A6BA 2A0UA 3EFOA 2YLGA 4MS2A 4M63A 1UG7A 1AVOB 1CPRA 3LS0A 4JRZA 4H54A 2L6HA 2XS1A 1WWPA 2YZSA 3LS1A 4MVMA 1K05A 5EK0A 1ST6A 2WVQA 2LD6A 4U9DA 3DKAA 1PD0A 3ASOC 1C02A 2MHRA 3EG9A 3GM3A 3LESA 4AL1A 2YVKA 3ZDLA 1FNTc 4WGZA 4CJGA 1FFHA 2OJQA 1TWAA 4MVQA 1QVXA 2G62A 3HLZA 5F28E 5COMA 1SZIA 5DS5A 3LLIA 1IW7F 1LM3B 3DJNB 4XLNF 4WABA 1YARO 3SXMA 5JUAA 5E3CA 1E83A 2ETSA 2XLHA 3HNKA 1FR0A 3QVZA 2CDQA 2CYDA 4XWJA 2R7OA 4JJGA 2GFHA 1Z7Qc 2CNWA 2XLDA 4YK5A 1AUEA 3SNHA 2J9VA 1ZYRF 2EPNA 3S29A 1YZAA 1ZHTA 1L3PA 2KSFA 3R7CA 5DLJA 1EI7A 5BQGA 1FAPB 5HV9A 2ICWG 4CIHA 3GWLA 3V5XA 2JD3A 2ZD9A 2L9JA 3B0UX 1M57C 4J32B 3RVZA 5KYYA 4YL0A 4DRIB 2WVOA 3C8GD 1JPNA 1FTSA 1G4WR 2WL8A 3CQZA 3X2QC 4C3EA 3SXKA 2CCYA 3JTLO 1BR1A 1QSPA 2R7VA 4EBJA 2V26A 4GQHA 4N4WA 3S27A 2OCCC 5DS6A 4YT8A 3M4CA 3ZTMA 1LPEA 3DJUB 4Z9JA 3K6BA 4AX2A 3DM5A 5JP7A 2OKUA 3JYHA 3KKBA 4N6CA 4YT2A 1E2XA 3FOPA 5BUOA 2TMVP 2B0HA 3B29A 4U5FE 4E7ZA 3QZCA 1YJGA 3EJNA 4BEMJ 3LNRA 5B1BC 3ZG1A 2WVNA 2VH3A 1H9GA 1HY5A 1NU9C 2XS8A 3B71A 3DM9B 3RF3A 3O39A 1VB5A 1IZMA 2H8AA 1HMDA 2YWAA 3IPMO 4MNDA 5DQZA 4K7BA 2L7AA 2WZGA 2Y3BA 5KYXA 3AJMA 4KC9A 2OJED 1KU2A 3DAGA
chains in the Genus database with same CATH topology
1WATA 3T9OA 4Z9JA 2ASRA 1JMWA 1WASA 1VLSA 3ATPA 4Z9HA 1VLTA 4H54A 4Z9IA 2LIGA 2D4UA 1LIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAT A;  3T9O A;  4Z9J A;  2ASR A;  1JMW A;  1WAS A;  1VLS A;  3ATP A;  4Z9H A;  1VLT A;  4H54 A;  4Z9I A;  2LIG A;  2D4U A;  1LIH A; 
#chains in the Genus database with same CATH topology
 4I44 A;  1HE9 A;  1PCX A;  3LAY A;  4MVO A;  3U5S A;  4PK4 A;  5E2Q A;  4BJ5 C;  5KYW B;  1ZU4 A;  4JVS A;  3EGX A;  2Q3T A;  4A4A A;  3NMI A;  5EHH A;  1I5N A;  1TWC A;  1TWH A;  4G0H A;  2RD9 A;  3Q7G A;  256B A;  5CI8 A;  4DRH B;  2A0B A;  4O7G A;  1MMN A;  1QLE C;  2BC5 A;  2NSF A;  3HKK A;  4C7O B;  3EQL F;  5DQT A;  3JSZ A;  4FAP B;  3FMS A;  4FWV A;  2R03 A;  4U5B E;  3KH2 A;  3RQG A;  2Q00 A;  2NUT A;  2DGJ A;  4EBK A;  2FGY A;  4CDA A;  2MWQ A;  2A6H F;  3EH1 A;  3L0I A;  3I4U A;  3RIP A;  4CX9 A;  3RQE A;  2YLD A;  3UMI A;  4EIY A;  4KI2 A;  4MVS A;  1OW6 A;  2LK4 A;  3GEH A;  4MQ9 F;  4NTA A;  4BPM A;  1RKE A;  2J45 A;  2R9R B;  2EIJ C;  4O79 A;  3GEI A;  3QW0 A;  2R7W A;  3FDQ A;  3C8G A;  3JRT A;  3L1M A;  1V4A A;  3UGP A;  3J06 A;  3RQF A;  2W4B A;  4KNW A;  2HFI A;  4N06 A;  3V5Y A;  1YA9 A;  3G4X A;  3UR3 C;  1NSG B;  2AP3 A;  3NKE A;  1M6T A;  3V5Z A;  1O5H A;  1VYK A;  2EIK C;  1Z3I X;  1LIH A;  3IQC A;  2KQ9 A;  3KYI A;  5KYY B;  3FXH A;  1RCP A;  5E3A A;  3PHF 2;  4NTF A;  3GM2 A;  4JTC B;  4YJW A;  3WAQ A;  4AK9 A;  2G3V A;  3V7O A;  2H7V C;  3RFY A;  3ZSU A;  4CS9 A;  1I4Z A;  2C03 A;  3HTK C;  3MFN A;  5BQI A;  4U5E E;  2WB7 A;  1T6Q A;  3TUL A;  3DD7 A;  5JLI A;  4XPX A;  2R7X A;  2YL7 A;  3SYN A;  2ASR A;  4HFF B;  1RJ9 A;  1HE1 A;  1D0Y A;  4NQF A;  3T6G B;  4B6I A;  1JAF A;  1WTY A;  2J9B A;  4OIR F;  1G5Z A;  3DI5 A;  3H65 A;  4MVZ A;  1TFO B;  1VYI A;  3GOD A;  4JJF A;  3U9M A;  2XL4 A;  4CS8 A;  4E18 A;  1XWJ A;  3KMI A;  1D1A A;  2WZF A;  1RXQ A;  4JIO A;  5CI9 A;  2HJ3 A;  2QLA A;  2M64 A;  5JS5 A;  3GM1 A;  4KBL A;  2HS5 A;  1MND A;  3FHD A;  2XLE A;  2VC9 A;  2J9U A;  2GDC A;  1ZZP A;  3O10 A;  3M4B A;  1ZVZ A;  4J7T A;  4JE9 A;  3NYM A;  3W8H A;  4Q4Z F;  4YL3 A;  2HSQ A;  2PX0 A;  2IXN A;  2PFD A;  4XEF A;  4OIQ F;  2UUH A;  4NCQ A;  3S0X A;  3EZI A;  3E9V A;  4LDK A;  5KYX B;  4G7Z F;  1KTM A;  2DB4 A;  2EIM C;  3B0V C;  1Z5Z A;  2HMQ A;  1DOV A;  3ZQV A;  1EKY A;  1LE4 A;  1Q0G A;  5AGF A;  5CIV A;  2A69 F;  2AVK A;  3OWT A;  1MQV A;  4XPW A;  3AGU A;  1J8Y F;  3EGX B;  3K33 A;  2LQG A;  3L34 A;  4LER A;  3ZVR A;  4ONS A;  3SP1 A;  2P7V A;  4MW3 A;  3TQO A;  2XXA B;  2R7Q A;  4QI0 A;  3RH3 A;  2R7T A;  2KC3 A;  3Q6N A;  2KK1 A;  3U9J A;  2Y39 A;  1VTM P;  3TOL A;  2JX0 A;  2EPM X;  4IWB A;  2R25 A;  1WAT A;  1YA7 O;  4H4K C;  4NC3 A;  2X0C A;  1ZHZ A;  2VB6 A;  1TR2 A;  2NUT B;  4MVR A;  4JCZ A;  4U5H A;  5L0F A;  1FFT C;  2JPU A;  4OIP F;  1T6I A;  1ORY A;  2GA0 A;  2ZXP A;  4KNV A;  1APC A;  4JUR I;  4MTO A;  4E17 A;  4Q5S F;  2A1D D;  1CGN A;  1PV3 A;  3H2U A;  4P6I C;  4PFP A;  1WAS A;  1Y6D A;  3CAX A;  1OCC C;  3BEH A;  1LS1 A;  3EPV A;  1MMG A;  4IAR A;  3EHN A;  2OU6 A;  3VAY A;  2YQY A;  1WOL A;  5F5F A;  3S90 A;  2J7P D;  3GOR A;  3ZQY A;  4NY3 A;  5COF A;  2C04 A;  3C8G B;  2XRH A;  3K7D A;  1D1B A;  4U9E A;  2QNL A;  2OEV A;  2P6V A;  3DE8 A;  2R02 A;  5GPG B;  4YN0 B;  4YT4 A;  3UNG C;  2J46 A;  4IRU A;  2HUJ A;  2Y69 C;  1M56 C;  1A41 A;  2GAQ A;  1U6H A;  3L8I A;  2P0N A;  1Y4C A;  3IQT A;  3JCU Q;  5D92 A;  5T3W A;  3KL4 A;  5K0I A;  1EA8 A;  2CW0 F;  1NBB A;  4J7Y A;  1ZHY A;  4EUK B;  5DS4 A;  2XLM A;  4C3D A;  3WHN A;  3E70 C;  2R7S A;  3AQB A;  2ZPA A;  3MYI A;  3OEO A;  2J0W A;  2W45 A;  3K66 A;  1Z23 A;  2IXO A;  3SEO A;  3U8V A;  1AEP A;  3W8I A;  3TOM A;  1LE2 A;  1RJ9 B;  3U3B A;  1QKR A;  3EHM A;  4LAC B;  3VF0 A;  1MNE A;  2XLV A;  2GWW A;  3L8J A;  5JSL A;  3MBG A;  3W4Y A;  3KYJ A;  5F5H A;  3Q6M A;  3U8P A;  1SYQ A;  3FAJ A;  4LDQ A;  3M79 A;  1TQG A;  3S84 A;  4JEA A;  3EZH A;  3X1O A;  1V54 C;  2EIL C;  3EFO B;  3IQ6 A;  4E0I A;  3DWW A;  4CSA A;  2L81 A;  4PJN A;  4G78 A;  2Q9C A;  3A9C A;  4J30 B;  3K1H A;  5DVW A;  2V3C C;  3R2P A;  2IXM A;  2VCC A;  1QPU A;  3CZ6 A;  1YZC A;  2KNH A;  3TJ5 A;  1Q0K A;  4JEB A;  4BJ6 A;  1BR4 A;  1ZHX A;  4CBE A;  1JOG A;  3B0P A;  4PR9 A;  2R7U A;  3HNJ A;  3G50 A;  3EG9 B;  3FOO A;  1CGM E;  3NYL A;  4CDY A;  2XSE A;  4BJ5 A;  5IY5 C;  1Q0M A;  4P9T A;  1JRA A;  2DYS C;  3NRH A;  1GS9 A;  3ASN C;  1GM5 A;  3LLK A;  4OD4 A;  2Q9A A;  3G4Z A;  1LI7 A;  1O87 A;  1V55 C;  1F1M A;  4IAO A;  1OR3 A;  3IHU A;  2QUP A;  2O9X A;  2LP4 A;  3TJ6 A;  3PMR A;  3TK0 A;  2OQM A;  2EIN C;  1HW2 A;  4WGY A;  1A7V A;  4ZLD A;  3NMK A;  2Y3H A;  3N0T A;  2LSE A;  1NU7 D;  2D4U A;  2X51 A;  4U5D E;  5B3I A;  2PNO A;  3C63 A;  4PAC A;  3H2V A;  3W2V A;  2HJM A;  2Q9B A;  2R05 A;  1QZX A;  3K1I A;  4MVU A;  4L6R A;  1YAU O;  3HNI A;  4AE4 A;  3RW0 A;  3ABL C;  4XTK A;  2J7P A;  5A6K A;  4K0D A;  2XLO A;  2LFF A;  3CSK A;  1HMO A;  2HV6 A;  5T3T A;  4CIP A;  1M2O A;  2YRF A;  4D4X A;  3FVY A;  1NG1 A;  5JRA A;  1VLS A;  3T4R A;  5KYU A;  1E84 A;  1GGQ A;  2A68 F;  4IJJ A;  1QQ3 A;  4IAQ A;  2MYS A;  1A7E A;  2QY9 A;  1H7I A;  2W9Y A;  4CS7 A;  4ULW A;  3LNM B;  2B0J A;  1JR8 A;  1JPJ A;  2I8B A;  1HW1 A;  1K40 A;  5AC5 A;  5FCL A;  5D91 A;  2H7B A;  5L0G A;  3ITF A;  3MYF A;  3AG4 C;  4HEA J;  1EQ1 A;  4YL1 A;  3WOD F;  5COG A;  1YVI A;  3AQC A;  3JSE O;  4MW8 A;  2Q4F A;  1S7Z A;  2HV7 A;  3I5Q A;  4OD5 A;  3US6 A;  1NFN A;  1FMV A;  2W4M A;  2Y3D A;  3LEO A;  4GEH A;  4YWQ A;  2VCB A;  4UDV A;  2KGO A;  2LCH A;  4AL0 A;  2HZ8 A;  3T9O A;  4LLE A;  3U3F A;  2Q7R A;  1TFK B;  4O6N A;  5L0D A;  1J8M F;  2ZXO A;  1MMA A;  1ZHW A;  2J9W A;  4JZA A;  4RBN A;  4N6H A;  4BJ1 A;  2NUP A;  3C8Z A;  2P61 A;  3Q7L A;  4JTD B;  3UGO A;  1S05 A;  5KYW A;  1DOW A;  2ZXR A;  3UMH A;  4BEJ A;  3RYL A;  2VAS A;  1NFO A;  3ZIB A;  4W8P A;  4PFO A;  5EGY A;  3C18 A;  5JVE A;  3DXJ F;  1TKN A;  1RMV A;  1C03 A;  5B1A C;  3VYW A;  2YL0 A;  2YKZ A;  5L0C A;  2EPO A;  1SF8 A;  5A69 A;  5BQH A;  4C7O A;  1OXK A;  1OKK D;  4RD9 A;  3VRC A;  4CDV A;  4IGG A;  1JMW A;  4G7H F;  2YEV A;  4E0H A;  5HSW A;  2PX3 A;  2YL1 A;  4JCH A;  2YHS A;  3AG1 C;  5A6J A;  1K04 A;  3DZA A;  1D0X A;  1H6G A;  4I1M A;  4DXW A;  1R4T A;  3AG2 C;  1OCR C;  2RSE B;  3MLG A;  5JT4 A;  1L7C A;  1VOM A;  5FZT A;  1RKE B;  3QVY A;  3GAN A;  4R32 A;  5T1D B;  3EH2 A;  3I5P A;  2UUI A;  2PF4 E;  1BR2 A;  3HNL A;  1XZQ A;  5L0H A;  3PDM P;  1Z63 A;  1OQC A;  4LDR A;  1BBH A;  5A6A A;  4P9F A;  1TWG A;  1ORS C;  1ZW3 A;  2LFD A;  3CEX A;  2L6F A;  4BG0 A;  4XQ1 A;  1T5O A;  2FAP B;  1G4U S;  3F46 A;  3A11 A;  3NYJ A;  4AE4 B;  1C17 M;  2H7O A;  3LJB A;  2Y3G A;  2EPK X;  3OA1 A;  3C62 A;  4I3M A;  3VM6 A;  1M2V A;  2YL3 A;  3W2W A;  1T6U A;  1D0Z A;  1Z6A A;  1U0B B;  2E87 A;  4D4N A;  1A7D A;  5E33 A;  3QTH A;  1LVK A;  4O6M A;  4MTG A;  2IYL D;  3EGD A;  2IXP A;  5KYU B;  2PP4 A;  1CPQ A;  2CGE A;  3POV A;  2Z15 A;  2XL8 A;  3ZC4 A;  4DRJ B;  2XM4 A;  4ZLC A;  3U0C A;  3DAF A;  4DJ9 A;  3NDB B;  2I15 A;  2J0X A;  1R5I D;  1T9K A;  4K1O A;  1ORJ A;  1D1C A;  2ZXW C;  4EHP A;  2WZL A;  1O3U A;  3N24 A;  1YYJ A;  2A6E F;  4FX5 A;  4OIN F;  3T6J A;  3WG7 C;  3S28 A;  3SXY A;  3ZWI A;  1E85 A;  3O55 A;  4U5C E;  1WGW A;  3JYY A;  4A2N B;  3ABK C;  3BRJ A;  2G3K A;  4WJ0 A;  1XZP A;  3RVY A;  1KNY A;  3SZR A;  3ECS A;  1YYX A;  2L6G A;  2XL6 A;  4CSA C;  4GYT A;  1G8X A;  2HSB A;  1PD1 A;  2P1A A;  3NMJ A;  3GWN A;  4DBR A;  5A6B D;  4BJ6 C;  1GQA A;  4JKV A;  3LEV A;  3LUT B;  3ZTZ A;  2IOQ A;  3ATP A;  4MTF A;  2AU5 A;  2NUP B;  2OG2 A;  4E7S A;  4XPY A;  4BJT A;  4QI2 A;  1I4Y A;  1OKK A;  2XLW A;  2IM8 A;  3O6X A;  4NTB A;  2HKV A;  3T6B A;  3NG1 A;  1VMA A;  2R7R A;  4EBB A;  2AWY A;  1OXB A;  2OEX A;  4EWC A;  4DVZ A;  5KYN A;  3ABM C;  3GEE A;  3QW1 A;  1W2W A;  2XXA A;  3B9Q A;  1NLX A;  4YT5 A;  4G7O F;  3IQ5 A;  3JT1 A;  3U2L A;  3UMK A;  1WN0 A;  1ZW2 A;  4ANJ A;  4W8K A;  1LI5 A;  4RDA A;  1N1C A;  3QMK A;  1Q0F A;  4FES A;  3DMD A;  3IEE A;  4Q7C A;  4IB4 A;  5B3S C;  1OCO C;  4JC7 A;  1LS4 A;  2AWC A;  4HE8 D;  1SMY F;  4DBQ A;  2NG1 A;  1OR2 A;  1OW8 A;  1E86 A;  4DOZ A;  1YLM A;  1ZU5 A;  2BE5 F;  3K1I C;  2KW3 C;  3KPH A;  3PCV A;  4QDL A;  2CNW D;  4CJO A;  4XEK A;  1H9T A;  3JRM O;  5L0J A;  2QTV A;  4JTA B;  4XEV A;  5L0I A;  1U89 A;  1VK5 A;  1V74 B;  2M4E A;  2OOC A;  2HMZ A;  2FFH A;  4PJM A;  4U5G A;  4CS9 C;  2YLI A;  5AC4 A;  2EPL X;  2KYH A;  3SXZ A;  1RKC A;  1VLT A;  2DYR C;  4I1O B;  4Z9H A;  4XLP F;  2BL2 A;  2PBE A;  1SR2 A;  2F22 A;  4C3B A;  3MX3 A;  4PJL A;  4LLC A;  4Z9I A;  3S9O A;  1M2V B;  4HFK B;  3U2M A;  1OW7 A;  5L3V A;  1OCZ C;  4CS8 C;  3M15 A;  2J8W A;  1YDI A;  1LKX A;  3AGT A;  3HJC A;  3F47 A;  1B68 A;  3N2Z B;  4O6Y A;  3M1C B;  3AOU A;  2KJG A;  4PJJ A;  3FAP B;  3NKD A;  3EGD B;  4DVY P;  4EKW A;  1FMW A;  1CGO A;  1Q0D A;  1UFB A;  2NSG A;  1A0B A;  4F4B A;  1BDJ B;  2D5R B;  3TD7 A;  4ER9 A;  2IBF A;  3DE9 A;  3RKO F;  1T01 A;  2DI3 A;  2QE9 A;  3JZ0 A;  2NPU A;  2VCA A;  1MMD A;  2XM0 A;  3C7J A;  5TJ5 E;  1NZE A;  4ULV A;  2LIG A;  3AG3 C;  4X0R A;  1BZ4 A;  4OIO F;  4JW1 A;  5L3Q A;  5A6B A;  2A0U A;  3EFO A;  2YLG A;  4MS2 A;  4M63 A;  1UG7 A;  1AVO B;  1CPR A;  3LS0 A;  4JRZ A;  4H54 A;  2L6H A;  2XS1 A;  1WWP A;  2YZS A;  3LS1 A;  4MVM A;  1K05 A;  5EK0 A;  1ST6 A;  2WVQ A;  2LD6 A;  4U9D A;  3DKA A;  1PD0 A;  3ASO C;  1C02 A;  2MHR A;  3EG9 A;  3GM3 A;  3LES A;  4AL1 A;  2YVK A;  3ZDL A;  1FNT c;  4WGZ A;  4CJG A;  1FFH A;  2OJQ A;  1TWA A;  4MVQ A;  1QVX A;  2G62 A;  3HLZ A;  5F28 E;  5COM A;  1SZI A;  5DS5 A;  3LLI A;  1IW7 F;  1LM3 B;  3DJN B;  4XLN F;  4WAB A;  1YAR O;  3SXM A;  5JUA A;  5E3C A;  1E83 A;  2ETS A;  2XLH A;  3HNK A;  1FR0 A;  3QVZ A;  2CDQ A;  2CYD A;  4XWJ A;  2R7O A;  4JJG A;  2GFH A;  1Z7Q c;  2CNW A;  2XLD A;  4YK5 A;  1AUE A;  3SNH A;  2J9V A;  1ZYR F;  2EPN A;  3S29 A;  1YZA A;  1ZHT A;  1L3P A;  2KSF A;  3R7C A;  5DLJ A;  1EI7 A;  5BQG A;  1FAP B;  5HV9 A;  2ICW G;  4CIH A;  3GWL A;  3V5X A;  2JD3 A;  2ZD9 A;  2L9J A;  3B0U X;  1M57 C;  4J32 B;  3RVZ A;  5KYY A;  4YL0 A;  4DRI B;  2WVO A;  3C8G D;  1JPN A;  1FTS A;  1G4W R;  2WL8 A;  3CQZ A;  3X2Q C;  4C3E A;  3SXK A;  2CCY A;  3JTL O;  1BR1 A;  1QSP A;  2R7V A;  4EBJ A;  2V26 A;  4GQH A;  4N4W A;  3S27 A;  2OCC C;  5DS6 A;  4YT8 A;  3M4C A;  3ZTM A;  1LPE A;  3DJU B;  4Z9J A;  3K6B A;  4AX2 A;  3DM5 A;  5JP7 A;  2OKU A;  3JYH A;  3KKB A;  4N6C A;  4YT2 A;  1E2X A;  3FOP A;  5BUO A;  2TMV P;  2B0H A;  3B29 A;  4U5F E;  4E7Z A;  3QZC A;  1YJG A;  3EJN A;  4BEM J;  3LNR A;  5B1B C;  3ZG1 A;  2WVN A;  2VH3 A;  1H9G A;  1HY5 A;  1NU9 C;  2XS8 A;  3B71 A;  3DM9 B;  3RF3 A;  3O39 A;  1VB5 A;  1IZM A;  2H8A A;  1HMD A;  2YWA A;  3IPM O;  4MND A;  5DQZ A;  4K7B A;  2L7A A;  2WZG A;  2Y3B A;  5KYX A;  3AJM A;  4KC9 A;  2OJE D;  1KU2 A;  3DAG A; 
#chains in the Genus database with same CATH homology
 1WAT A;  3T9O A;  4Z9J A;  2ASR A;  1JMW A;  1WAS A;  1VLS A;  3ATP A;  4Z9H A;  1VLT A;  4H54 A;  4Z9I A;  2LIG A;  2D4U A;  1LIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...