4Z9JA

Apo-tar from e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
158
structure length
158
Chain Sequence
b'SQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein II
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
total genus 70
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9jA00
1VLTA 1JMWA 1LIHA 4H54A 2D4UA 4Z9HA 3T9OA 4Z9JA 2LIGA 2ASRA 1WATA 1WASA 1VLSA 4Z9IA 3ATPA
chains in the Genus database with same CATH superfamily
1VYKA 2A0UA 4A4AA 2Y3DA 3T6BA 3VYWA 3Q6NA 1D0XA 1CGNA 1HMOA 2J7PA 3JSZA 5A69A 2J9VA 4XPXA 3AG4C 1OW7A 3HJCA 3K1IC 3W8IA 3PHF2 4JJGA 4YL3A 3VF0A 1SR2A 4U5DE 4J7YA 3GM3A 5A6AA 3VRCA 3EHMA 3DKAA 4O79A 2XS8A 3US6A 2H7OA 3AQBA 4LLEA 3LUTB 1E2XA 3DI5A 4XQ1A 3WG7C 2KW3C 4YWQA 2R03A 3EPVA 4IAOA 4K7BA 4MS2A 3K33A 2P1AA 2A6EF 1OXBA 2CW0F 4QI2A 3O55A 1DOVA 1T9KA 3HNJA 3LS1A 4CS8C 3DZAA 3U2MA 3SXYA 4CDVA 2KK1A 2IM8A 4H54A 4W8PA 2CGEA 3GWNA 3JTLO 2HV7A 3SP1A 4A2NB 3RVZA 4CIPA 3T6GB 3RKOF 4XPYA 3ZSUA 2V3CC 1ORYA 5DQZA 4EIYA 4K0DA 3U5SA 1LS1A 1M2VB 1NLXA 3ABLC 3GM2A 3L8IA 1U89A 1AVOB 4KC9A 4AE4A 4KNWA 1NG1A 1O87A 4IB4A 4BJ5C 4D4XA 4JE9A 1QSPA 4KNVA 3G50A 4CIHA 1U0BB 1Z63A 2PX0A 1K05A 1NFNA 1QQ3A 1A0BA 1B68A 4CBEA 2UUHA 1O3UA 3JCUQ 3M4CA 4N6HA 4MVUA 5D92A 4OIPF 2GDCA 1N1CA 3OWTA 1YYJA 5L0CA 1H7IA 2J9BA 2RSEB 1H6GA 2YQYA 5L0DA 3C8GB 5KYUB 2YRFA 2EPMX 1JPJA 2AWCA 4ULVA 3EG9A 3JYHA 3WODF 2X51A 3JRTA 5JS5A 4DOZA 3ZQVA 4DBQA 4FAPB 1YA9A 3QW1A 4MNDA 4P6IC 3B0UX 2LCHA 2NUTB 4JTDB 3TJ5A 3ABMC 3EHNA 3FDQA 1E86A 2HSQA 2OOCA 3U9JA 2IXMA 1AUEA 3EGXA 1WATA 2R9RB 2KQ9A 1A7DA 4H4KC 3LEVA 1OW6A 2IXNA 5L0FA 3RQGA 1Y4CA 3RH3A 2PFDA 2VCCA 3EQLF 4N06A 2M4EA 2LFDA 2XL6A 2A1DD 3TOMA 3QTHA 2Y3HA 4IGGA 4PK4A 4C3DA 3S90A 1G4WR 4XEKA 2PF4E 2Q9BA 2Y69C 5JVEA 3S27A 3L1MA 2XXAB 3W4YA 1VMAA 3DWWA 2HMZA 5IY5C 1BR1A 3S28A 3UMKA 4GEHA 1V4AA 3I5QA 5GPGB 1BR4A 3KL4A 2BL2A 4MVQA 3EZIA 1JRAA 1OKKD 4ONSA 5D91A 2OEVA 1TFKB 4PJJA 1I5NA 1JR8A 3UNGC 2LIGA 3RFYA 4YN0B 4D4NA 4F4BA 3L34A 5AC4A 4E18A 5JLIA 4JEAA 5DS4A 1FR0A 4JTAB 2CDQA 3GORA 2WZGA 3ZWIA 4E0HA 3DAGA 5JT4A 2AWYA 2HJ3A 2A6HF 3ZTZA 2I8BA 2Q9AA 3F46A 4O6NA 5E3CA 2JX0A 1M2OA 4U5EE 3V5YA 2WB7A 2NUPB 3LLKA 1EKYA 3NYJA 4G7HF 3EGDB 2GA0A 3SYNA 4GYTA 1YJGA 4ZLCA 5BQGA 3NMIA 1T6IA 1PCXA 3FOPA 2PNOA 3C7JA 1VLTA 4U5FE 4CS8A 2A0BA 3QVYA 4RDAA 4DRJB 1OR3A 3NYMA 1GGQA 4BEJA 1R4TA 3NG1A 1J8MF 4U5HA 4JTCB 3U0CA 3HNIA 3HKKA 1ORJA 4MVRA 3RQFA 1ZHTA 5KYWA 2MWQA 1M57C 5EGYA 1GS9A 3C63A 3DJNB 4LERA 1CPRA 2H7VC 2W4BA 2BE5F 4JCZA 2LQGA 4NTAA 2FAPB 1ZVZA 5L0JA 1ST6A 1YZCA 2M64A 3GM1A 5K0IA 4NTFA 3CSKA 1XWJA 4YL1A 2J7PD 4UDVA 1SZIA 2HS5A 2YHSA 5L0IA 3KPHA 5F5HA 2L6GA 3KH2A 3LNMB 4FX5A 2Q3TA 4OINF 3AG2C 1LS4A 1T5OA 2B0HA 2R02A 1NU9C 1V74B 3IQ6A 3O6XA 4DBRA 1E85A 1RXQA 3GEIA 1R5ID 4J7TA 1L3PA 1KU2A 2AU5A 4XTKA 3T4RA 3Q7LA 4AE4B 2MYSA 4GQHA 3AQCA 4MVOA 4DXWA 5A6JA 4PJLA 4YJWA 5T3WA 2W4MA 4ANJA 1S7ZA 4CX9A 1HW1A 3K1HA 1Z3IX 1LPEA 3MFNA 2KJGA 1Z7Qc 2Y3BA 4AL1A 5KYXB 2OJQA 2J45A 1WTYA 2LD6A 3KYIA 3M1CB 3W2VA 2QNLA 2EPLX 1OXKA 5JUAA 5KYYA 2Y39A 4X0RA 2IOQA 2L6FA 3DXJF 3KMIA 1VYIA 4N6CA 4U5GA 1E84A 4EUKB 4OIQF 2EILC 3QVZA 1OR2A 1XZQA 3EFOA 1SMYF 1F1MA 4IARA 1YVIA 5AC5A 3I4UA 3LS0A 2QLAA 3EH2A 4W8KA 3X1OA 1D0ZA 5T1DB 4BG0A 1OQCA 4BJ6A 5COGA 2AVKA 2CNWA 2JPUA 2XRHA 3V7OA 4AK9A 4AL0A 4XLPF 3NRHA 1K04A 3TQOA 3W2WA 4YL0A 4G7OF 5BQIA 1Q0KA 3QMKA 4MVSA 2WVQA 5E33A 2XLVA 1OW8A 3TJ6A 2OU6A 1VTMP 4YT8A 4QDLA 2F22A 2LP4A 1HY5A 5L3QA 3VM6A 3DD7A 5B3IA 4MTGA 2XLWA 3AG3C 4B6IA 2R7SA 2XS1A 3PMRA 4R32A 2XLHA 4CDAA 3OA1A 3L0IA 4NTBA 2G62A 4U9DA 4EBKA 3H65A 2LK4A 4MW3A 1MMGA 3H2UA 3CEXA 4MVMA 4Z9JA 3RF3A 4MQ9F 2WVOA 3ATPA 2IXPA 4G0HA 2KNHA 1TR2A 3B0PA 1I4ZA 3L8JA 4PR9A 5EK0A 4OIRF 4C3BA 1EI7A 1Q0FA 2J46A 3C18A 4FESA 3ZTMA 3LESA 3GANA 1RKEA 4BJTA 2XLDA 3RVYA 4EBBA 2HKVA 3T9OA 4DVZA 1D1CA 4O7GA 1U6HA 3SXMA 1RMVA 4DVYP 1AEPA 4CDYA 1ZW2A 1ZYRF 2VCBA 3NKDA 1WOLA 4I44A 3RW0A 1JMWA 2GWWA 4Z9HA 1WGWA 1YAUO 4O6MA 1ZU5A 3ZDLA 1NFOA 4KBLA 4WABA 1G8XA 1LI7A 3DE9A 5A6BA 4I1MA 3M79A 1DOWA 3ASNC 3K7DA 1C02A 2O9XA 3LLIA 4P9FA 2OEXA 1MQVA 2XL8A 4J30B 4IWBA 4E17A 3B9QA 3POVA 2PP4A 3DM9B 1VK5A 3CQZA 1RJ9B 1YYXA 4BJ6C 4ER9A 3N2ZB 2NPUA 3HNLA 2DB4A 4HE8D 4JCHA 1PV3A 1Z5ZA 3ASOC 1M2VA 3FHDA 1SYQA 3S29A 1RKCA 1NSGB 3J06A 2GAQA 2XSEA 3E9VA 3K66A 2ETSA 5COFA 2CCYA 3ABKC 2YVKA 3I5PA 1LM3B 3VAYA 5L0GA 3AJMA 2QY9A 1FTSA 3SXZA 2YL7A 1TWGA 4LDQA 3V5XA 3GODA 1LE2A 2LSEA 2HV6A 3GEEA 4FWVA 3TD7A 4BPMA 1YDIA 5CI9A 3SXKA 2DYRC 4AX2A 5KYUA 3C8GA 4NCQA 2D5RB 2CYDA 4CJOA 2J8WA 3G4XA 4NC3A 1T01A 5T3TA 4JEBA 1EQ1A 4YT2A 3ZG1A 1FMVA 1H9TA 4XPWA 1OCRC 2KC3A 2VC9A 3IQ5A 5F28E 4EWCA 5HV9A 5JP7A 2J0WA 4NQFA 3B29A 2YL0A 2W9YA 5CIVA 3DAFA 3IQCA 2G3KA 2XM4A 3RYLA 5F5FA 1W2WA 2EPNA 1YZAA 3MLGA 4IJJA 4DJ9A 3FAPB 1A7VA 3NMJA 3S0XA 2R7VA 3TULA 2KSFA 3OEOA 3QZCA 2XLOA 3FMSA 3SEOA 3IQTA 2HSBA 3R2PA 1E83A 2XXAA 3EH1A 4MTFA 2Z15A 4I1OB 2H7BA 5DVWA 1ZU4A 1GM5A 1J8YF 2WL8A 1HE9A 1PD1A 1YARO 1Z23A 2X0CA 2HZ8A 5L3VA 2P0NA 1CPQA 4C7OA 2ZXPA 4U5CE 3IPMO 4C3EA 3M15A 2Q7RA 2R7WA 3K6BA 2NSGA 1LIHA 5KYNA 2VB6A 1GQAA 2WZFA 4U9EA 2ZXOA 3ZVRA 4PJNA 3U9MA 2L9JA 2HJMA 3NDBB 1Q0GA 2W45A 3AG1C 3F47A 1TFOB 3T6JA 5CI8A 2VH3A 3GEHA 3AGTA 1OCCC 5DLJA 3JT1A 1JPNA 2ASRA 2EINC 4IRUA 256BA 4OIOF 4EBJA 2R05A 2R7OA 3ECSA 4DRIB 3LAYA 4JRZA 4JVSA 5BQHA 3EG9B 2VCAA 1Z6AA 4JKVA 5B1AC 4G78A 1A7EA 1M6TA 1Q0MA 3AOUA 1WN0A 2CNWD 1QPUA 3EGDA 4XEFA 3FXHA 3U8PA 2YLDA 1PD0A 1FNTc 1H9GA 1WASA 1VOMA 4E0IA 4Q5SF 4CS7A 4RD9A 4LDRA 1MMAA 2EIMC 3DE8A 2Y3GA 3EGXB 3FVYA 3RIPA 1RKEB 4BEMJ 2R7UA 1L7CA 3BEHA 1JAFA 1MMNA 4Z9IA 5JRAA 4Q4ZF 3ZC4A 3G4ZA 4MTOA 2G3VA 2EPKX 3WHNA 4G7ZF 1MNDA 5A6KA 3A9CA 1D1AA 3MYIA 1C03A 1IZMA 1OCZC 3TOLA 4U5BE 2IYLD 1SF8A 4PFOA 2DI3A 1ORSC 1HW2A 2XLEA 5JSLA 1O5HA 4JC7A 4CSAA 3O39A 4DRHB 5DS6A 1CGOA 2ZXWC 3JZ0A 1VB5A 2P6VA 1K40A 1EA8A 1C17M 4M63A 2YL1A 4LACB 4ZLDA 4ULWA 2E87A 1KNYA 3LNRA 3QW0A 3UMHA 3DM5A 4CJGA 4JIOA 4LDKA 1ZW3A 2EIJC 5TJ5E 3UGPA 2DGJA 2ZXRA 1MMDA 3MX3A 4O6YA 3SNHA 1YA7O 1NZEA 1ZHZA 2KYHA 2V26A 2HUJA 3LEOA 2Q4FA 2HFIA 1QVXA 2J9WA 5B1BC 4JURI 2J9UA 4J32B 3C8ZA 1YLMA 3S9OA 5EHHA 5KYXA 5A6BD 2LFFA 1A41A 1FMWA 2L81A 4EKWA 2JD3A 2KGOA 2R7QA 2ZPAA 3O10A 2OG2A 1QZXA 3BRJA 2A68F 3A11A 5FCLA 1ZHWA 4CS9A 2R7XA 2Q9CA 3V5ZA 5FZTA 1D0YA 1Y6DA 2VASA 4N4WA 1V54C 2A69F 3CAXA 3KKBA 4K1OA 1LVKA 2NG1A 1LI5A 3SZRA 3DMDA 2L6HA 5KYWB 3JYYA 1XZPA 5L0HA 1T6UA 5AGFA 1TWCA 2P7VA 3B0VC 1TQGA 4HFFB 4PJMA 1HMDA 2QTVA 3UMIA 3W8HA 3U3FA 1G4US 5BUOA 1M56C 3Q7GA 4XLNF 2ICWG 1RCPA 2RD9A 4EHPA 1G5ZA 2D4UA 3C8GD 4YK5A 2YEVA 3MYFA 4IAQA 2H8AA 1KTMA 1NBBA 2QUPA 4YT5A 1D1BA 3ZQYA 2ZD9A 4P9TA 2WZLA 2MHRA 2NSFA 1Q0DA 3KYJA 3U2LA 1NU7D 4CSAC 3FAJA 3U8VA 3NKEA 1VLSA 4HFKB 1BBHA 2R25A 2YLIA 4JW1A 4XEVA 4C7OB 1APCA 2C03A 2YKZA 4E7SA 1CGME 3NYLA 3HLZA 4I3MA 4RBNA 1QKRA 4YT4A 2TMVP 2AP3A 2XLMA 2J0XA 3U3BA 4LLCA 2WVNA 1FFHA 3K1IA 4QI0A 1QLEC 2NUTA 2OKUA 3HTKC 2R7RA 1BDJB 2PBEA 3IEEA 2B0JA 4MW8A 5DQTA 4L6RA 1BR2A 4KI2A 4PFPA 2FFHA 4Q7CA 1UFBA 3M4BA 2OJED 5KYYB 3WAQA 1JOGA 3FOOA 1FFTC 3S84A 1I4YA 2YLGA 1IW7F 1OKKA 2I15A 2OCCC 1LKXA 1LE4A 2EIKC 4JJFA 4WJ0A 5E3AA 4CS9C 3PDMP 2UUIA 1TWHA 2IXOA 5B3SC 2YL3A 1MNEA 3GWLA 3UR3C 1S05A 3AGUA 3X2QC 3EFOB 3EZHA 3HNKA 2BC5A 1WWPA 3Q6MA 3JSEO 3H2VA 2FGYA 1ZHXA 3ITFA 3C62A 3E70C 2QE9A 4HEAJ 4MVZA 4WGYA 4OD5A 5E2QA 1T6QA 2YWAA 3R7CA 5HSWA 2R7TA 3RQEA 2PX3A 2IBFA 3B71A 3ZIBA 1RJ9A 1TKNA 5DS5A 4PACA 4NY3A 1ZZPA 2C04A 2HMQA 3EJNA 4BJ5A 3CZ6A 4XWJA 1UG7A 2DYSC 2GFHA 4JZAA 1HE1A 2OQMA 2XL4A 4E7ZA 3IHUA 3NMKA 3N0TA 2YZSA 2EPOA 2XM0A 2Q00A 3DJUB 1V55C 3N24A 3TK0A 4BJ1A 4WGZA 1TWAA 1ZHYA 1OCOC 1BZ4A 2P61A 3PCVA 3MBGA 4OD4A 1FAPB 2L7AA 3LJBA 5COMA 2NUPA 3JRMO 3UGOA
chains in the Genus database with same CATH topology
1VLTA 1JMWA 1LIHA 4H54A 2D4UA 4Z9HA 3T9OA 4Z9JA 2LIGA 2ASRA 1WATA 1WASA 1VLSA 4Z9IA 3ATPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLT A;  1JMW A;  1LIH A;  4H54 A;  2D4U A;  4Z9H A;  3T9O A;  4Z9J A;  2LIG A;  2ASR A;  1WAT A;  1WAS A;  1VLS A;  4Z9I A;  3ATP A; 
#chains in the Genus database with same CATH topology
 1VYK A;  2A0U A;  4A4A A;  2Y3D A;  3T6B A;  3VYW A;  3Q6N A;  1D0X A;  1CGN A;  1HMO A;  2J7P A;  3JSZ A;  5A69 A;  2J9V A;  4XPX A;  3AG4 C;  1OW7 A;  3HJC A;  3K1I C;  3W8I A;  3PHF 2;  4JJG A;  4YL3 A;  3VF0 A;  1SR2 A;  4U5D E;  4J7Y A;  3GM3 A;  5A6A A;  3VRC A;  3EHM A;  3DKA A;  4O79 A;  2XS8 A;  3US6 A;  2H7O A;  3AQB A;  4LLE A;  3LUT B;  1E2X A;  3DI5 A;  4XQ1 A;  3WG7 C;  2KW3 C;  4YWQ A;  2R03 A;  3EPV A;  4IAO A;  4K7B A;  4MS2 A;  3K33 A;  2P1A A;  2A6E F;  1OXB A;  2CW0 F;  4QI2 A;  3O55 A;  1DOV A;  1T9K A;  3HNJ A;  3LS1 A;  4CS8 C;  3DZA A;  3U2M A;  3SXY A;  4CDV A;  2KK1 A;  2IM8 A;  4H54 A;  4W8P A;  2CGE A;  3GWN A;  3JTL O;  2HV7 A;  3SP1 A;  4A2N B;  3RVZ A;  4CIP A;  3T6G B;  3RKO F;  4XPY A;  3ZSU A;  2V3C C;  1ORY A;  5DQZ A;  4EIY A;  4K0D A;  3U5S A;  1LS1 A;  1M2V B;  1NLX A;  3ABL C;  3GM2 A;  3L8I A;  1U89 A;  1AVO B;  4KC9 A;  4AE4 A;  4KNW A;  1NG1 A;  1O87 A;  4IB4 A;  4BJ5 C;  4D4X A;  4JE9 A;  1QSP A;  4KNV A;  3G50 A;  4CIH A;  1U0B B;  1Z63 A;  2PX0 A;  1K05 A;  1NFN A;  1QQ3 A;  1A0B A;  1B68 A;  4CBE A;  2UUH A;  1O3U A;  3JCU Q;  3M4C A;  4N6H A;  4MVU A;  5D92 A;  4OIP F;  2GDC A;  1N1C A;  3OWT A;  1YYJ A;  5L0C A;  1H7I A;  2J9B A;  2RSE B;  1H6G A;  2YQY A;  5L0D A;  3C8G B;  5KYU B;  2YRF A;  2EPM X;  1JPJ A;  2AWC A;  4ULV A;  3EG9 A;  3JYH A;  3WOD F;  2X51 A;  3JRT A;  5JS5 A;  4DOZ A;  3ZQV A;  4DBQ A;  4FAP B;  1YA9 A;  3QW1 A;  4MND A;  4P6I C;  3B0U X;  2LCH A;  2NUT B;  4JTD B;  3TJ5 A;  3ABM C;  3EHN A;  3FDQ A;  1E86 A;  2HSQ A;  2OOC A;  3U9J A;  2IXM A;  1AUE A;  3EGX A;  1WAT A;  2R9R B;  2KQ9 A;  1A7D A;  4H4K C;  3LEV A;  1OW6 A;  2IXN A;  5L0F A;  3RQG A;  1Y4C A;  3RH3 A;  2PFD A;  2VCC A;  3EQL F;  4N06 A;  2M4E A;  2LFD A;  2XL6 A;  2A1D D;  3TOM A;  3QTH A;  2Y3H A;  4IGG A;  4PK4 A;  4C3D A;  3S90 A;  1G4W R;  4XEK A;  2PF4 E;  2Q9B A;  2Y69 C;  5JVE A;  3S27 A;  3L1M A;  2XXA B;  3W4Y A;  1VMA A;  3DWW A;  2HMZ A;  5IY5 C;  1BR1 A;  3S28 A;  3UMK A;  4GEH A;  1V4A A;  3I5Q A;  5GPG B;  1BR4 A;  3KL4 A;  2BL2 A;  4MVQ A;  3EZI A;  1JRA A;  1OKK D;  4ONS A;  5D91 A;  2OEV A;  1TFK B;  4PJJ A;  1I5N A;  1JR8 A;  3UNG C;  2LIG A;  3RFY A;  4YN0 B;  4D4N A;  4F4B A;  3L34 A;  5AC4 A;  4E18 A;  5JLI A;  4JEA A;  5DS4 A;  1FR0 A;  4JTA B;  2CDQ A;  3GOR A;  2WZG A;  3ZWI A;  4E0H A;  3DAG A;  5JT4 A;  2AWY A;  2HJ3 A;  2A6H F;  3ZTZ A;  2I8B A;  2Q9A A;  3F46 A;  4O6N A;  5E3C A;  2JX0 A;  1M2O A;  4U5E E;  3V5Y A;  2WB7 A;  2NUP B;  3LLK A;  1EKY A;  3NYJ A;  4G7H F;  3EGD B;  2GA0 A;  3SYN A;  4GYT A;  1YJG A;  4ZLC A;  5BQG A;  3NMI A;  1T6I A;  1PCX A;  3FOP A;  2PNO A;  3C7J A;  1VLT A;  4U5F E;  4CS8 A;  2A0B A;  3QVY A;  4RDA A;  4DRJ B;  1OR3 A;  3NYM A;  1GGQ A;  4BEJ A;  1R4T A;  3NG1 A;  1J8M F;  4U5H A;  4JTC B;  3U0C A;  3HNI A;  3HKK A;  1ORJ A;  4MVR A;  3RQF A;  1ZHT A;  5KYW A;  2MWQ A;  1M57 C;  5EGY A;  1GS9 A;  3C63 A;  3DJN B;  4LER A;  1CPR A;  2H7V C;  2W4B A;  2BE5 F;  4JCZ A;  2LQG A;  4NTA A;  2FAP B;  1ZVZ A;  5L0J A;  1ST6 A;  1YZC A;  2M64 A;  3GM1 A;  5K0I A;  4NTF A;  3CSK A;  1XWJ A;  4YL1 A;  2J7P D;  4UDV A;  1SZI A;  2HS5 A;  2YHS A;  5L0I A;  3KPH A;  5F5H A;  2L6G A;  3KH2 A;  3LNM B;  4FX5 A;  2Q3T A;  4OIN F;  3AG2 C;  1LS4 A;  1T5O A;  2B0H A;  2R02 A;  1NU9 C;  1V74 B;  3IQ6 A;  3O6X A;  4DBR A;  1E85 A;  1RXQ A;  3GEI A;  1R5I D;  4J7T A;  1L3P A;  1KU2 A;  2AU5 A;  4XTK A;  3T4R A;  3Q7L A;  4AE4 B;  2MYS A;  4GQH A;  3AQC A;  4MVO A;  4DXW A;  5A6J A;  4PJL A;  4YJW A;  5T3W A;  2W4M A;  4ANJ A;  1S7Z A;  4CX9 A;  1HW1 A;  3K1H A;  1Z3I X;  1LPE A;  3MFN A;  2KJG A;  1Z7Q c;  2Y3B A;  4AL1 A;  5KYX B;  2OJQ A;  2J45 A;  1WTY A;  2LD6 A;  3KYI A;  3M1C B;  3W2V A;  2QNL A;  2EPL X;  1OXK A;  5JUA A;  5KYY A;  2Y39 A;  4X0R A;  2IOQ A;  2L6F A;  3DXJ F;  3KMI A;  1VYI A;  4N6C A;  4U5G A;  1E84 A;  4EUK B;  4OIQ F;  2EIL C;  3QVZ A;  1OR2 A;  1XZQ A;  3EFO A;  1SMY F;  1F1M A;  4IAR A;  1YVI A;  5AC5 A;  3I4U A;  3LS0 A;  2QLA A;  3EH2 A;  4W8K A;  3X1O A;  1D0Z A;  5T1D B;  4BG0 A;  1OQC A;  4BJ6 A;  5COG A;  2AVK A;  2CNW A;  2JPU A;  2XRH A;  3V7O A;  4AK9 A;  4AL0 A;  4XLP F;  3NRH A;  1K04 A;  3TQO A;  3W2W A;  4YL0 A;  4G7O F;  5BQI A;  1Q0K A;  3QMK A;  4MVS A;  2WVQ A;  5E33 A;  2XLV A;  1OW8 A;  3TJ6 A;  2OU6 A;  1VTM P;  4YT8 A;  4QDL A;  2F22 A;  2LP4 A;  1HY5 A;  5L3Q A;  3VM6 A;  3DD7 A;  5B3I A;  4MTG A;  2XLW A;  3AG3 C;  4B6I A;  2R7S A;  2XS1 A;  3PMR A;  4R32 A;  2XLH A;  4CDA A;  3OA1 A;  3L0I A;  4NTB A;  2G62 A;  4U9D A;  4EBK A;  3H65 A;  2LK4 A;  4MW3 A;  1MMG A;  3H2U A;  3CEX A;  4MVM A;  4Z9J A;  3RF3 A;  4MQ9 F;  2WVO A;  3ATP A;  2IXP A;  4G0H A;  2KNH A;  1TR2 A;  3B0P A;  1I4Z A;  3L8J A;  4PR9 A;  5EK0 A;  4OIR F;  4C3B A;  1EI7 A;  1Q0F A;  2J46 A;  3C18 A;  4FES A;  3ZTM A;  3LES A;  3GAN A;  1RKE A;  4BJT A;  2XLD A;  3RVY A;  4EBB A;  2HKV A;  3T9O A;  4DVZ A;  1D1C A;  4O7G A;  1U6H A;  3SXM A;  1RMV A;  4DVY P;  1AEP A;  4CDY A;  1ZW2 A;  1ZYR F;  2VCB A;  3NKD A;  1WOL A;  4I44 A;  3RW0 A;  1JMW A;  2GWW A;  4Z9H A;  1WGW A;  1YAU O;  4O6M A;  1ZU5 A;  3ZDL A;  1NFO A;  4KBL A;  4WAB A;  1G8X A;  1LI7 A;  3DE9 A;  5A6B A;  4I1M A;  3M79 A;  1DOW A;  3ASN C;  3K7D A;  1C02 A;  2O9X A;  3LLI A;  4P9F A;  2OEX A;  1MQV A;  2XL8 A;  4J30 B;  4IWB A;  4E17 A;  3B9Q A;  3POV A;  2PP4 A;  3DM9 B;  1VK5 A;  3CQZ A;  1RJ9 B;  1YYX A;  4BJ6 C;  4ER9 A;  3N2Z B;  2NPU A;  3HNL A;  2DB4 A;  4HE8 D;  4JCH A;  1PV3 A;  1Z5Z A;  3ASO C;  1M2V A;  3FHD A;  1SYQ A;  3S29 A;  1RKC A;  1NSG B;  3J06 A;  2GAQ A;  2XSE A;  3E9V A;  3K66 A;  2ETS A;  5COF A;  2CCY A;  3ABK C;  2YVK A;  3I5P A;  1LM3 B;  3VAY A;  5L0G A;  3AJM A;  2QY9 A;  1FTS A;  3SXZ A;  2YL7 A;  1TWG A;  4LDQ A;  3V5X A;  3GOD A;  1LE2 A;  2LSE A;  2HV6 A;  3GEE A;  4FWV A;  3TD7 A;  4BPM A;  1YDI A;  5CI9 A;  3SXK A;  2DYR C;  4AX2 A;  5KYU A;  3C8G A;  4NCQ A;  2D5R B;  2CYD A;  4CJO A;  2J8W A;  3G4X A;  4NC3 A;  1T01 A;  5T3T A;  4JEB A;  1EQ1 A;  4YT2 A;  3ZG1 A;  1FMV A;  1H9T A;  4XPW A;  1OCR C;  2KC3 A;  2VC9 A;  3IQ5 A;  5F28 E;  4EWC A;  5HV9 A;  5JP7 A;  2J0W A;  4NQF A;  3B29 A;  2YL0 A;  2W9Y A;  5CIV A;  3DAF A;  3IQC A;  2G3K A;  2XM4 A;  3RYL A;  5F5F A;  1W2W A;  2EPN A;  1YZA A;  3MLG A;  4IJJ A;  4DJ9 A;  3FAP B;  1A7V A;  3NMJ A;  3S0X A;  2R7V A;  3TUL A;  2KSF A;  3OEO A;  3QZC A;  2XLO A;  3FMS A;  3SEO A;  3IQT A;  2HSB A;  3R2P A;  1E83 A;  2XXA A;  3EH1 A;  4MTF A;  2Z15 A;  4I1O B;  2H7B A;  5DVW A;  1ZU4 A;  1GM5 A;  1J8Y F;  2WL8 A;  1HE9 A;  1PD1 A;  1YAR O;  1Z23 A;  2X0C A;  2HZ8 A;  5L3V A;  2P0N A;  1CPQ A;  4C7O A;  2ZXP A;  4U5C E;  3IPM O;  4C3E A;  3M15 A;  2Q7R A;  2R7W A;  3K6B A;  2NSG A;  1LIH A;  5KYN A;  2VB6 A;  1GQA A;  2WZF A;  4U9E A;  2ZXO A;  3ZVR A;  4PJN A;  3U9M A;  2L9J A;  2HJM A;  3NDB B;  1Q0G A;  2W45 A;  3AG1 C;  3F47 A;  1TFO B;  3T6J A;  5CI8 A;  2VH3 A;  3GEH A;  3AGT A;  1OCC C;  5DLJ A;  3JT1 A;  1JPN A;  2ASR A;  2EIN C;  4IRU A;  256B A;  4OIO F;  4EBJ A;  2R05 A;  2R7O A;  3ECS A;  4DRI B;  3LAY A;  4JRZ A;  4JVS A;  5BQH A;  3EG9 B;  2VCA A;  1Z6A A;  4JKV A;  5B1A C;  4G78 A;  1A7E A;  1M6T A;  1Q0M A;  3AOU A;  1WN0 A;  2CNW D;  1QPU A;  3EGD A;  4XEF A;  3FXH A;  3U8P A;  2YLD A;  1PD0 A;  1FNT c;  1H9G A;  1WAS A;  1VOM A;  4E0I A;  4Q5S F;  4CS7 A;  4RD9 A;  4LDR A;  1MMA A;  2EIM C;  3DE8 A;  2Y3G A;  3EGX B;  3FVY A;  3RIP A;  1RKE B;  4BEM J;  2R7U A;  1L7C A;  3BEH A;  1JAF A;  1MMN A;  4Z9I A;  5JRA A;  4Q4Z F;  3ZC4 A;  3G4Z A;  4MTO A;  2G3V A;  2EPK X;  3WHN A;  4G7Z F;  1MND A;  5A6K A;  3A9C A;  1D1A A;  3MYI A;  1C03 A;  1IZM A;  1OCZ C;  3TOL A;  4U5B E;  2IYL D;  1SF8 A;  4PFO A;  2DI3 A;  1ORS C;  1HW2 A;  2XLE A;  5JSL A;  1O5H A;  4JC7 A;  4CSA A;  3O39 A;  4DRH B;  5DS6 A;  1CGO A;  2ZXW C;  3JZ0 A;  1VB5 A;  2P6V A;  1K40 A;  1EA8 A;  1C17 M;  4M63 A;  2YL1 A;  4LAC B;  4ZLD A;  4ULW A;  2E87 A;  1KNY A;  3LNR A;  3QW0 A;  3UMH A;  3DM5 A;  4CJG A;  4JIO A;  4LDK A;  1ZW3 A;  2EIJ C;  5TJ5 E;  3UGP A;  2DGJ A;  2ZXR A;  1MMD A;  3MX3 A;  4O6Y A;  3SNH A;  1YA7 O;  1NZE A;  1ZHZ A;  2KYH A;  2V26 A;  2HUJ A;  3LEO A;  2Q4F A;  2HFI A;  1QVX A;  2J9W A;  5B1B C;  4JUR I;  2J9U A;  4J32 B;  3C8Z A;  1YLM A;  3S9O A;  5EHH A;  5KYX A;  5A6B D;  2LFF A;  1A41 A;  1FMW A;  2L81 A;  4EKW A;  2JD3 A;  2KGO A;  2R7Q A;  2ZPA A;  3O10 A;  2OG2 A;  1QZX A;  3BRJ A;  2A68 F;  3A11 A;  5FCL A;  1ZHW A;  4CS9 A;  2R7X A;  2Q9C A;  3V5Z A;  5FZT A;  1D0Y A;  1Y6D A;  2VAS A;  4N4W A;  1V54 C;  2A69 F;  3CAX A;  3KKB A;  4K1O A;  1LVK A;  2NG1 A;  1LI5 A;  3SZR A;  3DMD A;  2L6H A;  5KYW B;  3JYY A;  1XZP A;  5L0H A;  1T6U A;  5AGF A;  1TWC A;  2P7V A;  3B0V C;  1TQG A;  4HFF B;  4PJM A;  1HMD A;  2QTV A;  3UMI A;  3W8H A;  3U3F A;  1G4U S;  5BUO A;  1M56 C;  3Q7G A;  4XLN F;  2ICW G;  1RCP A;  2RD9 A;  4EHP A;  1G5Z A;  2D4U A;  3C8G D;  4YK5 A;  2YEV A;  3MYF A;  4IAQ A;  2H8A A;  1KTM A;  1NBB A;  2QUP A;  4YT5 A;  1D1B A;  3ZQY A;  2ZD9 A;  4P9T A;  2WZL A;  2MHR A;  2NSF A;  1Q0D A;  3KYJ A;  3U2L A;  1NU7 D;  4CSA C;  3FAJ A;  3U8V A;  3NKE A;  1VLS A;  4HFK B;  1BBH A;  2R25 A;  2YLI A;  4JW1 A;  4XEV A;  4C7O B;  1APC A;  2C03 A;  2YKZ A;  4E7S A;  1CGM E;  3NYL A;  3HLZ A;  4I3M A;  4RBN A;  1QKR A;  4YT4 A;  2TMV P;  2AP3 A;  2XLM A;  2J0X A;  3U3B A;  4LLC A;  2WVN A;  1FFH A;  3K1I A;  4QI0 A;  1QLE C;  2NUT A;  2OKU A;  3HTK C;  2R7R A;  1BDJ B;  2PBE A;  3IEE A;  2B0J A;  4MW8 A;  5DQT A;  4L6R A;  1BR2 A;  4KI2 A;  4PFP A;  2FFH A;  4Q7C A;  1UFB A;  3M4B A;  2OJE D;  5KYY B;  3WAQ A;  1JOG A;  3FOO A;  1FFT C;  3S84 A;  1I4Y A;  2YLG A;  1IW7 F;  1OKK A;  2I15 A;  2OCC C;  1LKX A;  1LE4 A;  2EIK C;  4JJF A;  4WJ0 A;  5E3A A;  4CS9 C;  3PDM P;  2UUI A;  1TWH A;  2IXO A;  5B3S C;  2YL3 A;  1MNE A;  3GWL A;  3UR3 C;  1S05 A;  3AGU A;  3X2Q C;  3EFO B;  3EZH A;  3HNK A;  2BC5 A;  1WWP A;  3Q6M A;  3JSE O;  3H2V A;  2FGY A;  1ZHX A;  3ITF A;  3C62 A;  3E70 C;  2QE9 A;  4HEA J;  4MVZ A;  4WGY A;  4OD5 A;  5E2Q A;  1T6Q A;  2YWA A;  3R7C A;  5HSW A;  2R7T A;  3RQE A;  2PX3 A;  2IBF A;  3B71 A;  3ZIB A;  1RJ9 A;  1TKN A;  5DS5 A;  4PAC A;  4NY3 A;  1ZZP A;  2C04 A;  2HMQ A;  3EJN A;  4BJ5 A;  3CZ6 A;  4XWJ A;  1UG7 A;  2DYS C;  2GFH A;  4JZA A;  1HE1 A;  2OQM A;  2XL4 A;  4E7Z A;  3IHU A;  3NMK A;  3N0T A;  2YZS A;  2EPO A;  2XM0 A;  2Q00 A;  3DJU B;  1V55 C;  3N24 A;  3TK0 A;  4BJ1 A;  4WGZ A;  1TWA A;  1ZHY A;  1OCO C;  1BZ4 A;  2P61 A;  3PCV A;  3MBG A;  4OD4 A;  1FAP B;  2L7A A;  3LJB A;  5COM A;  2NUP A;  3JRM O;  3UGO A; 
#chains in the Genus database with same CATH homology
 1VLT A;  1JMW A;  1LIH A;  4H54 A;  2D4U A;  4Z9H A;  3T9O A;  4Z9J A;  2LIG A;  2ASR A;  1WAT A;  1WAS A;  1VLS A;  4Z9I A;  3ATP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...