4Z9JA

Apo-tar from e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
158
structure length
158
Chain Sequence
SQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
molecule keywords Methyl-accepting chemotaxis protein II
total genus 70
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9jA00
4Z9JA 1VLTA 1VLSA 4H54A 2D4UA 4Z9IA 1LIHA 2LIGA 3T9OA 3ATPA 1JMWA 1WASA 2ASRA 1WATA 4Z9HA
chains in the Genus database with same CATH superfamily
2NUTB 3US6A 5A69A 2XLWA 1QLEC 1BR2A 3U0CA 1LI5A 1T01A 1QZXA 3NMIA 1NFOA 3DZAA 2VCBA 3K33A 2IXNA 3EG9A 4K1OA 2H7OA 1T6UA 1YYJA 3LEOA 2KNHA 4RD9A 1BBHA 4GYTA 2YHSA 1HE9A 4EHPA 1YZAA 5KYUB 2LP4A 4WJ0A 4XEVA 3ZDLA 2H8AA 3ZQVA 2NSFA 1FMWA 3C62A 4L6RA 4E0HA 1E84A 4I1OB 5CIVA 5A6JA 4U9DA 4EUKB 3ZQYA 2LCHA 2Q4FA 3GEEA 3MFNA 3AG1C 3U3BA 2I8BA 3HKKA 2W4MA 4IB4A 3U8VA 1T6QA 2G62A 2HJMA 4J30B 1LKXA 1FTSA 3TJ5A 3JRTA 4CJGA 2R7OA 2HMQA 1UFBA 4YL1A 2CW0F 3W8IA 4EIYA 1D1AA 2VASA 2R7QA 3K66A 4JKVA 3TQOA 2EINC 1WASA 5F5HA 4PJNA 1HW1A 4OIPF 1M57C 2J9VA 2XLVA 3UMIA 4UDVA 2VH3A 1HW2A 5TJ5E 1Q0KA 2P1AA 4GEHA 2EPLX 5COGA 4FAPB 2LFFA 4JW1A 2JX0A 2V26A 2WZFA 2IXMA 1V74B 3U2LA 4YT8A 1HMDA 2W45A 2R9RB 1D1BA 4XPXA 2R25A 3O6XA 3SP1A 1H7IA 2EPMX 3GEHA 1EQ1A 3VRCA 3F46A 3DAFA 3RIPA 1Z63A 1OCZC 3T6GB 4E17A 2KGOA 1NU9C 1GM5A 4U5DE 2XLMA 2D4UA 3JZ0A 5FCLA 2QNLA 1GS9A 5D92A 2Q3TA 4HFFB 3RF3A 2MYSA 3RW0A 3WHNA 3PCVA 2XLDA 4G7ZF 1M56C 2LQGA 3GM3A 1HMOA 1LIHA 3HTKC 4MW3A 5DVWA 3T4RA 3S0XA 4MVUA 1NZEA 2ASRA 3L1MA 2IYLD 3GANA 5E33A 4Q4ZF 1CPQA 2YKZA 3EQLF 1MMNA 2E87A 2PX3A 4PR9A 5JP7A 1I4YA 1RKCA 2M64A 4YL3A 5F28E 4DVYP 3T6JA 4G78A 4NTBA 1CGOA 5COFA 2YL0A 4IGGA 4JJFA 1AVOB 1OCRC 3DAGA 5FZTA 2P7VA 2NPUA 4ANJA 1NLXA 1LS4A 1T5OA 3C8GD 2W9YA 3ECSA 3KH2A 3B9QA 3Q7LA 1EA8A 3SXYA 2VCAA 3HJCA 4MTFA 4N4WA 4PJJA 5B3SC 2LIGA 3L8IA 4HFKB 5JS5A 4C7OA 2HZ8A 5L0IA 2XM4A 4Z9HA 4YT2A 3RVYA 2CGEA 3QMKA 2Q9CA 1T9KA 2NUPA 5DQTA 2OG2A 4XPWA 4R32A 3MYFA 1Z5ZA 3C8GB 3ZSUA 3VM6A 2CNWA 3C63A 4IAQA 4YN0B 2KK1A 4WGYA 4PACA 1OW8A 2XL8A 3T9OA 2AWCA 4XTKA 3JYHA 3EG9B 4CSAA 1ZVZA 3EHNA 2HMZA 3NKDA 1YZCA 1FAPB 2L6FA 5AC5A 3EZHA 3H2VA 2G3KA 3E9VA 4NTFA 3V5YA 3FAJA 4RBNA 4DBRA 2WL8A 2J46A 2ZPAA 1FFTC 1Z6AA 5JSLA 3F47A 2QTVA 5DS5A 1O3UA 5L3QA 4C3EA 2HKVA 2J45A 1YVIA 2BL2A 2L6GA 3R2PA 1KTMA 3KYIA 4BJTA 2J0WA 3I4UA 2IOQA 1G8XA 1I5NA 2W4BA 3DMDA 4CIPA 1TFKB 3VYWA 3UGOA 1LS1A 2XLOA 4Q5SF 4LLCA 3OWTA 2KYHA 1EI7A 2DYRC 2YLIA 5A6KA 1BDJB 4BJ1A 3N24A 2NSGA 4BG0A 2ZXPA 3KL4A 1MMGA 3SNHA 4ZLCA 1QSPA 1RKEA 3FDQA 1GGQA 1JR8A 3T6BA 2EPKX 1ST6A 3AQCA 3JT1A 2P0NA 3WODF 5L0DA 2ZXRA 1MNDA 2Z15A 2XLEA 3A9CA 1ZW3A 2L81A 3EFOB 1JRAA 1TWCA 2RD9A 1NU7D 4KNWA 2A68F 4JC7A 1S05A 2LD6A 3FXHA 4YT5A 5L0FA 1M2OA 3LJBA 2X51A 3N0TA 4CX9A 4YL0A 5D91A 2HS5A 4AE4B 2UUHA 3RFYA 3S9OA 4XLNF 2LK4A 4BJ6C 1XWJA 4N6CA 4MVRA 4U5BE 4U9EA 1Q0GA 1TWAA 4D4NA 5JRAA 1FMVA 3AGTA 2BE5F 1WATA 2HSBA 2J9WA 2FAPB 3GM2A 3Q6MA 3B0VC 4MQ9F 1BR4A 3M4BA 3JSZA 5L0CA 2Q9BA 1Q0FA 4PFOA 1MMDA 4BJ6A 2QLAA 1JOGA 1N1CA 3NYJA 5HSWA 1UG7A 3VAYA 4CS9C 4MVMA 1IZMA 4XLPF 3AG2C 5L0HA 1ZHXA 5KYYB 1C03A 3IQCA 2Q7RA 1A7VA 2MWQA 2QE9A 1K40A 3G50A 4BEJA 2ZXWC 4LERA 2O9XA 5T1DB 2TMVP 1MQVA 3Q6NA 3QVYA 5DLJA 1ZHZA 1U0BB 3WG7C 3DWWA 1FNTc 1PD1A 1OR3A 3M79A 2PBEA 4FESA 1E83A 4I3MA 1YA7O 3KKBA 4HEAJ 2XS8A 4OD4A 1RJ9A 5GPGB 3RQEA 3TJ6A 1GQAA 2WVOA 3EFOA 3ZC4A 1SR2A 3DXJF 4JTDB 3V5XA 1Z23A 3PMRA 1F1MA 3JRMO 2Y3DA 2M4EA 2D5RB 2HV7A 1Z7Qc 3U5SA 4AE4A 1VLSA 1XZPA 1G4WR 1JPNA 2HUJA 2AWYA 5E3CA 3O10A 1Q0MA 3FVYA 4Z9IA 4OIRF 4RDAA 4WABA 3LUTB 5A6BD 4MTOA 5A6BA 1APCA 2XSEA 5KYWA 4JE9A 1YDIA 2R05A 2Y39A 3LS0A 3MX3A 3H2UA 3NMJA 4DXWA 2WZLA 4JTAB 3BRJA 3ZTZA 4ULWA 2QUPA 2IBFA 2OKUA 2L9JA 1H9TA 2HJ3A 1BZ4A 2YL3A 1SYQA 2GFHA 3AQBA 3C7JA 4OD5A 3RKOF 1OW6A 2Q9AA 4W8KA 2HFIA 1M6TA 1B68A 2ZD9A 4HE8D 3SEOA 1KU2A 1LPEA 2CNWD 2KC3A 2OJED 4MVZA 4WGZA 2LFDA 2V3CC 4CS9A 4ONSA 3WAQA 4DVZA 1OXBA 1C02A 2NG1A 3HNKA 4NC3A 1L3PA 4PK4A 2YVKA 3QZCA 3CSKA 4Q7CA 3EGDA 3SXMA 1U89A 3NDBB 3BEHA 2I15A 5T3WA 1ZHWA 2YL1A 3C8GA 3I5QA 4OINF 2R7WA 3EGXB 3SYNA 1KNYA 4DJ9A 1MMAA 3DE9A 1YJGA 3KYJA 4YK5A 3SXKA 1RKEB 4IWBA 4JZAA 4CDVA 3L0IA 5BQHA 4U5EE 1CGME 1YARO 3IHUA 4C3BA 2IXPA 2P6VA 2C03A 1TWHA 1G5ZA 3HNIA 1LVKA 2XLHA 1A0BA 3EZIA 1WOLA 2YLDA 3G4ZA 3NRHA 3X1OA 2R7XA 4U5GA 1SZIA 2R7VA 4U5HA 3ABMC 4KBLA 4LACB 1PV3A 1DOVA 1YAUO 2PFDA 2YEVA 2OU6A 3U2MA 1U6HA 1TWGA 3TK0A 5JUAA 2Y69C 3GORA 4M63A 3LLKA 2CCYA 5COMA 4NTAA 5HV9A 3NMKA 4H54A 1AEPA 1WGWA 5CI8A 3S28A 5BQIA 4LDRA 1Y4CA 3UMHA 1OKKA 2R03A 1TKNA 3C18A 1SF8A 1R4TA 1V4AA 3EGDB 3LESA 2A1DD 4B6IA 4DBQA 2XXAB 1R5ID 2HSQA 1M2VB 4GQHA 5EK0A 1OCOC 2J9BA 2NUTA 4ER9A 3TULA 4AL1A 2KQ9A 1J8YF 3DJNB 4XQ1A 3TOLA 4YJWA 3VF0A 3W2VA 4JRZA 2A0BA 5T3TA 4BJ5A 4N06A 4CJOA 3PDMP 3U9JA 1VK5A 4E18A 4CSAC 3A11A 2BC5A 5KYNA 1VLTA 2OEXA 1W2WA 4CDYA 1ZYRF 3KPHA 4D4XA 4CBEA 1A41A 1Z3IX 1RJ9B 2YWAA 1LM3B 5KYUA 4QI2A 2EPNA 2L7AA 2NUPB 1ZU4A 2EPOA 2Y3GA 3IQ5A 4QI0A 5DQZA 2YL7A 4MTGA 1QVXA 3GM1A 1LI7A 1VYIA 3EPVA 1PCXA 1YYXA 4MVOA 1FR0A 1VTMP 3B0PA 3FOOA 4LDKA 4O7GA 1T6IA 4FWVA 4O79A 4JIOA 1ZU5A 1TQGA 2XL6A 2OCCC 2OJQA 2P61A 4EKWA 4F4BA 3L34A 1E85A 4KI2A 256BA 1OW7A 2KSFA 4O6MA 2YQYA 5KYYA 5AGFA 3V5ZA 3S29A 4I1MA 3HNJA 4JVSA 2J8WA 4NQFA 2Q00A 1EKYA 4KNVA 3QW0A 1NSGB 1TR2A 1RXQA 2JD3A 2L6HA 3N2ZB 2LSEA 4G7OF 5L3VA 1VOMA 1H6GA 4KC9A 3L8JA 2EIMC 4AL0A 3CQZA 1C17M 2J9UA 2VB6A 2B0JA 3HLZA 2EILC 1D0XA 1NBBA 3B29A 3DKAA 2DI3A 2EIJC 3HNLA 5AC4A 4BEMJ 2IXOA 4J7TA 1G4US 4LLEA 3UGPA 3FMSA 3ITFA 1Y6DA 4Z9JA 5JLIA 2DGJA 4IAOA 3RQFA 2R7TA 2CYDA 3AOUA 4U5FE 4XPYA 4PFPA 4K7BA 2B0HA 1WN0A 1ZHYA 1E86A 1WTYA 2PNOA 4E7SA 2GAQA 4OIQF 4MVSA 3W4YA 4CDAA 3AG4C 4I44A 1V54C 3V7OA 2ZXOA 4EBKA 3KMIA 2GA0A 4ULVA 2XM0A 5DS4A 4YWQA 5IY5C 4ZLDA 1AUEA 3AJMA 5KYWB 5E3AA 2X0CA 3OA1A 3I5PA 1NG1A 3DI5A 4PJLA 3U3FA 3CEXA 1BR1A 1MNEA 4XEFA 4DRHB 1L7CA 1I4ZA 4AK9A 2A0UA 5BUOA 3C8ZA 3JSEO 3O39A 1XZQA 3MYIA 1YA9A 3QW1A 5JVEA 3ASNC 3FAPB 3W2WA 4E7ZA 1LE4A 3AG3C 2HV6A 5KYXA 2Y3BA 4K0DA 3EHMA 2R7UA 2VCCA 2H7BA 4LDQA 2FFHA 1K05A 3K1HA 1ORSC 1OKKD 2MHRA 3PHF2 4FX5A 3J06A 4CS7A 3H65A 2ETSA 3RVZA 1NFNA 5B3IA 2XRHA 1IW7F 4IJJA 4JJGA 4MS2A 5DS6A 3GODA 5JT4A 1ZZPA 3X2QC 3UR3C 1OR2A 4C7OB 2YZSA 3LS1A 4JEAA 1HE1A 3DM9B 3IQ6A 5B1AC 2R7RA 1O87A 4U5CE 3SZRA 3B71A 1D0YA 1SMYF 3MLGA 4AX2A 1VYKA 2EIKC 4NY3A 3UMKA 4E0IA 4CIHA 2PP4A 3NKEA 2DYSC 3GWLA 1VB5A 1WWPA 3QTHA 3FOPA 3IQTA 1DOWA 4OIOF 3NYLA 2R02A 1HY5A 2J0XA 2KJGA 3NYMA 4CS8C 4JTCB 3ZWIA 1OXKA 2J7PD 4H4KC 1YLMA 4XEKA 3W8HA 2RSEB 1JPJA 4NCQA 2IM8A 5KYXB 1S7ZA 3DJUB 2VC9A 2UUIA 2WVNA 4P6IC 1E2XA 3EH2A 3K1IA 2XL4A 4MW8A 5E2QA 3LAYA 1D0ZA 5F5FA 3M1CB 5BQGA 4CS8A 3S84A 3RYLA 2CDQA 1ZHTA 2OEVA 2YRFA 1RCPA 3M15A 2XXAA 3ZVRA 1QKRA 1O5HA 1V55C 5EGYA 3TD7A 3Q7GA 1LE2A 3DM5A 4IRUA 5L0GA 2AVKA 3G4XA 4O6YA 2PX0A 2WVQA 1A7DA 2YLGA 4P9FA 3ABKC 3IPMO 2J7PA 3U8PA 3IEEA 4G0HA 3MBGA 4QDLA 2WB7A 3CZ6A 4YT4A 2PF4E 4XWJA 3K6BA 2A69F 3AGUA 4BJ5C 1J8MF 1ORYA 2JPUA 1QQ3A 3DD7A 3LLIA 1OCCC 5K0IA 2DB4A 3O55A 4EBJA 3GEIA 2XS1A 4X0RA 3R7CA 4A4AA 4J7YA 4MVQA 4N6HA 3S90A 5CI9A 5L0JA 3EGXA 2A6EF 4JCHA 5A6AA 1TFOB 2AU5A 3QVZA 2H7VC 1D1CA 2OOCA 4PJMA 3LEVA 3ASOC 1FFHA 3ZTMA 2C04A 2WZGA 4DOZA 1QPUA 1JMWA 3RQGA 4JEBA 1RMVA 4O6NA 1OQCA 3ZIBA 4P9TA 3JCUQ 3U9MA 3EJNA 2R7SA 4J32B 3FHDA 3K7DA 4DRIB 3ABLC 3GWNA 2GDCA 1CPRA 2G3VA 4BPMA 4EBBA 2KW3C 2OQMA 3DE8A 3OEOA 3LNMB 4A2NB 4G7HF 1K04A 3TOMA 1ORJA 2F22A 3E70C 3EH1A 4JURI 3SXZA 3RH3A 2ICWG 5B1BC 3ATPA 1CGNA 4EWCA 3CAXA 3LNRA 1PD0A 4IARA 3UNGC 4C3DA 4DRJB 1ZW2A 5EHHA 4W8PA 2A6HF 2AP3A 1H9GA 3B0UX 1VMAA 1Q0DA 1A7EA 3NG1A 4MNDA 3ZG1A 3M4CA 3S27A 4JCZA 3K1IC 2Y3HA 1JAFA 2FGYA 2QY9A 2GWWA 3JTLO 1M2VA 3POVA 3JYYA
chains in the Genus database with same CATH topology
4Z9JA 1VLTA 1VLSA 4H54A 2D4UA 4Z9IA 1LIHA 2LIGA 3T9OA 3ATPA 1JMWA 1WASA 2ASRA 1WATA 4Z9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9J A;  1VLT A;  1VLS A;  4H54 A;  2D4U A;  4Z9I A;  1LIH A;  2LIG A;  3T9O A;  3ATP A;  1JMW A;  1WAS A;  2ASR A;  1WAT A;  4Z9H A; 
#chains in the Genus database with same CATH topology
 2NUT B;  3US6 A;  5A69 A;  2XLW A;  1QLE C;  1BR2 A;  3U0C A;  1LI5 A;  1T01 A;  1QZX A;  3NMI A;  1NFO A;  3DZA A;  2VCB A;  3K33 A;  2IXN A;  3EG9 A;  4K1O A;  2H7O A;  1T6U A;  1YYJ A;  3LEO A;  2KNH A;  4RD9 A;  1BBH A;  4GYT A;  2YHS A;  1HE9 A;  4EHP A;  1YZA A;  5KYU B;  2LP4 A;  4WJ0 A;  4XEV A;  3ZDL A;  2H8A A;  3ZQV A;  2NSF A;  1FMW A;  3C62 A;  4L6R A;  4E0H A;  1E84 A;  4I1O B;  5CIV A;  5A6J A;  4U9D A;  4EUK B;  3ZQY A;  2LCH A;  2Q4F A;  3GEE A;  3MFN A;  3AG1 C;  3U3B A;  2I8B A;  3HKK A;  2W4M A;  4IB4 A;  3U8V A;  1T6Q A;  2G62 A;  2HJM A;  4J30 B;  1LKX A;  1FTS A;  3TJ5 A;  3JRT A;  4CJG A;  2R7O A;  2HMQ A;  1UFB A;  4YL1 A;  2CW0 F;  3W8I A;  4EIY A;  1D1A A;  2VAS A;  2R7Q A;  3K66 A;  4JKV A;  3TQO A;  2EIN C;  1WAS A;  5F5H A;  4PJN A;  1HW1 A;  4OIP F;  1M57 C;  2J9V A;  2XLV A;  3UMI A;  4UDV A;  2VH3 A;  1HW2 A;  5TJ5 E;  1Q0K A;  2P1A A;  4GEH A;  2EPL X;  5COG A;  4FAP B;  2LFF A;  4JW1 A;  2JX0 A;  2V26 A;  2WZF A;  2IXM A;  1V74 B;  3U2L A;  4YT8 A;  1HMD A;  2W45 A;  2R9R B;  1D1B A;  4XPX A;  2R25 A;  3O6X A;  3SP1 A;  1H7I A;  2EPM X;  3GEH A;  1EQ1 A;  3VRC A;  3F46 A;  3DAF A;  3RIP A;  1Z63 A;  1OCZ C;  3T6G B;  4E17 A;  2KGO A;  1NU9 C;  1GM5 A;  4U5D E;  2XLM A;  2D4U A;  3JZ0 A;  5FCL A;  2QNL A;  1GS9 A;  5D92 A;  2Q3T A;  4HFF B;  3RF3 A;  2MYS A;  3RW0 A;  3WHN A;  3PCV A;  2XLD A;  4G7Z F;  1M56 C;  2LQG A;  3GM3 A;  1HMO A;  1LIH A;  3HTK C;  4MW3 A;  5DVW A;  3T4R A;  3S0X A;  4MVU A;  1NZE A;  2ASR A;  3L1M A;  2IYL D;  3GAN A;  5E33 A;  4Q4Z F;  1CPQ A;  2YKZ A;  3EQL F;  1MMN A;  2E87 A;  2PX3 A;  4PR9 A;  5JP7 A;  1I4Y A;  1RKC A;  2M64 A;  4YL3 A;  5F28 E;  4DVY P;  3T6J A;  4G78 A;  4NTB A;  1CGO A;  5COF A;  2YL0 A;  4IGG A;  4JJF A;  1AVO B;  1OCR C;  3DAG A;  5FZT A;  2P7V A;  2NPU A;  4ANJ A;  1NLX A;  1LS4 A;  1T5O A;  3C8G D;  2W9Y A;  3ECS A;  3KH2 A;  3B9Q A;  3Q7L A;  1EA8 A;  3SXY A;  2VCA A;  3HJC A;  4MTF A;  4N4W A;  4PJJ A;  5B3S C;  2LIG A;  3L8I A;  4HFK B;  5JS5 A;  4C7O A;  2HZ8 A;  5L0I A;  2XM4 A;  4Z9H A;  4YT2 A;  3RVY A;  2CGE A;  3QMK A;  2Q9C A;  1T9K A;  2NUP A;  5DQT A;  2OG2 A;  4XPW A;  4R32 A;  3MYF A;  1Z5Z A;  3C8G B;  3ZSU A;  3VM6 A;  2CNW A;  3C63 A;  4IAQ A;  4YN0 B;  2KK1 A;  4WGY A;  4PAC A;  1OW8 A;  2XL8 A;  3T9O A;  2AWC A;  4XTK A;  3JYH A;  3EG9 B;  4CSA A;  1ZVZ A;  3EHN A;  2HMZ A;  3NKD A;  1YZC A;  1FAP B;  2L6F A;  5AC5 A;  3EZH A;  3H2V A;  2G3K A;  3E9V A;  4NTF A;  3V5Y A;  3FAJ A;  4RBN A;  4DBR A;  2WL8 A;  2J46 A;  2ZPA A;  1FFT C;  1Z6A A;  5JSL A;  3F47 A;  2QTV A;  5DS5 A;  1O3U A;  5L3Q A;  4C3E A;  2HKV A;  2J45 A;  1YVI A;  2BL2 A;  2L6G A;  3R2P A;  1KTM A;  3KYI A;  4BJT A;  2J0W A;  3I4U A;  2IOQ A;  1G8X A;  1I5N A;  2W4B A;  3DMD A;  4CIP A;  1TFK B;  3VYW A;  3UGO A;  1LS1 A;  2XLO A;  4Q5S F;  4LLC A;  3OWT A;  2KYH A;  1EI7 A;  2DYR C;  2YLI A;  5A6K A;  1BDJ B;  4BJ1 A;  3N24 A;  2NSG A;  4BG0 A;  2ZXP A;  3KL4 A;  1MMG A;  3SNH A;  4ZLC A;  1QSP A;  1RKE A;  3FDQ A;  1GGQ A;  1JR8 A;  3T6B A;  2EPK X;  1ST6 A;  3AQC A;  3JT1 A;  2P0N A;  3WOD F;  5L0D A;  2ZXR A;  1MND A;  2Z15 A;  2XLE A;  3A9C A;  1ZW3 A;  2L81 A;  3EFO B;  1JRA A;  1TWC A;  2RD9 A;  1NU7 D;  4KNW A;  2A68 F;  4JC7 A;  1S05 A;  2LD6 A;  3FXH A;  4YT5 A;  5L0F A;  1M2O A;  3LJB A;  2X51 A;  3N0T A;  4CX9 A;  4YL0 A;  5D91 A;  2HS5 A;  4AE4 B;  2UUH A;  3RFY A;  3S9O A;  4XLN F;  2LK4 A;  4BJ6 C;  1XWJ A;  4N6C A;  4MVR A;  4U5B E;  4U9E A;  1Q0G A;  1TWA A;  4D4N A;  5JRA A;  1FMV A;  3AGT A;  2BE5 F;  1WAT A;  2HSB A;  2J9W A;  2FAP B;  3GM2 A;  3Q6M A;  3B0V C;  4MQ9 F;  1BR4 A;  3M4B A;  3JSZ A;  5L0C A;  2Q9B A;  1Q0F A;  4PFO A;  1MMD A;  4BJ6 A;  2QLA A;  1JOG A;  1N1C A;  3NYJ A;  5HSW A;  1UG7 A;  3VAY A;  4CS9 C;  4MVM A;  1IZM A;  4XLP F;  3AG2 C;  5L0H A;  1ZHX A;  5KYY B;  1C03 A;  3IQC A;  2Q7R A;  1A7V A;  2MWQ A;  2QE9 A;  1K40 A;  3G50 A;  4BEJ A;  2ZXW C;  4LER A;  2O9X A;  5T1D B;  2TMV P;  1MQV A;  3Q6N A;  3QVY A;  5DLJ A;  1ZHZ A;  1U0B B;  3WG7 C;  3DWW A;  1FNT c;  1PD1 A;  1OR3 A;  3M79 A;  2PBE A;  4FES A;  1E83 A;  4I3M A;  1YA7 O;  3KKB A;  4HEA J;  2XS8 A;  4OD4 A;  1RJ9 A;  5GPG B;  3RQE A;  3TJ6 A;  1GQA A;  2WVO A;  3EFO A;  3ZC4 A;  1SR2 A;  3DXJ F;  4JTD B;  3V5X A;  1Z23 A;  3PMR A;  1F1M A;  3JRM O;  2Y3D A;  2M4E A;  2D5R B;  2HV7 A;  1Z7Q c;  3U5S A;  4AE4 A;  1VLS A;  1XZP A;  1G4W R;  1JPN A;  2HUJ A;  2AWY A;  5E3C A;  3O10 A;  1Q0M A;  3FVY A;  4Z9I A;  4OIR F;  4RDA A;  4WAB A;  3LUT B;  5A6B D;  4MTO A;  5A6B A;  1APC A;  2XSE A;  5KYW A;  4JE9 A;  1YDI A;  2R05 A;  2Y39 A;  3LS0 A;  3MX3 A;  3H2U A;  3NMJ A;  4DXW A;  2WZL A;  4JTA B;  3BRJ A;  3ZTZ A;  4ULW A;  2QUP A;  2IBF A;  2OKU A;  2L9J A;  1H9T A;  2HJ3 A;  1BZ4 A;  2YL3 A;  1SYQ A;  2GFH A;  3AQB A;  3C7J A;  4OD5 A;  3RKO F;  1OW6 A;  2Q9A A;  4W8K A;  2HFI A;  1M6T A;  1B68 A;  2ZD9 A;  4HE8 D;  3SEO A;  1KU2 A;  1LPE A;  2CNW D;  2KC3 A;  2OJE D;  4MVZ A;  4WGZ A;  2LFD A;  2V3C C;  4CS9 A;  4ONS A;  3WAQ A;  4DVZ A;  1OXB A;  1C02 A;  2NG1 A;  3HNK A;  4NC3 A;  1L3P A;  4PK4 A;  2YVK A;  3QZC A;  3CSK A;  4Q7C A;  3EGD A;  3SXM A;  1U89 A;  3NDB B;  3BEH A;  2I15 A;  5T3W A;  1ZHW A;  2YL1 A;  3C8G A;  3I5Q A;  4OIN F;  2R7W A;  3EGX B;  3SYN A;  1KNY A;  4DJ9 A;  1MMA A;  3DE9 A;  1YJG A;  3KYJ A;  4YK5 A;  3SXK A;  1RKE B;  4IWB A;  4JZA A;  4CDV A;  3L0I A;  5BQH A;  4U5E E;  1CGM E;  1YAR O;  3IHU A;  4C3B A;  2IXP A;  2P6V A;  2C03 A;  1TWH A;  1G5Z A;  3HNI A;  1LVK A;  2XLH A;  1A0B A;  3EZI A;  1WOL A;  2YLD A;  3G4Z A;  3NRH A;  3X1O A;  2R7X A;  4U5G A;  1SZI A;  2R7V A;  4U5H A;  3ABM C;  4KBL A;  4LAC B;  1PV3 A;  1DOV A;  1YAU O;  2PFD A;  2YEV A;  2OU6 A;  3U2M A;  1U6H A;  1TWG A;  3TK0 A;  5JUA A;  2Y69 C;  3GOR A;  4M63 A;  3LLK A;  2CCY A;  5COM A;  4NTA A;  5HV9 A;  3NMK A;  4H54 A;  1AEP A;  1WGW A;  5CI8 A;  3S28 A;  5BQI A;  4LDR A;  1Y4C A;  3UMH A;  1OKK A;  2R03 A;  1TKN A;  3C18 A;  1SF8 A;  1R4T A;  1V4A A;  3EGD B;  3LES A;  2A1D D;  4B6I A;  4DBQ A;  2XXA B;  1R5I D;  2HSQ A;  1M2V B;  4GQH A;  5EK0 A;  1OCO C;  2J9B A;  2NUT A;  4ER9 A;  3TUL A;  4AL1 A;  2KQ9 A;  1J8Y F;  3DJN B;  4XQ1 A;  3TOL A;  4YJW A;  3VF0 A;  3W2V A;  4JRZ A;  2A0B A;  5T3T A;  4BJ5 A;  4N06 A;  4CJO A;  3PDM P;  3U9J A;  1VK5 A;  4E18 A;  4CSA C;  3A11 A;  2BC5 A;  5KYN A;  1VLT A;  2OEX A;  1W2W A;  4CDY A;  1ZYR F;  3KPH A;  4D4X A;  4CBE A;  1A41 A;  1Z3I X;  1RJ9 B;  2YWA A;  1LM3 B;  5KYU A;  4QI2 A;  2EPN A;  2L7A A;  2NUP B;  1ZU4 A;  2EPO A;  2Y3G A;  3IQ5 A;  4QI0 A;  5DQZ A;  2YL7 A;  4MTG A;  1QVX A;  3GM1 A;  1LI7 A;  1VYI A;  3EPV A;  1PCX A;  1YYX A;  4MVO A;  1FR0 A;  1VTM P;  3B0P A;  3FOO A;  4LDK A;  4O7G A;  1T6I A;  4FWV A;  4O79 A;  4JIO A;  1ZU5 A;  1TQG A;  2XL6 A;  2OCC C;  2OJQ A;  2P61 A;  4EKW A;  4F4B A;  3L34 A;  1E85 A;  4KI2 A;  256B A;  1OW7 A;  2KSF A;  4O6M A;  2YQY A;  5KYY A;  5AGF A;  3V5Z A;  3S29 A;  4I1M A;  3HNJ A;  4JVS A;  2J8W A;  4NQF A;  2Q00 A;  1EKY A;  4KNV A;  3QW0 A;  1NSG B;  1TR2 A;  1RXQ A;  2JD3 A;  2L6H A;  3N2Z B;  2LSE A;  4G7O F;  5L3V A;  1VOM A;  1H6G A;  4KC9 A;  3L8J A;  2EIM C;  4AL0 A;  3CQZ A;  1C17 M;  2J9U A;  2VB6 A;  2B0J A;  3HLZ A;  2EIL C;  1D0X A;  1NBB A;  3B29 A;  3DKA A;  2DI3 A;  2EIJ C;  3HNL A;  5AC4 A;  4BEM J;  2IXO A;  4J7T A;  1G4U S;  4LLE A;  3UGP A;  3FMS A;  3ITF A;  1Y6D A;  4Z9J A;  5JLI A;  2DGJ A;  4IAO A;  3RQF A;  2R7T A;  2CYD A;  3AOU A;  4U5F E;  4XPY A;  4PFP A;  4K7B A;  2B0H A;  1WN0 A;  1ZHY A;  1E86 A;  1WTY A;  2PNO A;  4E7S A;  2GAQ A;  4OIQ F;  4MVS A;  3W4Y A;  4CDA A;  3AG4 C;  4I44 A;  1V54 C;  3V7O A;  2ZXO A;  4EBK A;  3KMI A;  2GA0 A;  4ULV A;  2XM0 A;  5DS4 A;  4YWQ A;  5IY5 C;  4ZLD A;  1AUE A;  3AJM A;  5KYW B;  5E3A A;  2X0C A;  3OA1 A;  3I5P A;  1NG1 A;  3DI5 A;  4PJL A;  3U3F A;  3CEX A;  1BR1 A;  1MNE A;  4XEF A;  4DRH B;  1L7C A;  1I4Z A;  4AK9 A;  2A0U A;  5BUO A;  3C8Z A;  3JSE O;  3O39 A;  1XZQ A;  3MYI A;  1YA9 A;  3QW1 A;  5JVE A;  3ASN C;  3FAP B;  3W2W A;  4E7Z A;  1LE4 A;  3AG3 C;  2HV6 A;  5KYX A;  2Y3B A;  4K0D A;  3EHM A;  2R7U A;  2VCC A;  2H7B A;  4LDQ A;  2FFH A;  1K05 A;  3K1H A;  1ORS C;  1OKK D;  2MHR A;  3PHF 2;  4FX5 A;  3J06 A;  4CS7 A;  3H65 A;  2ETS A;  3RVZ A;  1NFN A;  5B3I A;  2XRH A;  1IW7 F;  4IJJ A;  4JJG A;  4MS2 A;  5DS6 A;  3GOD A;  5JT4 A;  1ZZP A;  3X2Q C;  3UR3 C;  1OR2 A;  4C7O B;  2YZS A;  3LS1 A;  4JEA A;  1HE1 A;  3DM9 B;  3IQ6 A;  5B1A C;  2R7R A;  1O87 A;  4U5C E;  3SZR A;  3B71 A;  1D0Y A;  1SMY F;  3MLG A;  4AX2 A;  1VYK A;  2EIK C;  4NY3 A;  3UMK A;  4E0I A;  4CIH A;  2PP4 A;  3NKE A;  2DYS C;  3GWL A;  1VB5 A;  1WWP A;  3QTH A;  3FOP A;  3IQT A;  1DOW A;  4OIO F;  3NYL A;  2R02 A;  1HY5 A;  2J0X A;  2KJG A;  3NYM A;  4CS8 C;  4JTC B;  3ZWI A;  1OXK A;  2J7P D;  4H4K C;  1YLM A;  4XEK A;  3W8H A;  2RSE B;  1JPJ A;  4NCQ A;  2IM8 A;  5KYX B;  1S7Z A;  3DJU B;  2VC9 A;  2UUI A;  2WVN A;  4P6I C;  1E2X A;  3EH2 A;  3K1I A;  2XL4 A;  4MW8 A;  5E2Q A;  3LAY A;  1D0Z A;  5F5F A;  3M1C B;  5BQG A;  4CS8 A;  3S84 A;  3RYL A;  2CDQ A;  1ZHT A;  2OEV A;  2YRF A;  1RCP A;  3M15 A;  2XXA A;  3ZVR A;  1QKR A;  1O5H A;  1V55 C;  5EGY A;  3TD7 A;  3Q7G A;  1LE2 A;  3DM5 A;  4IRU A;  5L0G A;  2AVK A;  3G4X A;  4O6Y A;  2PX0 A;  2WVQ A;  1A7D A;  2YLG A;  4P9F A;  3ABK C;  3IPM O;  2J7P A;  3U8P A;  3IEE A;  4G0H A;  3MBG A;  4QDL A;  2WB7 A;  3CZ6 A;  4YT4 A;  2PF4 E;  4XWJ A;  3K6B A;  2A69 F;  3AGU A;  4BJ5 C;  1J8M F;  1ORY A;  2JPU A;  1QQ3 A;  3DD7 A;  3LLI A;  1OCC C;  5K0I A;  2DB4 A;  3O55 A;  4EBJ A;  3GEI A;  2XS1 A;  4X0R A;  3R7C A;  4A4A A;  4J7Y A;  4MVQ A;  4N6H A;  3S90 A;  5CI9 A;  5L0J A;  3EGX A;  2A6E F;  4JCH A;  5A6A A;  1TFO B;  2AU5 A;  3QVZ A;  2H7V C;  1D1C A;  2OOC A;  4PJM A;  3LEV A;  3ASO C;  1FFH A;  3ZTM A;  2C04 A;  2WZG A;  4DOZ A;  1QPU A;  1JMW A;  3RQG A;  4JEB A;  1RMV A;  4O6N A;  1OQC A;  3ZIB A;  4P9T A;  3JCU Q;  3U9M A;  3EJN A;  2R7S A;  4J32 B;  3FHD A;  3K7D A;  4DRI B;  3ABL C;  3GWN A;  2GDC A;  1CPR A;  2G3V A;  4BPM A;  4EBB A;  2KW3 C;  2OQM A;  3DE8 A;  3OEO A;  3LNM B;  4A2N B;  4G7H F;  1K04 A;  3TOM A;  1ORJ A;  2F22 A;  3E70 C;  3EH1 A;  4JUR I;  3SXZ A;  3RH3 A;  2ICW G;  5B1B C;  3ATP A;  1CGN A;  4EWC A;  3CAX A;  3LNR A;  1PD0 A;  4IAR A;  3UNG C;  4C3D A;  4DRJ B;  1ZW2 A;  5EHH A;  4W8P A;  2A6H F;  2AP3 A;  1H9G A;  3B0U X;  1VMA A;  1Q0D A;  1A7E A;  3NG1 A;  4MND A;  3ZG1 A;  3M4C A;  3S27 A;  4JCZ A;  3K1I C;  2Y3H A;  1JAF A;  2FGY A;  2QY9 A;  2GWW A;  3JTL O;  1M2V A;  3POV A;  3JYY A; 
#chains in the Genus database with same CATH homology
 4Z9J A;  1VLT A;  1VLS A;  4H54 A;  2D4U A;  4Z9I A;  1LIH A;  2LIG A;  3T9O A;  3ATP A;  1JMW A;  1WAS A;  2ASR A;  1WAT A;  4Z9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...