4Z9JA

Apo-tar from e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
158
structure length
158
Chain Sequence
SQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein II
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
total genus 70
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9jA00
3ATPA 4H54A 1JMWA 3T9OA 1WASA 2ASRA 1VLSA 1WATA 4Z9HA 4Z9IA 4Z9JA 2LIGA 1LIHA 2D4UA 1VLTA
chains in the Genus database with same CATH superfamily
4MTGA 2HSQA 2J9WA 1TQGA 5T3WA 1GQAA 3K1IC 3T6BA 4OIPF 1OKKD 1WOLA 3U3FA 4Q7CA 4WABA 3RF3A 2KK1A 3KKBA 1ORSC 1ZW3A 2Q4FA 2WL8A 4IWBA 5FCLA 1N1CA 4I3MA 1MMAA 5L3VA 1CPQA 4CIPA 3AJMA 4JVSA 4MTOA 3EZHA 3EGXA 3I5QA 1RJ9B 4ZLDA 4K7BA 4BG0A 5IY5C 3SP1A 4R32A 3LEOA 2DYSC 4JE9A 5B1BC 1KNYA 2HV6A 4LACB 3JSZA 2KSFA 3SZRA 2HFIA 1W2WA 5L3QA 2OQMA 4D4XA 3N2ZB 2Q9BA 1TWGA 3GM2A 1G4WR 3AQCA 4OIQF 1KTMA 1I4ZA 5COGA 5DLJA 1S05A 1M2VB 2CNWD 2KW3C 3NMJA 1ZHYA 3C18A 3A9CA 3EFOA 4EBKA 3TJ6A 4MNDA 2R7TA 3S0XA 4FWVA 2L9JA 2G3KA 2QY9A 1APCA 4A2NB 2GWWA 4WGZA 3RYLA 4N6HA 2HSBA 1NFNA 1A0BA 4H4KC 2ZD9A 2EIJC 3NMKA 1D0YA 2D4UA 2LIGA 1NZEA 3NG1A 5JT4A 2P7VA 4CBEA 3ABMC 5KYYB 2H7OA 1ZYRF 1BZ4A 1FAPB 2VCAA 3FHDA 3RQFA 4E0HA 2HKVA 2KGOA 1HW1A 4YN0B 3I4UA 4LDQA 1H9TA 3LUTB 1FMVA 3LLKA 3ASOC 3LS0A 3NDBB 2PX0A 5L0CA 2P61A 3GEEA 1ZHXA 3MBGA 4Q5SF 4XEFA 2TMVP 1A7VA 4MVMA 4P9FA 1HMDA 4PJMA 2XLWA 3Q6MA 1T9KA 1LE4A 2YLGA 2FAPB 2ETSA 2IXPA 4WGYA 5T1DB 4OIOF 4G7HF 4BJ6A 3MYFA 3EGXB 1VB5A 3WHNA 1OCRC 5E3AA 1Z5ZA 1JMWA 5L0FA 4C3DA 1FR0A 1QZXA 4LLCA 1LVKA 2X51A 1E84A 2WZGA 4CSAA 1BR2A 5JUAA 1BBHA 3S28A 2L7AA 2PX3A 3ITFA 4OD5A 1Z7Qc 4CJGA 5D91A 1TFKB 3EH1A 3CEXA 1AVOB 1OW6A 2EIKC 4NCQA 2J45A 2Y39A 1VMAA 4E0IA 3B71A 5COMA 3EFOB 4NY3A 3UR3C 1E85A 1RKCA 2JD3A 1YA7O 2BC5A 4PJJA 3NKDA 3NYMA 4F4BA 3JCUQ 3B0PA 4U5HA 3HNLA 2DI3A 4AK9A 5DS5A 1QVXA 3ABKC 3HKKA 2ZXPA 3T6GB 4WJ0A 4C3BA 1SMYF 2EPKX 3RVZA 3U9JA 3QVZA 4IAOA 3LJBA 4KNVA 3JRMO 2ZXWC 3AG4C 4BPMA 4U5GA 3GORA 1S7ZA 2IM8A 2GA0A 3C8ZA 1WWPA 4Z9JA 4IJJA 4BJ6C 4CS8A 4DVZA 3VYWA 4LDKA 2VH3A 4MVOA 3EPVA 1C02A 2V3CC 5A6JA 3LNRA 1CGNA 4MVSA 2F22A 1OW7A 2Y69C 1Z23A 3DD7A 4CDAA 3JZ0A 4LDRA 4CSAC 3EJNA 4CIHA 2OKUA 2YL0A 3M4CA 4AL1A 4KI2A 1M2OA 2XSEA 2HMZA 2YQYA 1QLEC 2PP4A 1M2VA 2G3VA 1Q0MA 3W4YA 2AWYA 2HV7A 2DGJA 5E3CA 3DAGA 3JT1A 1ZHWA 2A6EF 4YJWA 2HJMA 4I1OB 1CGOA 2Q7RA 2Y3BA 2YKZA 4DRIB 1D1AA 2J9VA 2LP4A 4GQHA 2VC9A 2OOCA 5EK0A 2OJQA 1EI7A 3AGTA 5F5FA 2J0XA 2XLEA 4U9EA 2PF4E 4QI0A 1ZVZA 3F46A 3ZQYA 3TOLA 1E83A 2YVKA 1O87A 2E87A 4IARA 3DI5A 1RKEA 5AC4A 1G8XA 2MWQA 2XLHA 4PFOA 3FOOA 1LIHA 2LQGA 3C8GD 3HNKA 3UMIA 4CS8C 3RIPA 3PDMP 1VTMP 2GDCA 3L8JA 3R2PA 2JX0A 3KYJA 3S27A 3UNGC 4EIYA 3B29A 3AG2C 5HSWA 3HTKC 4YK5A 2NG1A 4N06A 1OXBA 3TOMA 3GM1A 4MW8A 1G5ZA 1L3PA 4RD9A 2EINC 2A6HF 5T3TA 5JRAA 1IW7F 3DMDA 3V5YA 1XWJA 2BL2A 3WODF 2Q9CA 2IXNA 2XL4A 3Q7LA 1LM3B 3GEIA 4KNWA 1MNEA 1QPUA 2H7VC 3K7DA 2UUHA 3RKOF 3LAYA 3TQOA 3IEEA 1OXKA 2ZXOA 4CJOA 2XL6A 4O6NA 1VYKA 4Z9IA 1EQ1A 3DE9A 1BR4A 4U5CE 1T6QA 1ST6A 3DZAA 4IAQA 2YLIA 3NMIA 5F28E 1V74B 1F1MA 3BRJA 4XQ1A 2P1AA 3FMSA 3CAXA 5KYWA 2V26A 1YA9A 3C7JA 5HV9A 2C04A 1WASA 4JURI 4M63A 2R02A 3S9OA 3QTHA 1J8MF 1K04A 4J32B 2R03A 3HJCA 2A69F 4QDLA 4I1MA 1PD1A 2J7PA 2Q00A 5DS4A 4P6IC 2NUTB 5L0JA 3G50A 5CI8A 1LE2A 3M1CB 3DWWA 1M57C 5JP7A 1NG1A 4HFFB 1TWAA 2LD6A 2HZ8A 2DYRC 3OEOA 4ULVA 4OINF 3US6A 1CPRA 2A68F 4G0HA 3X2QC 2LFDA 5L0IA 2WZFA 2W9YA 1OCZC 3B0UX 1RKEB 3R7CA 4JTAB 1YARO 3NYLA 4KC9A 4XPWA 4OIRF 1U89A 3Q6NA 3MLGA 5JSLA 3DJUB 2XXAA 1Q0GA 3ZSUA 2PFDA 3ZTZA 1FMWA 1V4AA 2DB4A 2HJ3A 2R05A 5BQIA 1R5ID 3SNHA 2XL8A 2YZSA 1LS4A 2YL7A 4AE4B 3ZC4A 1YAUO 2YL1A 3UMHA 4N6CA 2RD9A 3UMKA 1Q0KA 1VLTA 3U8PA 1TFOB 1YYJA 3L34A 1ZZPA 3O55A 1IZMA 2M4EA 2RSEB 4JCZA 1RCPA 5TJ5E 4MVQA 3IPMO 1V55C 1JR8A 1LI5A 2XS1A 4NTAA 1QSPA 1OCOC 3N0TA 1Q0FA 3OWTA 3RFYA 4JRZA 4N4WA 1PCXA 1YZCA 4YL0A 3VF0A 4Q4ZF 1U0BB 1MMNA 1NSGB 1TWHA 2IXMA 4X0RA 4EHPA 4O7GA 1UG7A 3LESA 1OW8A 3H2VA 5KYWB 1YYXA 2XM4A 1YZAA 3QW1A 3SXYA 3ZTMA 4AX2A 2Y3GA 1K05A 1TKNA 1TWCA 4U5FE 1LI7A 2R7SA 3PMRA 2NSFA 4DRHB 4JTDB 4YT5A 2C03A 2M64A 2XS8A 2CDQA 4EUKB 2X0CA 2YLDA 1BDJB 1JAFA 4XPXA 2VCCA 3SXZA 3RVYA 4DRJB 5KYNA 1E86A 1LKXA 3MX3A 2J8WA 5L0HA 4DBQA 2WVOA 3K66A 3ZVRA 3ABLC 2KJGA 2WVQA 4HEAJ 2KYHA 1WATA 3SEOA 1A7EA 3U2LA 3ZQVA 3PCVA 4NTBA 4CS9A 4XLNF 4DOZA 5JS5A 3VAYA 3O10A 2XXAB 5CI9A 4ZLCA 3ZWIA 3S90A 3CSKA 2L81A 1O3UA 3BEHA 2UUIA 4YT4A 4RBNA 3KL4A 2R7RA 1AUEA 1LS1A 3B9QA 4AL0A 3HLZA 3ZIBA 4RDAA 3OA1A 3ZDLA 1ORYA 2KNHA 5DS6A 2GFHA 3V5XA 4LLEA 3C8GA 1UFBA 3QMKA 4O6YA 2I8BA 1H9GA 2ASRA 4ONSA 4JCHA 4MVZA 1HY5A 1TR2A 3FDQA 3T4RA 3JSEO 4P9TA 4E17A 4JEAA 1D0ZA 4L6RA 2J0WA 2OU6A 1OKKA 1T01A 2A0UA 3EG9A 2VCBA 2NUTA 1Z3IX 2R9RB 4XEVA 4IB4A 5CIVA 4JIOA 3EHNA 5B1AC 4A4AA 1O5HA 2XLDA 5AGFA 1L7CA 3LNMB 1T6IA 2R25A 3T6JA 4C3EA 2EPNA 1FFHA 4JTCB 3VM6A 3DAFA 3W2VA 3WG7C 1V54C 2AU5A 3E9VA 4G78A 1XZQA 4CS9C 5KYXA 5A6BD 2R7VA 4GEHA 4E7SA 2KQ9A 1D1CA 3EZIA 1RXQA 3AOUA 2WVNA 1ZU4A 3WAQA 4O79A 5FZTA 2IBFA 2LK4A 4EBBA 5GPGB 4E18A 3T9OA 2IOQA 4XWJA 1YJGA 2PNOA 4AE4A 4JZAA 3POVA 4IGGA 3U2MA 4UDVA 256BA 4PFPA 2CNWA 2VASA 3RQGA 1FNTc 4HFKB 3FAPB 3K1HA 3U0CA 2R7OA 3QW0A 3K6BA 1GGQA 1ZW2A 3I5PA 1B68A 5A6AA 3F47A 2CW0F 2NSGA 2JPUA 4DXWA 4H54A 3C63A 5B3SC 3LLIA 5JLIA 3H65A 1VYIA 4J7YA 2R7UA 1CGME 4B6IA 2L6GA 5DQTA 4ER9A 1SZIA 2YEVA 3EQLF 5L0GA 2EILC 2J9UA 1JOGA 3ECSA 1D0XA 1HE1A 3LEVA 4U9DA 3A11A 4BEJA 4D4NA 1WTYA 2KC3A 1QQ3A 2WB7A 3C8GB 2QTVA 4MW3A 4YT2A 1FTSA 3U5SA 1JPJA 3TD7A 2OEVA 2ZPAA 1GS9A 2W4MA 2MYSA 1T5OA 3B0VC 2H7BA 3O6XA 4C7OA 3IQTA 1I5NA 1MMDA 1SF8A 3EG9B 3KYIA 3U3BA 5BQGA 1GM5A 3EH2A 1MQVA 1YDIA 3M4BA 2EPOA 2R7WA 3TULA 3VRCA 1G4US 2LCHA 4MTFA 4XLPF 2G62A 3GWNA 2EPMX 1H6GA 5KYXB 2FGYA 3QVYA 3NRHA 3CZ6A 3X1OA 2R7QA 3FVYA 1AEPA 5BQHA 2CCYA 5A6KA 2AP3A 3IQCA 4W8PA 3W8IA 2Q9AA 2W4BA 3MYIA 2OJED 4J30B 4Z9HA 2B0HA 3DKAA 4HE8D 1DOWA 1I4YA 4XEKA 4CS7A 4G7OF 5K0IA 5DVWA 1K40A 3FOPA 2L6HA 4JKVA 1JPNA 3NYJA 3ATPA 3M79A 4U5BE 2W45A 3KMIA 2MHRA 4YL1A 4G7ZF 1YVIA 2PBEA 3CQZA 2QNLA 3S29A 3K33A 2P6VA 2AVKA 3V5ZA 2ICWG 3SXMA 2O9XA 3FXHA 5F5HA 3DE8A 3M15A 2YHSA 2Y3DA 3GM3A 3GWLA 2Y3HA 1OCCC 2YWAA 5B3IA 2L6FA 2A0BA 3JYHA 4K0DA 1MMGA 4XPYA 4K1OA 3ZG1A 3PHF2 1OR3A 4J7TA 3AGUA 3IQ6A 1ZU5A 1YLMA 2J7PD 3QZCA 1KU2A 3AG3C 2EIMC 3MFNA 3S84A 2LFFA 2YL3A 4EWCA 1JRAA 2J46A 4CDVA 2NUPA 3EGDA 3FAJA 1M6TA 4BJTA 4YL3A 1PD0A 2XM0A 1LPEA 2VB6A 3N24A 1A41A 1VOMA 1NFOA 2CGEA 3SXKA 1H7IA 1BR1A 1PV3A 2XLVA 4C7OB 3HNIA 1NBBA 5AC5A 5BUOA 3RW0A 1Z63A 4U5EE 2I15A 1T6UA 5EGYA 3H2UA 3DM9B 1HW2A 2XRHA 5A69A 4JJFA 3GEHA 5EHHA 4DBRA 4DVYP 2OEXA 3O39A 1OR2A 1EA8A 2FFHA 2GAQA 3C62A 2HS5A 4MVRA 3RH3A 2D5RB 5KYUA 3IHUA 3W2WA 4YT8A 4BJ5A 3TJ5A 2HUJA 2QUPA 1WN0A 3JTLO 4KBLA 4I44A 4EKWA 4JW1A 1FFTC 3Q7GA 2BE5F 4ULWA 2XLOA 4BEMJ 4FAPB 2AWCA 1HMOA 3AQBA 4IRUA 2Q3TA 4BJ1A 4NC3A 2Z15A 1MNDA 3L1MA 4NTFA 5L0DA 4CDYA 3LS1A 2IYLD 3KH2A 4GYTA 4MS2A 4PR9A 5E2QA 3G4XA 3RQEA 5A6BA 3L0IA 1ORJA 4JC7A 4DJ9A 1VLSA 4XTKA 1R4TA 1U6HA 3ASNC 2XLMA 2HMQA 4EBJA 1RMVA 1E2XA 3G4ZA 1D1BA 3V7OA 3J06A 1NLXA 3EHMA 4PK4A 3U8VA 1SR2A 2NPUA 2LSEA 4JEBA 3JRTA 1RJ9A 3DXJF 1WGWA 1Z6AA 3L8IA 2QLAA 4MQ9F 1XZPA 1C03A 4CX9A 1NU9C 3K1IA 2OCCC 4E7ZA 2QE9A 2R7XA 4PJLA 1ZHZA 4ANJA 4OD4A 2P0NA 2NUPB 2WZLA 3EGDB 4NQFA 1NU7D 4BJ5C 4YWQA 4FESA 3SYNA 5DQZA 3JYYA 4MVUA 1A7DA 4W8KA 3DJNB 3IQ5A 2CYDA 4JJGA 1J8YF 3W8HA 1Y6DA 2OG2A 1HE9A 4LERA 1M56C 4FX5A 1DOVA 1Y4CA 3DM5A 1SYQA 2IXOA 3AG1C 5E33A 4O6MA 1EKYA 1VK5A 1ZHTA 2A1DD 3KPHA 3U9MA 2YRFA 2H8AA 3GANA 3HNJA 3TK0A 3E70C 5JVEA 5KYYA 2J9BA 3NKEA 5KYUB 1QKRA 1OQCA 2ZXRA 3UGPA 2EPLX 5COFA 4U5DE 2B0JA 5D92A 1C17M 4QI2A 3GODA 3UGOA 4PJNA 4PACA 1Q0DA
chains in the Genus database with same CATH topology
3ATPA 4H54A 1JMWA 3T9OA 1WASA 2ASRA 1VLSA 1WATA 4Z9HA 4Z9IA 4Z9JA 2LIGA 1LIHA 2D4UA 1VLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ATP A;  4H54 A;  1JMW A;  3T9O A;  1WAS A;  2ASR A;  1VLS A;  1WAT A;  4Z9H A;  4Z9I A;  4Z9J A;  2LIG A;  1LIH A;  2D4U A;  1VLT A; 
#chains in the Genus database with same CATH topology
 4MTG A;  2HSQ A;  2J9W A;  1TQG A;  5T3W A;  1GQA A;  3K1I C;  3T6B A;  4OIP F;  1OKK D;  1WOL A;  3U3F A;  4Q7C A;  4WAB A;  3RF3 A;  2KK1 A;  3KKB A;  1ORS C;  1ZW3 A;  2Q4F A;  2WL8 A;  4IWB A;  5FCL A;  1N1C A;  4I3M A;  1MMA A;  5L3V A;  1CPQ A;  4CIP A;  3AJM A;  4JVS A;  4MTO A;  3EZH A;  3EGX A;  3I5Q A;  1RJ9 B;  4ZLD A;  4K7B A;  4BG0 A;  5IY5 C;  3SP1 A;  4R32 A;  3LEO A;  2DYS C;  4JE9 A;  5B1B C;  1KNY A;  2HV6 A;  4LAC B;  3JSZ A;  2KSF A;  3SZR A;  2HFI A;  1W2W A;  5L3Q A;  2OQM A;  4D4X A;  3N2Z B;  2Q9B A;  1TWG A;  3GM2 A;  1G4W R;  3AQC A;  4OIQ F;  1KTM A;  1I4Z A;  5COG A;  5DLJ A;  1S05 A;  1M2V B;  2CNW D;  2KW3 C;  3NMJ A;  1ZHY A;  3C18 A;  3A9C A;  3EFO A;  4EBK A;  3TJ6 A;  4MND A;  2R7T A;  3S0X A;  4FWV A;  2L9J A;  2G3K A;  2QY9 A;  1APC A;  4A2N B;  2GWW A;  4WGZ A;  3RYL A;  4N6H A;  2HSB A;  1NFN A;  1A0B A;  4H4K C;  2ZD9 A;  2EIJ C;  3NMK A;  1D0Y A;  2D4U A;  2LIG A;  1NZE A;  3NG1 A;  5JT4 A;  2P7V A;  4CBE A;  3ABM C;  5KYY B;  2H7O A;  1ZYR F;  1BZ4 A;  1FAP B;  2VCA A;  3FHD A;  3RQF A;  4E0H A;  2HKV A;  2KGO A;  1HW1 A;  4YN0 B;  3I4U A;  4LDQ A;  1H9T A;  3LUT B;  1FMV A;  3LLK A;  3ASO C;  3LS0 A;  3NDB B;  2PX0 A;  5L0C A;  2P61 A;  3GEE A;  1ZHX A;  3MBG A;  4Q5S F;  4XEF A;  2TMV P;  1A7V A;  4MVM A;  4P9F A;  1HMD A;  4PJM A;  2XLW A;  3Q6M A;  1T9K A;  1LE4 A;  2YLG A;  2FAP B;  2ETS A;  2IXP A;  4WGY A;  5T1D B;  4OIO F;  4G7H F;  4BJ6 A;  3MYF A;  3EGX B;  1VB5 A;  3WHN A;  1OCR C;  5E3A A;  1Z5Z A;  1JMW A;  5L0F A;  4C3D A;  1FR0 A;  1QZX A;  4LLC A;  1LVK A;  2X51 A;  1E84 A;  2WZG A;  4CSA A;  1BR2 A;  5JUA A;  1BBH A;  3S28 A;  2L7A A;  2PX3 A;  3ITF A;  4OD5 A;  1Z7Q c;  4CJG A;  5D91 A;  1TFK B;  3EH1 A;  3CEX A;  1AVO B;  1OW6 A;  2EIK C;  4NCQ A;  2J45 A;  2Y39 A;  1VMA A;  4E0I A;  3B71 A;  5COM A;  3EFO B;  4NY3 A;  3UR3 C;  1E85 A;  1RKC A;  2JD3 A;  1YA7 O;  2BC5 A;  4PJJ A;  3NKD A;  3NYM A;  4F4B A;  3JCU Q;  3B0P A;  4U5H A;  3HNL A;  2DI3 A;  4AK9 A;  5DS5 A;  1QVX A;  3ABK C;  3HKK A;  2ZXP A;  3T6G B;  4WJ0 A;  4C3B A;  1SMY F;  2EPK X;  3RVZ A;  3U9J A;  3QVZ A;  4IAO A;  3LJB A;  4KNV A;  3JRM O;  2ZXW C;  3AG4 C;  4BPM A;  4U5G A;  3GOR A;  1S7Z A;  2IM8 A;  2GA0 A;  3C8Z A;  1WWP A;  4Z9J A;  4IJJ A;  4BJ6 C;  4CS8 A;  4DVZ A;  3VYW A;  4LDK A;  2VH3 A;  4MVO A;  3EPV A;  1C02 A;  2V3C C;  5A6J A;  3LNR A;  1CGN A;  4MVS A;  2F22 A;  1OW7 A;  2Y69 C;  1Z23 A;  3DD7 A;  4CDA A;  3JZ0 A;  4LDR A;  4CSA C;  3EJN A;  4CIH A;  2OKU A;  2YL0 A;  3M4C A;  4AL1 A;  4KI2 A;  1M2O A;  2XSE A;  2HMZ A;  2YQY A;  1QLE C;  2PP4 A;  1M2V A;  2G3V A;  1Q0M A;  3W4Y A;  2AWY A;  2HV7 A;  2DGJ A;  5E3C A;  3DAG A;  3JT1 A;  1ZHW A;  2A6E F;  4YJW A;  2HJM A;  4I1O B;  1CGO A;  2Q7R A;  2Y3B A;  2YKZ A;  4DRI B;  1D1A A;  2J9V A;  2LP4 A;  4GQH A;  2VC9 A;  2OOC A;  5EK0 A;  2OJQ A;  1EI7 A;  3AGT A;  5F5F A;  2J0X A;  2XLE A;  4U9E A;  2PF4 E;  4QI0 A;  1ZVZ A;  3F46 A;  3ZQY A;  3TOL A;  1E83 A;  2YVK A;  1O87 A;  2E87 A;  4IAR A;  3DI5 A;  1RKE A;  5AC4 A;  1G8X A;  2MWQ A;  2XLH A;  4PFO A;  3FOO A;  1LIH A;  2LQG A;  3C8G D;  3HNK A;  3UMI A;  4CS8 C;  3RIP A;  3PDM P;  1VTM P;  2GDC A;  3L8J A;  3R2P A;  2JX0 A;  3KYJ A;  3S27 A;  3UNG C;  4EIY A;  3B29 A;  3AG2 C;  5HSW A;  3HTK C;  4YK5 A;  2NG1 A;  4N06 A;  1OXB A;  3TOM A;  3GM1 A;  4MW8 A;  1G5Z A;  1L3P A;  4RD9 A;  2EIN C;  2A6H F;  5T3T A;  5JRA A;  1IW7 F;  3DMD A;  3V5Y A;  1XWJ A;  2BL2 A;  3WOD F;  2Q9C A;  2IXN A;  2XL4 A;  3Q7L A;  1LM3 B;  3GEI A;  4KNW A;  1MNE A;  1QPU A;  2H7V C;  3K7D A;  2UUH A;  3RKO F;  3LAY A;  3TQO A;  3IEE A;  1OXK A;  2ZXO A;  4CJO A;  2XL6 A;  4O6N A;  1VYK A;  4Z9I A;  1EQ1 A;  3DE9 A;  1BR4 A;  4U5C E;  1T6Q A;  1ST6 A;  3DZA A;  4IAQ A;  2YLI A;  3NMI A;  5F28 E;  1V74 B;  1F1M A;  3BRJ A;  4XQ1 A;  2P1A A;  3FMS A;  3CAX A;  5KYW A;  2V26 A;  1YA9 A;  3C7J A;  5HV9 A;  2C04 A;  1WAS A;  4JUR I;  4M63 A;  2R02 A;  3S9O A;  3QTH A;  1J8M F;  1K04 A;  4J32 B;  2R03 A;  3HJC A;  2A69 F;  4QDL A;  4I1M A;  1PD1 A;  2J7P A;  2Q00 A;  5DS4 A;  4P6I C;  2NUT B;  5L0J A;  3G50 A;  5CI8 A;  1LE2 A;  3M1C B;  3DWW A;  1M57 C;  5JP7 A;  1NG1 A;  4HFF B;  1TWA A;  2LD6 A;  2HZ8 A;  2DYR C;  3OEO A;  4ULV A;  4OIN F;  3US6 A;  1CPR A;  2A68 F;  4G0H A;  3X2Q C;  2LFD A;  5L0I A;  2WZF A;  2W9Y A;  1OCZ C;  3B0U X;  1RKE B;  3R7C A;  4JTA B;  1YAR O;  3NYL A;  4KC9 A;  4XPW A;  4OIR F;  1U89 A;  3Q6N A;  3MLG A;  5JSL A;  3DJU B;  2XXA A;  1Q0G A;  3ZSU A;  2PFD A;  3ZTZ A;  1FMW A;  1V4A A;  2DB4 A;  2HJ3 A;  2R05 A;  5BQI A;  1R5I D;  3SNH A;  2XL8 A;  2YZS A;  1LS4 A;  2YL7 A;  4AE4 B;  3ZC4 A;  1YAU O;  2YL1 A;  3UMH A;  4N6C A;  2RD9 A;  3UMK A;  1Q0K A;  1VLT A;  3U8P A;  1TFO B;  1YYJ A;  3L34 A;  1ZZP A;  3O55 A;  1IZM A;  2M4E A;  2RSE B;  4JCZ A;  1RCP A;  5TJ5 E;  4MVQ A;  3IPM O;  1V55 C;  1JR8 A;  1LI5 A;  2XS1 A;  4NTA A;  1QSP A;  1OCO C;  3N0T A;  1Q0F A;  3OWT A;  3RFY A;  4JRZ A;  4N4W A;  1PCX A;  1YZC A;  4YL0 A;  3VF0 A;  4Q4Z F;  1U0B B;  1MMN A;  1NSG B;  1TWH A;  2IXM A;  4X0R A;  4EHP A;  4O7G A;  1UG7 A;  3LES A;  1OW8 A;  3H2V A;  5KYW B;  1YYX A;  2XM4 A;  1YZA A;  3QW1 A;  3SXY A;  3ZTM A;  4AX2 A;  2Y3G A;  1K05 A;  1TKN A;  1TWC A;  4U5F E;  1LI7 A;  2R7S A;  3PMR A;  2NSF A;  4DRH B;  4JTD B;  4YT5 A;  2C03 A;  2M64 A;  2XS8 A;  2CDQ A;  4EUK B;  2X0C A;  2YLD A;  1BDJ B;  1JAF A;  4XPX A;  2VCC A;  3SXZ A;  3RVY A;  4DRJ B;  5KYN A;  1E86 A;  1LKX A;  3MX3 A;  2J8W A;  5L0H A;  4DBQ A;  2WVO A;  3K66 A;  3ZVR A;  3ABL C;  2KJG A;  2WVQ A;  4HEA J;  2KYH A;  1WAT A;  3SEO A;  1A7E A;  3U2L A;  3ZQV A;  3PCV A;  4NTB A;  4CS9 A;  4XLN F;  4DOZ A;  5JS5 A;  3VAY A;  3O10 A;  2XXA B;  5CI9 A;  4ZLC A;  3ZWI A;  3S90 A;  3CSK A;  2L81 A;  1O3U A;  3BEH A;  2UUI A;  4YT4 A;  4RBN A;  3KL4 A;  2R7R A;  1AUE A;  1LS1 A;  3B9Q A;  4AL0 A;  3HLZ A;  3ZIB A;  4RDA A;  3OA1 A;  3ZDL A;  1ORY A;  2KNH A;  5DS6 A;  2GFH A;  3V5X A;  4LLE A;  3C8G A;  1UFB A;  3QMK A;  4O6Y A;  2I8B A;  1H9G A;  2ASR A;  4ONS A;  4JCH A;  4MVZ A;  1HY5 A;  1TR2 A;  3FDQ A;  3T4R A;  3JSE O;  4P9T A;  4E17 A;  4JEA A;  1D0Z A;  4L6R A;  2J0W A;  2OU6 A;  1OKK A;  1T01 A;  2A0U A;  3EG9 A;  2VCB A;  2NUT A;  1Z3I X;  2R9R B;  4XEV A;  4IB4 A;  5CIV A;  4JIO A;  3EHN A;  5B1A C;  4A4A A;  1O5H A;  2XLD A;  5AGF A;  1L7C A;  3LNM B;  1T6I A;  2R25 A;  3T6J A;  4C3E A;  2EPN A;  1FFH A;  4JTC B;  3VM6 A;  3DAF A;  3W2V A;  3WG7 C;  1V54 C;  2AU5 A;  3E9V A;  4G78 A;  1XZQ A;  4CS9 C;  5KYX A;  5A6B D;  2R7V A;  4GEH A;  4E7S A;  2KQ9 A;  1D1C A;  3EZI A;  1RXQ A;  3AOU A;  2WVN A;  1ZU4 A;  3WAQ A;  4O79 A;  5FZT A;  2IBF A;  2LK4 A;  4EBB A;  5GPG B;  4E18 A;  3T9O A;  2IOQ A;  4XWJ A;  1YJG A;  2PNO A;  4AE4 A;  4JZA A;  3POV A;  4IGG A;  3U2M A;  4UDV A;  256B A;  4PFP A;  2CNW A;  2VAS A;  3RQG A;  1FNT c;  4HFK B;  3FAP B;  3K1H A;  3U0C A;  2R7O A;  3QW0 A;  3K6B A;  1GGQ A;  1ZW2 A;  3I5P A;  1B68 A;  5A6A A;  3F47 A;  2CW0 F;  2NSG A;  2JPU A;  4DXW A;  4H54 A;  3C63 A;  5B3S C;  3LLI A;  5JLI A;  3H65 A;  1VYI A;  4J7Y A;  2R7U A;  1CGM E;  4B6I A;  2L6G A;  5DQT A;  4ER9 A;  1SZI A;  2YEV A;  3EQL F;  5L0G A;  2EIL C;  2J9U A;  1JOG A;  3ECS A;  1D0X A;  1HE1 A;  3LEV A;  4U9D A;  3A11 A;  4BEJ A;  4D4N A;  1WTY A;  2KC3 A;  1QQ3 A;  2WB7 A;  3C8G B;  2QTV A;  4MW3 A;  4YT2 A;  1FTS A;  3U5S A;  1JPJ A;  3TD7 A;  2OEV A;  2ZPA A;  1GS9 A;  2W4M A;  2MYS A;  1T5O A;  3B0V C;  2H7B A;  3O6X A;  4C7O A;  3IQT A;  1I5N A;  1MMD A;  1SF8 A;  3EG9 B;  3KYI A;  3U3B A;  5BQG A;  1GM5 A;  3EH2 A;  1MQV A;  1YDI A;  3M4B A;  2EPO A;  2R7W A;  3TUL A;  3VRC A;  1G4U S;  2LCH A;  4MTF A;  4XLP F;  2G62 A;  3GWN A;  2EPM X;  1H6G A;  5KYX B;  2FGY A;  3QVY A;  3NRH A;  3CZ6 A;  3X1O A;  2R7Q A;  3FVY A;  1AEP A;  5BQH A;  2CCY A;  5A6K A;  2AP3 A;  3IQC A;  4W8P A;  3W8I A;  2Q9A A;  2W4B A;  3MYI A;  2OJE D;  4J30 B;  4Z9H A;  2B0H A;  3DKA A;  4HE8 D;  1DOW A;  1I4Y A;  4XEK A;  4CS7 A;  4G7O F;  5K0I A;  5DVW A;  1K40 A;  3FOP A;  2L6H A;  4JKV A;  1JPN A;  3NYJ A;  3ATP A;  3M79 A;  4U5B E;  2W45 A;  3KMI A;  2MHR A;  4YL1 A;  4G7Z F;  1YVI A;  2PBE A;  3CQZ A;  2QNL A;  3S29 A;  3K33 A;  2P6V A;  2AVK A;  3V5Z A;  2ICW G;  3SXM A;  2O9X A;  3FXH A;  5F5H A;  3DE8 A;  3M15 A;  2YHS A;  2Y3D A;  3GM3 A;  3GWL A;  2Y3H A;  1OCC C;  2YWA A;  5B3I A;  2L6F A;  2A0B A;  3JYH A;  4K0D A;  1MMG A;  4XPY A;  4K1O A;  3ZG1 A;  3PHF 2;  1OR3 A;  4J7T A;  3AGU A;  3IQ6 A;  1ZU5 A;  1YLM A;  2J7P D;  3QZC A;  1KU2 A;  3AG3 C;  2EIM C;  3MFN A;  3S84 A;  2LFF A;  2YL3 A;  4EWC A;  1JRA A;  2J46 A;  4CDV A;  2NUP A;  3EGD A;  3FAJ A;  1M6T A;  4BJT A;  4YL3 A;  1PD0 A;  2XM0 A;  1LPE A;  2VB6 A;  3N24 A;  1A41 A;  1VOM A;  1NFO A;  2CGE A;  3SXK A;  1H7I A;  1BR1 A;  1PV3 A;  2XLV A;  4C7O B;  3HNI A;  1NBB A;  5AC5 A;  5BUO A;  3RW0 A;  1Z63 A;  4U5E E;  2I15 A;  1T6U A;  5EGY A;  3H2U A;  3DM9 B;  1HW2 A;  2XRH A;  5A69 A;  4JJF A;  3GEH A;  5EHH A;  4DBR A;  4DVY P;  2OEX A;  3O39 A;  1OR2 A;  1EA8 A;  2FFH A;  2GAQ A;  3C62 A;  2HS5 A;  4MVR A;  3RH3 A;  2D5R B;  5KYU A;  3IHU A;  3W2W A;  4YT8 A;  4BJ5 A;  3TJ5 A;  2HUJ A;  2QUP A;  1WN0 A;  3JTL O;  4KBL A;  4I44 A;  4EKW A;  4JW1 A;  1FFT C;  3Q7G A;  2BE5 F;  4ULW A;  2XLO A;  4BEM J;  4FAP B;  2AWC A;  1HMO A;  3AQB A;  4IRU A;  2Q3T A;  4BJ1 A;  4NC3 A;  2Z15 A;  1MND A;  3L1M A;  4NTF A;  5L0D A;  4CDY A;  3LS1 A;  2IYL D;  3KH2 A;  4GYT A;  4MS2 A;  4PR9 A;  5E2Q A;  3G4X A;  3RQE A;  5A6B A;  3L0I A;  1ORJ A;  4JC7 A;  4DJ9 A;  1VLS A;  4XTK A;  1R4T A;  1U6H A;  3ASN C;  2XLM A;  2HMQ A;  4EBJ A;  1RMV A;  1E2X A;  3G4Z A;  1D1B A;  3V7O A;  3J06 A;  1NLX A;  3EHM A;  4PK4 A;  3U8V A;  1SR2 A;  2NPU A;  2LSE A;  4JEB A;  3JRT A;  1RJ9 A;  3DXJ F;  1WGW A;  1Z6A A;  3L8I A;  2QLA A;  4MQ9 F;  1XZP A;  1C03 A;  4CX9 A;  1NU9 C;  3K1I A;  2OCC C;  4E7Z A;  2QE9 A;  2R7X A;  4PJL A;  1ZHZ A;  4ANJ A;  4OD4 A;  2P0N A;  2NUP B;  2WZL A;  3EGD B;  4NQF A;  1NU7 D;  4BJ5 C;  4YWQ A;  4FES A;  3SYN A;  5DQZ A;  3JYY A;  4MVU A;  1A7D A;  4W8K A;  3DJN B;  3IQ5 A;  2CYD A;  4JJG A;  1J8Y F;  3W8H A;  1Y6D A;  2OG2 A;  1HE9 A;  4LER A;  1M56 C;  4FX5 A;  1DOV A;  1Y4C A;  3DM5 A;  1SYQ A;  2IXO A;  3AG1 C;  5E33 A;  4O6M A;  1EKY A;  1VK5 A;  1ZHT A;  2A1D D;  3KPH A;  3U9M A;  2YRF A;  2H8A A;  3GAN A;  3HNJ A;  3TK0 A;  3E70 C;  5JVE A;  5KYY A;  2J9B A;  3NKE A;  5KYU B;  1QKR A;  1OQC A;  2ZXR A;  3UGP A;  2EPL X;  5COF A;  4U5D E;  2B0J A;  5D92 A;  1C17 M;  4QI2 A;  3GOD A;  3UGO A;  4PJN A;  4PAC A;  1Q0D A; 
#chains in the Genus database with same CATH homology
 3ATP A;  4H54 A;  1JMW A;  3T9O A;  1WAS A;  2ASR A;  1VLS A;  1WAT A;  4Z9H A;  4Z9I A;  4Z9J A;  2LIG A;  1LIH A;  2D4U A;  1VLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...