3ZQVA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans at 0.84 a resolution: non-restrained refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAVQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Electron transport
source organism Achromobacter xylosoxidans
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3zqvA00
4NC3A 5JS5A 3ZQVA 2YL0A 4N4WA 3HNIA 4CJGA 3NMIA 3FOPA 2J9BA 2XLHA 3HNLA 1YZCA 2XLOA 3U8PA 1YZAA 4WGZA 4L6RA 2QLAA 4CX9A 5JRAA 4JEBA 5JLIA 3IQ6A 4D4XA 1E84A 1E86A 1YYXA 2YLDA 1RCPA 3C63A 3QVZA 4IARA 2YL7A 3L1MA 2XLDA 2YL1A 3ZQYA 3ZTMA 4JKVA 1EKYA 1JAFA 4EIYA 4U9EA 3NMKA 1NBBA 3HNJA 3M15A 2XLMA 5JT4A 1APCA 1M6TA 2YLIA 4CJOA 5JSLA 2XM4A 2XM0A 1YYJA 3VRCA 4CIPA 4WGYA 3QW1A 4JE9A 2YL3A 1GQAA 2XLWA 3IQ5A 4CDVA 1QQ3A 5AGFA 3TOLA 3HNKA 3M79A 3ZWIA 3QW0A 5JP7A 3NMJA 4U9DA 2CCYA 4CDAA 2XL6A 3ZTZA 1CPRA 2BC5A 5JVEA 256BA 1CPQA 4N6HA 1CGOA 1A7VA 1QPUA 3DE9A 4IAQA 1BBHA 2YLGA 4JEAA 4ER9A 2XLEA 3TOMA 2XLVA 1MQVA 3QVYA 5B3IA 3C62A 5JUAA 4IB4A 1CGNA 1S05A 2YKZA 4D4NA 1LM3B 1E83A 1E85A 3M4CA 3FOOA 2XL8A 3M4BA 4ULVA 3DE8A 4CDYA 2J8WA
chains in the Genus database with same CATH superfamily
4NC3A 1J8YF 2EPOA 2P1AA 3MLGA 4DJ9A 2WZFA 3ABKC 2UUIA 1U6HA 3DI5A 5JS5A 5HSWA 1OW7A 4JVSA 5K0IA 1ORSC 1M2VB 5GPGB 5KYXA 4BG0A 1QLEC 4AK9A 4N4WA 4Q4ZF 3G50A 3HNIA 4HE8D 4YL3A 1RMVA 1TWGA 2J7PD 2ZXWC 1SZIA 1ZHWA 3NMIA 4CS9C 3SZRA 1TKNA 4U5HA 3O39A 3U9MA 3IHUA 3UGOA 3LEVA 3S29A 2XLOA 3X1OA 3U8PA 1OCOC 1YZAA 2OKUA 3RFYA 2RD9A 4MTOA 1VTMP 1NLXA 1TWCA 4AX2A 1U0BB 2QLAA 4H4KC 3C8ZA 2CW0F 4LLCA 4E7SA 2Y69C 4JEBA 1RKEB 4PJNA 5JLIA 3IQ6A 3JT1A 2OEVA 1YYXA 5A6BA 3RF3A 4C7OB 3DAGA 3V7OA 1L7CA 2ZXOA 1GGQA 3FXHA 3K33A 3I5PA 3KL4A 3L1MA 2XLDA 2KQ9A 1H9TA 4MVSA 1LS4A 4RDAA 3ZQYA 4Z9HA 4PFOA 2J7PA 3KMIA 5DLJA 4U9EA 2ZD9A 3RQFA 1LE4A 4JW1A 1NBBA 4GQHA 3ZG1A 4XLPF 3ATPA 2A1DD 2OCCC 3HNJA 5L0JA 4DVYP 4PJLA 3QTHA 3ZVRA 1IW7F 4KNWA 1G4US 3A9CA 4JZAA 3LS1A 1EA8A 5E3CA 3RH3A 4CS8C 4YT4A 4CIPA 1AUEA 2PNOA 2P6VA 3QW1A 1VLTA 4AE4B 1TR2A 1RJ9B 4JTDB 3GM2A 3W2WA 3JYHA 1BZ4A 2C03A 3C8GB 3LESA 5DQTA 3VYWA 2CGEA 5A6BD 2EPMX 4DVZA 4ZLDA 5KYYA 4CBEA 4W8KA 1MMGA 4U5EE 4O6NA 3HNKA 3GEIA 2EPLX 3EJNA 2EIJC 4KBLA 2XS1A 4BPMA 1E2XA 1NFOA 3AGUA 3GODA 2W4MA 4G78A 3WAQA 4A4AA 1CGME 1YAUO 2A6EF 4BEJA 4U5CE 1MMDA 1WATA 2CCYA 1WGWA 1NSGB 5D91A 4CDAA 3ITFA 1A7DA 3ZTMA 4AL0A 2VCBA 1M56C 1OKKA 2LCHA 4K7BA 1KU2A 4I1MA 5CI8A 1M2VA 1O3UA 5KYXB 3K6BA 5JVEA 1Z3IX 2LIGA 3RVYA 4OINF 1KTMA 4O7GA 2F22A 2CDQA 3CZ6A 3DWWA 3K7DA 4J30B 3N2ZB 3NKEA 4E18A 2LQGA 4EBBA 3O6XA 2Y3HA 4XEVA 1OR2A 3V5YA 1VYKA 1KNYA 1OCCC 4P9TA 1SYQA 2L6GA 2MYSA 1TWAA 1BBHA 1GS9A 2YLGA 4JEAA 4JJGA 4PK4A 1O87A 2UUHA 3LNMB 3UNGC 1D0ZA 3PHF2 1V74B 2R25A 3V5XA 2VCAA 3NYJA 2YVKA 3QVYA 3B0VC 1Z23A 1CGNA 3Q7LA 3W8IA 5DVWA 5EGYA 2W9YA 3AQCA 3C18A 2KJGA 4PACA 3AG3C 2FGYA 4FX5A 2PP4A 4A2NB 3SXKA 2W45A 3RVZA 3ABMC 1J8MF 2QE9A 1Q0MA 2L9JA 2WVQA 2VC9A 4QI0A 3FMSA 5FZTA 4G7ZF 2P7VA 4CDYA 3Q6NA 4E7ZA 3H65A 2HS5A 5CIVA 3T6BA 5L0CA 3EHNA 4KNVA 2BE5F 1WN0A 3EGXB 1T9KA 3POVA 4MVMA 4G7OF 3Q7GA 4JC7A 4CS9A 1UG7A 1U89A 2Q9CA 3U2MA 3W8HA 4BJ6C 2PBEA 1Q0FA 5B1AC 2B0JA 5COGA 5A6AA 3VF0A 3BEHA 5FCLA 2FAPB 4PFPA 3S9OA 4IAOA 1V54C 1T6IA 4H54A 5HV9A 4K1OA 1NU7D 3VM6A 1XZQA 1LVKA 2A0UA 1ORYA 2D4UA 1YZCA 2R7QA 1TFKB 3HLZA 3MX3A 3W2VA 2Y3BA 3CEXA 1M57C 2R02A 4L6RA 2Q00A 3EG9B 5BQIA 1D0YA 5A6KA 2VB6A 5L3QA 3UGPA 1C03A 4YT5A 5L0FA 1PCXA 1Z6AA 1WTYA 3L34A 2HZ8A 2YRFA 3FAJA 1QKRA 2KW3C 1Q0DA 4JCZA 3AQBA 3F46A 1A7EA 2YLDA 1RCPA 2GFHA 4EKWA 1RXQA 4U5GA 2Q9BA 5EHHA 4F4BA 3R2PA 3LLIA 5L0HA 2CNWD 2R7OA 2AWCA 2DYRC 2EPNA 1Z7Qc 2YL1A 3FAPB 1VB5A 4XTKA 4U5FE 1Y6DA 3NYMA 4JIOA 5TJ5E 4JKVA 3U5SA 1HW1A 1NZEA 1SF8A 4OD4A 1JAFA 3N24A 3GORA 2J9WA 4I44A 2G3VA 3PMRA 3X2QC 4B6IA 4DRIB 4EIYA 1ST6A 3DM9B 5KYWA 1HMDA 4IRUA 5COMA 2H7BA 4NQFA 3VAYA 3SXYA 2J9UA 1I4ZA 2G62A 3LNRA 5B3IA 3S28A 2Y39A 2YLIA 4FAPB 4CJOA 2IXPA 3LLKA 5JSLA 1JRAA 4LACB 3TD7A 3QMKA 4YWQA 5T3TA 1MMNA 4YL1A 3ZSUA 1V55C 2Y3DA 2WVOA 1O5HA 3CAXA 3GANA 4DRJB 4E0IA 1YLMA 1ZZPA 2DB4A 2OG2A 1D1BA 2LSEA 2R7XA 2H7VC 1L3PA 1Q0KA 2XLWA 5BQGA 2NUTA 1QQ3A 3GM1A 4Q7CA 4CDVA 5BQHA 3TOLA 4E17A 1NFNA 1TWHA 2L81A 4R32A 1ZHTA 1K04A 1AEPA 4E0HA 3EGDA 4CSAC 4Q5SF 3MBGA 2CYDA 3E70C 3UR3C 1T6UA 1CPRA 1PD1A 5KYYB 3N0TA 5D92A 2X0CA 1Q0GA 2BC5A 2HMZA 1LIHA 5B1BC 4QI2A 4O6YA 3DJUB 4C3EA 3EH1A 3OWTA 5KYNA 2LK4A 3F47A 4U5BE 3EZIA 3E9VA 4EHPA 3K1IC 1CPQA 1R5ID 3OA1A 3HJCA 4N6HA 4RBNA 2L6FA 4JURI 2WZLA 3FDQA 3DD7A 5L0GA 3AG2C 1QPUA 2JPUA 1XZPA 2L6HA 2PF4E 2Q4FA 4GYTA 4IAQA 4CS8A 4EUKB 2MWQA 2HMQA 4XPWA 2XSEA 2XLEA 3TOMA 2XLVA 4BJ5C 2NUPA 1OCRC 3EG9A 2Q7RA 4ULWA 2JX0A 2GDCA 4K0DA 4X0RA 3S90A 1PD0A 4LERA 2RSEB 2QUPA 3GWNA 4M63A 2B0HA 3SYNA 3FOOA 2XL8A 2YZSA 3WG7C 2GAQA 2ASRA 2L7AA 3ASOC 1A7VA 4RD9A 5COFA 2AP3A 5B3SC 4XWJA 3AOUA 4JCHA 2R9RB 5T1DB 3KYJA 4ZLCA 1JMWA 2KC3A 3O10A 3WODF 1R4TA 2YL0A 1YVIA 2LFFA 2WB7A 3LJBA 3C8GD 3U8VA 4JRZA 1JPNA 3B71A 3ZC4A 2KYHA 3PDMP 1T5OA 1VLSA 4LDRA 3TQOA 3AG4C 2J9BA 3LS0A 3B29A 1A0BA 3HNLA 4DOZA 1I4YA 1FMVA 3H2VA 3H2UA 3RW0A 4N06A 3JTLO 2VASA 2HJMA 3HTKC 2R7SA 4NTBA 4WGZA 1QVXA 3KYIA 3NYLA 1XWJA 4IGGA 5F5FA 2NG1A 2J46A 4CX9A 5JRAA 1RKEA 3R7CA 4C3BA 1LPEA 2ZXPA 2H7OA 2Q3TA 2O9XA 1FTSA 4D4XA 4C7OA 2OJED 2HJ3A 3KPHA 5AC5A 5IY5C 3JSEO 2R05A 1E86A 5KYUB 2XRHA 3QVZA 2LFDA 3HKKA 3DZAA 4WABA 3WHNA 4YT8A 3U3FA 4MVOA 1HY5A 1VMAA 3ASNC 1GM5A 1EKYA 1N1CA 1W2WA 3JZ0A 4G0HA 4FWVA 3I5QA 3EGXA 1TQGA 3NMKA 5F28E 2YWAA 1YA9A 3RQEA 2OEXA 2X51A 5L0IA 4OIPF 3NDBB 1LE2A 3M15A 5AC4A 3KH2A 3I4UA 4YN0B 5T3WA 1ZHZA 1C02A 2EIKC 1E84A 2R7TA 1ZU4A 5DS5A 1F1MA 1G5ZA 2YEVA 2OU6A 2XM4A 1ORJA 3DM5A 3UMHA 4UDVA 1H6GA 1YYJA 2XM0A 3AG1C 4PJJA 1D0XA 3RIPA 2ZXRA 3VRCA 5DS6A 3G4ZA 2WZGA 1D1AA 1ZVZA 1A41A 4JE9A 1YJGA 1MNEA 3FVYA 2YL3A 4BJ1A 1EI7A 2HSBA 3DMDA 2W4BA 1GQAA 2EPKX 4KC9A 1LKXA 2J45A 1H7IA 3KKBA 3EHMA 3S84A 3ZWIA 1HW2A 1FR0A 3ECSA 4MVZA 2AU5A 3B0UX 1WOLA 5JP7A 1IZMA 4QDLA 1JPJA 2KNHA 4U9DA 1K40A 3JYYA 2A68F 4YJWA 1BDJB 3SNHA 1SR2A 2VCCA 3V5ZA 5L3VA 3ZTZA 2OOCA 1FAPB 2NUTB 3T9OA 4AL1A 4XLNF 2ICWG 1PV3A 2PX3A 3EGDB 2AVKA 4YK5A 3Q6MA 1BR1A 1CGOA 5E3AA 4C3DA 4DXWA 2OJQA 3JSZA 1ZHXA 1WWPA 2CNWA 3SEOA 1B68A 2NPUA 3K1HA 3U9JA 1EQ1A 1LI7A 3GEEA 2HUJA 3ZDLA 2GA0A 2J9VA 2WL8A 3RQGA 2HV7A 1D1CA 1G4WR 2R7RA 3L8JA 3LEOA 2D5RB 1T01A 1UFBA 2ZPAA 3LUTB 2E87A 4I1OB 3EPVA 3C62A 3MFNA 5E2QA 4IB4A 3B9QA 2YKZA 3JRTA 3RYLA 3ZIBA 5JUAA 4P6IC 1Z63A 3J06A 2A69F 3C7JA 1ZHYA 1MNDA 4MTGA 1VOMA 1HMOA 4J7YA 2NSFA 1E83A 1BR4A 3T6GB 1Y4CA 4J32B 2R03A 4NCQA 1H9GA 4XEKA 3SXMA 1FNTc 4MW8A 5KYUA 2M64A 2Q9AA 4IWBA 5E33A 2HV6A 1FFTC 3BRJA 4ULVA 4CSAA 2IXNA 2HFIA 3JCUQ 3DE8A 1ZW3A 1QZXA 3TJ6A 5L0DA 1ZW2A 2DGJA 5CI9A 2H8AA 3EH2A 1M2OA 1OKKD 2Z15A 3T6JA 4BJ5A 2GWWA 3G4XA 4N6CA 4DBRA 2YQYA 5DS4A 3RKOF 3QZCA 3ZQVA 3U2LA 2TMVP 3AGTA 3U0CA 2P61A 4J7TA 1SMYF 4G7HF 4CJGA 1WASA 4NY3A 1BR2A 3FOPA 2EIMC 2XLHA 3CSKA 3MYFA 2NUPB 2IBFA 4Z9IA 3S27A 2OQMA 4ANJA 3B0PA 2XXAA 2Y3GA 4XQ1A 3S0XA 4EBJA 4W8PA 1G8XA 2EINC 1V4AA 2V26A 3EFOB 2HKVA 3OEOA 5DQZA 4OIQF 2PFDA 1MMAA 1NU9C 3SP1A 5A6JA 1YARO 3U3BA 4MS2A 3W4YA 2MHRA 2QTVA 2XL4A 3C63A 2IM8A 3PCVA 1T6QA 4IARA 1NG1A 2YL7A 4XPXA 1OR3A 5BUOA 4EBKA 4EWCA 2IYLD 2KSFA 1C17M 2LD6A 2M4EA 2VH3A 4MTFA 4OIRF 3DKAA 4NTAA 2IXOA 2A6HF 3DXJF 4HEAJ 4I3MA 4OIOF 3A11A 5F5HA 2XLMA 1I5NA 4XPYA 4CIHA 4MQ9F 4MW3A 4Z9JA 2J0XA 1S7ZA 3AJMA 1APCA 3K1IA 1M6TA 3DAFA 4MNDA 5JT4A 3TULA 4LDKA 1OW8A 2DYSC 4LDQA 3LAYA 4MVQA 4DBQA 2AWYA 4DRHB 4WJ0A 4BJ6A 3EQLF 3TK0A 4WGYA 2WVNA 1JOGA 2KGOA 3GM3A 5KYWB 3NRHA 4U5DE 3SXZA 3GEHA 2PX0A 2IOQA 3IEEA 1RJ9A 4XEFA 2QNLA 1ZU5A 3O55A 4JTAB 3IQ5A 2P0NA 3FHDA 3M1CB 4NTFA 3T4RA 5AGFA 2G3KA 4FESA 2XS8A 3MYIA 4O6MA 3M79A 4GEHA 4IJJA 3ABLC 3QW0A 4MVUA 3NMJA 3K66A 4HFFB 2V3CC 1YA7O 2KK1A 2R7VA 2XL6A 4HFKB 4OD5A 4YT2A 4CS7A 3IQCA 1TFOB 5A69A 1HE9A 2HSQA 1AVOB 2QY9A 4PR9A 1LI5A 3UMKA 3NKDA 1ZYRF 4LLEA 3TJ5A 5EK0A 3US6A 1RKCA 2BL2A 1OW6A 1VK5A 256BA 4P9FA 2LP4A 2I8BA 1FFHA 4O79A 3JRMO 2JD3A 3DE9A 2FFHA 2R7WA 2XXAB 3IQTA 3IPMO 2R7UA 1OCZC 3GWLA 2C04A 3NG1A 4BJTA 4ER9A 3DJNB 1DOWA 1MQVA 1OQCA 3EFOA 4JTCB 2DI3A 4BEMJ 1K05A 2J0WA 2ETSA 2IXMA 1S05A 3L8IA 4AE4A 3EZHA 4D4NA 1LM3B 4YL0A 1QSPA 2A0BA 3C8GA 1Z5ZA 1E85A 1FMWA 3L0IA 1OXBA 1LS1A 2EILC 3M4CA 3CQZA 2NSGA 4PJMA 2I15A 4KI2A 1YDIA 2YHSA 3UMIA 3M4BA 4ONSA 4MVRA 1HE1A 1DOVA 1JR8A 1OXKA 2J8WA 1VYIA 4JJFA
chains in the Genus database with same CATH topology
4NC3A 5JS5A 3ZQVA 2YL0A 4N4WA 3HNIA 4CJGA 3NMIA 3FOPA 2J9BA 2XLHA 3HNLA 1YZCA 2XLOA 3U8PA 1YZAA 4WGZA 4L6RA 2QLAA 4CX9A 5JRAA 4JEBA 5JLIA 3IQ6A 4D4XA 1E84A 1E86A 1YYXA 2YLDA 1RCPA 3C63A 3QVZA 4IARA 2YL7A 3L1MA 2XLDA 2YL1A 3ZQYA 3ZTMA 4JKVA 1EKYA 1JAFA 4EIYA 4U9EA 3NMKA 1NBBA 3HNJA 3M15A 2XLMA 5JT4A 1APCA 1M6TA 2YLIA 4CJOA 5JSLA 2XM4A 2XM0A 1YYJA 3VRCA 4CIPA 4WGYA 3QW1A 4JE9A 2YL3A 1GQAA 2XLWA 3IQ5A 4CDVA 1QQ3A 5AGFA 3TOLA 3HNKA 3M79A 3ZWIA 3QW0A 5JP7A 3NMJA 4U9DA 2CCYA 4CDAA 2XL6A 3ZTZA 1CPRA 2BC5A 5JVEA 256BA 1CPQA 4N6HA 1CGOA 1A7VA 1QPUA 3DE9A 4IAQA 1BBHA 2YLGA 4JEAA 4ER9A 2XLEA 3TOMA 2XLVA 1MQVA 3QVYA 5B3IA 3C62A 5JUAA 4IB4A 1CGNA 1S05A 2YKZA 4D4NA 1LM3B 1E83A 1E85A 3M4CA 3FOOA 2XL8A 3M4BA 4ULVA 3DE8A 4CDYA 2J8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC3 A;  5JS5 A;  3ZQV A;  2YL0 A;  4N4W A;  3HNI A;  4CJG A;  3NMI A;  3FOP A;  2J9B A;  2XLH A;  3HNL A;  1YZC A;  2XLO A;  3U8P A;  1YZA A;  4WGZ A;  4L6R A;  2QLA A;  4CX9 A;  5JRA A;  4JEB A;  5JLI A;  3IQ6 A;  4D4X A;  1E84 A;  1E86 A;  1YYX A;  2YLD A;  1RCP A;  3C63 A;  3QVZ A;  4IAR A;  2YL7 A;  3L1M A;  2XLD A;  2YL1 A;  3ZQY A;  3ZTM A;  4JKV A;  1EKY A;  1JAF A;  4EIY A;  4U9E A;  3NMK A;  1NBB A;  3HNJ A;  3M15 A;  2XLM A;  5JT4 A;  1APC A;  1M6T A;  2YLI A;  4CJO A;  5JSL A;  2XM4 A;  2XM0 A;  1YYJ A;  3VRC A;  4CIP A;  4WGY A;  3QW1 A;  4JE9 A;  2YL3 A;  1GQA A;  2XLW A;  3IQ5 A;  4CDV A;  1QQ3 A;  5AGF A;  3TOL A;  3HNK A;  3M79 A;  3ZWI A;  3QW0 A;  5JP7 A;  3NMJ A;  4U9D A;  2CCY A;  4CDA A;  2XL6 A;  3ZTZ A;  1CPR A;  2BC5 A;  5JVE A;  256B A;  1CPQ A;  4N6H A;  1CGO A;  1A7V A;  1QPU A;  3DE9 A;  4IAQ A;  1BBH A;  2YLG A;  4JEA A;  4ER9 A;  2XLE A;  3TOM A;  2XLV A;  1MQV A;  3QVY A;  5B3I A;  3C62 A;  5JUA A;  4IB4 A;  1CGN A;  1S05 A;  2YKZ A;  4D4N A;  1LM3 B;  1E83 A;  1E85 A;  3M4C A;  3FOO A;  2XL8 A;  3M4B A;  4ULV A;  3DE8 A;  4CDY A;  2J8W A; 
#chains in the Genus database with same CATH topology
 4NC3 A;  1J8Y F;  2EPO A;  2P1A A;  3MLG A;  4DJ9 A;  2WZF A;  3ABK C;  2UUI A;  1U6H A;  3DI5 A;  5JS5 A;  5HSW A;  1OW7 A;  4JVS A;  5K0I A;  1ORS C;  1M2V B;  5GPG B;  5KYX A;  4BG0 A;  1QLE C;  4AK9 A;  4N4W A;  4Q4Z F;  3G50 A;  3HNI A;  4HE8 D;  4YL3 A;  1RMV A;  1TWG A;  2J7P D;  2ZXW C;  1SZI A;  1ZHW A;  3NMI A;  4CS9 C;  3SZR A;  1TKN A;  4U5H A;  3O39 A;  3U9M A;  3IHU A;  3UGO A;  3LEV A;  3S29 A;  2XLO A;  3X1O A;  3U8P A;  1OCO C;  1YZA A;  2OKU A;  3RFY A;  2RD9 A;  4MTO A;  1VTM P;  1NLX A;  1TWC A;  4AX2 A;  1U0B B;  2QLA A;  4H4K C;  3C8Z A;  2CW0 F;  4LLC A;  4E7S A;  2Y69 C;  4JEB A;  1RKE B;  4PJN A;  5JLI A;  3IQ6 A;  3JT1 A;  2OEV A;  1YYX A;  5A6B A;  3RF3 A;  4C7O B;  3DAG A;  3V7O A;  1L7C A;  2ZXO A;  1GGQ A;  3FXH A;  3K33 A;  3I5P A;  3KL4 A;  3L1M A;  2XLD A;  2KQ9 A;  1H9T A;  4MVS A;  1LS4 A;  4RDA A;  3ZQY A;  4Z9H A;  4PFO A;  2J7P A;  3KMI A;  5DLJ A;  4U9E A;  2ZD9 A;  3RQF A;  1LE4 A;  4JW1 A;  1NBB A;  4GQH A;  3ZG1 A;  4XLP F;  3ATP A;  2A1D D;  2OCC C;  3HNJ A;  5L0J A;  4DVY P;  4PJL A;  3QTH A;  3ZVR A;  1IW7 F;  4KNW A;  1G4U S;  3A9C A;  4JZA A;  3LS1 A;  1EA8 A;  5E3C A;  3RH3 A;  4CS8 C;  4YT4 A;  4CIP A;  1AUE A;  2PNO A;  2P6V A;  3QW1 A;  1VLT A;  4AE4 B;  1TR2 A;  1RJ9 B;  4JTD B;  3GM2 A;  3W2W A;  3JYH A;  1BZ4 A;  2C03 A;  3C8G B;  3LES A;  5DQT A;  3VYW A;  2CGE A;  5A6B D;  2EPM X;  4DVZ A;  4ZLD A;  5KYY A;  4CBE A;  4W8K A;  1MMG A;  4U5E E;  4O6N A;  3HNK A;  3GEI A;  2EPL X;  3EJN A;  2EIJ C;  4KBL A;  2XS1 A;  4BPM A;  1E2X A;  1NFO A;  3AGU A;  3GOD A;  2W4M A;  4G78 A;  3WAQ A;  4A4A A;  1CGM E;  1YAU O;  2A6E F;  4BEJ A;  4U5C E;  1MMD A;  1WAT A;  2CCY A;  1WGW A;  1NSG B;  5D91 A;  4CDA A;  3ITF A;  1A7D A;  3ZTM A;  4AL0 A;  2VCB A;  1M56 C;  1OKK A;  2LCH A;  4K7B A;  1KU2 A;  4I1M A;  5CI8 A;  1M2V A;  1O3U A;  5KYX B;  3K6B A;  5JVE A;  1Z3I X;  2LIG A;  3RVY A;  4OIN F;  1KTM A;  4O7G A;  2F22 A;  2CDQ A;  3CZ6 A;  3DWW A;  3K7D A;  4J30 B;  3N2Z B;  3NKE A;  4E18 A;  2LQG A;  4EBB A;  3O6X A;  2Y3H A;  4XEV A;  1OR2 A;  3V5Y A;  1VYK A;  1KNY A;  1OCC C;  4P9T A;  1SYQ A;  2L6G A;  2MYS A;  1TWA A;  1BBH A;  1GS9 A;  2YLG A;  4JEA A;  4JJG A;  4PK4 A;  1O87 A;  2UUH A;  3LNM B;  3UNG C;  1D0Z A;  3PHF 2;  1V74 B;  2R25 A;  3V5X A;  2VCA A;  3NYJ A;  2YVK A;  3QVY A;  3B0V C;  1Z23 A;  1CGN A;  3Q7L A;  3W8I A;  5DVW A;  5EGY A;  2W9Y A;  3AQC A;  3C18 A;  2KJG A;  4PAC A;  3AG3 C;  2FGY A;  4FX5 A;  2PP4 A;  4A2N B;  3SXK A;  2W45 A;  3RVZ A;  3ABM C;  1J8M F;  2QE9 A;  1Q0M A;  2L9J A;  2WVQ A;  2VC9 A;  4QI0 A;  3FMS A;  5FZT A;  4G7Z F;  2P7V A;  4CDY A;  3Q6N A;  4E7Z A;  3H65 A;  2HS5 A;  5CIV A;  3T6B A;  5L0C A;  3EHN A;  4KNV A;  2BE5 F;  1WN0 A;  3EGX B;  1T9K A;  3POV A;  4MVM A;  4G7O F;  3Q7G A;  4JC7 A;  4CS9 A;  1UG7 A;  1U89 A;  2Q9C A;  3U2M A;  3W8H A;  4BJ6 C;  2PBE A;  1Q0F A;  5B1A C;  2B0J A;  5COG A;  5A6A A;  3VF0 A;  3BEH A;  5FCL A;  2FAP B;  4PFP A;  3S9O A;  4IAO A;  1V54 C;  1T6I A;  4H54 A;  5HV9 A;  4K1O A;  1NU7 D;  3VM6 A;  1XZQ A;  1LVK A;  2A0U A;  1ORY A;  2D4U A;  1YZC A;  2R7Q A;  1TFK B;  3HLZ A;  3MX3 A;  3W2V A;  2Y3B A;  3CEX A;  1M57 C;  2R02 A;  4L6R A;  2Q00 A;  3EG9 B;  5BQI A;  1D0Y A;  5A6K A;  2VB6 A;  5L3Q A;  3UGP A;  1C03 A;  4YT5 A;  5L0F A;  1PCX A;  1Z6A A;  1WTY A;  3L34 A;  2HZ8 A;  2YRF A;  3FAJ A;  1QKR A;  2KW3 C;  1Q0D A;  4JCZ A;  3AQB A;  3F46 A;  1A7E A;  2YLD A;  1RCP A;  2GFH A;  4EKW A;  1RXQ A;  4U5G A;  2Q9B A;  5EHH A;  4F4B A;  3R2P A;  3LLI A;  5L0H A;  2CNW D;  2R7O A;  2AWC A;  2DYR C;  2EPN A;  1Z7Q c;  2YL1 A;  3FAP B;  1VB5 A;  4XTK A;  4U5F E;  1Y6D A;  3NYM A;  4JIO A;  5TJ5 E;  4JKV A;  3U5S A;  1HW1 A;  1NZE A;  1SF8 A;  4OD4 A;  1JAF A;  3N24 A;  3GOR A;  2J9W A;  4I44 A;  2G3V A;  3PMR A;  3X2Q C;  4B6I A;  4DRI B;  4EIY A;  1ST6 A;  3DM9 B;  5KYW A;  1HMD A;  4IRU A;  5COM A;  2H7B A;  4NQF A;  3VAY A;  3SXY A;  2J9U A;  1I4Z A;  2G62 A;  3LNR A;  5B3I A;  3S28 A;  2Y39 A;  2YLI A;  4FAP B;  4CJO A;  2IXP A;  3LLK A;  5JSL A;  1JRA A;  4LAC B;  3TD7 A;  3QMK A;  4YWQ A;  5T3T A;  1MMN A;  4YL1 A;  3ZSU A;  1V55 C;  2Y3D A;  2WVO A;  1O5H A;  3CAX A;  3GAN A;  4DRJ B;  4E0I A;  1YLM A;  1ZZP A;  2DB4 A;  2OG2 A;  1D1B A;  2LSE A;  2R7X A;  2H7V C;  1L3P A;  1Q0K A;  2XLW A;  5BQG A;  2NUT A;  1QQ3 A;  3GM1 A;  4Q7C A;  4CDV A;  5BQH A;  3TOL A;  4E17 A;  1NFN A;  1TWH A;  2L81 A;  4R32 A;  1ZHT A;  1K04 A;  1AEP A;  4E0H A;  3EGD A;  4CSA C;  4Q5S F;  3MBG A;  2CYD A;  3E70 C;  3UR3 C;  1T6U A;  1CPR A;  1PD1 A;  5KYY B;  3N0T A;  5D92 A;  2X0C A;  1Q0G A;  2BC5 A;  2HMZ A;  1LIH A;  5B1B C;  4QI2 A;  4O6Y A;  3DJU B;  4C3E A;  3EH1 A;  3OWT A;  5KYN A;  2LK4 A;  3F47 A;  4U5B E;  3EZI A;  3E9V A;  4EHP A;  3K1I C;  1CPQ A;  1R5I D;  3OA1 A;  3HJC A;  4N6H A;  4RBN A;  2L6F A;  4JUR I;  2WZL A;  3FDQ A;  3DD7 A;  5L0G A;  3AG2 C;  1QPU A;  2JPU A;  1XZP A;  2L6H A;  2PF4 E;  2Q4F A;  4GYT A;  4IAQ A;  4CS8 A;  4EUK B;  2MWQ A;  2HMQ A;  4XPW A;  2XSE A;  2XLE A;  3TOM A;  2XLV A;  4BJ5 C;  2NUP A;  1OCR C;  3EG9 A;  2Q7R A;  4ULW A;  2JX0 A;  2GDC A;  4K0D A;  4X0R A;  3S90 A;  1PD0 A;  4LER A;  2RSE B;  2QUP A;  3GWN A;  4M63 A;  2B0H A;  3SYN A;  3FOO A;  2XL8 A;  2YZS A;  3WG7 C;  2GAQ A;  2ASR A;  2L7A A;  3ASO C;  1A7V A;  4RD9 A;  5COF A;  2AP3 A;  5B3S C;  4XWJ A;  3AOU A;  4JCH A;  2R9R B;  5T1D B;  3KYJ A;  4ZLC A;  1JMW A;  2KC3 A;  3O10 A;  3WOD F;  1R4T A;  2YL0 A;  1YVI A;  2LFF A;  2WB7 A;  3LJB A;  3C8G D;  3U8V A;  4JRZ A;  1JPN A;  3B71 A;  3ZC4 A;  2KYH A;  3PDM P;  1T5O A;  1VLS A;  4LDR A;  3TQO A;  3AG4 C;  2J9B A;  3LS0 A;  3B29 A;  1A0B A;  3HNL A;  4DOZ A;  1I4Y A;  1FMV A;  3H2V A;  3H2U A;  3RW0 A;  4N06 A;  3JTL O;  2VAS A;  2HJM A;  3HTK C;  2R7S A;  4NTB A;  4WGZ A;  1QVX A;  3KYI A;  3NYL A;  1XWJ A;  4IGG A;  5F5F A;  2NG1 A;  2J46 A;  4CX9 A;  5JRA A;  1RKE A;  3R7C A;  4C3B A;  1LPE A;  2ZXP A;  2H7O A;  2Q3T A;  2O9X A;  1FTS A;  4D4X A;  4C7O A;  2OJE D;  2HJ3 A;  3KPH A;  5AC5 A;  5IY5 C;  3JSE O;  2R05 A;  1E86 A;  5KYU B;  2XRH A;  3QVZ A;  2LFD A;  3HKK A;  3DZA A;  4WAB A;  3WHN A;  4YT8 A;  3U3F A;  4MVO A;  1HY5 A;  1VMA A;  3ASN C;  1GM5 A;  1EKY A;  1N1C A;  1W2W A;  3JZ0 A;  4G0H A;  4FWV A;  3I5Q A;  3EGX A;  1TQG A;  3NMK A;  5F28 E;  2YWA A;  1YA9 A;  3RQE A;  2OEX A;  2X51 A;  5L0I A;  4OIP F;  3NDB B;  1LE2 A;  3M15 A;  5AC4 A;  3KH2 A;  3I4U A;  4YN0 B;  5T3W A;  1ZHZ A;  1C02 A;  2EIK C;  1E84 A;  2R7T A;  1ZU4 A;  5DS5 A;  1F1M A;  1G5Z A;  2YEV A;  2OU6 A;  2XM4 A;  1ORJ A;  3DM5 A;  3UMH A;  4UDV A;  1H6G A;  1YYJ A;  2XM0 A;  3AG1 C;  4PJJ A;  1D0X A;  3RIP A;  2ZXR A;  3VRC A;  5DS6 A;  3G4Z A;  2WZG A;  1D1A A;  1ZVZ A;  1A41 A;  4JE9 A;  1YJG A;  1MNE A;  3FVY A;  2YL3 A;  4BJ1 A;  1EI7 A;  2HSB A;  3DMD A;  2W4B A;  1GQA A;  2EPK X;  4KC9 A;  1LKX A;  2J45 A;  1H7I A;  3KKB A;  3EHM A;  3S84 A;  3ZWI A;  1HW2 A;  1FR0 A;  3ECS A;  4MVZ A;  2AU5 A;  3B0U X;  1WOL A;  5JP7 A;  1IZM A;  4QDL A;  1JPJ A;  2KNH A;  4U9D A;  1K40 A;  3JYY A;  2A68 F;  4YJW A;  1BDJ B;  3SNH A;  1SR2 A;  2VCC A;  3V5Z A;  5L3V A;  3ZTZ A;  2OOC A;  1FAP B;  2NUT B;  3T9O A;  4AL1 A;  4XLN F;  2ICW G;  1PV3 A;  2PX3 A;  3EGD B;  2AVK A;  4YK5 A;  3Q6M A;  1BR1 A;  1CGO A;  5E3A A;  4C3D A;  4DXW A;  2OJQ A;  3JSZ A;  1ZHX A;  1WWP A;  2CNW A;  3SEO A;  1B68 A;  2NPU A;  3K1H A;  3U9J A;  1EQ1 A;  1LI7 A;  3GEE A;  2HUJ A;  3ZDL A;  2GA0 A;  2J9V A;  2WL8 A;  3RQG A;  2HV7 A;  1D1C A;  1G4W R;  2R7R A;  3L8J A;  3LEO A;  2D5R B;  1T01 A;  1UFB A;  2ZPA A;  3LUT B;  2E87 A;  4I1O B;  3EPV A;  3C62 A;  3MFN A;  5E2Q A;  4IB4 A;  3B9Q A;  2YKZ A;  3JRT A;  3RYL A;  3ZIB A;  5JUA A;  4P6I C;  1Z63 A;  3J06 A;  2A69 F;  3C7J A;  1ZHY A;  1MND A;  4MTG A;  1VOM A;  1HMO A;  4J7Y A;  2NSF A;  1E83 A;  1BR4 A;  3T6G B;  1Y4C A;  4J32 B;  2R03 A;  4NCQ A;  1H9G A;  4XEK A;  3SXM A;  1FNT c;  4MW8 A;  5KYU A;  2M64 A;  2Q9A A;  4IWB A;  5E33 A;  2HV6 A;  1FFT C;  3BRJ A;  4ULV A;  4CSA A;  2IXN A;  2HFI A;  3JCU Q;  3DE8 A;  1ZW3 A;  1QZX A;  3TJ6 A;  5L0D A;  1ZW2 A;  2DGJ A;  5CI9 A;  2H8A A;  3EH2 A;  1M2O A;  1OKK D;  2Z15 A;  3T6J A;  4BJ5 A;  2GWW A;  3G4X A;  4N6C A;  4DBR A;  2YQY A;  5DS4 A;  3RKO F;  3QZC A;  3ZQV A;  3U2L A;  2TMV P;  3AGT A;  3U0C A;  2P61 A;  4J7T A;  1SMY F;  4G7H F;  4CJG A;  1WAS A;  4NY3 A;  1BR2 A;  3FOP A;  2EIM C;  2XLH A;  3CSK A;  3MYF A;  2NUP B;  2IBF A;  4Z9I A;  3S27 A;  2OQM A;  4ANJ A;  3B0P A;  2XXA A;  2Y3G A;  4XQ1 A;  3S0X A;  4EBJ A;  4W8P A;  1G8X A;  2EIN C;  1V4A A;  2V26 A;  3EFO B;  2HKV A;  3OEO A;  5DQZ A;  4OIQ F;  2PFD A;  1MMA A;  1NU9 C;  3SP1 A;  5A6J A;  1YAR O;  3U3B A;  4MS2 A;  3W4Y A;  2MHR A;  2QTV A;  2XL4 A;  3C63 A;  2IM8 A;  3PCV A;  1T6Q A;  4IAR A;  1NG1 A;  2YL7 A;  4XPX A;  1OR3 A;  5BUO A;  4EBK A;  4EWC A;  2IYL D;  2KSF A;  1C17 M;  2LD6 A;  2M4E A;  2VH3 A;  4MTF A;  4OIR F;  3DKA A;  4NTA A;  2IXO A;  2A6H F;  3DXJ F;  4HEA J;  4I3M A;  4OIO F;  3A11 A;  5F5H A;  2XLM A;  1I5N A;  4XPY A;  4CIH A;  4MQ9 F;  4MW3 A;  4Z9J A;  2J0X A;  1S7Z A;  3AJM A;  1APC A;  3K1I A;  1M6T A;  3DAF A;  4MND A;  5JT4 A;  3TUL A;  4LDK A;  1OW8 A;  2DYS C;  4LDQ A;  3LAY A;  4MVQ A;  4DBQ A;  2AWY A;  4DRH B;  4WJ0 A;  4BJ6 A;  3EQL F;  3TK0 A;  4WGY A;  2WVN A;  1JOG A;  2KGO A;  3GM3 A;  5KYW B;  3NRH A;  4U5D E;  3SXZ A;  3GEH A;  2PX0 A;  2IOQ A;  3IEE A;  1RJ9 A;  4XEF A;  2QNL A;  1ZU5 A;  3O55 A;  4JTA B;  3IQ5 A;  2P0N A;  3FHD A;  3M1C B;  4NTF A;  3T4R A;  5AGF A;  2G3K A;  4FES A;  2XS8 A;  3MYI A;  4O6M A;  3M79 A;  4GEH A;  4IJJ A;  3ABL C;  3QW0 A;  4MVU A;  3NMJ A;  3K66 A;  4HFF B;  2V3C C;  1YA7 O;  2KK1 A;  2R7V A;  2XL6 A;  4HFK B;  4OD5 A;  4YT2 A;  4CS7 A;  3IQC A;  1TFO B;  5A69 A;  1HE9 A;  2HSQ A;  1AVO B;  2QY9 A;  4PR9 A;  1LI5 A;  3UMK A;  3NKD A;  1ZYR F;  4LLE A;  3TJ5 A;  5EK0 A;  3US6 A;  1RKC A;  2BL2 A;  1OW6 A;  1VK5 A;  256B A;  4P9F A;  2LP4 A;  2I8B A;  1FFH A;  4O79 A;  3JRM O;  2JD3 A;  3DE9 A;  2FFH A;  2R7W A;  2XXA B;  3IQT A;  3IPM O;  2R7U A;  1OCZ C;  3GWL A;  2C04 A;  3NG1 A;  4BJT A;  4ER9 A;  3DJN B;  1DOW A;  1MQV A;  1OQC A;  3EFO A;  4JTC B;  2DI3 A;  4BEM J;  1K05 A;  2J0W A;  2ETS A;  2IXM A;  1S05 A;  3L8I A;  4AE4 A;  3EZH A;  4D4N A;  1LM3 B;  4YL0 A;  1QSP A;  2A0B A;  3C8G A;  1Z5Z A;  1E85 A;  1FMW A;  3L0I A;  1OXB A;  1LS1 A;  2EIL C;  3M4C A;  3CQZ A;  2NSG A;  4PJM A;  2I15 A;  4KI2 A;  1YDI A;  2YHS A;  3UMI A;  3M4B A;  4ONS A;  4MVR A;  1HE1 A;  1DOV A;  1JR8 A;  1OXK A;  2J8W A;  1VYI A;  4JJF A; 
#chains in the Genus database with same CATH homology
 4NC3 A;  5JS5 A;  3ZQV A;  2YL0 A;  4N4W A;  3HNI A;  4CJG A;  3NMI A;  3FOP A;  2J9B A;  2XLH A;  3HNL A;  1YZC A;  2XLO A;  3U8P A;  1YZA A;  4WGZ A;  4L6R A;  2QLA A;  4CX9 A;  5JRA A;  4JEB A;  5JLI A;  3IQ6 A;  4D4X A;  1E84 A;  1E86 A;  1YYX A;  2YLD A;  1RCP A;  3C63 A;  3QVZ A;  4IAR A;  2YL7 A;  3L1M A;  2XLD A;  2YL1 A;  3ZQY A;  3ZTM A;  4JKV A;  1EKY A;  1JAF A;  4EIY A;  4U9E A;  3NMK A;  1NBB A;  3HNJ A;  3M15 A;  2XLM A;  5JT4 A;  1APC A;  1M6T A;  2YLI A;  4CJO A;  5JSL A;  2XM4 A;  2XM0 A;  1YYJ A;  3VRC A;  4CIP A;  4WGY A;  3QW1 A;  4JE9 A;  2YL3 A;  1GQA A;  2XLW A;  3IQ5 A;  4CDV A;  1QQ3 A;  5AGF A;  3TOL A;  3HNK A;  3M79 A;  3ZWI A;  3QW0 A;  5JP7 A;  3NMJ A;  4U9D A;  2CCY A;  4CDA A;  2XL6 A;  3ZTZ A;  1CPR A;  2BC5 A;  5JVE A;  256B A;  1CPQ A;  4N6H A;  1CGO A;  1A7V A;  1QPU A;  3DE9 A;  4IAQ A;  1BBH A;  2YLG A;  4JEA A;  4ER9 A;  2XLE A;  3TOM A;  2XLV A;  1MQV A;  3QVY A;  5B3I A;  3C62 A;  5JUA A;  4IB4 A;  1CGN A;  1S05 A;  2YKZ A;  4D4N A;  1LM3 B;  1E83 A;  1E85 A;  3M4C A;  3FOO A;  2XL8 A;  3M4B A;  4ULV A;  3DE8 A;  4CDY A;  2J8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...