3ZQVA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans at 0.84 a resolution: non-restrained refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAVQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3zqvA00
4U9EA 1M6TA 2XLWA 1NBBA 4JE9A 3NMJA 1YZCA 4CIPA 5JP7A 1CPQA 2QLAA 3IQ6A 5JSLA 4D4XA 1YZAA 3M79A 3NMKA 3ZQVA 2XLMA 3M4CA 1E84A 1YYXA 2XM0A 4CJOA 1QQ3A 3HNJA 4JEBA 1LM3B 4WGZA 3FOPA 3FOOA 2CCYA 4CDYA 3ZTZA 2YL3A 4ER9A 2XM4A 3NMIA 2XLEA 3QW1A 3M4BA 1S05A 3TOMA 4JEAA 1GQAA 1CPRA 4N6HA 4JKVA 3L1MA 5JRAA 3QW0A 2YL1A 1RCPA 2YLIA 2YL7A 1YYJA 3IQ5A 4L6RA 3ZWIA 1JAFA 1A7VA 3HNIA 4IB4A 5B3IA 3M15A 3HNKA 1E85A 2XL8A 2J8WA 2XLHA 3C63A 2YKZA 1MQVA 5JT4A 3TOLA 2YLGA 5JS5A 2XLDA 3DE8A 5JVEA 4CJGA 256BA 1CGOA 2XLVA 2XLOA 2BC5A 4CDVA 4IAQA 3VRCA 1EKYA 4EIYA 3QVZA 1E83A 2XL6A 4CX9A 2YL0A 1APCA 3U8PA 4ULVA 4IARA 5AGFA 3QVYA 4CDAA 2YLDA 4D4NA 5JLIA 5JUAA 3ZTMA 1QPUA 4N4WA 4U9DA 3DE9A 3HNLA 2J9BA 3ZQYA 1BBHA 4WGYA 3C62A 1E86A 1CGNA 4NC3A
chains in the Genus database with same CATH superfamily
3J06A 1M6TA 1W2WA 2IOQA 2CDQA 3GM2A 3H2UA 1MMDA 1YZCA 3NKDA 1A7DA 4K1OA 5L0IA 4JJGA 3RQFA 2MWQA 2AVKA 2VCAA 3CEXA 2YRFA 4LDQA 1NU9C 5AC4A 3EGDA 2HMZA 2ICWG 3EGDB 3RQEA 4CS9C 2HSQA 1SF8A 5K0IA 4XPYA 3T6JA 3KH2A 1YYXA 2XM0A 1J8MF 3F46A 3W4YA 3WHNA 1PV3A 4CJOA 2KNHA 3S0XA 3WAQA 5COGA 1OW6A 4RDAA 4YL0A 2B0HA 1Q0KA 4LDRA 4AE4B 3ECSA 4A4AA 1PD1A 3GEEA 3ZIBA 2V3CC 3K33A 5T3WA 1VK5A 5B3SC 3QW1A 2IYLD 1K05A 2XLEA 1TWHA 1FTSA 4C3EA 3CZ6A 4O6YA 1Z23A 2HV6A 2PP4A 2VH3A 4XPWA 3W8HA 2XRHA 1S05A 2R7RA 4MQ9F 4JEAA 3QZCA 2R25A 1OCOC 2H7BA 2A0UA 2NPUA 2ZXOA 4DRHB 1CPRA 2CNWD 2CNWA 4N6HA 1D0XA 2B0JA 1T6IA 1YDIA 2C03A 2GAQA 3MX3A 3QW0A 1Z7Qc 1OCRC 2J7PD 3I5PA 5L0CA 2G3KA 5T1DB 3NYLA 4JC7A 5KYUA 1DOWA 1V55C 2QE9A 4L6RA 1UFBA 3JTLO 3L8JA 4A2NB 4BEMJ 1ZU4A 4CSAA 3ATPA 3WG7C 3T4RA 2EPOA 2FAPB 4BJ6C 2A0BA 3UNGC 4EHPA 2J9UA 2LFDA 4XEVA 3H2VA 4EWCA 2YEVA 1QSPA 4LERA 5EK0A 1S7ZA 3G50A 4E18A 4MVZA 3DAFA 1NG1A 2YWAA 3UMHA 3GM3A 2R7SA 2CYDA 2Y39A 1Z3IX 2A68F 3TQOA 2UUIA 4NTAA 1MQVA 2P61A 3JSEO 3C8GB 3U8VA 2JD3A 1VMAA 3K1IC 3Q7GA 4NTBA 3NYMA 1ZHTA 4JTCB 4OINF 1AUEA 3MFNA 5EGYA 2Y3DA 2DI3A 2J45A 4GEHA 2YHSA 4YN0B 5DS5A 4DOZA 3EFOA 1OXKA 2IBFA 2DYRC 4MVRA 4B6IA 3DM9B 3LNRA 4U5FE 1CGOA 2LFFA 2QY9A 4CJGA 2XS8A 1D1BA 4N6CA 5KYWA 1HY5A 4OIOF 4Q4ZF 2R7XA 4I3MA 2DB4A 1OR2A 2H8AA 4JTAB 4WABA 2XL6A 1ZW3A 3B0VC 1F1MA 2NUTA 3DJUB 2HSBA 4I1OB 3U8PA 4P9FA 4IARA 1VYIA 4PACA 3DJNB 3QVYA 4J32B 3DI5A 4KBLA 2YLDA 4LLCA 3SXKA 1V4AA 2OQMA 5CIVA 4YK5A 3EHMA 1LS4A 5L0GA 3GEHA 3UGOA 4H4KC 4BG0A 1D1AA 1HW1A 1BR4A 3E9VA 2OJQA 3C7JA 1QPUA 3ASOC 1TR2A 2IXOA 3LEOA 1Z6AA 3AOUA 4I44A 4N4WA 3U2LA 4AL1A 2L7AA 2A1DD 2PNOA 4MVSA 2AP3A 2IXMA 3DE9A 4MTFA 1Y4CA 4OD5A 4QI0A 3ZQYA 2XS1A 3TJ5A 1ST6A 1U89A 3FAPB 4WGYA 1ZHZA 2R7UA 2C04A 5L0JA 4ZLDA 3H65A 1UG7A 4IGGA 4M63A 4P6IC 1MMAA 1JMWA 2LD6A 2IXPA 2XXAB 1ZW2A 1TWGA 3I4UA 2OJED 2NUTB 2HMQA 4JE9A 4RD9A 1A7EA 1HW2A 1EA8A 4JVSA 2H7VC 2GWWA 2BE5F 5JP7A 3B0PA 1H9GA 1TWCA 3F47A 4HFKB 3OWTA 4D4XA 4NY3A 4E7ZA 1EQ1A 3JRTA 1RKEB 2GA0A 1M2OA 1JPJA 1NZEA 4QI2A 3V5YA 2WL8A 5DQTA 4YWQA 1NFNA 2KC3A 3ZDLA 1E84A 4GYTA 2VC9A 4KI2A 3ABLC 4JCHA 1LM3B 3LESA 1ORSC 2D4UA 1L3PA 2EPMX 2G3VA 2P6VA 1TWAA 3JYYA 2ZXRA 4X0RA 3SYNA 5KYYB 3C8GA 2GFHA 2YL3A 4G0HA 4NTFA 4ER9A 2Y3GA 2XM4A 3A9CA 1LIHA 3M4BA 4MVOA 4WJ0A 3C8ZA 1TKNA 4PFPA 3VF0A 3EGXA 1WN0A 4C7OB 3RH3A 5BQHA 1WTYA 3ABKC 1YA7O 2W45A 3C18A 2I8BA 3AG1C 5KYWB 1GQAA 3EZHA 4I1MA 3JYHA 4JKVA 3LAYA 1VOMA 2NG1A 2R7QA 4JTDB 2DYSC 4BJ6A 2YLIA 2OCCC 3FMSA 3EZIA 4ONSA 4BJTA 5CI8A 3VAYA 1V54C 3ZWIA 3GODA 4DVZA 2PFDA 3L0IA 2QTVA 3HNIA 4F4BA 1QLEC 3N24A 1I5NA 3M15A 1FNTc 3PHF2 3K6BA 3KL4A 3LS0A 1GS9A 1KNYA 1Q0FA 1ZHWA 3RYLA 1FFTC 1WATA 2HJ3A 1WASA 5B1BC 3SXMA 3UMKA 3UMIA 2I15A 3IQTA 5IY5C 4E0IA 4O6MA 4XQ1A 5F28E 3AQCA 2XLHA 1E2XA 1YA9A 4XPXA 2J0WA 3X2QC 4YL1A 3US6A 1Q0GA 2OEVA 4J7TA 2HJMA 3IEEA 3E70C 3NYJA 5DS6A 4AL0A 2KJGA 4MTGA 4OIRF 2J46A 4DJ9A 4DBRA 4JW1A 1ORJA 3BEHA 5KYUB 3RW0A 4LLEA 1NU7D 2DGJA 4IAOA 5E3AA 1HE1A 1EI7A 2PBEA 3TULA 2V26A 1T5OA 2EIMC 3B0UX 3DD7A 4R32A 3GWLA 4Z9IA 1QZXA 1RJ9B 2JPUA 1JPNA 2W4MA 3AQBA 3JRMO 2J0XA 4K0DA 5D91A 3R7CA 4EIYA 1E83A 2NSFA 2GDCA 2WZFA 4Q5SF 4BPMA 2KK1A 4G78A 3U2MA 1OKKD 1APCA 2LIGA 4JCZA 4YT5A 1C02A 4O6NA 4PJLA 3ITFA 4NCQA 4ANJA 5COFA 2MYSA 4YT2A 5B1AC 4BJ5A 1MMNA 1FFHA 2LQGA 4BJ1A 1U6HA 3JZ0A 3UGPA 5DS4A 1LI5A 4DRIB 3SP1A 1XZPA 2Q00A 4U9DA 1A0BA 1VB5A 1ZYRF 5KYXA 2A6HF 3NDBB 2KYHA 3EH1A 1LPEA 2J9BA 4K7BA 3S84A 2LK4A 1H9TA 4FX5A 2LSEA 4W8PA 5T3TA 4MVUA 3U9MA 1ZVZA 2AWCA 3DKAA 2RD9A 3O10A 4H54A 1M2VB 3VYWA 5F5FA 1E86A 2OG2A 2Q9AA 3EQLF 4E7SA 3KKBA 1LE4A 4U9EA 2ZPAA 4PFOA 1NBBA 1C03A 2R7VA 1T6UA 1O87A 2XSEA 3M1CB 4FWVA 3JSZA 4PK4A 2NUPA 2R7TA 4U5CE 2QLAA 3IQ6A 1TFKB 5JSLA 3LLIA 4MW3A 5L0HA 4BEJA 2EPLX 3NMKA 3ZQVA 4AK9A 3O39A 4HE8D 5E2QA 1ZHXA 3CAXA 1XWJA 4CS8A 5A6JA 1M57C 1QQ3A 3HNJA 4JEBA 1H6GA 1OXBA 1OCZC 2QUPA 1LVKA 1QVXA 2AU5A 2KQ9A 3LJBA 4CDYA 4O7GA 3ZTZA 2O9XA 3K66A 5E3CA 4XTKA 4XEFA 1TQGA 2Q7RA 1BR1A 2OU6A 3PDMP 5DQZA 2HKVA 1G5ZA 3HKKA 3LS1A 4Q7CA 4PJMA 4DVYP 4FAPB 3R2PA 3L8IA 1C17M 2BL2A 4IWBA 5BQGA 3TOMA 4MVMA 2OKUA 1OKKA 3SEOA 3SXYA 3RQGA 5KYXB 5CI9A 1RXQA 3PMRA 1QKRA 4W8KA 3DXJF 4KC9A 2G62A 1I4ZA 4U5EE 1OW7A 2MHRA 3L1MA 1VTMP 2YL1A 3HTKC 1IW7F 2KSFA 1XZQA 1PCXA 1FR0A 2PF4E 4MS2A 2X0CA 1D1CA 1JR8A 3EG9A 1JAFA 4G7ZF 3T6GB 2OEXA 3LNMB 5FZTA 1U0BB 4N06A 1E85A 2L9JA 2IXNA 3GORA 2Y69C 3KMIA 2HFIA 1O5HA 1YAUO 5KYYA 2XL8A 3MBGA 1RKCA 2J8WA 1SYQA 2J7PA 3GEIA 1NLXA 4EBBA 2KW3C 3FVYA 1N1CA 2WVOA 1D0ZA 2NSGA 5BUOA 4LDKA 3C63A 2A69F 2YKZA 1MMGA 2VCBA 1AEPA 3EH2A 3K1HA 1LE2A 3K7DA 3IQCA 2YLGA 2YVKA 4J30B 1M56C 5JS5A 5HSWA 1JOGA 2FGYA 2ZXWC 2D5RB 3W2VA 3FDQA 4MVQA 4U5DE 3DE8A 5JVEA 4YT8A 1L7CA 2L6HA 1ZHYA 1OQCA 256BA 2EIKC 2OOCA 2XLVA 2CGEA 3B29A 1Q0MA 2XLOA 4IAQA 1H7IA 1EKYA 2EPKX 4PJNA 3UR3C 1R4TA 1SR2A 3W2WA 5D92A 4BJ5C 3MYFA 2Q9BA 3HLZA 3Q7LA 4LACB 2J9VA 4JZAA 4CX9A 3EG9B 5FCLA 3LEVA 2Q9CA 2W9YA 3CSKA 2LCHA 4ULVA 1T01A 1SZIA 2CW0F 5AGFA 5AC5A 3AGUA 3MLGA 3RVZA 2VCCA 4MTOA 2EIJC 1VYKA 4E17A 3ASNC 2WZGA 5JUAA 3ZTMA 4J7YA 5DLJA 3SZRA 2PX0A 2L6GA 5A6AA 4P9TA 3ZC4A 3GANA 3U5SA 5F5HA 5EHHA 3W8IA 1RJ9A 2WVQA 1BZ4A 3O6XA 4C7OA 3OA1A 4HFFB 5HV9A 5L3VA 1YARO 3EJNA 1OW8A 1A41A 2W4BA 4XWJA 2ZXPA 1YVIA 4FESA 1V74B 5KYNA 4MNDA 4DRJB 1NSGB 2E87A 2Q4FA 3JCUQ 1WGWA 2PX3A 3HJCA 2WB7A 4NC3A 4U5HA 2XLWA 4EUKB 2M64A 2JX0A 3VM6A 4OIQF 4JIOA 1PD0A 3NMJA 1HMDA 3RIPA 3GM1A 2HUJA 2HV7A 4CIPA 4XLNF 2TMVP 1IZMA 3IHUA 4G7HF 1CPQA 3FXHA 3TK0A 1MNEA 1K40A 3O55A 5COMA 2R05A 1KTMA 1B68A 1RKEA 1YZAA 3GWNA 1O3UA 3M79A 3L34A 2ZD9A 1ZZPA 1HE9A 3KYJA 1BR2A 2XLMA 3M4CA 4KNWA 1Z63A 2EINC 3AGTA 3EPVA 2NUPB 2KGOA 4YL3A 4CSAC 4KNVA 4WGZA 3S9OA 3TJ6A 3LLKA 3FOPA 3FOOA 2CCYA 3QMKA 1GGQA 1ZU5A 4CS7A 4G7OF 1FMVA 1MNDA 3Q6MA 2EPNA 3T9OA 1VLTA 3WODF 2P0NA 5GPGB 4Z9JA 3NMIA 4PR9A 1Y6DA 1M2VA 4MW8A 3U3BA 4ZLCA 2ETSA 1G8XA 5A69A 1K04A 3AJMA 2VASA 3DAGA 3SNHA 4RBNA 3X1OA 3U3FA 1D0YA 4IRUA 1T9KA 2IM8A 3T6BA 2VB6A 2H7OA 3EGXB 3N0TA 3S28A 3K1IA 4JRZA 3RFYA 3CQZA 4YJWA 4CS8C 3RVYA 3G4ZA 4EKWA 2HS5A 3NRHA 5TJ5E 4O79A 4EBJA 2F22A 3BRJA 3ZSUA 5JRAA 2R9RB 1RCPA 3KPHA 1WOLA 2YL7A 3NG1A 1YYJA 3ZG1A 5L0FA 1Z5ZA 4AE4A 3RF3A 4JJFA 4YT4A 3IQ5A 2YZSA 1DOVA 1T6QA 3JT1A 4HEAJ 2EILC 3IPMO 1A7VA 1NFOA 3DMDA 4IB4A 4CS9A 3AG3C 5B3IA 3HNKA 3U0CA 2R7OA 1LS1A 2P1AA 3QTHA 3C8GD 4DBQA 3S90A 2UUHA 1RMVA 2Q3TA 1J8YF 4C3BA 5E33A 1YLMA 3NKEA 5A6BD 3EHNA 2J9WA 3TD7A 1JRAA 1AVOB 4GQHA 3RKOF 2LP4A 3N2ZB 4CBEA 5L0DA 3G4XA 3V5ZA 1FAPB 3EFOB 4ULWA 2ASRA 5DVWA 4DXWA 2FFHA 3DWWA 1I4YA 4C3DA 2M4EA 3TOLA 5JT4A 3ABMC 3B9QA 4XEKA 5L3QA 1HMOA 2AWYA 5BQIA 1G4US 2WVNA 4IJJA 2XLDA 5A6BA 4JURI 4CIHA 2X51A 1G4WR 3S27A 3DM5A 1TFOB 2WZLA 3FHDA 2QNLA 2XL4A 4AX2A 2YQYA 3LUTB 3S29A 3POVA 3MYIA 4QDLA 3SXZA 1BDJB 2BC5A 4CDVA 3VRCA 3I5QA 1OR3A 3OEOA 3QVZA 4EBKA 1CGME 2R7WA 4PJJA 4XLPF 2YL0A 3AG4C 4E0HA 1Q0DA 5A6KA 3ZVRA 2XXAA 2P7VA 2HZ8A 4CDAA 3V7OA 4D4NA 1KU2A 5JLIA 2Y3HA 2Z15A 3U9JA 3B71A 3A11A 3FAJA 3KYIA 2Y3BA 1OCCC 3PCVA 4OIPF 1YJGA 3AG2C 3DZAA 1WWPA 4U5BE 1LKXA 3HNLA 4OD4A 3V5XA 4NQFA 4U5GA 2R03A 1ORYA 2L81A 1BBHA 1SMYF 2R02A 2RSEB 1VLSA 3C62A 1GM5A 2L6FA 2A6EF 1CGNA 1LI7A 4Z9HA 4UDVA 1R5ID 1FMWA 3Q6NA
chains in the Genus database with same CATH topology
4U9EA 1M6TA 2XLWA 1NBBA 4JE9A 3NMJA 1YZCA 4CIPA 5JP7A 1CPQA 2QLAA 3IQ6A 5JSLA 4D4XA 1YZAA 3M79A 3NMKA 3ZQVA 2XLMA 3M4CA 1E84A 1YYXA 2XM0A 4CJOA 1QQ3A 3HNJA 4JEBA 1LM3B 4WGZA 3FOPA 3FOOA 2CCYA 4CDYA 3ZTZA 2YL3A 4ER9A 2XM4A 3NMIA 2XLEA 3QW1A 3M4BA 1S05A 3TOMA 4JEAA 1GQAA 1CPRA 4N6HA 4JKVA 3L1MA 5JRAA 3QW0A 2YL1A 1RCPA 2YLIA 2YL7A 1YYJA 3IQ5A 4L6RA 3ZWIA 1JAFA 1A7VA 3HNIA 4IB4A 5B3IA 3M15A 3HNKA 1E85A 2XL8A 2J8WA 2XLHA 3C63A 2YKZA 1MQVA 5JT4A 3TOLA 2YLGA 5JS5A 2XLDA 3DE8A 5JVEA 4CJGA 256BA 1CGOA 2XLVA 2XLOA 2BC5A 4CDVA 4IAQA 3VRCA 1EKYA 4EIYA 3QVZA 1E83A 2XL6A 4CX9A 2YL0A 1APCA 3U8PA 4ULVA 4IARA 5AGFA 3QVYA 4CDAA 2YLDA 4D4NA 5JLIA 5JUAA 3ZTMA 1QPUA 4N4WA 4U9DA 3DE9A 3HNLA 2J9BA 3ZQYA 1BBHA 4WGYA 3C62A 1E86A 1CGNA 4NC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9E A;  1M6T A;  2XLW A;  1NBB A;  4JE9 A;  3NMJ A;  1YZC A;  4CIP A;  5JP7 A;  1CPQ A;  2QLA A;  3IQ6 A;  5JSL A;  4D4X A;  1YZA A;  3M79 A;  3NMK A;  3ZQV A;  2XLM A;  3M4C A;  1E84 A;  1YYX A;  2XM0 A;  4CJO A;  1QQ3 A;  3HNJ A;  4JEB A;  1LM3 B;  4WGZ A;  3FOP A;  3FOO A;  2CCY A;  4CDY A;  3ZTZ A;  2YL3 A;  4ER9 A;  2XM4 A;  3NMI A;  2XLE A;  3QW1 A;  3M4B A;  1S05 A;  3TOM A;  4JEA A;  1GQA A;  1CPR A;  4N6H A;  4JKV A;  3L1M A;  5JRA A;  3QW0 A;  2YL1 A;  1RCP A;  2YLI A;  2YL7 A;  1YYJ A;  3IQ5 A;  4L6R A;  3ZWI A;  1JAF A;  1A7V A;  3HNI A;  4IB4 A;  5B3I A;  3M15 A;  3HNK A;  1E85 A;  2XL8 A;  2J8W A;  2XLH A;  3C63 A;  2YKZ A;  1MQV A;  5JT4 A;  3TOL A;  2YLG A;  5JS5 A;  2XLD A;  3DE8 A;  5JVE A;  4CJG A;  256B A;  1CGO A;  2XLV A;  2XLO A;  2BC5 A;  4CDV A;  4IAQ A;  3VRC A;  1EKY A;  4EIY A;  3QVZ A;  1E83 A;  2XL6 A;  4CX9 A;  2YL0 A;  1APC A;  3U8P A;  4ULV A;  4IAR A;  5AGF A;  3QVY A;  4CDA A;  2YLD A;  4D4N A;  5JLI A;  5JUA A;  3ZTM A;  1QPU A;  4N4W A;  4U9D A;  3DE9 A;  3HNL A;  2J9B A;  3ZQY A;  1BBH A;  4WGY A;  3C62 A;  1E86 A;  1CGN A;  4NC3 A; 
#chains in the Genus database with same CATH topology
 3J06 A;  1M6T A;  1W2W A;  2IOQ A;  2CDQ A;  3GM2 A;  3H2U A;  1MMD A;  1YZC A;  3NKD A;  1A7D A;  4K1O A;  5L0I A;  4JJG A;  3RQF A;  2MWQ A;  2AVK A;  2VCA A;  3CEX A;  2YRF A;  4LDQ A;  1NU9 C;  5AC4 A;  3EGD A;  2HMZ A;  2ICW G;  3EGD B;  3RQE A;  4CS9 C;  2HSQ A;  1SF8 A;  5K0I A;  4XPY A;  3T6J A;  3KH2 A;  1YYX A;  2XM0 A;  1J8M F;  3F46 A;  3W4Y A;  3WHN A;  1PV3 A;  4CJO A;  2KNH A;  3S0X A;  3WAQ A;  5COG A;  1OW6 A;  4RDA A;  4YL0 A;  2B0H A;  1Q0K A;  4LDR A;  4AE4 B;  3ECS A;  4A4A A;  1PD1 A;  3GEE A;  3ZIB A;  2V3C C;  3K33 A;  5T3W A;  1VK5 A;  5B3S C;  3QW1 A;  2IYL D;  1K05 A;  2XLE A;  1TWH A;  1FTS A;  4C3E A;  3CZ6 A;  4O6Y A;  1Z23 A;  2HV6 A;  2PP4 A;  2VH3 A;  4XPW A;  3W8H A;  2XRH A;  1S05 A;  2R7R A;  4MQ9 F;  4JEA A;  3QZC A;  2R25 A;  1OCO C;  2H7B A;  2A0U A;  2NPU A;  2ZXO A;  4DRH B;  1CPR A;  2CNW D;  2CNW A;  4N6H A;  1D0X A;  2B0J A;  1T6I A;  1YDI A;  2C03 A;  2GAQ A;  3MX3 A;  3QW0 A;  1Z7Q c;  1OCR C;  2J7P D;  3I5P A;  5L0C A;  2G3K A;  5T1D B;  3NYL A;  4JC7 A;  5KYU A;  1DOW A;  1V55 C;  2QE9 A;  4L6R A;  1UFB A;  3JTL O;  3L8J A;  4A2N B;  4BEM J;  1ZU4 A;  4CSA A;  3ATP A;  3WG7 C;  3T4R A;  2EPO A;  2FAP B;  4BJ6 C;  2A0B A;  3UNG C;  4EHP A;  2J9U A;  2LFD A;  4XEV A;  3H2V A;  4EWC A;  2YEV A;  1QSP A;  4LER A;  5EK0 A;  1S7Z A;  3G50 A;  4E18 A;  4MVZ A;  3DAF A;  1NG1 A;  2YWA A;  3UMH A;  3GM3 A;  2R7S A;  2CYD A;  2Y39 A;  1Z3I X;  2A68 F;  3TQO A;  2UUI A;  4NTA A;  1MQV A;  2P61 A;  3JSE O;  3C8G B;  3U8V A;  2JD3 A;  1VMA A;  3K1I C;  3Q7G A;  4NTB A;  3NYM A;  1ZHT A;  4JTC B;  4OIN F;  1AUE A;  3MFN A;  5EGY A;  2Y3D A;  2DI3 A;  2J45 A;  4GEH A;  2YHS A;  4YN0 B;  5DS5 A;  4DOZ A;  3EFO A;  1OXK A;  2IBF A;  2DYR C;  4MVR A;  4B6I A;  3DM9 B;  3LNR A;  4U5F E;  1CGO A;  2LFF A;  2QY9 A;  4CJG A;  2XS8 A;  1D1B A;  4N6C A;  5KYW A;  1HY5 A;  4OIO F;  4Q4Z F;  2R7X A;  4I3M A;  2DB4 A;  1OR2 A;  2H8A A;  4JTA B;  4WAB A;  2XL6 A;  1ZW3 A;  3B0V C;  1F1M A;  2NUT A;  3DJU B;  2HSB A;  4I1O B;  3U8P A;  4P9F A;  4IAR A;  1VYI A;  4PAC A;  3DJN B;  3QVY A;  4J32 B;  3DI5 A;  4KBL A;  2YLD A;  4LLC A;  3SXK A;  1V4A A;  2OQM A;  5CIV A;  4YK5 A;  3EHM A;  1LS4 A;  5L0G A;  3GEH A;  3UGO A;  4H4K C;  4BG0 A;  1D1A A;  1HW1 A;  1BR4 A;  3E9V A;  2OJQ A;  3C7J A;  1QPU A;  3ASO C;  1TR2 A;  2IXO A;  3LEO A;  1Z6A A;  3AOU A;  4I44 A;  4N4W A;  3U2L A;  4AL1 A;  2L7A A;  2A1D D;  2PNO A;  4MVS A;  2AP3 A;  2IXM A;  3DE9 A;  4MTF A;  1Y4C A;  4OD5 A;  4QI0 A;  3ZQY A;  2XS1 A;  3TJ5 A;  1ST6 A;  1U89 A;  3FAP B;  4WGY A;  1ZHZ A;  2R7U A;  2C04 A;  5L0J A;  4ZLD A;  3H65 A;  1UG7 A;  4IGG A;  4M63 A;  4P6I C;  1MMA A;  1JMW A;  2LD6 A;  2IXP A;  2XXA B;  1ZW2 A;  1TWG A;  3I4U A;  2OJE D;  2NUT B;  2HMQ A;  4JE9 A;  4RD9 A;  1A7E A;  1HW2 A;  1EA8 A;  4JVS A;  2H7V C;  2GWW A;  2BE5 F;  5JP7 A;  3B0P A;  1H9G A;  1TWC A;  3F47 A;  4HFK B;  3OWT A;  4D4X A;  4NY3 A;  4E7Z A;  1EQ1 A;  3JRT A;  1RKE B;  2GA0 A;  1M2O A;  1JPJ A;  1NZE A;  4QI2 A;  3V5Y A;  2WL8 A;  5DQT A;  4YWQ A;  1NFN A;  2KC3 A;  3ZDL A;  1E84 A;  4GYT A;  2VC9 A;  4KI2 A;  3ABL C;  4JCH A;  1LM3 B;  3LES A;  1ORS C;  2D4U A;  1L3P A;  2EPM X;  2G3V A;  2P6V A;  1TWA A;  3JYY A;  2ZXR A;  4X0R A;  3SYN A;  5KYY B;  3C8G A;  2GFH A;  2YL3 A;  4G0H A;  4NTF A;  4ER9 A;  2Y3G A;  2XM4 A;  3A9C A;  1LIH A;  3M4B A;  4MVO A;  4WJ0 A;  3C8Z A;  1TKN A;  4PFP A;  3VF0 A;  3EGX A;  1WN0 A;  4C7O B;  3RH3 A;  5BQH A;  1WTY A;  3ABK C;  1YA7 O;  2W45 A;  3C18 A;  2I8B A;  3AG1 C;  5KYW B;  1GQA A;  3EZH A;  4I1M A;  3JYH A;  4JKV A;  3LAY A;  1VOM A;  2NG1 A;  2R7Q A;  4JTD B;  2DYS C;  4BJ6 A;  2YLI A;  2OCC C;  3FMS A;  3EZI A;  4ONS A;  4BJT A;  5CI8 A;  3VAY A;  1V54 C;  3ZWI A;  3GOD A;  4DVZ A;  2PFD A;  3L0I A;  2QTV A;  3HNI A;  4F4B A;  1QLE C;  3N24 A;  1I5N A;  3M15 A;  1FNT c;  3PHF 2;  3K6B A;  3KL4 A;  3LS0 A;  1GS9 A;  1KNY A;  1Q0F A;  1ZHW A;  3RYL A;  1FFT C;  1WAT A;  2HJ3 A;  1WAS A;  5B1B C;  3SXM A;  3UMK A;  3UMI A;  2I15 A;  3IQT A;  5IY5 C;  4E0I A;  4O6M A;  4XQ1 A;  5F28 E;  3AQC A;  2XLH A;  1E2X A;  1YA9 A;  4XPX A;  2J0W A;  3X2Q C;  4YL1 A;  3US6 A;  1Q0G A;  2OEV A;  4J7T A;  2HJM A;  3IEE A;  3E70 C;  3NYJ A;  5DS6 A;  4AL0 A;  2KJG A;  4MTG A;  4OIR F;  2J46 A;  4DJ9 A;  4DBR A;  4JW1 A;  1ORJ A;  3BEH A;  5KYU B;  3RW0 A;  4LLE A;  1NU7 D;  2DGJ A;  4IAO A;  5E3A A;  1HE1 A;  1EI7 A;  2PBE A;  3TUL A;  2V26 A;  1T5O A;  2EIM C;  3B0U X;  3DD7 A;  4R32 A;  3GWL A;  4Z9I A;  1QZX A;  1RJ9 B;  2JPU A;  1JPN A;  2W4M A;  3AQB A;  3JRM O;  2J0X A;  4K0D A;  5D91 A;  3R7C A;  4EIY A;  1E83 A;  2NSF A;  2GDC A;  2WZF A;  4Q5S F;  4BPM A;  2KK1 A;  4G78 A;  3U2M A;  1OKK D;  1APC A;  2LIG A;  4JCZ A;  4YT5 A;  1C02 A;  4O6N A;  4PJL A;  3ITF A;  4NCQ A;  4ANJ A;  5COF A;  2MYS A;  4YT2 A;  5B1A C;  4BJ5 A;  1MMN A;  1FFH A;  2LQG A;  4BJ1 A;  1U6H A;  3JZ0 A;  3UGP A;  5DS4 A;  1LI5 A;  4DRI B;  3SP1 A;  1XZP A;  2Q00 A;  4U9D A;  1A0B A;  1VB5 A;  1ZYR F;  5KYX A;  2A6H F;  3NDB B;  2KYH A;  3EH1 A;  1LPE A;  2J9B A;  4K7B A;  3S84 A;  2LK4 A;  1H9T A;  4FX5 A;  2LSE A;  4W8P A;  5T3T A;  4MVU A;  3U9M A;  1ZVZ A;  2AWC A;  3DKA A;  2RD9 A;  3O10 A;  4H54 A;  1M2V B;  3VYW A;  5F5F A;  1E86 A;  2OG2 A;  2Q9A A;  3EQL F;  4E7S A;  3KKB A;  1LE4 A;  4U9E A;  2ZPA A;  4PFO A;  1NBB A;  1C03 A;  2R7V A;  1T6U A;  1O87 A;  2XSE A;  3M1C B;  4FWV A;  3JSZ A;  4PK4 A;  2NUP A;  2R7T A;  4U5C E;  2QLA A;  3IQ6 A;  1TFK B;  5JSL A;  3LLI A;  4MW3 A;  5L0H A;  4BEJ A;  2EPL X;  3NMK A;  3ZQV A;  4AK9 A;  3O39 A;  4HE8 D;  5E2Q A;  1ZHX A;  3CAX A;  1XWJ A;  4CS8 A;  5A6J A;  1M57 C;  1QQ3 A;  3HNJ A;  4JEB A;  1H6G A;  1OXB A;  1OCZ C;  2QUP A;  1LVK A;  1QVX A;  2AU5 A;  2KQ9 A;  3LJB A;  4CDY A;  4O7G A;  3ZTZ A;  2O9X A;  3K66 A;  5E3C A;  4XTK A;  4XEF A;  1TQG A;  2Q7R A;  1BR1 A;  2OU6 A;  3PDM P;  5DQZ A;  2HKV A;  1G5Z A;  3HKK A;  3LS1 A;  4Q7C A;  4PJM A;  4DVY P;  4FAP B;  3R2P A;  3L8I A;  1C17 M;  2BL2 A;  4IWB A;  5BQG A;  3TOM A;  4MVM A;  2OKU A;  1OKK A;  3SEO A;  3SXY A;  3RQG A;  5KYX B;  5CI9 A;  1RXQ A;  3PMR A;  1QKR A;  4W8K A;  3DXJ F;  4KC9 A;  2G62 A;  1I4Z A;  4U5E E;  1OW7 A;  2MHR A;  3L1M A;  1VTM P;  2YL1 A;  3HTK C;  1IW7 F;  2KSF A;  1XZQ A;  1PCX A;  1FR0 A;  2PF4 E;  4MS2 A;  2X0C A;  1D1C A;  1JR8 A;  3EG9 A;  1JAF A;  4G7Z F;  3T6G B;  2OEX A;  3LNM B;  5FZT A;  1U0B B;  4N06 A;  1E85 A;  2L9J A;  2IXN A;  3GOR A;  2Y69 C;  3KMI A;  2HFI A;  1O5H A;  1YAU O;  5KYY A;  2XL8 A;  3MBG A;  1RKC A;  2J8W A;  1SYQ A;  2J7P A;  3GEI A;  1NLX A;  4EBB A;  2KW3 C;  3FVY A;  1N1C A;  2WVO A;  1D0Z A;  2NSG A;  5BUO A;  4LDK A;  3C63 A;  2A69 F;  2YKZ A;  1MMG A;  2VCB A;  1AEP A;  3EH2 A;  3K1H A;  1LE2 A;  3K7D A;  3IQC A;  2YLG A;  2YVK A;  4J30 B;  1M56 C;  5JS5 A;  5HSW A;  1JOG A;  2FGY A;  2ZXW C;  2D5R B;  3W2V A;  3FDQ A;  4MVQ A;  4U5D E;  3DE8 A;  5JVE A;  4YT8 A;  1L7C A;  2L6H A;  1ZHY A;  1OQC A;  256B A;  2EIK C;  2OOC A;  2XLV A;  2CGE A;  3B29 A;  1Q0M A;  2XLO A;  4IAQ A;  1H7I A;  1EKY A;  2EPK X;  4PJN A;  3UR3 C;  1R4T A;  1SR2 A;  3W2W A;  5D92 A;  4BJ5 C;  3MYF A;  2Q9B A;  3HLZ A;  3Q7L A;  4LAC B;  2J9V A;  4JZA A;  4CX9 A;  3EG9 B;  5FCL A;  3LEV A;  2Q9C A;  2W9Y A;  3CSK A;  2LCH A;  4ULV A;  1T01 A;  1SZI A;  2CW0 F;  5AGF A;  5AC5 A;  3AGU A;  3MLG A;  3RVZ A;  2VCC A;  4MTO A;  2EIJ C;  1VYK A;  4E17 A;  3ASN C;  2WZG A;  5JUA A;  3ZTM A;  4J7Y A;  5DLJ A;  3SZR A;  2PX0 A;  2L6G A;  5A6A A;  4P9T A;  3ZC4 A;  3GAN A;  3U5S A;  5F5H A;  5EHH A;  3W8I A;  1RJ9 A;  2WVQ A;  1BZ4 A;  3O6X A;  4C7O A;  3OA1 A;  4HFF B;  5HV9 A;  5L3V A;  1YAR O;  3EJN A;  1OW8 A;  1A41 A;  2W4B A;  4XWJ A;  2ZXP A;  1YVI A;  4FES A;  1V74 B;  5KYN A;  4MND A;  4DRJ B;  1NSG B;  2E87 A;  2Q4F A;  3JCU Q;  1WGW A;  2PX3 A;  3HJC A;  2WB7 A;  4NC3 A;  4U5H A;  2XLW A;  4EUK B;  2M64 A;  2JX0 A;  3VM6 A;  4OIQ F;  4JIO A;  1PD0 A;  3NMJ A;  1HMD A;  3RIP A;  3GM1 A;  2HUJ A;  2HV7 A;  4CIP A;  4XLN F;  2TMV P;  1IZM A;  3IHU A;  4G7H F;  1CPQ A;  3FXH A;  3TK0 A;  1MNE A;  1K40 A;  3O55 A;  5COM A;  2R05 A;  1KTM A;  1B68 A;  1RKE A;  1YZA A;  3GWN A;  1O3U A;  3M79 A;  3L34 A;  2ZD9 A;  1ZZP A;  1HE9 A;  3KYJ A;  1BR2 A;  2XLM A;  3M4C A;  4KNW A;  1Z63 A;  2EIN C;  3AGT A;  3EPV A;  2NUP B;  2KGO A;  4YL3 A;  4CSA C;  4KNV A;  4WGZ A;  3S9O A;  3TJ6 A;  3LLK A;  3FOP A;  3FOO A;  2CCY A;  3QMK A;  1GGQ A;  1ZU5 A;  4CS7 A;  4G7O F;  1FMV A;  1MND A;  3Q6M A;  2EPN A;  3T9O A;  1VLT A;  3WOD F;  2P0N A;  5GPG B;  4Z9J A;  3NMI A;  4PR9 A;  1Y6D A;  1M2V A;  4MW8 A;  3U3B A;  4ZLC A;  2ETS A;  1G8X A;  5A69 A;  1K04 A;  3AJM A;  2VAS A;  3DAG A;  3SNH A;  4RBN A;  3X1O A;  3U3F A;  1D0Y A;  4IRU A;  1T9K A;  2IM8 A;  3T6B A;  2VB6 A;  2H7O A;  3EGX B;  3N0T A;  3S28 A;  3K1I A;  4JRZ A;  3RFY A;  3CQZ A;  4YJW A;  4CS8 C;  3RVY A;  3G4Z A;  4EKW A;  2HS5 A;  3NRH A;  5TJ5 E;  4O79 A;  4EBJ A;  2F22 A;  3BRJ A;  3ZSU A;  5JRA A;  2R9R B;  1RCP A;  3KPH A;  1WOL A;  2YL7 A;  3NG1 A;  1YYJ A;  3ZG1 A;  5L0F A;  1Z5Z A;  4AE4 A;  3RF3 A;  4JJF A;  4YT4 A;  3IQ5 A;  2YZS A;  1DOV A;  1T6Q A;  3JT1 A;  4HEA J;  2EIL C;  3IPM O;  1A7V A;  1NFO A;  3DMD A;  4IB4 A;  4CS9 A;  3AG3 C;  5B3I A;  3HNK A;  3U0C A;  2R7O A;  1LS1 A;  2P1A A;  3QTH A;  3C8G D;  4DBQ A;  3S90 A;  2UUH A;  1RMV A;  2Q3T A;  1J8Y F;  4C3B A;  5E33 A;  1YLM A;  3NKE A;  5A6B D;  3EHN A;  2J9W A;  3TD7 A;  1JRA A;  1AVO B;  4GQH A;  3RKO F;  2LP4 A;  3N2Z B;  4CBE A;  5L0D A;  3G4X A;  3V5Z A;  1FAP B;  3EFO B;  4ULW A;  2ASR A;  5DVW A;  4DXW A;  2FFH A;  3DWW A;  1I4Y A;  4C3D A;  2M4E A;  3TOL A;  5JT4 A;  3ABM C;  3B9Q A;  4XEK A;  5L3Q A;  1HMO A;  2AWY A;  5BQI A;  1G4U S;  2WVN A;  4IJJ A;  2XLD A;  5A6B A;  4JUR I;  4CIH A;  2X51 A;  1G4W R;  3S27 A;  3DM5 A;  1TFO B;  2WZL A;  3FHD A;  2QNL A;  2XL4 A;  4AX2 A;  2YQY A;  3LUT B;  3S29 A;  3POV A;  3MYI A;  4QDL A;  3SXZ A;  1BDJ B;  2BC5 A;  4CDV A;  3VRC A;  3I5Q A;  1OR3 A;  3OEO A;  3QVZ A;  4EBK A;  1CGM E;  2R7W A;  4PJJ A;  4XLP F;  2YL0 A;  3AG4 C;  4E0H A;  1Q0D A;  5A6K A;  3ZVR A;  2XXA A;  2P7V A;  2HZ8 A;  4CDA A;  3V7O A;  4D4N A;  1KU2 A;  5JLI A;  2Y3H A;  2Z15 A;  3U9J A;  3B71 A;  3A11 A;  3FAJ A;  3KYI A;  2Y3B A;  1OCC C;  3PCV A;  4OIP F;  1YJG A;  3AG2 C;  3DZA A;  1WWP A;  4U5B E;  1LKX A;  3HNL A;  4OD4 A;  3V5X A;  4NQF A;  4U5G A;  2R03 A;  1ORY A;  2L81 A;  1BBH A;  1SMY F;  2R02 A;  2RSE B;  1VLS A;  3C62 A;  1GM5 A;  2L6F A;  2A6E F;  1CGN A;  1LI7 A;  4Z9H A;  4UDV A;  1R5I D;  1FMW A;  3Q6N A; 
#chains in the Genus database with same CATH homology
 4U9E A;  1M6T A;  2XLW A;  1NBB A;  4JE9 A;  3NMJ A;  1YZC A;  4CIP A;  5JP7 A;  1CPQ A;  2QLA A;  3IQ6 A;  5JSL A;  4D4X A;  1YZA A;  3M79 A;  3NMK A;  3ZQV A;  2XLM A;  3M4C A;  1E84 A;  1YYX A;  2XM0 A;  4CJO A;  1QQ3 A;  3HNJ A;  4JEB A;  1LM3 B;  4WGZ A;  3FOP A;  3FOO A;  2CCY A;  4CDY A;  3ZTZ A;  2YL3 A;  4ER9 A;  2XM4 A;  3NMI A;  2XLE A;  3QW1 A;  3M4B A;  1S05 A;  3TOM A;  4JEA A;  1GQA A;  1CPR A;  4N6H A;  4JKV A;  3L1M A;  5JRA A;  3QW0 A;  2YL1 A;  1RCP A;  2YLI A;  2YL7 A;  1YYJ A;  3IQ5 A;  4L6R A;  3ZWI A;  1JAF A;  1A7V A;  3HNI A;  4IB4 A;  5B3I A;  3M15 A;  3HNK A;  1E85 A;  2XL8 A;  2J8W A;  2XLH A;  3C63 A;  2YKZ A;  1MQV A;  5JT4 A;  3TOL A;  2YLG A;  5JS5 A;  2XLD A;  3DE8 A;  5JVE A;  4CJG A;  256B A;  1CGO A;  2XLV A;  2XLO A;  2BC5 A;  4CDV A;  4IAQ A;  3VRC A;  1EKY A;  4EIY A;  3QVZ A;  1E83 A;  2XL6 A;  4CX9 A;  2YL0 A;  1APC A;  3U8P A;  4ULV A;  4IAR A;  5AGF A;  3QVY A;  4CDA A;  2YLD A;  4D4N A;  5JLI A;  5JUA A;  3ZTM A;  1QPU A;  4N4W A;  4U9D A;  3DE9 A;  3HNL A;  2J9B A;  3ZQY A;  1BBH A;  4WGY A;  3C62 A;  1E86 A;  1CGN A;  4NC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...