3ZQVA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans at 0.84 a resolution: non-restrained refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAVQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3zqvA00
3DE9A 1CGNA 1EKYA 5JRAA 2XLMA 1E84A 3M15A 3IQ5A 4JEBA 2XM4A 3QW1A 1S05A 4WGZA 3ZQYA 4CDYA 2XLHA 2YL7A 4CIPA 5JS5A 5JUAA 1MQVA 5JP7A 3ZWIA 2YLGA 3FOOA 4JE9A 4JKVA 3QVZA 2XLWA 4CDAA 1CPRA 1YZCA 1YYXA 1E83A 3C63A 4WGYA 2CCYA 4JEAA 5JSLA 4CDVA 1LM3B 2XLEA 2XL6A 2XLDA 1NBBA 1GQAA 2YL1A 1JAFA 3NMKA 1QPUA 1YYJA 4IB4A 5B3IA 2XLVA 1CGOA 4U9DA 2J8WA 3HNIA 3HNLA 1E86A 4IARA 3DE8A 3NMIA 256BA 2QLAA 2YL0A 1QQ3A 3NMJA 1RCPA 4IAQA 3TOMA 2YLIA 2XL8A 3M4BA 3QW0A 3ZTZA 4N4WA 3M4CA 5JLIA 2YLDA 3TOLA 1YZAA 3HNJA 4U9EA 2BC5A 4ULVA 5AGFA 4D4XA 3FOPA 4L6RA 3L1MA 4NC3A 3U8PA 2XLOA 3HNKA 4CJGA 4ER9A 3ZQVA 1A7VA 1E85A 2YL3A 5JT4A 4D4NA 1CPQA 1M6TA 1APCA 3ZTMA 2YKZA 4N6HA 3M79A 3QVYA 4CJOA 4CX9A 3VRCA 2J9BA 2XM0A 4EIYA 5JVEA 1BBHA 3C62A 3IQ6A
chains in the Genus database with same CATH superfamily
3DE9A 4Q7CA 4N6CA 4RBNA 3TJ5A 3EGDB 3CSKA 3RIPA 4EKWA 3SXYA 3LJBA 2QUPA 3I5PA 4C3EA 2IBFA 3U0CA 4NTAA 1R4TA 2L7AA 4HE8D 2J0WA 3QZCA 4NY3A 5BQIA 3KYIA 2G62A 5A6BD 4RDAA 2I15A 2VC9A 4LERA 2X0CA 3QW1A 1H6GA 1K04A 2CGEA 2HJ3A 4CDYA 1FMVA 3ABKC 4OIPF 3G4XA 4CIPA 3FAPB 3SZRA 3LESA 1ORYA 4JKVA 2ZXWC 4U5HA 4U5BE 4E7ZA 1D1CA 2HV6A 4JURI 1CPRA 1YZCA 4MVOA 1VK5A 1E83A 1YARO 1NZEA 1BR2A 3EQLF 2JX0A 2KQ9A 2Q9AA 1Z5ZA 3EGXA 1OKKD 4WGYA 3GM2A 5L0IA 3JYHA 4G7ZF 3OWTA 2KK1A 4BJ1A 3DXJF 4CDVA 2VCAA 3K66A 2KW3C 1MMAA 1UG7A 1V74B 2W4BA 4C3DA 4EWCA 3U3FA 3RQGA 3EH2A 1T6IA 1NU7D 2XLDA 1ZW2A 1I4ZA 2EINC 1C17M 4QDLA 2XSEA 3ZVRA 1HE9A 3LNRA 5A6JA 3GODA 3S28A 4JVSA 2PBEA 3T6GB 1Z6AA 5L0DA 4O6YA 4JJFA 2J9UA 1LI5A 3T6JA 3JZ0A 3GANA 4BJ5C 4CS9C 4QI2A 1OW8A 2QY9A 3S0XA 1ZYRF 5DS6A 4YL0A 3FDQA 1RJ9B 4IAOA 3RQFA 4YT2A 2F22A 3NMIA 3B0UX 4MTFA 4FESA 4BEMJ 2P0NA 1PD0A 2OQMA 3JSEO 2EIJC 3ZC4A 2XXAB 1H7IA 1Q0FA 1WGWA 1MMDA 3KYJA 3GM3A 2YL0A 4YJWA 2M4EA 3JRMO 4MVRA 1A7EA 2HMZA 3CAXA 1OCZC 4XEKA 1CGME 2VASA 4JC7A 2AP3A 2C04A 2NG1A 3LEVA 3C8GD 1LIHA 5KYWA 2IYLD 1YZAA 1ORSC 1VMAA 1M2VA 5A6AA 1Z63A 2BC5A 4DBQA 4ULVA 5E33A 3ITFA 5HV9A 4Z9IA 1TFKB 3IHUA 3S9OA 3EZIA 4AE4B 4J32B 2Y3GA 2WVOA 2QNLA 4O79A 1C02A 2HSQA 5B1BC 3U8PA 3HNKA 1G8XA 1M2OA 4CJGA 2YZSA 2J7PD 3H2VA 4UDVA 3DAFA 4ER9A 1HE1A 2IOQA 3AOUA 5D92A 4P9TA 3ZQVA 2ICWG 3HTKC 5L3VA 4H4KC 4MNDA 4W8PA 4DXWA 2IXOA 1EA8A 1VB5A 3PHF2 3FMSA 2ZXPA 4P9FA 1ZHXA 2H7BA 3EHMA 3DD7A 4CX9A 3AQBA 3VRCA 4YT8A 1FAPB 1LVKA 4E18A 2YQYA 2M64A 3ABLC 1DOVA 4F4BA 4O7GA 2LK4A 1BBHA 3AJMA 3C62A 3VYWA 1OKKA 4BJ5A 4P6IC 1GGQA 4MVSA 3EJNA 4G7OF 5KYUA 4PK4A 2ETSA 1JPJA 2NUTB 3S90A 4G7HF 2Y3HA 2Y3BA 3EFOB 5CI8A 1WWPA 2YWAA 4E0IA 1YLMA 4HEAJ 1LKXA 4I1MA 3RW0A 1LS4A 4O6MA 4KNVA 3ASNC 2XLMA 3DI5A 3NKDA 4BJ6C 1BDJB 2H7VC 4BPMA 4HFKB 1NG1A 1JPNA 3JYYA 4JEBA 2UUHA 1W2WA 2KNHA 1RKEB 2WZGA 2XM4A 3ATPA 3FVYA 3I4UA 2YVKA 3NG1A 5A6KA 3K6BA 4WGZA 1NSGB 1MMNA 2J45A 2PNOA 2YL7A 3CQZA 3JRTA 5JS5A 5JUAA 5JP7A 3MX3A 3JT1A 1N1CA 3ZWIA 1TWGA 2YLGA 1G4US 3DKAA 5T1DB 1PCXA 1Q0GA 1V54C 1HW1A 3SXKA 2EIMC 2XLWA 2H7OA 4LLEA 4PJMA 5E3CA 1YYXA 2RSEB 1LI7A 2BE5F 4XPWA 3UGOA 3WAQA 2CCYA 1Z23A 3QMKA 1V55C 2EIKC 3Q7LA 4CS8C 2EPLX 5GPGB 2P6VA 3NDBB 3AG4C 4C7OA 3U9JA 1YA7O 3WODF 4KC9A 2C03A 4OIRF 3X2QC 2OG2A 2XLEA 1NBBA 2ZXOA 3C8GA 4LDQA 2OEVA 3G50A 1JAFA 3AG1C 4U5DE 2KC3A 4PFPA 1YYJA 1HMOA 3IQTA 4HFFB 4BEJA 4CS7A 1MMGA 3K1IC 2Y69C 1NFNA 1O3UA 1SF8A 1G4WR 3MLGA 4DJ9A 1ZW3A 5A69A 5HSWA 3SXMA 3DM5A 2TMVP 4CS9A 1QZXA 2R05A 4U5FE 3ZG1A 3HLZA 1OR3A 4KI2A 3G4ZA 1YVIA 3EH1A 2EPNA 2LD6A 3EGXB 1T01A 3H65A 1D0ZA 2OCCC 1ZHWA 3O10A 4JIOA 4YWQA 4MW8A 256BA 5T3TA 1WOLA 1T6UA 4LLCA 2L6FA 4MVUA 1NLXA 2QLAA 1A41A 1NU9C 1QKRA 4I44A 4J7YA 5DS4A 1QQ3A 3E9VA 3NMJA 2RD9A 2A69F 2HSBA 3SNHA 1G5ZA 1H9TA 5EHHA 3LEOA 4A2NB 4AK9A 3U9MA 4YL1A 3ZTZA 1IZMA 3Q7GA 4E17A 3M4CA 1QVXA 1KNYA 2GWWA 3NYJA 3TOLA 3WG7C 2GDCA 3L8IA 3RQEA 3HNJA 1A0BA 1FFTC 4JTCB 1SYQA 1TWHA 2J0XA 1OQCA 3KPHA 2KGOA 1T6QA 3GEEA 2LP4A 2PFDA 4R32A 4EBJA 5BUOA 2PX0A 2AWYA 4YK5A 4DRJB 3C7JA 2HMQA 3LLKA 3BRJA 3RKOF 4IJJA 4I1OB 3U2MA 2KSFA 3KMIA 2YRFA 2Q9CA 4K0DA 4DRIB 1J8MF 4O6NA 1FR0A 3JSZA 4U5GA 2R7TA 1D1BA 2AVKA 2YL3A 1E85A 4D4NA 4LACB 1CPQA 2DI3A 2Q9BA 3K7DA 2X51A 4C3BA 5L0FA 2QTVA 1S7ZA 2YKZA 5KYWB 3M79A 1JMWA 1M2VB 2O9XA 3O55A 3EG9A 4PFOA 4A4AA 5BQHA 1IW7F 1OXBA 2HV7A 1OCOC 2MYSA 3DJNB 2QE9A 3MYIA 3GEHA 4JJGA 4XLNF 1U89A 3K1HA 2J9BA 2XM0A 4EIYA 2Z15A 2PX3A 1YDIA 2GAQA 2EILC 2FGYA 1OW7A 2R9RB 3IQ6A 4GQHA 4PJJA 3W2VA 1XZPA 5L0HA 2A6EF 2W45A 1CGNA 3RFYA 1AVOB 2W9YA 3GM1A 1EKYA 2KYHA 4H54A 4X0RA 1LPEA 3O6XA 4MVMA 2IM8A 1HMDA 3DZAA 4M63A 4NTBA 3UMKA 4ZLCA 3RYLA 1JOGA 4BJ6A 4N06A 3U5SA 3V7OA 2G3VA 4JCZA 1U6HA 2WVNA 2NUPA 2WB7A 3O39A 3NYLA 3LNMB 1NFOA 1S05A 2WL8A 1KTMA 2HS5A 5L0JA 2P61A 4RD9A 1T5OA 3HJCA 4EHPA 2FFHA 2XLHA 1C03A 4YL3A 5EGYA 3B0VC 1MQVA 2D4UA 2DB4A 2LSEA 1ZU4A 1SZIA 4XPYA 4Z9HA 4JE9A 4IGGA 1L3PA 1FFHA 2D5RB 2R25A 4CDAA 3W8IA 4AL0A 4W8KA 5KYUB 3C63A 1VYKA 2XL4A 3ECSA 1M57C 4XLPF 1VLSA 1ST6A 1XZQA 3V5ZA 4CS8A 4XWJA 1A7DA 2DYSC 4JEAA 3M1CB 1PD1A 2R7WA 3TJ6A 2G3KA 1LM3B 5DS5A 2I8BA 3V5YA 2XL6A 1HW2A 1K40A 2YL1A 3NRHA 3T9OA 1ZHTA 2R7OA 1O87A 3LAYA 3WHNA 1H9GA 3K1IA 5L3QA 3K33A 1WTYA 3Q6NA 2CNWD 5L0CA 2HJMA 2XRHA 1BZ4A 2J46A 2XLVA 3EHNA 1Y4CA 3EPVA 3PCVA 4G0HA 4QI0A 4OD5A 4DVYP 2J8WA 3HNIA 2OKUA 1Z7Qc 3TQOA 4AX2A 3HNLA 2MWQA 5AC4A 4JW1A 4U5EE 2OOCA 3J06A 5BQGA 5KYYA 4MVZA 1AEPA 2L6GA 2ZPAA 3S27A 2HKVA 3W4YA 4C7OB 1WASA 2BL2A 2JPUA 2YEVA 3POVA 5L0GA 3RVZA 2HFIA 2KJGA 1I5NA 2Y3DA 1BR1A 1D0XA 1RCPA 3RH3A 3C8GB 4JCHA 3UMIA 3L8JA 4CSAC 1E2XA 3QW0A 3TULA 4WABA 3CZ6A 5KYXA 2UUIA 2A0BA 4LDKA 3TK0A 4K7BA 3N24A 2YLDA 2Q7RA 1RXQA 4CBEA 5AC5A 1Q0DA 4U9EA 1YJGA 3U8VA 3SXZA 2HUJA 4IRUA 4DVZA 3QTHA 2Y39A 4DBRA 3E70C 4BJTA 5CI9A 1OW6A 5AGFA 4ZLDA 4XEVA 3SP1A 1L7CA 1BR4A 3DJUB 4L6RA 4NC3A 3ZSUA 4YT4A 2J7PA 4OIOF 4YN0B 2WVQA 4U5CE 2LFFA 2R03A 3EGDA 2A1DD 3UNGC 4MQ9F 2CDQA 2DGJA 5B1AC 2L81A 1VOMA 1F1MA 1LE2A 4E7SA 4JZAA 5JT4A 2B0HA 4PACA 5DVWA 1M6TA 3ZTMA 2NSFA 1SR2A 2R7QA 3X1OA 4Q5SF 2OU6A 2W4MA 1FTSA 4N6HA 5F28E 3AQCA 3QVYA 1UFBA 2E87A 3NKEA 4CJOA 5DQZA 3C8ZA 4EBBA 5COFA 3BEHA 1OCCC 1R5ID 1T9KA 1LE4A 3OEOA 1K05A 4GYTA 4JRZA 4PJLA 1V4AA 3C18A 4ULWA 1QLEC 2IXPA 5E3AA 4OD4A 2NPUA 1ZZPA 3GORA 3W2WA 4FAPB 4K1OA 5K0IA 4LDRA 4EBKA 1JR8A 1TKNA 2ZD9A 3EZHA 1ZHZA 2FAPB 1MNEA 4OIQF 2V26A 2A0UA 4B6IA 2P7VA 3GEIA 2Q00A 2CYDA 1ZVZA 1HY5A 3VF0A 5TJ5E 1DOWA 1D1AA 5JRAA 1FMWA 1E84A 1TR2A 1ZU5A 2OJED 2CNWA 3UGPA 1OCRC 2DYRC 3M15A 1KU2A 2YHSA 3IQ5A 2PP4A 2A68F 2Q3TA 3EG9B 4NQFA 3L34A 2VB6A 3IQCA 2IXNA 2R02A 1Q0KA 3F46A 3ZQYA 3SEOA 2R7UA 3B29A 2L9JA 3KH2A 5B3SC 3S84A 3CEXA 2NSGA 4MVQA 3TD7A 1B68A 2VCBA 2LCHA 2ASRA 1AUEA 3FOOA 2GFHA 4MW3A 4Z9JA 3W8HA 2LFDA 3AG2C 3QVZA 4IWBA 1ZHYA 3IPMO 2EPKX 4YT5A 3RVYA 3ABMC 4XTKA 4JTAB 4XPXA 2ZXRA 1RJ9A 4KBLA 4FWVA 2P1AA 5JSLA 5CIVA 1VTMP 4E0HA 4I3MA 3I5QA 2R7VA 2XXAA 2WZFA 2R7RA 1TFOB 3AGUA 2NUPB 4DRHB 3F47A 3LUTB 4ANJA 2VH3A 3DAGA 1GQAA 3DM9B 5DQTA 2VCCA 2WZLA 1PV3A 1GS9A 2EPOA 4OINF 3RF3A 3NMKA 1QPUA 4JTDB 3MFNA 4IB4A 3V5XA 4CIHA 2L6HA 3U3BA 5B3IA 3DWWA 1CGOA 4U9DA 3NYMA 3Q6MA 3KL4A 1E86A 4J30B 2IXMA 4IARA 4MS2A 2R7SA 1J8YF 1EQ1A 1OR2A 2OJQA 3DE8A 5D91A 3FAJA 4AE4A 1LS1A 2A6HF 3UMHA 1MNDA 2XS1A 2LIGA 3OA1A 4XQ1A 3PMRA 4PR9A 4J7TA 5F5HA 4DOZA 3U2LA 2GA0A 2LQGA 3US6A 4IAQA 1FNTc 2J9VA 2J9WA 5FCLA 3ASOC 3TOMA 4CSAA 2YLIA 4NTFA 2XL8A 1U0BB 1YAUO 2XS8A 1O5HA 3M4BA 1WATA 2Q4FA 3HKKA 3N0TA 5COMA 4N4WA 2V3CC 5A6BA 3H2UA 4ONSA 1M56C 4GEHA 1TWAA 5JLIA 3T6BA 2AWCA 1Y6DA 4MTGA 5KYNA 3FXHA 5FZTA 3MYFA 3GWNA 2JD3A 3R7CA 5F5FA 1RMVA 3DMDA 4D4XA 5COGA 5KYYB 1Z3IX 3B9QA 4KNWA 1VLTA 3FOPA 5E2QA 3UR3C 3L1MA 1YA9A 3VAYA 5IY5C 1WN0A 1I4YA 2B0JA 3A9CA 1ORJA 1D0YA 3LLIA 4FX5A 5EK0A 2XLOA 4Q4ZF 1TWCA 1JRAA 1SMYF 2NUTA 4AL1A 1RKCA 1QSPA 2MHRA 3GWLA 4WJ0A 3T4RA 3EFOA 3ZDLA 3L0IA 1VYIA 3MBGA 2AU5A 3AGTA 4NCQA 1XWJA 4MTOA 4BG0A 1A7VA 2PF4E 3JCUQ 3A11A 1TQGA 3KKBA 3B0PA 3IEEA 1APCA 5KYXB 4XEFA 4G78A 2CW0F 2EPMX 2HZ8A 2OEXA 1OXKA 1Q0MA 3B71A 1RKEA 3R2PA 4PJNA 3LS0A 3LS1A 3S29A 3VM6A 1GM5A 3SYNA 2H8AA 3JTLO 3AG3C 3FHDA 2R7XA 3ZIBA 4EUKB 5DLJA 3PDMP 5JVEA 5T3WA 1EI7A 3N2ZB
chains in the Genus database with same CATH topology
3DE9A 1CGNA 1EKYA 5JRAA 2XLMA 1E84A 3M15A 3IQ5A 4JEBA 2XM4A 3QW1A 1S05A 4WGZA 3ZQYA 4CDYA 2XLHA 2YL7A 4CIPA 5JS5A 5JUAA 1MQVA 5JP7A 3ZWIA 2YLGA 3FOOA 4JE9A 4JKVA 3QVZA 2XLWA 4CDAA 1CPRA 1YZCA 1YYXA 1E83A 3C63A 4WGYA 2CCYA 4JEAA 5JSLA 4CDVA 1LM3B 2XLEA 2XL6A 2XLDA 1NBBA 1GQAA 2YL1A 1JAFA 3NMKA 1QPUA 1YYJA 4IB4A 5B3IA 2XLVA 1CGOA 4U9DA 2J8WA 3HNIA 3HNLA 1E86A 4IARA 3DE8A 3NMIA 256BA 2QLAA 2YL0A 1QQ3A 3NMJA 1RCPA 4IAQA 3TOMA 2YLIA 2XL8A 3M4BA 3QW0A 3ZTZA 4N4WA 3M4CA 5JLIA 2YLDA 3TOLA 1YZAA 3HNJA 4U9EA 2BC5A 4ULVA 5AGFA 4D4XA 3FOPA 4L6RA 3L1MA 4NC3A 3U8PA 2XLOA 3HNKA 4CJGA 4ER9A 3ZQVA 1A7VA 1E85A 2YL3A 5JT4A 4D4NA 1CPQA 1M6TA 1APCA 3ZTMA 2YKZA 4N6HA 3M79A 3QVYA 4CJOA 4CX9A 3VRCA 2J9BA 2XM0A 4EIYA 5JVEA 1BBHA 3C62A 3IQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DE9 A;  1CGN A;  1EKY A;  5JRA A;  2XLM A;  1E84 A;  3M15 A;  3IQ5 A;  4JEB A;  2XM4 A;  3QW1 A;  1S05 A;  4WGZ A;  3ZQY A;  4CDY A;  2XLH A;  2YL7 A;  4CIP A;  5JS5 A;  5JUA A;  1MQV A;  5JP7 A;  3ZWI A;  2YLG A;  3FOO A;  4JE9 A;  4JKV A;  3QVZ A;  2XLW A;  4CDA A;  1CPR A;  1YZC A;  1YYX A;  1E83 A;  3C63 A;  4WGY A;  2CCY A;  4JEA A;  5JSL A;  4CDV A;  1LM3 B;  2XLE A;  2XL6 A;  2XLD A;  1NBB A;  1GQA A;  2YL1 A;  1JAF A;  3NMK A;  1QPU A;  1YYJ A;  4IB4 A;  5B3I A;  2XLV A;  1CGO A;  4U9D A;  2J8W A;  3HNI A;  3HNL A;  1E86 A;  4IAR A;  3DE8 A;  3NMI A;  256B A;  2QLA A;  2YL0 A;  1QQ3 A;  3NMJ A;  1RCP A;  4IAQ A;  3TOM A;  2YLI A;  2XL8 A;  3M4B A;  3QW0 A;  3ZTZ A;  4N4W A;  3M4C A;  5JLI A;  2YLD A;  3TOL A;  1YZA A;  3HNJ A;  4U9E A;  2BC5 A;  4ULV A;  5AGF A;  4D4X A;  3FOP A;  4L6R A;  3L1M A;  4NC3 A;  3U8P A;  2XLO A;  3HNK A;  4CJG A;  4ER9 A;  3ZQV A;  1A7V A;  1E85 A;  2YL3 A;  5JT4 A;  4D4N A;  1CPQ A;  1M6T A;  1APC A;  3ZTM A;  2YKZ A;  4N6H A;  3M79 A;  3QVY A;  4CJO A;  4CX9 A;  3VRC A;  2J9B A;  2XM0 A;  4EIY A;  5JVE A;  1BBH A;  3C62 A;  3IQ6 A; 
#chains in the Genus database with same CATH topology
 3DE9 A;  4Q7C A;  4N6C A;  4RBN A;  3TJ5 A;  3EGD B;  3CSK A;  3RIP A;  4EKW A;  3SXY A;  3LJB A;  2QUP A;  3I5P A;  4C3E A;  2IBF A;  3U0C A;  4NTA A;  1R4T A;  2L7A A;  4HE8 D;  2J0W A;  3QZC A;  4NY3 A;  5BQI A;  3KYI A;  2G62 A;  5A6B D;  4RDA A;  2I15 A;  2VC9 A;  4LER A;  2X0C A;  3QW1 A;  1H6G A;  1K04 A;  2CGE A;  2HJ3 A;  4CDY A;  1FMV A;  3ABK C;  4OIP F;  3G4X A;  4CIP A;  3FAP B;  3SZR A;  3LES A;  1ORY A;  4JKV A;  2ZXW C;  4U5H A;  4U5B E;  4E7Z A;  1D1C A;  2HV6 A;  4JUR I;  1CPR A;  1YZC A;  4MVO A;  1VK5 A;  1E83 A;  1YAR O;  1NZE A;  1BR2 A;  3EQL F;  2JX0 A;  2KQ9 A;  2Q9A A;  1Z5Z A;  3EGX A;  1OKK D;  4WGY A;  3GM2 A;  5L0I A;  3JYH A;  4G7Z F;  3OWT A;  2KK1 A;  4BJ1 A;  3DXJ F;  4CDV A;  2VCA A;  3K66 A;  2KW3 C;  1MMA A;  1UG7 A;  1V74 B;  2W4B A;  4C3D A;  4EWC A;  3U3F A;  3RQG A;  3EH2 A;  1T6I A;  1NU7 D;  2XLD A;  1ZW2 A;  1I4Z A;  2EIN C;  1C17 M;  4QDL A;  2XSE A;  3ZVR A;  1HE9 A;  3LNR A;  5A6J A;  3GOD A;  3S28 A;  4JVS A;  2PBE A;  3T6G B;  1Z6A A;  5L0D A;  4O6Y A;  4JJF A;  2J9U A;  1LI5 A;  3T6J A;  3JZ0 A;  3GAN A;  4BJ5 C;  4CS9 C;  4QI2 A;  1OW8 A;  2QY9 A;  3S0X A;  1ZYR F;  5DS6 A;  4YL0 A;  3FDQ A;  1RJ9 B;  4IAO A;  3RQF A;  4YT2 A;  2F22 A;  3NMI A;  3B0U X;  4MTF A;  4FES A;  4BEM J;  2P0N A;  1PD0 A;  2OQM A;  3JSE O;  2EIJ C;  3ZC4 A;  2XXA B;  1H7I A;  1Q0F A;  1WGW A;  1MMD A;  3KYJ A;  3GM3 A;  2YL0 A;  4YJW A;  2M4E A;  3JRM O;  4MVR A;  1A7E A;  2HMZ A;  3CAX A;  1OCZ C;  4XEK A;  1CGM E;  2VAS A;  4JC7 A;  2AP3 A;  2C04 A;  2NG1 A;  3LEV A;  3C8G D;  1LIH A;  5KYW A;  2IYL D;  1YZA A;  1ORS C;  1VMA A;  1M2V A;  5A6A A;  1Z63 A;  2BC5 A;  4DBQ A;  4ULV A;  5E33 A;  3ITF A;  5HV9 A;  4Z9I A;  1TFK B;  3IHU A;  3S9O A;  3EZI A;  4AE4 B;  4J32 B;  2Y3G A;  2WVO A;  2QNL A;  4O79 A;  1C02 A;  2HSQ A;  5B1B C;  3U8P A;  3HNK A;  1G8X A;  1M2O A;  4CJG A;  2YZS A;  2J7P D;  3H2V A;  4UDV A;  3DAF A;  4ER9 A;  1HE1 A;  2IOQ A;  3AOU A;  5D92 A;  4P9T A;  3ZQV A;  2ICW G;  3HTK C;  5L3V A;  4H4K C;  4MND A;  4W8P A;  4DXW A;  2IXO A;  1EA8 A;  1VB5 A;  3PHF 2;  3FMS A;  2ZXP A;  4P9F A;  1ZHX A;  2H7B A;  3EHM A;  3DD7 A;  4CX9 A;  3AQB A;  3VRC A;  4YT8 A;  1FAP B;  1LVK A;  4E18 A;  2YQY A;  2M64 A;  3ABL C;  1DOV A;  4F4B A;  4O7G A;  2LK4 A;  1BBH A;  3AJM A;  3C62 A;  3VYW A;  1OKK A;  4BJ5 A;  4P6I C;  1GGQ A;  4MVS A;  3EJN A;  4G7O F;  5KYU A;  4PK4 A;  2ETS A;  1JPJ A;  2NUT B;  3S90 A;  4G7H F;  2Y3H A;  2Y3B A;  3EFO B;  5CI8 A;  1WWP A;  2YWA A;  4E0I A;  1YLM A;  4HEA J;  1LKX A;  4I1M A;  3RW0 A;  1LS4 A;  4O6M A;  4KNV A;  3ASN C;  2XLM A;  3DI5 A;  3NKD A;  4BJ6 C;  1BDJ B;  2H7V C;  4BPM A;  4HFK B;  1NG1 A;  1JPN A;  3JYY A;  4JEB A;  2UUH A;  1W2W A;  2KNH A;  1RKE B;  2WZG A;  2XM4 A;  3ATP A;  3FVY A;  3I4U A;  2YVK A;  3NG1 A;  5A6K A;  3K6B A;  4WGZ A;  1NSG B;  1MMN A;  2J45 A;  2PNO A;  2YL7 A;  3CQZ A;  3JRT A;  5JS5 A;  5JUA A;  5JP7 A;  3MX3 A;  3JT1 A;  1N1C A;  3ZWI A;  1TWG A;  2YLG A;  1G4U S;  3DKA A;  5T1D B;  1PCX A;  1Q0G A;  1V54 C;  1HW1 A;  3SXK A;  2EIM C;  2XLW A;  2H7O A;  4LLE A;  4PJM A;  5E3C A;  1YYX A;  2RSE B;  1LI7 A;  2BE5 F;  4XPW A;  3UGO A;  3WAQ A;  2CCY A;  1Z23 A;  3QMK A;  1V55 C;  2EIK C;  3Q7L A;  4CS8 C;  2EPL X;  5GPG B;  2P6V A;  3NDB B;  3AG4 C;  4C7O A;  3U9J A;  1YA7 O;  3WOD F;  4KC9 A;  2C03 A;  4OIR F;  3X2Q C;  2OG2 A;  2XLE A;  1NBB A;  2ZXO A;  3C8G A;  4LDQ A;  2OEV A;  3G50 A;  1JAF A;  3AG1 C;  4U5D E;  2KC3 A;  4PFP A;  1YYJ A;  1HMO A;  3IQT A;  4HFF B;  4BEJ A;  4CS7 A;  1MMG A;  3K1I C;  2Y69 C;  1NFN A;  1O3U A;  1SF8 A;  1G4W R;  3MLG A;  4DJ9 A;  1ZW3 A;  5A69 A;  5HSW A;  3SXM A;  3DM5 A;  2TMV P;  4CS9 A;  1QZX A;  2R05 A;  4U5F E;  3ZG1 A;  3HLZ A;  1OR3 A;  4KI2 A;  3G4Z A;  1YVI A;  3EH1 A;  2EPN A;  2LD6 A;  3EGX B;  1T01 A;  3H65 A;  1D0Z A;  2OCC C;  1ZHW A;  3O10 A;  4JIO A;  4YWQ A;  4MW8 A;  256B A;  5T3T A;  1WOL A;  1T6U A;  4LLC A;  2L6F A;  4MVU A;  1NLX A;  2QLA A;  1A41 A;  1NU9 C;  1QKR A;  4I44 A;  4J7Y A;  5DS4 A;  1QQ3 A;  3E9V A;  3NMJ A;  2RD9 A;  2A69 F;  2HSB A;  3SNH A;  1G5Z A;  1H9T A;  5EHH A;  3LEO A;  4A2N B;  4AK9 A;  3U9M A;  4YL1 A;  3ZTZ A;  1IZM A;  3Q7G A;  4E17 A;  3M4C A;  1QVX A;  1KNY A;  2GWW A;  3NYJ A;  3TOL A;  3WG7 C;  2GDC A;  3L8I A;  3RQE A;  3HNJ A;  1A0B A;  1FFT C;  4JTC B;  1SYQ A;  1TWH A;  2J0X A;  1OQC A;  3KPH A;  2KGO A;  1T6Q A;  3GEE A;  2LP4 A;  2PFD A;  4R32 A;  4EBJ A;  5BUO A;  2PX0 A;  2AWY A;  4YK5 A;  4DRJ B;  3C7J A;  2HMQ A;  3LLK A;  3BRJ A;  3RKO F;  4IJJ A;  4I1O B;  3U2M A;  2KSF A;  3KMI A;  2YRF A;  2Q9C A;  4K0D A;  4DRI B;  1J8M F;  4O6N A;  1FR0 A;  3JSZ A;  4U5G A;  2R7T A;  1D1B A;  2AVK A;  2YL3 A;  1E85 A;  4D4N A;  4LAC B;  1CPQ A;  2DI3 A;  2Q9B A;  3K7D A;  2X51 A;  4C3B A;  5L0F A;  2QTV A;  1S7Z A;  2YKZ A;  5KYW B;  3M79 A;  1JMW A;  1M2V B;  2O9X A;  3O55 A;  3EG9 A;  4PFO A;  4A4A A;  5BQH A;  1IW7 F;  1OXB A;  2HV7 A;  1OCO C;  2MYS A;  3DJN B;  2QE9 A;  3MYI A;  3GEH A;  4JJG A;  4XLN F;  1U89 A;  3K1H A;  2J9B A;  2XM0 A;  4EIY A;  2Z15 A;  2PX3 A;  1YDI A;  2GAQ A;  2EIL C;  2FGY A;  1OW7 A;  2R9R B;  3IQ6 A;  4GQH A;  4PJJ A;  3W2V A;  1XZP A;  5L0H A;  2A6E F;  2W45 A;  1CGN A;  3RFY A;  1AVO B;  2W9Y A;  3GM1 A;  1EKY A;  2KYH A;  4H54 A;  4X0R A;  1LPE A;  3O6X A;  4MVM A;  2IM8 A;  1HMD A;  3DZA A;  4M63 A;  4NTB A;  3UMK A;  4ZLC A;  3RYL A;  1JOG A;  4BJ6 A;  4N06 A;  3U5S A;  3V7O A;  2G3V A;  4JCZ A;  1U6H A;  2WVN A;  2NUP A;  2WB7 A;  3O39 A;  3NYL A;  3LNM B;  1NFO A;  1S05 A;  2WL8 A;  1KTM A;  2HS5 A;  5L0J A;  2P61 A;  4RD9 A;  1T5O A;  3HJC A;  4EHP A;  2FFH A;  2XLH A;  1C03 A;  4YL3 A;  5EGY A;  3B0V C;  1MQV A;  2D4U A;  2DB4 A;  2LSE A;  1ZU4 A;  1SZI A;  4XPY A;  4Z9H A;  4JE9 A;  4IGG A;  1L3P A;  1FFH A;  2D5R B;  2R25 A;  4CDA A;  3W8I A;  4AL0 A;  4W8K A;  5KYU B;  3C63 A;  1VYK A;  2XL4 A;  3ECS A;  1M57 C;  4XLP F;  1VLS A;  1ST6 A;  1XZQ A;  3V5Z A;  4CS8 A;  4XWJ A;  1A7D A;  2DYS C;  4JEA A;  3M1C B;  1PD1 A;  2R7W A;  3TJ6 A;  2G3K A;  1LM3 B;  5DS5 A;  2I8B A;  3V5Y A;  2XL6 A;  1HW2 A;  1K40 A;  2YL1 A;  3NRH A;  3T9O A;  1ZHT A;  2R7O A;  1O87 A;  3LAY A;  3WHN A;  1H9G A;  3K1I A;  5L3Q A;  3K33 A;  1WTY A;  3Q6N A;  2CNW D;  5L0C A;  2HJM A;  2XRH A;  1BZ4 A;  2J46 A;  2XLV A;  3EHN A;  1Y4C A;  3EPV A;  3PCV A;  4G0H A;  4QI0 A;  4OD5 A;  4DVY P;  2J8W A;  3HNI A;  2OKU A;  1Z7Q c;  3TQO A;  4AX2 A;  3HNL A;  2MWQ A;  5AC4 A;  4JW1 A;  4U5E E;  2OOC A;  3J06 A;  5BQG A;  5KYY A;  4MVZ A;  1AEP A;  2L6G A;  2ZPA A;  3S27 A;  2HKV A;  3W4Y A;  4C7O B;  1WAS A;  2BL2 A;  2JPU A;  2YEV A;  3POV A;  5L0G A;  3RVZ A;  2HFI A;  2KJG A;  1I5N A;  2Y3D A;  1BR1 A;  1D0X A;  1RCP A;  3RH3 A;  3C8G B;  4JCH A;  3UMI A;  3L8J A;  4CSA C;  1E2X A;  3QW0 A;  3TUL A;  4WAB A;  3CZ6 A;  5KYX A;  2UUI A;  2A0B A;  4LDK A;  3TK0 A;  4K7B A;  3N24 A;  2YLD A;  2Q7R A;  1RXQ A;  4CBE A;  5AC5 A;  1Q0D A;  4U9E A;  1YJG A;  3U8V A;  3SXZ A;  2HUJ A;  4IRU A;  4DVZ A;  3QTH A;  2Y39 A;  4DBR A;  3E70 C;  4BJT A;  5CI9 A;  1OW6 A;  5AGF A;  4ZLD A;  4XEV A;  3SP1 A;  1L7C A;  1BR4 A;  3DJU B;  4L6R A;  4NC3 A;  3ZSU A;  4YT4 A;  2J7P A;  4OIO F;  4YN0 B;  2WVQ A;  4U5C E;  2LFF A;  2R03 A;  3EGD A;  2A1D D;  3UNG C;  4MQ9 F;  2CDQ A;  2DGJ A;  5B1A C;  2L81 A;  1VOM A;  1F1M A;  1LE2 A;  4E7S A;  4JZA A;  5JT4 A;  2B0H A;  4PAC A;  5DVW A;  1M6T A;  3ZTM A;  2NSF A;  1SR2 A;  2R7Q A;  3X1O A;  4Q5S F;  2OU6 A;  2W4M A;  1FTS A;  4N6H A;  5F28 E;  3AQC A;  3QVY A;  1UFB A;  2E87 A;  3NKE A;  4CJO A;  5DQZ A;  3C8Z A;  4EBB A;  5COF A;  3BEH A;  1OCC C;  1R5I D;  1T9K A;  1LE4 A;  3OEO A;  1K05 A;  4GYT A;  4JRZ A;  4PJL A;  1V4A A;  3C18 A;  4ULW A;  1QLE C;  2IXP A;  5E3A A;  4OD4 A;  2NPU A;  1ZZP A;  3GOR A;  3W2W A;  4FAP B;  4K1O A;  5K0I A;  4LDR A;  4EBK A;  1JR8 A;  1TKN A;  2ZD9 A;  3EZH A;  1ZHZ A;  2FAP B;  1MNE A;  4OIQ F;  2V26 A;  2A0U A;  4B6I A;  2P7V A;  3GEI A;  2Q00 A;  2CYD A;  1ZVZ A;  1HY5 A;  3VF0 A;  5TJ5 E;  1DOW A;  1D1A A;  5JRA A;  1FMW A;  1E84 A;  1TR2 A;  1ZU5 A;  2OJE D;  2CNW A;  3UGP A;  1OCR C;  2DYR C;  3M15 A;  1KU2 A;  2YHS A;  3IQ5 A;  2PP4 A;  2A68 F;  2Q3T A;  3EG9 B;  4NQF A;  3L34 A;  2VB6 A;  3IQC A;  2IXN A;  2R02 A;  1Q0K A;  3F46 A;  3ZQY A;  3SEO A;  2R7U A;  3B29 A;  2L9J A;  3KH2 A;  5B3S C;  3S84 A;  3CEX A;  2NSG A;  4MVQ A;  3TD7 A;  1B68 A;  2VCB A;  2LCH A;  2ASR A;  1AUE A;  3FOO A;  2GFH A;  4MW3 A;  4Z9J A;  3W8H A;  2LFD A;  3AG2 C;  3QVZ A;  4IWB A;  1ZHY A;  3IPM O;  2EPK X;  4YT5 A;  3RVY A;  3ABM C;  4XTK A;  4JTA B;  4XPX A;  2ZXR A;  1RJ9 A;  4KBL A;  4FWV A;  2P1A A;  5JSL A;  5CIV A;  1VTM P;  4E0H A;  4I3M A;  3I5Q A;  2R7V A;  2XXA A;  2WZF A;  2R7R A;  1TFO B;  3AGU A;  2NUP B;  4DRH B;  3F47 A;  3LUT B;  4ANJ A;  2VH3 A;  3DAG A;  1GQA A;  3DM9 B;  5DQT A;  2VCC A;  2WZL A;  1PV3 A;  1GS9 A;  2EPO A;  4OIN F;  3RF3 A;  3NMK A;  1QPU A;  4JTD B;  3MFN A;  4IB4 A;  3V5X A;  4CIH A;  2L6H A;  3U3B A;  5B3I A;  3DWW A;  1CGO A;  4U9D A;  3NYM A;  3Q6M A;  3KL4 A;  1E86 A;  4J30 B;  2IXM A;  4IAR A;  4MS2 A;  2R7S A;  1J8Y F;  1EQ1 A;  1OR2 A;  2OJQ A;  3DE8 A;  5D91 A;  3FAJ A;  4AE4 A;  1LS1 A;  2A6H F;  3UMH A;  1MND A;  2XS1 A;  2LIG A;  3OA1 A;  4XQ1 A;  3PMR A;  4PR9 A;  4J7T A;  5F5H A;  4DOZ A;  3U2L A;  2GA0 A;  2LQG A;  3US6 A;  4IAQ A;  1FNT c;  2J9V A;  2J9W A;  5FCL A;  3ASO C;  3TOM A;  4CSA A;  2YLI A;  4NTF A;  2XL8 A;  1U0B B;  1YAU O;  2XS8 A;  1O5H A;  3M4B A;  1WAT A;  2Q4F A;  3HKK A;  3N0T A;  5COM A;  4N4W A;  2V3C C;  5A6B A;  3H2U A;  4ONS A;  1M56 C;  4GEH A;  1TWA A;  5JLI A;  3T6B A;  2AWC A;  1Y6D A;  4MTG A;  5KYN A;  3FXH A;  5FZT A;  3MYF A;  3GWN A;  2JD3 A;  3R7C A;  5F5F A;  1RMV A;  3DMD A;  4D4X A;  5COG A;  5KYY B;  1Z3I X;  3B9Q A;  4KNW A;  1VLT A;  3FOP A;  5E2Q A;  3UR3 C;  3L1M A;  1YA9 A;  3VAY A;  5IY5 C;  1WN0 A;  1I4Y A;  2B0J A;  3A9C A;  1ORJ A;  1D0Y A;  3LLI A;  4FX5 A;  5EK0 A;  2XLO A;  4Q4Z F;  1TWC A;  1JRA A;  1SMY F;  2NUT A;  4AL1 A;  1RKC A;  1QSP A;  2MHR A;  3GWL A;  4WJ0 A;  3T4R A;  3EFO A;  3ZDL A;  3L0I A;  1VYI A;  3MBG A;  2AU5 A;  3AGT A;  4NCQ A;  1XWJ A;  4MTO A;  4BG0 A;  1A7V A;  2PF4 E;  3JCU Q;  3A11 A;  1TQG A;  3KKB A;  3B0P A;  3IEE A;  1APC A;  5KYX B;  4XEF A;  4G78 A;  2CW0 F;  2EPM X;  2HZ8 A;  2OEX A;  1OXK A;  1Q0M A;  3B71 A;  1RKE A;  3R2P A;  4PJN A;  3LS0 A;  3LS1 A;  3S29 A;  3VM6 A;  1GM5 A;  3SYN A;  2H8A A;  3JTL O;  3AG3 C;  3FHD A;  2R7X A;  3ZIB A;  4EUK B;  5DLJ A;  3PDM P;  5JVE A;  5T3W A;  1EI7 A;  3N2Z B; 
#chains in the Genus database with same CATH homology
 3DE9 A;  1CGN A;  1EKY A;  5JRA A;  2XLM A;  1E84 A;  3M15 A;  3IQ5 A;  4JEB A;  2XM4 A;  3QW1 A;  1S05 A;  4WGZ A;  3ZQY A;  4CDY A;  2XLH A;  2YL7 A;  4CIP A;  5JS5 A;  5JUA A;  1MQV A;  5JP7 A;  3ZWI A;  2YLG A;  3FOO A;  4JE9 A;  4JKV A;  3QVZ A;  2XLW A;  4CDA A;  1CPR A;  1YZC A;  1YYX A;  1E83 A;  3C63 A;  4WGY A;  2CCY A;  4JEA A;  5JSL A;  4CDV A;  1LM3 B;  2XLE A;  2XL6 A;  2XLD A;  1NBB A;  1GQA A;  2YL1 A;  1JAF A;  3NMK A;  1QPU A;  1YYJ A;  4IB4 A;  5B3I A;  2XLV A;  1CGO A;  4U9D A;  2J8W A;  3HNI A;  3HNL A;  1E86 A;  4IAR A;  3DE8 A;  3NMI A;  256B A;  2QLA A;  2YL0 A;  1QQ3 A;  3NMJ A;  1RCP A;  4IAQ A;  3TOM A;  2YLI A;  2XL8 A;  3M4B A;  3QW0 A;  3ZTZ A;  4N4W A;  3M4C A;  5JLI A;  2YLD A;  3TOL A;  1YZA A;  3HNJ A;  4U9E A;  2BC5 A;  4ULV A;  5AGF A;  4D4X A;  3FOP A;  4L6R A;  3L1M A;  4NC3 A;  3U8P A;  2XLO A;  3HNK A;  4CJG A;  4ER9 A;  3ZQV A;  1A7V A;  1E85 A;  2YL3 A;  5JT4 A;  4D4N A;  1CPQ A;  1M6T A;  1APC A;  3ZTM A;  2YKZ A;  4N6H A;  3M79 A;  3QVY A;  4CJO A;  4CX9 A;  3VRC A;  2J9B A;  2XM0 A;  4EIY A;  5JVE A;  1BBH A;  3C62 A;  3IQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...