3ZQVA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans at 0.84 a resolution: non-restrained refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAVQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3zqvA00
3HNLA 4L6RA 256BA 3QW0A 4CX9A 4CDVA 4IAQA 3DE9A 2XLMA 3ZQVA 4EIYA 4IARA 3U8PA 1E85A 2XLHA 2YL0A 2YLGA 5JP7A 2YL7A 1S05A 1RCPA 5JVEA 4N6HA 3ZWIA 1YZCA 3NMKA 1E86A 4ULVA 4CIPA 3HNJA 4U9DA 1JAFA 1BBHA 2XLDA 4D4NA 4D4XA 4JE9A 5JS5A 2XLEA 4CJGA 3NMJA 4JEAA 5JT4A 2YLIA 3NMIA 3HNKA 1E84A 3ZTZA 1APCA 1NBBA 3TOMA 4N4WA 3FOOA 2QLAA 3DE8A 2YLDA 3M79A 1LM3B 1QPUA 3C62A 2YKZA 1MQVA 5JUAA 5B3IA 3L1MA 2XLOA 4CJOA 1YYJA 1CGOA 3VRCA 1CPQA 3QW1A 5JLIA 4CDYA 1GQAA 4U9EA 2XL8A 1EKYA 3QVYA 4NC3A 2YL3A 2XLVA 3M15A 5JRAA 1E83A 3IQ6A 3IQ5A 3HNIA 1YZAA 4JEBA 4CDAA 4JKVA 3ZQYA 3QVZA 5JSLA 1YYXA 1A7VA 1QQ3A 3ZTMA 4IB4A 1M6TA 4WGZA 3C63A 2XM4A 2XLWA 1CPRA 1CGNA 2CCYA 3M4BA 2BC5A 4ER9A 5AGFA 2XM0A 2YL1A 4WGYA 2J8WA 2J9BA 2XL6A 3M4CA 3FOPA 3TOLA
chains in the Genus database with same CATH superfamily
2WVNA 5L3QA 1JR8A 1LE2A 2PF4E 5F5HA 1RJ9A 2HSBA 1ZHXA 1VB5A 4CSAA 2L6FA 3FAPB 4GEHA 1D1CA 3FVYA 4OIPF 3Q6NA 4NTFA 1Y4CA 1NZEA 1U0BB 1OXBA 2XLHA 3SZRA 4JJGA 2M4EA 5A6BD 1EI7A 3K33A 5JP7A 3NYMA 5L0IA 2LP4A 2R7UA 1G5ZA 1NLXA 1PV3A 2CGEA 1T6UA 4NTBA 3N2ZB 3FMSA 3NMKA 1E86A 2OJED 4KNVA 5B1AC 3RVYA 3VAYA 1BR4A 2HS5A 2HMZA 2LFDA 4ULWA 4C3DA 4CIPA 3S29A 4PR9A 3G50A 4PJNA 3DM9B 4D4XA 4CS9C 4DBRA 5KYNA 4P9FA 2DGJA 2R02A 4O6YA 5COGA 2H7OA 4JVSA 4PJLA 1FNTc 4PJJA 1OW8A 1NFOA 3NG1A 4MW3A 2ZD9A 1FFHA 3DWWA 3NMJA 5BUOA 3EZHA 1RKCA 1IW7F 1H7IA 3MYIA 1WASA 5JT4A 4MNDA 2WVQA 4RDAA 5T3TA 1W2WA 2W4MA 3RQEA 3SXZA 2AP3A 3T6JA 2GAQA 2J0WA 4LLCA 4YL3A 3DKAA 2FGYA 3TOMA 3N0TA 3VYWA 3S27A 5AC5A 4LDRA 3WODF 1Z5ZA 1UFBA 2Q9BA 2ETSA 1L3PA 1SMYF 2PBEA 2EILC 2QLAA 3DE8A 2YQYA 4DRJB 3U0CA 1H6GA 3M79A 3SP1A 1AEPA 3C62A 3POVA 3RQGA 4KC9A 3OWTA 3NYLA 1JRAA 4GYTA 4QI0A 4XWJA 2XLOA 1I4YA 1ZZPA 1M2OA 3I5PA 1CGOA 2P7VA 4BEJA 3VRCA 4C3EA 5T1DB 2JPUA 2ZXPA 3U5SA 1KU2A 3S84A 2HKVA 3HTKC 1Q0KA 1RJ9B 5JLIA 1E2XA 2L9JA 3K1HA 2XXAA 5F5FA 5EHHA 2XL8A 3H2UA 2D5RB 2IYLD 2QNLA 4OIOF 1HE1A 4HFKB 4NC3A 2IXMA 4HFFB 1JOGA 3WAQA 2R7SA 1MNEA 3M15A 4G0HA 2HSQA 1YA9A 2OEXA 1RKEA 4XQ1A 3EGXA 1DOWA 2H7BA 2KNHA 3HNIA 3LEOA 4CDAA 1GGQA 2XSEA 1OW7A 1O87A 4FX5A 4PACA 3SXMA 4NY3A 4EWCA 1BZ4A 3UMKA 1YDIA 3NRHA 4XEFA 1VLTA 3EJNA 4G7OF 2CDQA 3KH2A 2BE5F 3I4UA 3T6BA 3ZQYA 2DYSC 3QVZA 1ZVZA 4J7YA 1YYXA 4MTFA 4BJ6A 1ZHZA 2WZGA 3C8GB 1CGME 2J9WA 4YT5A 3X1OA 3R7CA 4P6IC 4WGZA 3ZTMA 1IZMA 2KQ9A 1TFOB 4E0HA 1OQCA 1LVKA 1OCZC 4WABA 2W45A 3KKBA 4CBEA 2ZXWC 3S0XA 3CZ6A 4I1OB 2AWCA 1F1MA 1QVXA 2UUHA 3EPVA 2I8BA 3LESA 3DJUB 3GEIA 3M4BA 2AVKA 2WL8A 2XRHA 3SEOA 3IEEA 2YL1A 5GPGB 2OQMA 3EG9A 3B29A 2LD6A 2R25A 3FOPA 3GORA 3W8IA 3HNLA 4L6RA 4N6CA 3QW0A 4G7ZF 1ZU4A 2BL2A 1S7ZA 1H9GA 3U2LA 3DZAA 4FWVA 2EPOA 2WB7A 4IJJA 4H4KC 4ONSA 3NYJA 5KYYB 3VM6A 2WVOA 2XLMA 3L34A 3W2VA 3ZQVA 4EIYA 2OEVA 4IARA 1OCOC 3FDQA 3MYFA 1LS4A 1OXKA 2EPNA 2YL0A 3GWNA 1FR0A 2YLGA 1A0BA 2YL7A 1PD0A 2DB4A 4JJFA 3L8IA 4XLNF 1A41A 5JVEA 2IM8A 2KYHA 1LI5A 4J32B 4JCZA 3RKOF 5AC4A 1QSPA 4MVQA 3B0VC 4LDKA 2QTVA 3KYJA 4F4BA 1V55C 3DI5A 3GM3A 3HNJA 1WOLA 1JAFA 1BBHA 2LQGA 2Y69C 4QDLA 2AU5A 2RD9A 3MFNA 3L0IA 4LDQA 3GEHA 3X2QC 5A69A 1OR2A 4BJ6C 1TWAA 2EPMX 4YT4A 2X0CA 1G4US 1LKXA 3EGXB 4O6NA 4OINF 3E70C 5L0JA 5DQTA 3V5YA 2R9RB 4EBBA 3US6A 1D1AA 5HV9A 1M57C 2YEVA 3O10A 2VCBA 5EK0A 1YJGA 2JD3A 2DI3A 1PD1A 3DM5A 3K66A 3KYIA 4LACB 2YLIA 2CW0F 3C18A 3LNMB 2ZXOA 4MVSA 4MS2A 1K40A 2I15A 1NBBA 1YA7O 2EPLX 4N4WA 2ZXRA 3L8JA 1H9TA 5DVWA 3GM1A 3CSKA 1YAUO 4MTOA 4P9TA 3ASOC 3RFYA 1MMAA 2HJMA 4ANJA 2NUPA 1D0ZA 3U9MA 5COMA 2OJQA 2YKZA 4AE4A 1B68A 1Q0DA 2Q9CA 1DOVA 3EFOA 1ZHWA 5B3IA 3ZIBA 3EH1A 1WTYA 3G4ZA 1NG1A 4CJOA 5D91A 1YYJA 2GDCA 1KTMA 4YN0B 4LERA 4NQFA 4YWQA 1D0YA 3PDMP 3Q7LA 4XEVA 1U89A 2GWWA 3V5ZA 1M56C 1OCCC 1BR1A 2IXOA 1T5OA 2R7TA 2ASRA 2P61A 3PHF2 1HMOA 4JW1A 2R05A 4XPXA 1JMWA 5KYUA 3U2MA 1NSGB 2YL3A 1KNYA 2XLVA 2Y3DA 2V26A 3TD7A 1EQ1A 2J7PA 1VK5A 4KNWA 3WG7C 4IWBA 2P6VA 3DD7A 3UR3C 1E83A 2R7RA 3S9OA 1YARO 1OCRC 1OW6A 1YVIA 1NFNA 1M2VA 1YZAA 2A68F 3KPHA 3W8HA 1K05A 1FMWA 5D92A 5T3WA 3UNGC 4E17A 2Q4FA 3T9OA 3KMIA 5IY5C 2R7VA 3EGDA 4JKVA 3ECSA 4C7OA 2C04A 1WGWA 3B71A 4LLEA 3T6GB 3UGPA 1A7EA 1HW2A 1RMVA 2O9XA 2EIKC 3JZ0A 2B0HA 2NUTA 5KYWB 5KYXB 3AGTA 1V74B 2IXPA 1ZW2A 2R7QA 1A7VA 2QUPA 3A11A 4XPWA 1QQ3A 2IBFA 5COFA 5DLJA 1ZHTA 5F28E 2XM4A 2OG2A 2NSFA 4J7TA 2PP4A 4E0IA 1ZHYA 3IHUA 3U9JA 4Z9JA 4BPMA 5DS6A 2HZ8A 1SYQA 4O7GA 1Z63A 1G8XA 2YRFA 3ATPA 3JCUQ 3LNRA 5AGFA 4YL1A 4MVOA 4JZAA 3WHNA 4BJTA 3NKDA 3KL4A 2J0XA 1VMAA 2J9BA 1TQGA 3M4CA 2QE9A 1BDJB 2HV7A 2XS8A 4RD9A 3T4RA 3TOLA 4BJ1A 3RYLA 3GODA 2MWQA 4CX9A 1QKRA 2CNWA 3DMDA 1TR2A 3K7DA 4MW8A 2WZLA 3GEEA 2X51A 1L7CA 4PJMA 3RH3A 4QI2A 1VOMA 2G3VA 4IAQA 4O79A 2A6EF 1T01A 3DE9A 2OOCA 3H2VA 3O6XA 4XEKA 3PMRA 2OKUA 4IAOA 5E3AA 3U8PA 4FESA 3JSZA 2KC3A 1ORSC 1SR2A 4WJ0A 1E85A 2W9YA 1HW1A 2RSEB 3NDBB 3UMIA 2R7XA 1ORYA 2PX0A 3I5QA 5E3CA 4JTAB 3EQLF 5CIVA 3AQCA 1RCPA 3BEHA 1LPEA 1C17M 4U5HA 2GFHA 4JTCB 1YZCA 4JC7A 1TKNA 4N6HA 4YL0A 1ZW3A 1ZU5A 1Z3IX 2J7PD 4MVRA 5KYUB 2L7AA 1XZQA 2PFDA 1Y6DA 2LIGA 3GANA 4KI2A 2L81A 4DRHB 3VF0A 3ZG1A 1LIHA 2ICWG 2KW3C 3QTHA 2R7OA 3JTLO 4N06A 3ASNC 4DXWA 4JE9A 5B1BC 5JS5A 3MBGA 2G3KA 3LS0A 4OIQF 1M2VB 1FTSA 1MMGA 3Q6MA 1D0XA 1FAPB 5L3VA 3DAGA 2C03A 4DJ9A 5BQIA 2A0UA 3EGDB 1J8MF 3RVZA 3TJ5A 4AL0A 2GA0A 3R2PA 4YJWA 4MVMA 1PCXA 2P1AA 2LFFA 1C03A 2J45A 2JX0A 3HNKA 4Q7CA 4YT2A 1VLSA 3RQFA 2Y39A 3BRJA 4HEAJ 4DRIB 5L0HA 3JRMO 1D1BA 3K1IC 4AX2A 4JIOA 4CIHA 2FFHA 3SXYA 1Q0MA 3LJBA 3AGUA 3DXJF 2XXAB 2Q3TA 3FOOA 2A69F 3LS1A 2YLDA 3IQTA 3N24A 2EIMC 1LM3B 2NSGA 4KBLA 5B3SC 1QPUA 1ZYRF 1MQVA 1Z6AA 2R03A 3HJCA 2E87A 2L6GA 1RKEB 4H54A 4E7SA 2NPUA 2J46A 2CNWD 2W4BA 3RF3A 1CPQA 3HKKA 3M1CB 3PCVA 4IRUA 3LUTB 5DS5A 3QW1A 1HE9A 1JPNA 1OR3A 1XZPA 4CDYA 4U9EA 3TJ6A 3JYYA 4E18A 1O3UA 3AJMA 1GS9A 3S90A 1EKYA 3QVYA 2MYSA 4AK9A 1TWGA 5L0FA 3EHNA 3TULA 3U3BA 4G7HF 5JRAA 2B0JA 4PFPA 5A6AA 3U3FA 4BEMJ 2HJ3A 4OIRF 1XWJA 3ITFA 4I44A 4OD5A 2HFIA 4YT8A 3FXHA 4Z9IA 3OEOA 4EBJA 3HLZA 3CEXA 2VC9A 3EG9B 4PK4A 4B6IA 4EHPA 4M63A 2XS1A 5JSLA 4G78A 5L0DA 3B0PA 3RIPA 1Z7Qc 1MNDA 3B0UX 1VYKA 5DQZA 2HMQA 2HV6A 3QZCA 1BR2A 4JCHA 3A9CA 3Q7GA 3AOUA 5A6JA 5E2QA 1QLEC 1WATA 1GM5A 4PFOA 1CGNA 2CCYA 1A7DA 2F22A 2BC5A 5BQGA 4ER9A 4MVUA 1AUEA 2PNOA 2J9VA 4A2NB 4I3MA 4DVYP 4WGYA 3H65A 3JYHA 4MQ9F 1RXQA 3QMKA 2H7VC 3C8GA 3AG1C 1UG7A 1ST6A 256BA 3JSEO 3K6BA 1WN0A 4DBQA 2IXNA 3JT1A 1N1CA 3C7JA 1SF8A 5FZTA 5JUAA 2CYDA 5E33A 2YHSA 1WWPA 3JRTA 4CDVA 4MTGA 4CS8C 4MVZA 1TWCA 4C3BA 4UDVA 2YVKA 5HSWA 1FFTC 4K0DA 2R7WA 2Q00A 3TK0A 1EA8A 2EIJC 2H8AA 4NCQA 2ZPAA 3RW0A 1S05A 1U6HA 4U5FE 3F47A 5CI9A 2EINC 2Y3BA 3DAFA 3IQCA 3FHDA 1C02A 2XL4A 4ULVA 5CI8A 1V4AA 2G62A 5KYYA 1MMDA 3K1IA 4U5CE 4CSAC 3B9QA 3G4XA 4U9DA 2UUIA 1T6IA 2DYRC 2P0NA 1QZXA 2XLDA 4D4NA 4JURI 1J8YF 2VH3A 3TQOA 2EPKX 4BG0A 1V54C 1R5ID 3U8VA 4W8PA 4CS7A 2XLEA 4EKWA 2V3CC 1K04A 4CJGA 1Q0FA 2YZSA 3LAYA 4U5DE 1OKKA 2LCHA 2NUPB 4NTAA 3MLGA 3ABMC 4W8KA 4AE4B 3SXKA 4JEAA 1LI7A 2D4UA 3OA1A 4BJ5A 4OD4A 3EFOB 4AL1A 4R32A 1I5NA 2TMVP 3GWLA 3NMIA 1T6QA 3F46A 1E84A 3ZTZA 1APCA 3EZIA 4E7ZA 4A4AA 4K1OA 3ZDLA 3DJNB 3LEVA 3W2WA 4I1MA 1LS1A 1NU7D 3ZWIA 3CQZA 3V5XA 3SNHA 3CAXA 4JRZA 4XTKA 2KJGA 2Y3HA 2Q7RA 5A6KA 3O55A 4HE8D 2OU6A 2QY9A 4O6MA 3MX3A 3C8GD 2L6HA 3J06A 1MMNA 3L1MA 3UGOA 2OCCC 4IGGA 3ABKC 4U5GA 3ZC4A 2PX3A 1HY5A 1YLMA 4RBNA 4U5BE 4DOZA 5A6BA 4K7BA 1GQAA 4GQHA 1O5HA 1R4TA 2Q9AA 3O39A 5TJ5E 4EUKB 4EBKA 5BQHA 2VCAA 4X0RA 5EGYA 3C8ZA 4C7OB 3LLIA 2NUTB 3V7OA 4Q5SF 3ZVRA 2Z15A 4XLPF 1NU9C 1TWHA 2KSFA 4XPYA 2A1DD 1HMDA 1Z23A 2HUJA 3ABLC 3IQ6A 4Z9HA 5DS4A 5K0IA 4ZLDA 4YK5A 3AG4C 3IQ5A 1JPJA 1T9KA 4JEBA 3GM2A 1FMVA 2KGOA 3E9VA 1TFKB 4Q4ZF 3IPMO 5L0GA 5L0CA 4DVZA 3LLKA 4J30B 4BJ5C 3AG2C 2YWAA 3AG3C 3AQBA 3EHMA 4CS9A 1Q0GA 3SYNA 2M64A 2LK4A 2NG1A 3NKEA 1M6TA 2KK1A 2MHRA 4IB4A 1OKKD 3C63A 2J9UA 4ZLCA 1G4WR 2AWYA 1SZIA 2IOQA 2XLWA 1CPRA 2A6HF 3FAJA 3ZSUA 4CS8A 3UMHA 2Y3GA 3W4YA 1VTMP 2VASA 5FCLA 2VCCA 4U5EE 4FAPB 3EH2A 2VB6A 1ORJA 2A0BA 1AVOB 2XM0A 5KYWA 5KYXA 2J8WA 1I4ZA 1VYIA 4JTDB 2FAPB 2XL6A 3S28A 1LE4A 2WZFA 2LSEA
chains in the Genus database with same CATH topology
3HNLA 4L6RA 256BA 3QW0A 4CX9A 4CDVA 4IAQA 3DE9A 2XLMA 3ZQVA 4EIYA 4IARA 3U8PA 1E85A 2XLHA 2YL0A 2YLGA 5JP7A 2YL7A 1S05A 1RCPA 5JVEA 4N6HA 3ZWIA 1YZCA 3NMKA 1E86A 4ULVA 4CIPA 3HNJA 4U9DA 1JAFA 1BBHA 2XLDA 4D4NA 4D4XA 4JE9A 5JS5A 2XLEA 4CJGA 3NMJA 4JEAA 5JT4A 2YLIA 3NMIA 3HNKA 1E84A 3ZTZA 1APCA 1NBBA 3TOMA 4N4WA 3FOOA 2QLAA 3DE8A 2YLDA 3M79A 1LM3B 1QPUA 3C62A 2YKZA 1MQVA 5JUAA 5B3IA 3L1MA 2XLOA 4CJOA 1YYJA 1CGOA 3VRCA 1CPQA 3QW1A 5JLIA 4CDYA 1GQAA 4U9EA 2XL8A 1EKYA 3QVYA 4NC3A 2YL3A 2XLVA 3M15A 5JRAA 1E83A 3IQ6A 3IQ5A 3HNIA 1YZAA 4JEBA 4CDAA 4JKVA 3ZQYA 3QVZA 5JSLA 1YYXA 1A7VA 1QQ3A 3ZTMA 4IB4A 1M6TA 4WGZA 3C63A 2XM4A 2XLWA 1CPRA 1CGNA 2CCYA 3M4BA 2BC5A 4ER9A 5AGFA 2XM0A 2YL1A 4WGYA 2J8WA 2J9BA 2XL6A 3M4CA 3FOPA 3TOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNL A;  4L6R A;  256B A;  3QW0 A;  4CX9 A;  4CDV A;  4IAQ A;  3DE9 A;  2XLM A;  3ZQV A;  4EIY A;  4IAR A;  3U8P A;  1E85 A;  2XLH A;  2YL0 A;  2YLG A;  5JP7 A;  2YL7 A;  1S05 A;  1RCP A;  5JVE A;  4N6H A;  3ZWI A;  1YZC A;  3NMK A;  1E86 A;  4ULV A;  4CIP A;  3HNJ A;  4U9D A;  1JAF A;  1BBH A;  2XLD A;  4D4N A;  4D4X A;  4JE9 A;  5JS5 A;  2XLE A;  4CJG A;  3NMJ A;  4JEA A;  5JT4 A;  2YLI A;  3NMI A;  3HNK A;  1E84 A;  3ZTZ A;  1APC A;  1NBB A;  3TOM A;  4N4W A;  3FOO A;  2QLA A;  3DE8 A;  2YLD A;  3M79 A;  1LM3 B;  1QPU A;  3C62 A;  2YKZ A;  1MQV A;  5JUA A;  5B3I A;  3L1M A;  2XLO A;  4CJO A;  1YYJ A;  1CGO A;  3VRC A;  1CPQ A;  3QW1 A;  5JLI A;  4CDY A;  1GQA A;  4U9E A;  2XL8 A;  1EKY A;  3QVY A;  4NC3 A;  2YL3 A;  2XLV A;  3M15 A;  5JRA A;  1E83 A;  3IQ6 A;  3IQ5 A;  3HNI A;  1YZA A;  4JEB A;  4CDA A;  4JKV A;  3ZQY A;  3QVZ A;  5JSL A;  1YYX A;  1A7V A;  1QQ3 A;  3ZTM A;  4IB4 A;  1M6T A;  4WGZ A;  3C63 A;  2XM4 A;  2XLW A;  1CPR A;  1CGN A;  2CCY A;  3M4B A;  2BC5 A;  4ER9 A;  5AGF A;  2XM0 A;  2YL1 A;  4WGY A;  2J8W A;  2J9B A;  2XL6 A;  3M4C A;  3FOP A;  3TOL A; 
#chains in the Genus database with same CATH topology
 2WVN A;  5L3Q A;  1JR8 A;  1LE2 A;  2PF4 E;  5F5H A;  1RJ9 A;  2HSB A;  1ZHX A;  1VB5 A;  4CSA A;  2L6F A;  3FAP B;  4GEH A;  1D1C A;  3FVY A;  4OIP F;  3Q6N A;  4NTF A;  1Y4C A;  1NZE A;  1U0B B;  1OXB A;  2XLH A;  3SZR A;  4JJG A;  2M4E A;  5A6B D;  1EI7 A;  3K33 A;  5JP7 A;  3NYM A;  5L0I A;  2LP4 A;  2R7U A;  1G5Z A;  1NLX A;  1PV3 A;  2CGE A;  1T6U A;  4NTB A;  3N2Z B;  3FMS A;  3NMK A;  1E86 A;  2OJE D;  4KNV A;  5B1A C;  3RVY A;  3VAY A;  1BR4 A;  2HS5 A;  2HMZ A;  2LFD A;  4ULW A;  4C3D A;  4CIP A;  3S29 A;  4PR9 A;  3G50 A;  4PJN A;  3DM9 B;  4D4X A;  4CS9 C;  4DBR A;  5KYN A;  4P9F A;  2DGJ A;  2R02 A;  4O6Y A;  5COG A;  2H7O A;  4JVS A;  4PJL A;  1FNT c;  4PJJ A;  1OW8 A;  1NFO A;  3NG1 A;  4MW3 A;  2ZD9 A;  1FFH A;  3DWW A;  3NMJ A;  5BUO A;  3EZH A;  1RKC A;  1IW7 F;  1H7I A;  3MYI A;  1WAS A;  5JT4 A;  4MND A;  2WVQ A;  4RDA A;  5T3T A;  1W2W A;  2W4M A;  3RQE A;  3SXZ A;  2AP3 A;  3T6J A;  2GAQ A;  2J0W A;  4LLC A;  4YL3 A;  3DKA A;  2FGY A;  3TOM A;  3N0T A;  3VYW A;  3S27 A;  5AC5 A;  4LDR A;  3WOD F;  1Z5Z A;  1UFB A;  2Q9B A;  2ETS A;  1L3P A;  1SMY F;  2PBE A;  2EIL C;  2QLA A;  3DE8 A;  2YQY A;  4DRJ B;  3U0C A;  1H6G A;  3M79 A;  3SP1 A;  1AEP A;  3C62 A;  3POV A;  3RQG A;  4KC9 A;  3OWT A;  3NYL A;  1JRA A;  4GYT A;  4QI0 A;  4XWJ A;  2XLO A;  1I4Y A;  1ZZP A;  1M2O A;  3I5P A;  1CGO A;  2P7V A;  4BEJ A;  3VRC A;  4C3E A;  5T1D B;  2JPU A;  2ZXP A;  3U5S A;  1KU2 A;  3S84 A;  2HKV A;  3HTK C;  1Q0K A;  1RJ9 B;  5JLI A;  1E2X A;  2L9J A;  3K1H A;  2XXA A;  5F5F A;  5EHH A;  2XL8 A;  3H2U A;  2D5R B;  2IYL D;  2QNL A;  4OIO F;  1HE1 A;  4HFK B;  4NC3 A;  2IXM A;  4HFF B;  1JOG A;  3WAQ A;  2R7S A;  1MNE A;  3M15 A;  4G0H A;  2HSQ A;  1YA9 A;  2OEX A;  1RKE A;  4XQ1 A;  3EGX A;  1DOW A;  2H7B A;  2KNH A;  3HNI A;  3LEO A;  4CDA A;  1GGQ A;  2XSE A;  1OW7 A;  1O87 A;  4FX5 A;  4PAC A;  3SXM A;  4NY3 A;  4EWC A;  1BZ4 A;  3UMK A;  1YDI A;  3NRH A;  4XEF A;  1VLT A;  3EJN A;  4G7O F;  2CDQ A;  3KH2 A;  2BE5 F;  3I4U A;  3T6B A;  3ZQY A;  2DYS C;  3QVZ A;  1ZVZ A;  4J7Y A;  1YYX A;  4MTF A;  4BJ6 A;  1ZHZ A;  2WZG A;  3C8G B;  1CGM E;  2J9W A;  4YT5 A;  3X1O A;  3R7C A;  4P6I C;  4WGZ A;  3ZTM A;  1IZM A;  2KQ9 A;  1TFO B;  4E0H A;  1OQC A;  1LVK A;  1OCZ C;  4WAB A;  2W45 A;  3KKB A;  4CBE A;  2ZXW C;  3S0X A;  3CZ6 A;  4I1O B;  2AWC A;  1F1M A;  1QVX A;  2UUH A;  3EPV A;  2I8B A;  3LES A;  3DJU B;  3GEI A;  3M4B A;  2AVK A;  2WL8 A;  2XRH A;  3SEO A;  3IEE A;  2YL1 A;  5GPG B;  2OQM A;  3EG9 A;  3B29 A;  2LD6 A;  2R25 A;  3FOP A;  3GOR A;  3W8I A;  3HNL A;  4L6R A;  4N6C A;  3QW0 A;  4G7Z F;  1ZU4 A;  2BL2 A;  1S7Z A;  1H9G A;  3U2L A;  3DZA A;  4FWV A;  2EPO A;  2WB7 A;  4IJJ A;  4H4K C;  4ONS A;  3NYJ A;  5KYY B;  3VM6 A;  2WVO A;  2XLM A;  3L34 A;  3W2V A;  3ZQV A;  4EIY A;  2OEV A;  4IAR A;  1OCO C;  3FDQ A;  3MYF A;  1LS4 A;  1OXK A;  2EPN A;  2YL0 A;  3GWN A;  1FR0 A;  2YLG A;  1A0B A;  2YL7 A;  1PD0 A;  2DB4 A;  4JJF A;  3L8I A;  4XLN F;  1A41 A;  5JVE A;  2IM8 A;  2KYH A;  1LI5 A;  4J32 B;  4JCZ A;  3RKO F;  5AC4 A;  1QSP A;  4MVQ A;  3B0V C;  4LDK A;  2QTV A;  3KYJ A;  4F4B A;  1V55 C;  3DI5 A;  3GM3 A;  3HNJ A;  1WOL A;  1JAF A;  1BBH A;  2LQG A;  2Y69 C;  4QDL A;  2AU5 A;  2RD9 A;  3MFN A;  3L0I A;  4LDQ A;  3GEH A;  3X2Q C;  5A69 A;  1OR2 A;  4BJ6 C;  1TWA A;  2EPM X;  4YT4 A;  2X0C A;  1G4U S;  1LKX A;  3EGX B;  4O6N A;  4OIN F;  3E70 C;  5L0J A;  5DQT A;  3V5Y A;  2R9R B;  4EBB A;  3US6 A;  1D1A A;  5HV9 A;  1M57 C;  2YEV A;  3O10 A;  2VCB A;  5EK0 A;  1YJG A;  2JD3 A;  2DI3 A;  1PD1 A;  3DM5 A;  3K66 A;  3KYI A;  4LAC B;  2YLI A;  2CW0 F;  3C18 A;  3LNM B;  2ZXO A;  4MVS A;  4MS2 A;  1K40 A;  2I15 A;  1NBB A;  1YA7 O;  2EPL X;  4N4W A;  2ZXR A;  3L8J A;  1H9T A;  5DVW A;  3GM1 A;  3CSK A;  1YAU O;  4MTO A;  4P9T A;  3ASO C;  3RFY A;  1MMA A;  2HJM A;  4ANJ A;  2NUP A;  1D0Z A;  3U9M A;  5COM A;  2OJQ A;  2YKZ A;  4AE4 A;  1B68 A;  1Q0D A;  2Q9C A;  1DOV A;  3EFO A;  1ZHW A;  5B3I A;  3ZIB A;  3EH1 A;  1WTY A;  3G4Z A;  1NG1 A;  4CJO A;  5D91 A;  1YYJ A;  2GDC A;  1KTM A;  4YN0 B;  4LER A;  4NQF A;  4YWQ A;  1D0Y A;  3PDM P;  3Q7L A;  4XEV A;  1U89 A;  2GWW A;  3V5Z A;  1M56 C;  1OCC C;  1BR1 A;  2IXO A;  1T5O A;  2R7T A;  2ASR A;  2P61 A;  3PHF 2;  1HMO A;  4JW1 A;  2R05 A;  4XPX A;  1JMW A;  5KYU A;  3U2M A;  1NSG B;  2YL3 A;  1KNY A;  2XLV A;  2Y3D A;  2V26 A;  3TD7 A;  1EQ1 A;  2J7P A;  1VK5 A;  4KNW A;  3WG7 C;  4IWB A;  2P6V A;  3DD7 A;  3UR3 C;  1E83 A;  2R7R A;  3S9O A;  1YAR O;  1OCR C;  1OW6 A;  1YVI A;  1NFN A;  1M2V A;  1YZA A;  2A68 F;  3KPH A;  3W8H A;  1K05 A;  1FMW A;  5D92 A;  5T3W A;  3UNG C;  4E17 A;  2Q4F A;  3T9O A;  3KMI A;  5IY5 C;  2R7V A;  3EGD A;  4JKV A;  3ECS A;  4C7O A;  2C04 A;  1WGW A;  3B71 A;  4LLE A;  3T6G B;  3UGP A;  1A7E A;  1HW2 A;  1RMV A;  2O9X A;  2EIK C;  3JZ0 A;  2B0H A;  2NUT A;  5KYW B;  5KYX B;  3AGT A;  1V74 B;  2IXP A;  1ZW2 A;  2R7Q A;  1A7V A;  2QUP A;  3A11 A;  4XPW A;  1QQ3 A;  2IBF A;  5COF A;  5DLJ A;  1ZHT A;  5F28 E;  2XM4 A;  2OG2 A;  2NSF A;  4J7T A;  2PP4 A;  4E0I A;  1ZHY A;  3IHU A;  3U9J A;  4Z9J A;  4BPM A;  5DS6 A;  2HZ8 A;  1SYQ A;  4O7G A;  1Z63 A;  1G8X A;  2YRF A;  3ATP A;  3JCU Q;  3LNR A;  5AGF A;  4YL1 A;  4MVO A;  4JZA A;  3WHN A;  4BJT A;  3NKD A;  3KL4 A;  2J0X A;  1VMA A;  2J9B A;  1TQG A;  3M4C A;  2QE9 A;  1BDJ B;  2HV7 A;  2XS8 A;  4RD9 A;  3T4R A;  3TOL A;  4BJ1 A;  3RYL A;  3GOD A;  2MWQ A;  4CX9 A;  1QKR A;  2CNW A;  3DMD A;  1TR2 A;  3K7D A;  4MW8 A;  2WZL A;  3GEE A;  2X51 A;  1L7C A;  4PJM A;  3RH3 A;  4QI2 A;  1VOM A;  2G3V A;  4IAQ A;  4O79 A;  2A6E F;  1T01 A;  3DE9 A;  2OOC A;  3H2V A;  3O6X A;  4XEK A;  3PMR A;  2OKU A;  4IAO A;  5E3A A;  3U8P A;  4FES A;  3JSZ A;  2KC3 A;  1ORS C;  1SR2 A;  4WJ0 A;  1E85 A;  2W9Y A;  1HW1 A;  2RSE B;  3NDB B;  3UMI A;  2R7X A;  1ORY A;  2PX0 A;  3I5Q A;  5E3C A;  4JTA B;  3EQL F;  5CIV A;  3AQC A;  1RCP A;  3BEH A;  1LPE A;  1C17 M;  4U5H A;  2GFH A;  4JTC B;  1YZC A;  4JC7 A;  1TKN A;  4N6H A;  4YL0 A;  1ZW3 A;  1ZU5 A;  1Z3I X;  2J7P D;  4MVR A;  5KYU B;  2L7A A;  1XZQ A;  2PFD A;  1Y6D A;  2LIG A;  3GAN A;  4KI2 A;  2L81 A;  4DRH B;  3VF0 A;  3ZG1 A;  1LIH A;  2ICW G;  2KW3 C;  3QTH A;  2R7O A;  3JTL O;  4N06 A;  3ASN C;  4DXW A;  4JE9 A;  5B1B C;  5JS5 A;  3MBG A;  2G3K A;  3LS0 A;  4OIQ F;  1M2V B;  1FTS A;  1MMG A;  3Q6M A;  1D0X A;  1FAP B;  5L3V A;  3DAG A;  2C03 A;  4DJ9 A;  5BQI A;  2A0U A;  3EGD B;  1J8M F;  3RVZ A;  3TJ5 A;  4AL0 A;  2GA0 A;  3R2P A;  4YJW A;  4MVM A;  1PCX A;  2P1A A;  2LFF A;  1C03 A;  2J45 A;  2JX0 A;  3HNK A;  4Q7C A;  4YT2 A;  1VLS A;  3RQF A;  2Y39 A;  3BRJ A;  4HEA J;  4DRI B;  5L0H A;  3JRM O;  1D1B A;  3K1I C;  4AX2 A;  4JIO A;  4CIH A;  2FFH A;  3SXY A;  1Q0M A;  3LJB A;  3AGU A;  3DXJ F;  2XXA B;  2Q3T A;  3FOO A;  2A69 F;  3LS1 A;  2YLD A;  3IQT A;  3N24 A;  2EIM C;  1LM3 B;  2NSG A;  4KBL A;  5B3S C;  1QPU A;  1ZYR F;  1MQV A;  1Z6A A;  2R03 A;  3HJC A;  2E87 A;  2L6G A;  1RKE B;  4H54 A;  4E7S A;  2NPU A;  2J46 A;  2CNW D;  2W4B A;  3RF3 A;  1CPQ A;  3HKK A;  3M1C B;  3PCV A;  4IRU A;  3LUT B;  5DS5 A;  3QW1 A;  1HE9 A;  1JPN A;  1OR3 A;  1XZP A;  4CDY A;  4U9E A;  3TJ6 A;  3JYY A;  4E18 A;  1O3U A;  3AJM A;  1GS9 A;  3S90 A;  1EKY A;  3QVY A;  2MYS A;  4AK9 A;  1TWG A;  5L0F A;  3EHN A;  3TUL A;  3U3B A;  4G7H F;  5JRA A;  2B0J A;  4PFP A;  5A6A A;  3U3F A;  4BEM J;  2HJ3 A;  4OIR F;  1XWJ A;  3ITF A;  4I44 A;  4OD5 A;  2HFI A;  4YT8 A;  3FXH A;  4Z9I A;  3OEO A;  4EBJ A;  3HLZ A;  3CEX A;  2VC9 A;  3EG9 B;  4PK4 A;  4B6I A;  4EHP A;  4M63 A;  2XS1 A;  5JSL A;  4G78 A;  5L0D A;  3B0P A;  3RIP A;  1Z7Q c;  1MND A;  3B0U X;  1VYK A;  5DQZ A;  2HMQ A;  2HV6 A;  3QZC A;  1BR2 A;  4JCH A;  3A9C A;  3Q7G A;  3AOU A;  5A6J A;  5E2Q A;  1QLE C;  1WAT A;  1GM5 A;  4PFO A;  1CGN A;  2CCY A;  1A7D A;  2F22 A;  2BC5 A;  5BQG A;  4ER9 A;  4MVU A;  1AUE A;  2PNO A;  2J9V A;  4A2N B;  4I3M A;  4DVY P;  4WGY A;  3H65 A;  3JYH A;  4MQ9 F;  1RXQ A;  3QMK A;  2H7V C;  3C8G A;  3AG1 C;  1UG7 A;  1ST6 A;  256B A;  3JSE O;  3K6B A;  1WN0 A;  4DBQ A;  2IXN A;  3JT1 A;  1N1C A;  3C7J A;  1SF8 A;  5FZT A;  5JUA A;  2CYD A;  5E33 A;  2YHS A;  1WWP A;  3JRT A;  4CDV A;  4MTG A;  4CS8 C;  4MVZ A;  1TWC A;  4C3B A;  4UDV A;  2YVK A;  5HSW A;  1FFT C;  4K0D A;  2R7W A;  2Q00 A;  3TK0 A;  1EA8 A;  2EIJ C;  2H8A A;  4NCQ A;  2ZPA A;  3RW0 A;  1S05 A;  1U6H A;  4U5F E;  3F47 A;  5CI9 A;  2EIN C;  2Y3B A;  3DAF A;  3IQC A;  3FHD A;  1C02 A;  2XL4 A;  4ULV A;  5CI8 A;  1V4A A;  2G62 A;  5KYY A;  1MMD A;  3K1I A;  4U5C E;  4CSA C;  3B9Q A;  3G4X A;  4U9D A;  2UUI A;  1T6I A;  2DYR C;  2P0N A;  1QZX A;  2XLD A;  4D4N A;  4JUR I;  1J8Y F;  2VH3 A;  3TQO A;  2EPK X;  4BG0 A;  1V54 C;  1R5I D;  3U8V A;  4W8P A;  4CS7 A;  2XLE A;  4EKW A;  2V3C C;  1K04 A;  4CJG A;  1Q0F A;  2YZS A;  3LAY A;  4U5D E;  1OKK A;  2LCH A;  2NUP B;  4NTA A;  3MLG A;  3ABM C;  4W8K A;  4AE4 B;  3SXK A;  4JEA A;  1LI7 A;  2D4U A;  3OA1 A;  4BJ5 A;  4OD4 A;  3EFO B;  4AL1 A;  4R32 A;  1I5N A;  2TMV P;  3GWL A;  3NMI A;  1T6Q A;  3F46 A;  1E84 A;  3ZTZ A;  1APC A;  3EZI A;  4E7Z A;  4A4A A;  4K1O A;  3ZDL A;  3DJN B;  3LEV A;  3W2W A;  4I1M A;  1LS1 A;  1NU7 D;  3ZWI A;  3CQZ A;  3V5X A;  3SNH A;  3CAX A;  4JRZ A;  4XTK A;  2KJG A;  2Y3H A;  2Q7R A;  5A6K A;  3O55 A;  4HE8 D;  2OU6 A;  2QY9 A;  4O6M A;  3MX3 A;  3C8G D;  2L6H A;  3J06 A;  1MMN A;  3L1M A;  3UGO A;  2OCC C;  4IGG A;  3ABK C;  4U5G A;  3ZC4 A;  2PX3 A;  1HY5 A;  1YLM A;  4RBN A;  4U5B E;  4DOZ A;  5A6B A;  4K7B A;  1GQA A;  4GQH A;  1O5H A;  1R4T A;  2Q9A A;  3O39 A;  5TJ5 E;  4EUK B;  4EBK A;  5BQH A;  2VCA A;  4X0R A;  5EGY A;  3C8Z A;  4C7O B;  3LLI A;  2NUT B;  3V7O A;  4Q5S F;  3ZVR A;  2Z15 A;  4XLP F;  1NU9 C;  1TWH A;  2KSF A;  4XPY A;  2A1D D;  1HMD A;  1Z23 A;  2HUJ A;  3ABL C;  3IQ6 A;  4Z9H A;  5DS4 A;  5K0I A;  4ZLD A;  4YK5 A;  3AG4 C;  3IQ5 A;  1JPJ A;  1T9K A;  4JEB A;  3GM2 A;  1FMV A;  2KGO A;  3E9V A;  1TFK B;  4Q4Z F;  3IPM O;  5L0G A;  5L0C A;  4DVZ A;  3LLK A;  4J30 B;  4BJ5 C;  3AG2 C;  2YWA A;  3AG3 C;  3AQB A;  3EHM A;  4CS9 A;  1Q0G A;  3SYN A;  2M64 A;  2LK4 A;  2NG1 A;  3NKE A;  1M6T A;  2KK1 A;  2MHR A;  4IB4 A;  1OKK D;  3C63 A;  2J9U A;  4ZLC A;  1G4W R;  2AWY A;  1SZI A;  2IOQ A;  2XLW A;  1CPR A;  2A6H F;  3FAJ A;  3ZSU A;  4CS8 A;  3UMH A;  2Y3G A;  3W4Y A;  1VTM P;  2VAS A;  5FCL A;  2VCC A;  4U5E E;  4FAP B;  3EH2 A;  2VB6 A;  1ORJ A;  2A0B A;  1AVO B;  2XM0 A;  5KYW A;  5KYX A;  2J8W A;  1I4Z A;  1VYI A;  4JTD B;  2FAP B;  2XL6 A;  3S28 A;  1LE4 A;  2WZF A;  2LSE A; 
#chains in the Genus database with same CATH homology
 3HNL A;  4L6R A;  256B A;  3QW0 A;  4CX9 A;  4CDV A;  4IAQ A;  3DE9 A;  2XLM A;  3ZQV A;  4EIY A;  4IAR A;  3U8P A;  1E85 A;  2XLH A;  2YL0 A;  2YLG A;  5JP7 A;  2YL7 A;  1S05 A;  1RCP A;  5JVE A;  4N6H A;  3ZWI A;  1YZC A;  3NMK A;  1E86 A;  4ULV A;  4CIP A;  3HNJ A;  4U9D A;  1JAF A;  1BBH A;  2XLD A;  4D4N A;  4D4X A;  4JE9 A;  5JS5 A;  2XLE A;  4CJG A;  3NMJ A;  4JEA A;  5JT4 A;  2YLI A;  3NMI A;  3HNK A;  1E84 A;  3ZTZ A;  1APC A;  1NBB A;  3TOM A;  4N4W A;  3FOO A;  2QLA A;  3DE8 A;  2YLD A;  3M79 A;  1LM3 B;  1QPU A;  3C62 A;  2YKZ A;  1MQV A;  5JUA A;  5B3I A;  3L1M A;  2XLO A;  4CJO A;  1YYJ A;  1CGO A;  3VRC A;  1CPQ A;  3QW1 A;  5JLI A;  4CDY A;  1GQA A;  4U9E A;  2XL8 A;  1EKY A;  3QVY A;  4NC3 A;  2YL3 A;  2XLV A;  3M15 A;  5JRA A;  1E83 A;  3IQ6 A;  3IQ5 A;  3HNI A;  1YZA A;  4JEB A;  4CDA A;  4JKV A;  3ZQY A;  3QVZ A;  5JSL A;  1YYX A;  1A7V A;  1QQ3 A;  3ZTM A;  4IB4 A;  1M6T A;  4WGZ A;  3C63 A;  2XM4 A;  2XLW A;  1CPR A;  1CGN A;  2CCY A;  3M4B A;  2BC5 A;  4ER9 A;  5AGF A;  2XM0 A;  2YL1 A;  4WGY A;  2J8W A;  2J9B A;  2XL6 A;  3M4C A;  3FOP A;  3TOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...