3JRMO

Crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
218
Chain Sequence
b'KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEADNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGTDHMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome subunit alpha
publication title Structural models for interactions between the 20S proteasome and its PAN/19S activators.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 87
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3jrmO01
3IPMO 1YARO 3JRMO 3JTLO 1FNTc 1Z7Qc 1AVOB 3JSEO 1YAUO 1YA7O
chains in the Genus database with same CATH superfamily
2XL8A 2VC9A 5A6BA 1A7EA 1BR4A 1VYKA 2YL1A 3GEEA 3ABLC 1APCA 3K6BA 5TJ5E 3RVYA 4EBBA 3B0UX 2ICWG 1OXKA 4YT4A 2EINC 5JRAA 1E86A 1IW7F 3EGDA 3U5SA 3IQ6A 3LLIA 1LIHA 3LEOA 4JIOA 4MQ9F 1BR2A 1L3PA 1HE9A 2D4UA 1WATA 2QUPA 2YLIA 2Y3GA 3IQCA 3SZRA 3TK0A 2H7BA 4WJ0A 1M2VA 1YZAA 1RXQA 2J8WA 3M1CB 4YL0A 1ZHXA 4U5FE 3C7JA 4CS8C 5A6KA 1VB5A 1YYJA 2L7AA 3TULA 4YN0B 2Y3DA 2YZSA 1GM5A 1ZW3A 2VCBA 2J9WA 3S27A 2J0XA 4XTKA 4EUKB 2EIMC 2KGOA 2LSEA 2YVKA 1TFOB 3AQBA 4MVMA 2Q7RA 1GGQA 1I4ZA 1LKXA 1NG1A 1Z23A 2QY9A 3K1IA 4PJJA 4M63A 2R03A 3G4ZA 5T3TA 2R7WA 4IRUA 3M4BA 1A7VA 2ZXOA 2X0CA 3RYLA 3LESA 3EJNA 3TOLA 2LK4A 3ABKC 4IAQA 2PX0A 3GWNA 1LS1A 2Q9CA 4CIPA 3NMKA 3DMDA 1BDJB 4O6NA 4X0RA 5EHHA 4CS7A 5L0CA 3HTKC 4MVSA 1U89A 5DVWA 2M64A 5L0GA 2OJED 4NCQA 4U9EA 2J7PA 4XEVA 3PCVA 3JT1A 1OXBA 1TR2A 5EGYA 1XZQA 3EH1A 2WZLA 2GAQA 3ZQVA 3L8JA 2PBEA 5K0IA 3C63A 5KYUB 4BG0A 2HMQA 4XQ1A 1VOMA 3T6JA 2OEXA 2J9VA 1EKYA 2IXMA 1GQAA 2HSBA 2C04A 1GS9A 1SF8A 2L9JA 2NPUA 3JSEO 4HFFB 1ZU5A 3LS0A 3TJ5A 5AGFA 4ANJA 4IARA 4ZLDA 3M15A 3L34A 4E7ZA 2DYSC 1CPQA 2KSFA 4XPYA 4XLPF 2R7RA 4E7SA 1HMDA 3T9OA 3U9MA 4PJNA 5CI9A 5AC5A 4H4KC 2XM4A 2BE5F 4WABA 1QSPA 5KYYB 5E33A 3GWLA 1V55C 4BJ1A 4IGGA 2NUPA 5FZTA 1EQ1A 4MVQA 1LM3B 3U0CA 3QVZA 2P61A 5KYXA 2AVKA 4JC7A 4CSAC 1NU7D 3F46A 2R7XA 3UGOA 1RKEA 3AG3C 3EHNA 1NZEA 2W4BA 4J32B 3TD7A 2CGEA 3C62A 1FFHA 4U5CE 3SEOA 4LDKA 4ONSA 2Y3HA 5IY5C 4NTAA 2OKUA 5EK0A 5JSLA 5DS6A 3J06A 2YLGA 3W2VA 5HSWA 5BQGA 1ST6A 5GPGB 2WL8A 5L0FA 5JP7A 4DJ9A 3EH2A 3OEOA 1SZIA 3EZHA 2P0NA 1C02A 1ZHTA 3LEVA 2XL4A 1JPJA 2R7OA 3SXZA 1C03A 3MBGA 2AP3A 3KPHA 4U5HA 3K1IC 5DS4A 4BEJA 2FGYA 1C17M 3ZTZA 2PFDA 1WWPA 4MVUA 1CPRA 4O7GA 4O6MA 4L6RA 3JRMO 5B3IA 2CNWD 1T6QA 1D0XA 3ABMC 4BJTA 2YQYA 4JTCB 3JZ0A 3KH2A 4OD4A 3B9QA 1QZXA 4EBKA 4Q4ZF 2J45A 2QTVA 3AOUA 3K1HA 1I4YA 2GFHA 3IHUA 3JCUQ 3ZTMA 4BJ5A 4DVYP 2LCHA 1O87A 1OQCA 4YL1A 2R7QA 4I44A 3EGXA 2Z15A 4OIRF 4XPWA 4DBQA 5DQZA 1YZCA 3EFOA 4PJMA 1YAUO 4JZAA 3F47A 1U6HA 2A1DD 1OKKA 1QKRA 3U2LA 3O10A 1VLSA 1JR8A 2FAPB 2C03A 2Q4FA 4OIPF 4C7OA 4MVRA 1MNEA 3RQFA 2LQGA 4CX9A 3RF3A 4EBJA 2BC5A 3HNKA 3JTLO 4G7ZF 1S7ZA 3O6XA 1WTYA 3HKKA 4Z9HA 3UMKA 1ZW2A 2UUIA 2XLOA 3C8GB 4HEAJ 4CS9A 4OINF 2PX3A 3HJCA 5KYWB 1RJ9B 3WODF 1H7IA 4EHPA 1U0BB 1Z3IX 3K7DA 1RCPA 2CCYA 3DAFA 2Q9BA 3OA1A 3QMKA 1BR1A 3L8IA 2KNHA 1M56C 1HW1A 3NMJA 4JCHA 3G4XA 3LUTB 5F28E 3ZVRA 2H8AA 4LACB 1YVIA 1YJGA 1G4US 4U5DE 3B29A 5CI8A 1ORJA 1MMNA 1M2OA 1OCRC 3IQTA 1NFNA 1TQGA 2OG2A 2DB4A 1JRAA 4MVZA 5E3CA 3GM2A 3E70C 2EILC 4G0HA 2YKZA 1LI7A 3DJUB 4OIOF 4YT8A 3I4UA 4FWVA 4GQHA 2YL0A 4YK5A 3RQEA 1E2XA 3QTHA 3FOPA 2A0UA 3HNIA 4QI0A 5BQHA 4HFKB 1MMAA 1D1CA 1T6IA 2HZ8A 2LP4A 2PP4A 4AE4B 4MTGA 2ZXRA 4A2NB 1A0BA 3KL4A 1OR2A 4WGYA 1LE2A 1ORYA 3NYJA 4EIYA 5L0DA 2R7TA 1QPUA 1OW8A 4N06A 3ZQYA 4ZLCA 2ZXWC 1CGNA 3ZC4A 5DS5A 3A11A 4QDLA 5B3SC 2R7VA 1ZHZA 1QVXA 2NSGA 3DM9B 1T01A 1RMVA 1PCXA 1TWHA 3X1OA 3L1MA 1DOWA 2VCAA 3GM1A 3PDMP 1NU9C 1V74B 3US6A 1OCZC 1XWJA 2V3CC 2EPKX 2EPOA 4J7YA 1TKNA 4FAPB 2EIJC 5JS5A 3EG9B 2XXAB 1UG7A 3TQOA 2YL7A 4JCZA 5CIVA 1D0YA 2HJ3A 4JTDB 3S0XA 1L7CA 4OIQF 5BQIA 1E83A 3E9VA 1YLMA 2RD9A 3KKBA 5KYUA 5JT4A 1KNYA 2PNOA 2UUHA 1Q0MA 3CSKA 1PD1A 3JYHA 4WGZA 4BJ5C 3NYLA 2NSFA 3EHMA 3DE8A 2XRHA 3DE9A 1VLTA 3SYNA 3DD7A 5FCLA 3S28A 4XPXA 1T9KA 4UDVA 2KK1A 2LIGA 3Q7GA 3I5QA 1FMWA 1FR0A 4CDYA 4IB4A 2XLDA 3CQZA 4BEMJ 3GORA 3ITFA 4E0IA 4JE9A 2YHSA 4Z9JA 256BA 3QW0A 1H6GA 4CJGA 1WGWA 2IXNA 2YLDA 1T5OA 1J8YF 1VYIA 1FMVA 3KMIA 3U2MA 5AC4A 2ZXPA 5L0HA 4JJGA 2A6EF 3FOOA 2DGJA 3QW1A 4JURI 2W45A 1OW6A 4G7HF 3WAQA 2OCCC 2VH3A 4NTBA 1D1BA 4P9TA 1Q0KA 1NBBA 2XLHA 1DOVA 1IZMA 2JX0A 3MLGA 2HUJA 3LJBA 1M57C 3RFYA 4PK4A 3W8HA 4KBLA 4BJ6A 3DZAA 1K40A 2VCCA 2P1AA 3AG2C 4D4XA 1VK5A 2RSEB 3FMSA 3MYIA 4DXWA 3SNHA 1HY5A 2G3VA 1LS4A 3UNGC 5L0JA 4RBNA 4GYTA 2M4EA 1RKEB 2KYHA 3C8GD 2R7SA 1LE4A 3EQLF 3V5XA 4AL1A 5JVEA 1Z5ZA 4EKWA 3GODA 1EI7A 1E84A 1YA7O 3FAPB 1ORSC 4MS2A 5T1DB 3V7OA 4NC3A 3LNMB 3DJNB 2OQMA 1JMWA 1ZU4A 2P7VA 4HE8D 2HMZA 3FDQA 2NUTA 1SMYF 1BBHA 2IBFA 1W2WA 4NQFA 4BPMA 4YT2A 2KQ9A 1MMGA 1YA9A 2Q3TA 2R02A 3AGUA 3L0IA 3NDBB 1V4AA 2J9BA 1VTMP 2WZGA 4KNWA 2EPLX 1J8MF 3GEHA 4RD9A 2W9YA 3B0PA 3DI5A 1RKCA 3TJ6A 3VM6A 3ZWIA 2CYDA 2FFHA 3AJMA 3MYFA 4AX2A 3GM3A 1FFTC 4U9DA 1NSGB 2XL6A 1HMOA 3B0VC 3AGTA 1YYXA 3AQCA 1MMDA 4MW3A 3B71A 3MFNA 2MYSA 3Q6NA 4OD5A 3R2PA 2OU6A 1Q0DA 4H54A 2P6VA 4CIHA 2XS1A 1PV3A 3CZ6A 3H2VA 3IQ5A 2KJGA 2QLAA 3M4CA 4ULWA 2HJMA 4EWCA 1Y6DA 2HSQA 4XLNF 5D92A 1WOLA 4NTFA 2GWWA 3W8IA 2QE9A 4N6HA 5B1AC 5L0IA 1FAPB 2MHRA 2O9XA 3A9CA 2H7OA 3U8VA 1E85A 3PMRA 3NG1A 2Q00A 5E2QA 1FTSA 3EGXB 3LS1A 1B68A 1A41A 1BZ4A 3RQGA 3X2QC 4E18A 3C8GA 1OCOC 2NG1A 5KYWA 2W4MA 1OR3A 2A68F 3NMIA 4DRJB 1YARO 3O55A 4KI2A 4CJOA 2B0JA 2J9UA 3WHNA 4C3EA 5HV9A 1NFOA 3S84A 2A69F 4C7OB 2J7PD 4IWBA 4CSAA 3TOMA 3ZSUA 1M6TA 2A6HF 4JEAA 1NLXA 2LD6A 4MTFA 3EGDB 4XEKA 3SXYA 2XM0A 3KYJA 3LAYA 1V54C 2R25A 3VAYA 1LI5A 2CNWA 1G5ZA 2IM8A 4PFPA 3S90A 3DXJF 4JW1A 1JAFA 3O39A 4MW8A 3MX3A 4P6IC 1M2VB 4YJWA 1LPEA 4BJ6C 3RIPA 4N6CA 1Y4CA 3HNLA 2L6HA 3U8PA 4NY3A 5T3WA 4E0HA 2WZFA 5BUOA 1Z6AA 3GANA 1LVKA 4W8KA 3CAXA 2H7VC 4IJJA 4MVOA 1TWGA 2MWQA 4AE4A 3Q6MA 4FX5A 3SP1A 1G8XA 2HKVA 2OEVA 2XLMA 1YDIA 3FXHA 5KYNA 2KW3C 5COMA 1O3UA 2HV7A 2CW0F 2Q9AA 5L3QA 3JYYA 2DYRC 3AG1C 4XEFA 2G62A 4XWJA 3UR3C 1XZPA 3R7CA 4AL0A 4LLEA 3RH3A 4N4WA 4PACA 1Z63A 2YWAA 2PF4E 1HE1A 5DQTA 3SXMA 3ZG1A 3PHF2 4G78A 3LLKA 5F5FA 1MQVA 3EG9A 3FAJA 2LFDA 2KC3A 2XXAA 4KC9A 4D4NA 1TWCA 4ER9A 4IAOA 4U5BE 2DI3A 2QNLA 3JRTA 2AWCA 1F1MA 1K05A 1K04A 3BEHA 3N24A 3CEXA 4YL3A 1R5ID 4G7OF 1CGOA 3ZIBA 4LLCA 1OCCC 2R05A 4J30B 3RW0A 3U9JA 4CDVA 3DAGA 2L6GA 2GDCA 4DRIB 4JRZA 4U5EE 1KU2A 2EIKC 2YRFA 3EPVA 4O79A 4U5GA 3S9OA 5A69A 1CGME 2IXOA 4RDAA 2EPNA 4MTOA 2ZPAA 1QQ3A 4QI2A 3V5YA 5KYYA 1AEPA 1WN0A 3DKAA 4PJLA 1AUEA 2E87A 3ATPA 3NKEA 2ETSA 2ASRA 2AWYA 2I15A 1ZVZA 4W8PA 3SXKA 5JLIA 2B0HA 1ZHWA 4K0DA 4MNDA 4DOZA 4O6YA 3AG4C 4R32A 1KTMA 4LERA 2VB6A 3W4YA 1D1AA 5B1BC 3QVYA 3HNJA 5A6BD 1SR2A 1ZZPA 2WB7A 4CS9C 2OJQA 1EA8A 3NRHA 3G50A 3Q7LA 2CDQA 3K66A 4P9FA 2G3KA 2Y39A 3ASOC 3K33A 3RKOF 4CDAA 2R9RB 3FVYA 3U3FA 4DBRA 2NUPB 3W2WA 3S29A 3ASNC 1G4WR 2OOCA 5A6JA 5JUAA 2IOQA 3QZCA 1Q0GA 4LDQA 5KYXB 1A7DA 2WVOA 5COGA 2EPMX 2HV6A 3DM5A 4I1OB 4CBEA 4CS8A 1SYQA 2J0WA 3N2ZB 2IXPA 2A0BA 4DRHB 2ZD9A 2BL2A 2LFFA 1VMAA 3IPMO 1OKKD 5E3AA 2R7UA 1N1CA 3UMHA 3FHDA 5COFA 1T6UA 4YT5A 4C3BA 1WASA 4J7TA 1O5HA 4Z9IA 2V26A 3KYIA 4YWQA 1Q0FA 4C3DA 3U3BA 2VASA 1D0ZA 3NKDA 3T6GB 4Q7CA 3UMIA 3VRCA 1ZYRF 4I3MA 3BRJA 3H65A 2GA0A 3LNRA 4LDRA 4A4AA 1FNTc 2J46A 3IEEA 5L3VA 3M79A 5F5HA 3HLZA 1HW2A 4AK9A 2Y3BA 4DVZA 4PFOA 2I8BA 2YL3A 2JPUA 4ULVA 2L81A 3UGPA 1QLEC 2WVNA 4B6IA 2XLVA 3JSZA 4K1OA 3C18A 1TFKB 3DWWA 2NUTB 4JJFA 4F4BA 1UFBA 4FESA 2XSEA 3ZDLA 2IYLD 1H9GA 1JOGA 4JVSA 4K7BA 2Y69C 1AVOB 2WVQA 2X51A 3I5PA 1PD0A 1TWAA 3C8ZA 1ZHYA 2HFIA 4KNVA 3ECSA 1H9TA 5A6AA 1OW7A 2F22A 3NYMA 4PR9A 4JEBA 3H2UA 3POVA 4I1MA 2XLWA 3EZIA 5D91A 1MNDA 4GEHA 2AU5A 3T6BA 1Z7Qc 3WG7C 2JD3A 5DLJA 2TMVP 4JKVA 3EFOB 4E17A 3V5ZA 2XLEA 2L6FA 1RJ9A 3GEIA 4JTAB 1R4TA 3T4RA 3VF0A 2HS5A 3VYWA 3OWTA 4Q5SF 2D5RB 3RVZA 2YEVA 1I5NA 1S05A 3N0TA 1JPNA 2XS8A
chains in the Genus database with same CATH topology
3IPMO 1YARO 3JRMO 3JTLO 1FNTc 1Z7Qc 1AVOB 3JSEO 1YAUO 1YA7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPM O;  1YAR O;  3JRM O;  3JTL O;  1FNT c;  1Z7Q c;  1AVO B;  3JSE O;  1YAU O;  1YA7 O; 
#chains in the Genus database with same CATH topology
 2XL8 A;  2VC9 A;  5A6B A;  1A7E A;  1BR4 A;  1VYK A;  2YL1 A;  3GEE A;  3ABL C;  1APC A;  3K6B A;  5TJ5 E;  3RVY A;  4EBB A;  3B0U X;  2ICW G;  1OXK A;  4YT4 A;  2EIN C;  5JRA A;  1E86 A;  1IW7 F;  3EGD A;  3U5S A;  3IQ6 A;  3LLI A;  1LIH A;  3LEO A;  4JIO A;  4MQ9 F;  1BR2 A;  1L3P A;  1HE9 A;  2D4U A;  1WAT A;  2QUP A;  2YLI A;  2Y3G A;  3IQC A;  3SZR A;  3TK0 A;  2H7B A;  4WJ0 A;  1M2V A;  1YZA A;  1RXQ A;  2J8W A;  3M1C B;  4YL0 A;  1ZHX A;  4U5F E;  3C7J A;  4CS8 C;  5A6K A;  1VB5 A;  1YYJ A;  2L7A A;  3TUL A;  4YN0 B;  2Y3D A;  2YZS A;  1GM5 A;  1ZW3 A;  2VCB A;  2J9W A;  3S27 A;  2J0X A;  4XTK A;  4EUK B;  2EIM C;  2KGO A;  2LSE A;  2YVK A;  1TFO B;  3AQB A;  4MVM A;  2Q7R A;  1GGQ A;  1I4Z A;  1LKX A;  1NG1 A;  1Z23 A;  2QY9 A;  3K1I A;  4PJJ A;  4M63 A;  2R03 A;  3G4Z A;  5T3T A;  2R7W A;  4IRU A;  3M4B A;  1A7V A;  2ZXO A;  2X0C A;  3RYL A;  3LES A;  3EJN A;  3TOL A;  2LK4 A;  3ABK C;  4IAQ A;  2PX0 A;  3GWN A;  1LS1 A;  2Q9C A;  4CIP A;  3NMK A;  3DMD A;  1BDJ B;  4O6N A;  4X0R A;  5EHH A;  4CS7 A;  5L0C A;  3HTK C;  4MVS A;  1U89 A;  5DVW A;  2M64 A;  5L0G A;  2OJE D;  4NCQ A;  4U9E A;  2J7P A;  4XEV A;  3PCV A;  3JT1 A;  1OXB A;  1TR2 A;  5EGY A;  1XZQ A;  3EH1 A;  2WZL A;  2GAQ A;  3ZQV A;  3L8J A;  2PBE A;  5K0I A;  3C63 A;  5KYU B;  4BG0 A;  2HMQ A;  4XQ1 A;  1VOM A;  3T6J A;  2OEX A;  2J9V A;  1EKY A;  2IXM A;  1GQA A;  2HSB A;  2C04 A;  1GS9 A;  1SF8 A;  2L9J A;  2NPU A;  3JSE O;  4HFF B;  1ZU5 A;  3LS0 A;  3TJ5 A;  5AGF A;  4ANJ A;  4IAR A;  4ZLD A;  3M15 A;  3L34 A;  4E7Z A;  2DYS C;  1CPQ A;  2KSF A;  4XPY A;  4XLP F;  2R7R A;  4E7S A;  1HMD A;  3T9O A;  3U9M A;  4PJN A;  5CI9 A;  5AC5 A;  4H4K C;  2XM4 A;  2BE5 F;  4WAB A;  1QSP A;  5KYY B;  5E33 A;  3GWL A;  1V55 C;  4BJ1 A;  4IGG A;  2NUP A;  5FZT A;  1EQ1 A;  4MVQ A;  1LM3 B;  3U0C A;  3QVZ A;  2P61 A;  5KYX A;  2AVK A;  4JC7 A;  4CSA C;  1NU7 D;  3F46 A;  2R7X A;  3UGO A;  1RKE A;  3AG3 C;  3EHN A;  1NZE A;  2W4B A;  4J32 B;  3TD7 A;  2CGE A;  3C62 A;  1FFH A;  4U5C E;  3SEO A;  4LDK A;  4ONS A;  2Y3H A;  5IY5 C;  4NTA A;  2OKU A;  5EK0 A;  5JSL A;  5DS6 A;  3J06 A;  2YLG A;  3W2V A;  5HSW A;  5BQG A;  1ST6 A;  5GPG B;  2WL8 A;  5L0F A;  5JP7 A;  4DJ9 A;  3EH2 A;  3OEO A;  1SZI A;  3EZH A;  2P0N A;  1C02 A;  1ZHT A;  3LEV A;  2XL4 A;  1JPJ A;  2R7O A;  3SXZ A;  1C03 A;  3MBG A;  2AP3 A;  3KPH A;  4U5H A;  3K1I C;  5DS4 A;  4BEJ A;  2FGY A;  1C17 M;  3ZTZ A;  2PFD A;  1WWP A;  4MVU A;  1CPR A;  4O7G A;  4O6M A;  4L6R A;  3JRM O;  5B3I A;  2CNW D;  1T6Q A;  1D0X A;  3ABM C;  4BJT A;  2YQY A;  4JTC B;  3JZ0 A;  3KH2 A;  4OD4 A;  3B9Q A;  1QZX A;  4EBK A;  4Q4Z F;  2J45 A;  2QTV A;  3AOU A;  3K1H A;  1I4Y A;  2GFH A;  3IHU A;  3JCU Q;  3ZTM A;  4BJ5 A;  4DVY P;  2LCH A;  1O87 A;  1OQC A;  4YL1 A;  2R7Q A;  4I44 A;  3EGX A;  2Z15 A;  4OIR F;  4XPW A;  4DBQ A;  5DQZ A;  1YZC A;  3EFO A;  4PJM A;  1YAU O;  4JZA A;  3F47 A;  1U6H A;  2A1D D;  1OKK A;  1QKR A;  3U2L A;  3O10 A;  1VLS A;  1JR8 A;  2FAP B;  2C03 A;  2Q4F A;  4OIP F;  4C7O A;  4MVR A;  1MNE A;  3RQF A;  2LQG A;  4CX9 A;  3RF3 A;  4EBJ A;  2BC5 A;  3HNK A;  3JTL O;  4G7Z F;  1S7Z A;  3O6X A;  1WTY A;  3HKK A;  4Z9H A;  3UMK A;  1ZW2 A;  2UUI A;  2XLO A;  3C8G B;  4HEA J;  4CS9 A;  4OIN F;  2PX3 A;  3HJC A;  5KYW B;  1RJ9 B;  3WOD F;  1H7I A;  4EHP A;  1U0B B;  1Z3I X;  3K7D A;  1RCP A;  2CCY A;  3DAF A;  2Q9B A;  3OA1 A;  3QMK A;  1BR1 A;  3L8I A;  2KNH A;  1M56 C;  1HW1 A;  3NMJ A;  4JCH A;  3G4X A;  3LUT B;  5F28 E;  3ZVR A;  2H8A A;  4LAC B;  1YVI A;  1YJG A;  1G4U S;  4U5D E;  3B29 A;  5CI8 A;  1ORJ A;  1MMN A;  1M2O A;  1OCR C;  3IQT A;  1NFN A;  1TQG A;  2OG2 A;  2DB4 A;  1JRA A;  4MVZ A;  5E3C A;  3GM2 A;  3E70 C;  2EIL C;  4G0H A;  2YKZ A;  1LI7 A;  3DJU B;  4OIO F;  4YT8 A;  3I4U A;  4FWV A;  4GQH A;  2YL0 A;  4YK5 A;  3RQE A;  1E2X A;  3QTH A;  3FOP A;  2A0U A;  3HNI A;  4QI0 A;  5BQH A;  4HFK B;  1MMA A;  1D1C A;  1T6I A;  2HZ8 A;  2LP4 A;  2PP4 A;  4AE4 B;  4MTG A;  2ZXR A;  4A2N B;  1A0B A;  3KL4 A;  1OR2 A;  4WGY A;  1LE2 A;  1ORY A;  3NYJ A;  4EIY A;  5L0D A;  2R7T A;  1QPU A;  1OW8 A;  4N06 A;  3ZQY A;  4ZLC A;  2ZXW C;  1CGN A;  3ZC4 A;  5DS5 A;  3A11 A;  4QDL A;  5B3S C;  2R7V A;  1ZHZ A;  1QVX A;  2NSG A;  3DM9 B;  1T01 A;  1RMV A;  1PCX A;  1TWH A;  3X1O A;  3L1M A;  1DOW A;  2VCA A;  3GM1 A;  3PDM P;  1NU9 C;  1V74 B;  3US6 A;  1OCZ C;  1XWJ A;  2V3C C;  2EPK X;  2EPO A;  4J7Y A;  1TKN A;  4FAP B;  2EIJ C;  5JS5 A;  3EG9 B;  2XXA B;  1UG7 A;  3TQO A;  2YL7 A;  4JCZ A;  5CIV A;  1D0Y A;  2HJ3 A;  4JTD B;  3S0X A;  1L7C A;  4OIQ F;  5BQI A;  1E83 A;  3E9V A;  1YLM A;  2RD9 A;  3KKB A;  5KYU A;  5JT4 A;  1KNY A;  2PNO A;  2UUH A;  1Q0M A;  3CSK A;  1PD1 A;  3JYH A;  4WGZ A;  4BJ5 C;  3NYL A;  2NSF A;  3EHM A;  3DE8 A;  2XRH A;  3DE9 A;  1VLT A;  3SYN A;  3DD7 A;  5FCL A;  3S28 A;  4XPX A;  1T9K A;  4UDV A;  2KK1 A;  2LIG A;  3Q7G A;  3I5Q A;  1FMW A;  1FR0 A;  4CDY A;  4IB4 A;  2XLD A;  3CQZ A;  4BEM J;  3GOR A;  3ITF A;  4E0I A;  4JE9 A;  2YHS A;  4Z9J A;  256B A;  3QW0 A;  1H6G A;  4CJG A;  1WGW A;  2IXN A;  2YLD A;  1T5O A;  1J8Y F;  1VYI A;  1FMV A;  3KMI A;  3U2M A;  5AC4 A;  2ZXP A;  5L0H A;  4JJG A;  2A6E F;  3FOO A;  2DGJ A;  3QW1 A;  4JUR I;  2W45 A;  1OW6 A;  4G7H F;  3WAQ A;  2OCC C;  2VH3 A;  4NTB A;  1D1B A;  4P9T A;  1Q0K A;  1NBB A;  2XLH A;  1DOV A;  1IZM A;  2JX0 A;  3MLG A;  2HUJ A;  3LJB A;  1M57 C;  3RFY A;  4PK4 A;  3W8H A;  4KBL A;  4BJ6 A;  3DZA A;  1K40 A;  2VCC A;  2P1A A;  3AG2 C;  4D4X A;  1VK5 A;  2RSE B;  3FMS A;  3MYI A;  4DXW A;  3SNH A;  1HY5 A;  2G3V A;  1LS4 A;  3UNG C;  5L0J A;  4RBN A;  4GYT A;  2M4E A;  1RKE B;  2KYH A;  3C8G D;  2R7S A;  1LE4 A;  3EQL F;  3V5X A;  4AL1 A;  5JVE A;  1Z5Z A;  4EKW A;  3GOD A;  1EI7 A;  1E84 A;  1YA7 O;  3FAP B;  1ORS C;  4MS2 A;  5T1D B;  3V7O A;  4NC3 A;  3LNM B;  3DJN B;  2OQM A;  1JMW A;  1ZU4 A;  2P7V A;  4HE8 D;  2HMZ A;  3FDQ A;  2NUT A;  1SMY F;  1BBH A;  2IBF A;  1W2W A;  4NQF A;  4BPM A;  4YT2 A;  2KQ9 A;  1MMG A;  1YA9 A;  2Q3T A;  2R02 A;  3AGU A;  3L0I A;  3NDB B;  1V4A A;  2J9B A;  1VTM P;  2WZG A;  4KNW A;  2EPL X;  1J8M F;  3GEH A;  4RD9 A;  2W9Y A;  3B0P A;  3DI5 A;  1RKC A;  3TJ6 A;  3VM6 A;  3ZWI A;  2CYD A;  2FFH A;  3AJM A;  3MYF A;  4AX2 A;  3GM3 A;  1FFT C;  4U9D A;  1NSG B;  2XL6 A;  1HMO A;  3B0V C;  3AGT A;  1YYX A;  3AQC A;  1MMD A;  4MW3 A;  3B71 A;  3MFN A;  2MYS A;  3Q6N A;  4OD5 A;  3R2P A;  2OU6 A;  1Q0D A;  4H54 A;  2P6V A;  4CIH A;  2XS1 A;  1PV3 A;  3CZ6 A;  3H2V A;  3IQ5 A;  2KJG A;  2QLA A;  3M4C A;  4ULW A;  2HJM A;  4EWC A;  1Y6D A;  2HSQ A;  4XLN F;  5D92 A;  1WOL A;  4NTF A;  2GWW A;  3W8I A;  2QE9 A;  4N6H A;  5B1A C;  5L0I A;  1FAP B;  2MHR A;  2O9X A;  3A9C A;  2H7O A;  3U8V A;  1E85 A;  3PMR A;  3NG1 A;  2Q00 A;  5E2Q A;  1FTS A;  3EGX B;  3LS1 A;  1B68 A;  1A41 A;  1BZ4 A;  3RQG A;  3X2Q C;  4E18 A;  3C8G A;  1OCO C;  2NG1 A;  5KYW A;  2W4M A;  1OR3 A;  2A68 F;  3NMI A;  4DRJ B;  1YAR O;  3O55 A;  4KI2 A;  4CJO A;  2B0J A;  2J9U A;  3WHN A;  4C3E A;  5HV9 A;  1NFO A;  3S84 A;  2A69 F;  4C7O B;  2J7P D;  4IWB A;  4CSA A;  3TOM A;  3ZSU A;  1M6T A;  2A6H F;  4JEA A;  1NLX A;  2LD6 A;  4MTF A;  3EGD B;  4XEK A;  3SXY A;  2XM0 A;  3KYJ A;  3LAY A;  1V54 C;  2R25 A;  3VAY A;  1LI5 A;  2CNW A;  1G5Z A;  2IM8 A;  4PFP A;  3S90 A;  3DXJ F;  4JW1 A;  1JAF A;  3O39 A;  4MW8 A;  3MX3 A;  4P6I C;  1M2V B;  4YJW A;  1LPE A;  4BJ6 C;  3RIP A;  4N6C A;  1Y4C A;  3HNL A;  2L6H A;  3U8P A;  4NY3 A;  5T3W A;  4E0H A;  2WZF A;  5BUO A;  1Z6A A;  3GAN A;  1LVK A;  4W8K A;  3CAX A;  2H7V C;  4IJJ A;  4MVO A;  1TWG A;  2MWQ A;  4AE4 A;  3Q6M A;  4FX5 A;  3SP1 A;  1G8X A;  2HKV A;  2OEV A;  2XLM A;  1YDI A;  3FXH A;  5KYN A;  2KW3 C;  5COM A;  1O3U A;  2HV7 A;  2CW0 F;  2Q9A A;  5L3Q A;  3JYY A;  2DYR C;  3AG1 C;  4XEF A;  2G62 A;  4XWJ A;  3UR3 C;  1XZP A;  3R7C A;  4AL0 A;  4LLE A;  3RH3 A;  4N4W A;  4PAC A;  1Z63 A;  2YWA A;  2PF4 E;  1HE1 A;  5DQT A;  3SXM A;  3ZG1 A;  3PHF 2;  4G78 A;  3LLK A;  5F5F A;  1MQV A;  3EG9 A;  3FAJ A;  2LFD A;  2KC3 A;  2XXA A;  4KC9 A;  4D4N A;  1TWC A;  4ER9 A;  4IAO A;  4U5B E;  2DI3 A;  2QNL A;  3JRT A;  2AWC A;  1F1M A;  1K05 A;  1K04 A;  3BEH A;  3N24 A;  3CEX A;  4YL3 A;  1R5I D;  4G7O F;  1CGO A;  3ZIB A;  4LLC A;  1OCC C;  2R05 A;  4J30 B;  3RW0 A;  3U9J A;  4CDV A;  3DAG A;  2L6G A;  2GDC A;  4DRI B;  4JRZ A;  4U5E E;  1KU2 A;  2EIK C;  2YRF A;  3EPV A;  4O79 A;  4U5G A;  3S9O A;  5A69 A;  1CGM E;  2IXO A;  4RDA A;  2EPN A;  4MTO A;  2ZPA A;  1QQ3 A;  4QI2 A;  3V5Y A;  5KYY A;  1AEP A;  1WN0 A;  3DKA A;  4PJL A;  1AUE A;  2E87 A;  3ATP A;  3NKE A;  2ETS A;  2ASR A;  2AWY A;  2I15 A;  1ZVZ A;  4W8P A;  3SXK A;  5JLI A;  2B0H A;  1ZHW A;  4K0D A;  4MND A;  4DOZ A;  4O6Y A;  3AG4 C;  4R32 A;  1KTM A;  4LER A;  2VB6 A;  3W4Y A;  1D1A A;  5B1B C;  3QVY A;  3HNJ A;  5A6B D;  1SR2 A;  1ZZP A;  2WB7 A;  4CS9 C;  2OJQ A;  1EA8 A;  3NRH A;  3G50 A;  3Q7L A;  2CDQ A;  3K66 A;  4P9F A;  2G3K A;  2Y39 A;  3ASO C;  3K33 A;  3RKO F;  4CDA A;  2R9R B;  3FVY A;  3U3F A;  4DBR A;  2NUP B;  3W2W A;  3S29 A;  3ASN C;  1G4W R;  2OOC A;  5A6J A;  5JUA A;  2IOQ A;  3QZC A;  1Q0G A;  4LDQ A;  5KYX B;  1A7D A;  2WVO A;  5COG A;  2EPM X;  2HV6 A;  3DM5 A;  4I1O B;  4CBE A;  4CS8 A;  1SYQ A;  2J0W A;  3N2Z B;  2IXP A;  2A0B A;  4DRH B;  2ZD9 A;  2BL2 A;  2LFF A;  1VMA A;  3IPM O;  1OKK D;  5E3A A;  2R7U A;  1N1C A;  3UMH A;  3FHD A;  5COF A;  1T6U A;  4YT5 A;  4C3B A;  1WAS A;  4J7T A;  1O5H A;  4Z9I A;  2V26 A;  3KYI A;  4YWQ A;  1Q0F A;  4C3D A;  3U3B A;  2VAS A;  1D0Z A;  3NKD A;  3T6G B;  4Q7C A;  3UMI A;  3VRC A;  1ZYR F;  4I3M A;  3BRJ A;  3H65 A;  2GA0 A;  3LNR A;  4LDR A;  4A4A A;  1FNT c;  2J46 A;  3IEE A;  5L3V A;  3M79 A;  5F5H A;  3HLZ A;  1HW2 A;  4AK9 A;  2Y3B A;  4DVZ A;  4PFO A;  2I8B A;  2YL3 A;  2JPU A;  4ULV A;  2L81 A;  3UGP A;  1QLE C;  2WVN A;  4B6I A;  2XLV A;  3JSZ A;  4K1O A;  3C18 A;  1TFK B;  3DWW A;  2NUT B;  4JJF A;  4F4B A;  1UFB A;  4FES A;  2XSE A;  3ZDL A;  2IYL D;  1H9G A;  1JOG A;  4JVS A;  4K7B A;  2Y69 C;  1AVO B;  2WVQ A;  2X51 A;  3I5P A;  1PD0 A;  1TWA A;  3C8Z A;  1ZHY A;  2HFI A;  4KNV A;  3ECS A;  1H9T A;  5A6A A;  1OW7 A;  2F22 A;  3NYM A;  4PR9 A;  4JEB A;  3H2U A;  3POV A;  4I1M A;  2XLW A;  3EZI A;  5D91 A;  1MND A;  4GEH A;  2AU5 A;  3T6B A;  1Z7Q c;  3WG7 C;  2JD3 A;  5DLJ A;  2TMV P;  4JKV A;  3EFO B;  4E17 A;  3V5Z A;  2XLE A;  2L6F A;  1RJ9 A;  3GEI A;  4JTA B;  1R4T A;  3T4R A;  3VF0 A;  2HS5 A;  3VYW A;  3OWT A;  4Q5S F;  2D5R B;  3RVZ A;  2YEV A;  1I5N A;  1S05 A;  3N0T A;  1JPN A;  2XS8 A; 
#chains in the Genus database with same CATH homology
 3IPM O;  1YAR O;  3JRM O;  3JTL O;  1FNT c;  1Z7Q c;  1AVO B;  3JSE O;  1YAU O;  1YA7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...