3JRMO

Crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEADNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGTDHMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome subunit alpha
publication title Structural models for interactions between the 20S proteasome and its PAN/19S activators.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 87
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3jrmO01
1YAUO 1YARO 3JSEO 3JRMO 1Z7Qc 3IPMO 1YA7O 1AVOB 1FNTc 3JTLO
chains in the Genus database with same CATH superfamily
4DRIB 2WVQA 1H9TA 1AUEA 4BG0A 3LJBA 3V5YA 3U3FA 4BJ1A 3C7JA 5AGFA 1M2OA 4N4WA 4JRZA 3HNLA 4W8KA 3JYYA 3V5ZA 5HSWA 1A7VA 1YAUO 1PD0A 2LK4A 3O10A 1VLSA 4LDQA 4BJ5C 1A0BA 3GWNA 1K04A 3AOUA 4ONSA 1YA7O 3LNMB 2YHSA 4JCZA 3RVZA 1XZPA 4G7HF 4MTOA 3EZIA 4CJGA 1MNDA 4I3MA 3UGPA 1VK5A 3CQZA 3LEVA 3IEEA 3LESA 2OEVA 1BR4A 2R7OA 3I4UA 5B1AC 3GEHA 4MW8A 3X2QC 4CBEA 3C8GA 3V5XA 3TULA 2E87A 3OEOA 4U5EE 3DZAA 1M56C 4ZLCA 4JJFA 2GWWA 1G8XA 5JVEA 3GWLA 4IGGA 4RD9A 4XPXA 3RFYA 2W4MA 2UUHA 1O5HA 4PJMA 2D5RB 2J7PA 3RIPA 2YQYA 3EJNA 5F5FA 1HMOA 4MVSA 1RJ9A 4WJ0A 1BR2A 4KNWA 2HV7A 4CS9A 1SF8A 3RQGA 1ZHZA 2MWQA 1JAFA 1WN0A 1G4US 2XLOA 3DMDA 5JSLA 3W2VA 3R7CA 2J46A 1WWPA 4Q7CA 4QI0A 4KBLA 2G3VA 3RQFA 3KMIA 1KTMA 1Z3IX 3AQCA 5E3CA 3NRHA 3ZTZA 3HKKA 3L8JA 3NYLA 2KQ9A 2R25A 3UMKA 4N6HA 2Q9BA 2XM4A 2YZSA 4J7YA 3DE9A 4JEAA 4CDVA 3EG9B 1T6IA 2KK1A 3ZTMA 4PJLA 3RW0A 3A11A 4G0HA 1RKCA 2ZD9A 1Z5ZA 2XL6A 4DVYP 3FHDA 1Q0GA 5DS6A 5KYXA 1CGNA 2LP4A 4QI2A 5CI8A 4CS7A 3HNIA 1ZYRF 2R7UA 1MMGA 3EZHA 5E3AA 2QE9A 1U6HA 4PR9A 1IW7F 3ZWIA 2XRHA 1C02A 4GQHA 5JT4A 1R5ID 3ASOC 4JVSA 3TQOA 3H2UA 3RQEA 1YYJA 3RH3A 2ZPAA 3Q7LA 2YVKA 3NDBB 2KSFA 2LQGA 4JURI 1HMDA 1TKNA 4CS8A 2OJED 2J9UA 4QDLA 3NMIA 1YVIA 1OCRC 3K1IA 2HFIA 3IQ6A 1DOVA 2AWCA 2YL0A 4O79A 4YJWA 3JYHA 3U2MA 4OIRF 2Q9CA 3MFNA 4HFFB 2HV6A 2KNHA 5JLIA 4K0DA 4C7OB 2AU5A 2J9BA 1CPRA 1Q0FA 2AWYA 3A9CA 2CGEA 3ZQYA 1H7IA 2DYRC 4MS2A 1E85A 4I1OB 4A4AA 5F28E 4CIPA 3Q6NA 2Y39A 5KYNA 4IWBA 4F4BA 2NSFA 1N1CA 4M63A 1VTMP 1ZHYA 2JD3A 2EPMX 3U8PA 4CJOA 2DGJA 3ZQVA 5A6JA 1APCA 4NTAA 1HE9A 1QPUA 3MX3A 3TJ5A 1OKKA 1H6GA 2HMQA 2PP4A 1D1BA 2R9RB 2X0CA 2X51A 3IQTA 5FCLA 3SNHA 2Y3BA 2NUPA 1CPQA 2AVKA 3M4BA 1EQ1A 3G4XA 2BC5A 2CNWA 2A69F 3DWWA 3BRJA 4Z9HA 5B1BC 2XL4A 3C18A 4WGYA 1QSPA 2R7QA 1S05A 1FFTC 2XLVA 5B3SC 1WOLA 1MQVA 2EPOA 3DD7A 1C03A 2A1DD 1VMAA 1YZAA 2GDCA 3HNKA 4XTKA 3ZVRA 4OD4A 3UMIA 3AGTA 2LIGA 3SXMA 2L6HA 2Q4FA 3EG9A 2OKUA 3SXKA 3GM1A 2CW0F 1M6TA 3LLIA 3IHUA 1L7CA 3S9OA 2P0NA 3LNRA 4PJNA 4JCHA 2VASA 1SMYF 2QTVA 3KH2A 3TD7A 1TQGA 3GEEA 5L0IA 4K1OA 3X1OA 5KYYA 2LD6A 1FR0A 1TFKB 4EBKA 2R7XA 2C03A 3VM6A 1BR1A 2QNLA 3U0CA 2HJMA 3GM3A 1A41A 2KW3C 2EINC 1E2XA 3C8ZA 2CCYA 4X0RA 3SP1A 5JRAA 1EI7A 2P6VA 3N0TA 2J45A 1D0ZA 3GM2A 3JZ0A 3K33A 4G78A 4MVUA 4O6MA 3IPMO 4AE4B 1OCCC 3NKEA 3T6BA 1Z63A 4B6IA 2OU6A 5L0HA 1JMWA 1GM5A 3EGDB 3FOOA 4XQ1A 2R7WA 2XLHA 2R7SA 1G4WR 1T6QA 2EIKC 4BPMA 3H2VA 5EHHA 1ZHTA 3B9QA 3EFOB 5A69A 5KYUA 1WTYA 5COGA 3B0UX 2HUJA 2WL8A 4KC9A 1HE1A 1RXQA 1LS4A 4NTFA 1ST6A 3L34A 3GEIA 1JRAA 4DOZA 3E70C 3HTKC 1GQAA 3NG1A 1FNTc 4CSAC 2OG2A 2IXNA 4MTFA 4W8PA 5A6BD 4HFKB 4O6NA 2V3CC 5E33A 1GGQA 2M4EA 3MYIA 4HE8D 4IAQA 5GPGB 3R2PA 4H4KC 1NFNA 1RKEB 4L6RA 2UUIA 2YLIA 2EIMC 1O87A 3S29A 3CZ6A 2H7VC 1HW2A 1A7EA 2Y3GA 2YKZA 4BJ6A 2IXOA 4LERA 2B0JA 4UDVA 1Z23A 2LFFA 3QW0A 4J32B 3U9MA 5D91A 4LLEA 3RF3A 2XXAB 3JSZA 1LI7A 3KPHA 5IY5C 3GORA 2P61A 5T3WA 1WASA 2IBFA 4MNDA 5COMA 3L8IA 4XLPF 3WODF 4XWJA 5CI9A 2J8WA 3W2WA 4GYTA 2CYDA 1T6UA 5BQHA 3MBGA 4P6IC 3FMSA 3C8GD 1ORSC 3KYIA 4C3EA 1UFBA 1TWHA 4K7BA 3QVZA 5AC4A 2DI3A 2WVNA 3K66A 3ATPA 3LS0A 4IRUA 4YT4A 1NFOA 1VYKA 1FFHA 1LS1A 1PD1A 2VB6A 2J7PD 4LDRA 3EPVA 5DS4A 2L7AA 4I44A 3RKOF 3FAPB 3QZCA 3ZC4A 3PDMP 1BDJB 2HSQA 1MMAA 3JTLO 2R02A 3HJCA 5JS5A 4EUKB 2YRFA 4JEBA 3DM9B 1LI5A 2YLDA 4JTDB 1QQ3A 1ZW3A 2A0BA 4EBBA 2A6EF 1E83A 1ZHXA 2CDQA 3M4CA 1U89A 3EGDA 3CSKA 4U5GA 4JJGA 3O55A 3T9OA 1V55C 4PACA 3DI5A 1MMDA 1W2WA 3B71A 3N24A 4JC7A 3M15A 3DXJF 3M1CB 3WAQA 1YLMA 4O7GA 1R4TA 1VYIA 4CDAA 4JTAB 2L81A 3SXZA 2XS8A 3FOPA 2WVOA 5L3VA 1Y4CA 2MYSA 2W4BA 2M64A 3MYFA 5DQTA 1FTSA 1QVXA 2ICWG 4Z9IA 1OR3A 2Q00A 1I5NA 4DRJB 1JPNA 1ORYA 2HJ3A 3TOMA 1EA8A 2XSEA 2R7VA 2ZXRA 1BBHA 4G7OF 2PX3A 2EPKX 2PNOA 1RKEA 5BQIA 4BJTA 3C8GB 1QLEC 2RD9A 4WGZA 3Q6MA 3QTHA 2IM8A 1K05A 1ZZPA 1V4AA 2EPLX 3F47A 1YJGA 2PFDA 4IB4A 3C62A 4J7TA 4EBJA 3O6XA 1OCOC 1VOMA 2ETSA 2R03A 4BJ5A 1WATA 2YEVA 3EH1A 5D92A 5KYYB 1LVKA 1VB5A 1RJ9B 3UR3C 1NLXA 3UGOA 1M57C 2LFDA 2W9YA 2XL8A 5L0JA 3PHF2 1QKRA 1V74B 4YL1A 5COFA 3LS1A 3JSEO 4MQ9F 2VC9A 3IQ5A 1NBBA 3EGXB 2XLMA 3K1IC 3AJMA 2IOQA 4NTBA 1S7ZA 3W8IA 1NU7D 2GA0A 1SZIA 4OIOF 2DYSC 4XLNF 1JOGA 2R7RA 4ULVA 2XM0A 3J06A 4JTCB 4P9TA 2NUTB 3T6JA 3OA1A 4AL1A 1RMVA 2IXMA 5FZTA 2KYHA 4CSAA 3AQBA 3QMKA 4FAPB 3FDQA 1B68A 2WZLA 4GEHA 4U5FE 2L6FA 3S90A 4Q4ZF 2A6HF 2VCAA 1J8YF 1AVOB 1ZHWA 3ASNC 3T4RA 4YN0B 5L0FA 2R7TA 3RYLA 3W8HA 3SXYA 1TWAA 2Q9AA 3NMJA 3QVYA 4U5DE 5KYXB 5HV9A 4OIQF 4P9FA 4YT2A 5A6BA 1DOWA 1D0YA 1EKYA 4AX2A 3S0XA 1BZ4A 2H8AA 2O9XA 2TMVP 1A7DA 1C17M 3DKAA 1RCPA 2ASRA 3PMRA 1ORJA 5L0DA 2I15A 4YL3A 3B29A 3BEHA 4U5BE 1XZQA 2NSGA 3AG4C 4DJ9A 2HMZA 1J8MF 3AG2C 2OJQA 2G3KA 4ULWA 1NSGB 1IZMA 1ZU4A 3FXHA 4E0IA 3UNGC 4LDKA 2IXPA 2YL7A 3EHNA 1LPEA 2V26A 3K1HA 3ABMC 2FGYA 2KGOA 4RDAA 4EHPA 3U3BA 4G7ZF 4D4XA 1AEPA 3SZRA 4KNVA 2A68F 3NYJA 4PFPA 4N6CA 3V7OA 3VYWA 5L0GA 3Q7GA 1NG1A 1I4YA 3DM5A 3K7DA 2B0HA 3NYMA 3B0PA 1ZW2A 3N2ZB 4IJJA 1T01A 5EGYA 4MTGA 2J9WA 1Z6AA 1VLTA 1G5ZA 1TWGA 3EH2A 3O39A 1LE4A 2QY9A 3QW1A 1F1MA 2VCBA 1OQCA 1SYQA 2D4UA 3VF0A 5BUOA 2J0XA 2LSEA 2WZGA 3H65A 3L1MA 4MVOA 4KI2A 4C7OA 4YT5A 1KU2A 3S28A 4EWCA 2R05A 5KYWB 4J30B 1HW1A 1FAPB 2G62A 3IQCA 4FX5A 4IAOA 1CGOA 3DAGA 2GAQA 1UG7A 2WZFA 3GANA 4I1MA 1FMVA 2FAPB 3JRMO 3M79A 3EQLF 2NPUA 4U9EA 3JT1A 4YK5A 3WG7C 4BEMJ 4DBQA 5CIVA 1NZEA 2WB7A 2Y69C 3EHMA 4FESA 5F5HA 3B0VC 1PCXA 2ZXPA 4U5HA 4RBNA 4YL0A 1D0XA 3E9VA 3NKDA 4MVMA 2NUPB 1D1AA 3POVA 2NG1A 3EGXA 1OCZC 1JR8A 3FAJA 1I4ZA 1KNYA 3I5PA 1XWJA 4NCQA 3VAYA 2AP3A 3K6BA 4N06A 3KL4A 1YDIA 1Z7Qc 3TJ6A 4DXWA 3U9JA 2W45A 3RVYA 2I8BA 1Y6DA 2NUTA 4PFOA 2LCHA 3KKBA 4AK9A 4DVZA 2DB4A 5BQGA 4E17A 2JX0A 1V54C 1LM3B 4JW1A 5T3TA 2C04A 1SR2A 2XLEA 4NC3A 4DRHB 3AG1C 3U2LA 4XPYA 1YA9A 4MW3A 1HY5A 4C3DA 4MVQA 2BL2A 4AE4A 1L3PA 1T5OA 3L0IA 2J0WA 5KYUB 4IARA 1ZVZA 1LKXA 2EPNA 2PX0A 3CEXA 3ITFA 1OW7A 2YL1A 3UMHA 3U5SA 4CS9C 4E0HA 4EIYA 4JKVA 2ZXWC 1M2VB 1TWCA 2ZXOA 4C3BA 4E18A 3EFOA 1JPJA 4ER9A 2Q7RA 2FFHA 3SEOA 3TOLA 1ZU5A 2JPUA 1Q0DA 3LUTB 1OR2A 2VH3A 4BJ6C 1WGWA 1D1CA 1E84A 2J9VA 2Y3DA 1OW8A 5AC5A 3DE8A 2YWAA 3JCUQ 3OWTA 4XPWA 3GODA 5DVWA 2OCCC 2BE5F 5JP7A 3SYNA 1H9GA 3WHNA 4PK4A 1TFOB 1OW6A 3T6GB 5B3IA 3LAYA 5DQZA 2QUPA 4JE9A 1OXKA 4DBRA 2XLDA 4OIPF 5E2QA 4ZLDA 2Y3HA 1K40A 3G4ZA 4NY3A 2KJGA 3HLZA 4XEVA 2EIJC 2P7VA 3I5QA 3S27A 4AL0A 4OINF 2RSEB 1PV3A 2QLAA 2IYLD 4MVZA 3JRTA 2GFHA 1QZXA 3S84A 3ZSUA 2XS1A 4Q5SF 3ABKC 5JUAA 2VCCA 3LEOA 3PCVA 3US6A 3ZIBA 4ANJA 4OD5A 5KYWA 2HZ8A 4YWQA 2XXAA 3VRCA 5A6AA 3NMKA 4Z9JA 2YL3A 1YYXA 2MHRA 4NQFA 2KC3A 3F46A 256BA 5L0CA 4PJJA 1NU9C 4D4NA 2Z15A 4CS8C 3G50A 2A0UA 4U9DA 3W4YA 1E86A 2OOCA 3HNJA 4YT8A 5TJ5E 2H7OA 1TR2A 2HKVA 2L9JA 3ABLC 4HEAJ 4U5CE 3MLGA 3AG3C 3C63A 4FWVA 1LE2A 3ZDLA 4E7SA 3ZG1A 1OXBA 5A6KA 4LACB 5K0IA 1T9KA 3DAFA 2OEXA 4EKWA 1MNEA 1FMWA 4LLCA 3LLKA 4JIOA 4WABA 4A2NB 5T1DB 2H7BA 5L3QA 3DJNB 3TK0A 4XEKA 1U0BB 2PF4E 3KYJA 1LIHA 5EK0A 5DLJA 4E7ZA 4CIHA 5DS5A 2L6GA 3ECSA 1MMNA 1Q0MA 1O3UA 1OKKD 3U8VA 2YLGA 1CGME 3AGUA 4CDYA 2EILC 2Q3TA 2HSBA 2PBEA 3FVYA 4BEJA 4O6YA 1YZCA 1YARO 2CNWD 2XLWA 1Q0KA 2HS5A 2OQMA 4JZAA 4R32A 4XEFA 3CAXA 2P1AA 4CX9A 2F22A 3DJUB 4H54A 1GS9A 4MVRA 1M2VA
chains in the Genus database with same CATH topology
1YAUO 1YARO 3JSEO 3JRMO 1Z7Qc 3IPMO 1YA7O 1AVOB 1FNTc 3JTLO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAU O;  1YAR O;  3JSE O;  3JRM O;  1Z7Q c;  3IPM O;  1YA7 O;  1AVO B;  1FNT c;  3JTL O; 
#chains in the Genus database with same CATH topology
 4DRI B;  2WVQ A;  1H9T A;  1AUE A;  4BG0 A;  3LJB A;  3V5Y A;  3U3F A;  4BJ1 A;  3C7J A;  5AGF A;  1M2O A;  4N4W A;  4JRZ A;  3HNL A;  4W8K A;  3JYY A;  3V5Z A;  5HSW A;  1A7V A;  1YAU O;  1PD0 A;  2LK4 A;  3O10 A;  1VLS A;  4LDQ A;  4BJ5 C;  1A0B A;  3GWN A;  1K04 A;  3AOU A;  4ONS A;  1YA7 O;  3LNM B;  2YHS A;  4JCZ A;  3RVZ A;  1XZP A;  4G7H F;  4MTO A;  3EZI A;  4CJG A;  1MND A;  4I3M A;  3UGP A;  1VK5 A;  3CQZ A;  3LEV A;  3IEE A;  3LES A;  2OEV A;  1BR4 A;  2R7O A;  3I4U A;  5B1A C;  3GEH A;  4MW8 A;  3X2Q C;  4CBE A;  3C8G A;  3V5X A;  3TUL A;  2E87 A;  3OEO A;  4U5E E;  3DZA A;  1M56 C;  4ZLC A;  4JJF A;  2GWW A;  1G8X A;  5JVE A;  3GWL A;  4IGG A;  4RD9 A;  4XPX A;  3RFY A;  2W4M A;  2UUH A;  1O5H A;  4PJM A;  2D5R B;  2J7P A;  3RIP A;  2YQY A;  3EJN A;  5F5F A;  1HMO A;  4MVS A;  1RJ9 A;  4WJ0 A;  1BR2 A;  4KNW A;  2HV7 A;  4CS9 A;  1SF8 A;  3RQG A;  1ZHZ A;  2MWQ A;  1JAF A;  1WN0 A;  1G4U S;  2XLO A;  3DMD A;  5JSL A;  3W2V A;  3R7C A;  2J46 A;  1WWP A;  4Q7C A;  4QI0 A;  4KBL A;  2G3V A;  3RQF A;  3KMI A;  1KTM A;  1Z3I X;  3AQC A;  5E3C A;  3NRH A;  3ZTZ A;  3HKK A;  3L8J A;  3NYL A;  2KQ9 A;  2R25 A;  3UMK A;  4N6H A;  2Q9B A;  2XM4 A;  2YZS A;  4J7Y A;  3DE9 A;  4JEA A;  4CDV A;  3EG9 B;  1T6I A;  2KK1 A;  3ZTM A;  4PJL A;  3RW0 A;  3A11 A;  4G0H A;  1RKC A;  2ZD9 A;  1Z5Z A;  2XL6 A;  4DVY P;  3FHD A;  1Q0G A;  5DS6 A;  5KYX A;  1CGN A;  2LP4 A;  4QI2 A;  5CI8 A;  4CS7 A;  3HNI A;  1ZYR F;  2R7U A;  1MMG A;  3EZH A;  5E3A A;  2QE9 A;  1U6H A;  4PR9 A;  1IW7 F;  3ZWI A;  2XRH A;  1C02 A;  4GQH A;  5JT4 A;  1R5I D;  3ASO C;  4JVS A;  3TQO A;  3H2U A;  3RQE A;  1YYJ A;  3RH3 A;  2ZPA A;  3Q7L A;  2YVK A;  3NDB B;  2KSF A;  2LQG A;  4JUR I;  1HMD A;  1TKN A;  4CS8 A;  2OJE D;  2J9U A;  4QDL A;  3NMI A;  1YVI A;  1OCR C;  3K1I A;  2HFI A;  3IQ6 A;  1DOV A;  2AWC A;  2YL0 A;  4O79 A;  4YJW A;  3JYH A;  3U2M A;  4OIR F;  2Q9C A;  3MFN A;  4HFF B;  2HV6 A;  2KNH A;  5JLI A;  4K0D A;  4C7O B;  2AU5 A;  2J9B A;  1CPR A;  1Q0F A;  2AWY A;  3A9C A;  2CGE A;  3ZQY A;  1H7I A;  2DYR C;  4MS2 A;  1E85 A;  4I1O B;  4A4A A;  5F28 E;  4CIP A;  3Q6N A;  2Y39 A;  5KYN A;  4IWB A;  4F4B A;  2NSF A;  1N1C A;  4M63 A;  1VTM P;  1ZHY A;  2JD3 A;  2EPM X;  3U8P A;  4CJO A;  2DGJ A;  3ZQV A;  5A6J A;  1APC A;  4NTA A;  1HE9 A;  1QPU A;  3MX3 A;  3TJ5 A;  1OKK A;  1H6G A;  2HMQ A;  2PP4 A;  1D1B A;  2R9R B;  2X0C A;  2X51 A;  3IQT A;  5FCL A;  3SNH A;  2Y3B A;  2NUP A;  1CPQ A;  2AVK A;  3M4B A;  1EQ1 A;  3G4X A;  2BC5 A;  2CNW A;  2A69 F;  3DWW A;  3BRJ A;  4Z9H A;  5B1B C;  2XL4 A;  3C18 A;  4WGY A;  1QSP A;  2R7Q A;  1S05 A;  1FFT C;  2XLV A;  5B3S C;  1WOL A;  1MQV A;  2EPO A;  3DD7 A;  1C03 A;  2A1D D;  1VMA A;  1YZA A;  2GDC A;  3HNK A;  4XTK A;  3ZVR A;  4OD4 A;  3UMI A;  3AGT A;  2LIG A;  3SXM A;  2L6H A;  2Q4F A;  3EG9 A;  2OKU A;  3SXK A;  3GM1 A;  2CW0 F;  1M6T A;  3LLI A;  3IHU A;  1L7C A;  3S9O A;  2P0N A;  3LNR A;  4PJN A;  4JCH A;  2VAS A;  1SMY F;  2QTV A;  3KH2 A;  3TD7 A;  1TQG A;  3GEE A;  5L0I A;  4K1O A;  3X1O A;  5KYY A;  2LD6 A;  1FR0 A;  1TFK B;  4EBK A;  2R7X A;  2C03 A;  3VM6 A;  1BR1 A;  2QNL A;  3U0C A;  2HJM A;  3GM3 A;  1A41 A;  2KW3 C;  2EIN C;  1E2X A;  3C8Z A;  2CCY A;  4X0R A;  3SP1 A;  5JRA A;  1EI7 A;  2P6V A;  3N0T A;  2J45 A;  1D0Z A;  3GM2 A;  3JZ0 A;  3K33 A;  4G78 A;  4MVU A;  4O6M A;  3IPM O;  4AE4 B;  1OCC C;  3NKE A;  3T6B A;  1Z63 A;  4B6I A;  2OU6 A;  5L0H A;  1JMW A;  1GM5 A;  3EGD B;  3FOO A;  4XQ1 A;  2R7W A;  2XLH A;  2R7S A;  1G4W R;  1T6Q A;  2EIK C;  4BPM A;  3H2V A;  5EHH A;  1ZHT A;  3B9Q A;  3EFO B;  5A69 A;  5KYU A;  1WTY A;  5COG A;  3B0U X;  2HUJ A;  2WL8 A;  4KC9 A;  1HE1 A;  1RXQ A;  1LS4 A;  4NTF A;  1ST6 A;  3L34 A;  3GEI A;  1JRA A;  4DOZ A;  3E70 C;  3HTK C;  1GQA A;  3NG1 A;  1FNT c;  4CSA C;  2OG2 A;  2IXN A;  4MTF A;  4W8P A;  5A6B D;  4HFK B;  4O6N A;  2V3C C;  5E33 A;  1GGQ A;  2M4E A;  3MYI A;  4HE8 D;  4IAQ A;  5GPG B;  3R2P A;  4H4K C;  1NFN A;  1RKE B;  4L6R A;  2UUI A;  2YLI A;  2EIM C;  1O87 A;  3S29 A;  3CZ6 A;  2H7V C;  1HW2 A;  1A7E A;  2Y3G A;  2YKZ A;  4BJ6 A;  2IXO A;  4LER A;  2B0J A;  4UDV A;  1Z23 A;  2LFF A;  3QW0 A;  4J32 B;  3U9M A;  5D91 A;  4LLE A;  3RF3 A;  2XXA B;  3JSZ A;  1LI7 A;  3KPH A;  5IY5 C;  3GOR A;  2P61 A;  5T3W A;  1WAS A;  2IBF A;  4MND A;  5COM A;  3L8I A;  4XLP F;  3WOD F;  4XWJ A;  5CI9 A;  2J8W A;  3W2W A;  4GYT A;  2CYD A;  1T6U A;  5BQH A;  3MBG A;  4P6I C;  3FMS A;  3C8G D;  1ORS C;  3KYI A;  4C3E A;  1UFB A;  1TWH A;  4K7B A;  3QVZ A;  5AC4 A;  2DI3 A;  2WVN A;  3K66 A;  3ATP A;  3LS0 A;  4IRU A;  4YT4 A;  1NFO A;  1VYK A;  1FFH A;  1LS1 A;  1PD1 A;  2VB6 A;  2J7P D;  4LDR A;  3EPV A;  5DS4 A;  2L7A A;  4I44 A;  3RKO F;  3FAP B;  3QZC A;  3ZC4 A;  3PDM P;  1BDJ B;  2HSQ A;  1MMA A;  3JTL O;  2R02 A;  3HJC A;  5JS5 A;  4EUK B;  2YRF A;  4JEB A;  3DM9 B;  1LI5 A;  2YLD A;  4JTD B;  1QQ3 A;  1ZW3 A;  2A0B A;  4EBB A;  2A6E F;  1E83 A;  1ZHX A;  2CDQ A;  3M4C A;  1U89 A;  3EGD A;  3CSK A;  4U5G A;  4JJG A;  3O55 A;  3T9O A;  1V55 C;  4PAC A;  3DI5 A;  1MMD A;  1W2W A;  3B71 A;  3N24 A;  4JC7 A;  3M15 A;  3DXJ F;  3M1C B;  3WAQ A;  1YLM A;  4O7G A;  1R4T A;  1VYI A;  4CDA A;  4JTA B;  2L81 A;  3SXZ A;  2XS8 A;  3FOP A;  2WVO A;  5L3V A;  1Y4C A;  2MYS A;  2W4B A;  2M64 A;  3MYF A;  5DQT A;  1FTS A;  1QVX A;  2ICW G;  4Z9I A;  1OR3 A;  2Q00 A;  1I5N A;  4DRJ B;  1JPN A;  1ORY A;  2HJ3 A;  3TOM A;  1EA8 A;  2XSE A;  2R7V A;  2ZXR A;  1BBH A;  4G7O F;  2PX3 A;  2EPK X;  2PNO A;  1RKE A;  5BQI A;  4BJT A;  3C8G B;  1QLE C;  2RD9 A;  4WGZ A;  3Q6M A;  3QTH A;  2IM8 A;  1K05 A;  1ZZP A;  1V4A A;  2EPL X;  3F47 A;  1YJG A;  2PFD A;  4IB4 A;  3C62 A;  4J7T A;  4EBJ A;  3O6X A;  1OCO C;  1VOM A;  2ETS A;  2R03 A;  4BJ5 A;  1WAT A;  2YEV A;  3EH1 A;  5D92 A;  5KYY B;  1LVK A;  1VB5 A;  1RJ9 B;  3UR3 C;  1NLX A;  3UGO A;  1M57 C;  2LFD A;  2W9Y A;  2XL8 A;  5L0J A;  3PHF 2;  1QKR A;  1V74 B;  4YL1 A;  5COF A;  3LS1 A;  3JSE O;  4MQ9 F;  2VC9 A;  3IQ5 A;  1NBB A;  3EGX B;  2XLM A;  3K1I C;  3AJM A;  2IOQ A;  4NTB A;  1S7Z A;  3W8I A;  1NU7 D;  2GA0 A;  1SZI A;  4OIO F;  2DYS C;  4XLN F;  1JOG A;  2R7R A;  4ULV A;  2XM0 A;  3J06 A;  4JTC B;  4P9T A;  2NUT B;  3T6J A;  3OA1 A;  4AL1 A;  1RMV A;  2IXM A;  5FZT A;  2KYH A;  4CSA A;  3AQB A;  3QMK A;  4FAP B;  3FDQ A;  1B68 A;  2WZL A;  4GEH A;  4U5F E;  2L6F A;  3S90 A;  4Q4Z F;  2A6H F;  2VCA A;  1J8Y F;  1AVO B;  1ZHW A;  3ASN C;  3T4R A;  4YN0 B;  5L0F A;  2R7T A;  3RYL A;  3W8H A;  3SXY A;  1TWA A;  2Q9A A;  3NMJ A;  3QVY A;  4U5D E;  5KYX B;  5HV9 A;  4OIQ F;  4P9F A;  4YT2 A;  5A6B A;  1DOW A;  1D0Y A;  1EKY A;  4AX2 A;  3S0X A;  1BZ4 A;  2H8A A;  2O9X A;  2TMV P;  1A7D A;  1C17 M;  3DKA A;  1RCP A;  2ASR A;  3PMR A;  1ORJ A;  5L0D A;  2I15 A;  4YL3 A;  3B29 A;  3BEH A;  4U5B E;  1XZQ A;  2NSG A;  3AG4 C;  4DJ9 A;  2HMZ A;  1J8M F;  3AG2 C;  2OJQ A;  2G3K A;  4ULW A;  1NSG B;  1IZM A;  1ZU4 A;  3FXH A;  4E0I A;  3UNG C;  4LDK A;  2IXP A;  2YL7 A;  3EHN A;  1LPE A;  2V26 A;  3K1H A;  3ABM C;  2FGY A;  2KGO A;  4RDA A;  4EHP A;  3U3B A;  4G7Z F;  4D4X A;  1AEP A;  3SZR A;  4KNV A;  2A68 F;  3NYJ A;  4PFP A;  4N6C A;  3V7O A;  3VYW A;  5L0G A;  3Q7G A;  1NG1 A;  1I4Y A;  3DM5 A;  3K7D A;  2B0H A;  3NYM A;  3B0P A;  1ZW2 A;  3N2Z B;  4IJJ A;  1T01 A;  5EGY A;  4MTG A;  2J9W A;  1Z6A A;  1VLT A;  1G5Z A;  1TWG A;  3EH2 A;  3O39 A;  1LE4 A;  2QY9 A;  3QW1 A;  1F1M A;  2VCB A;  1OQC A;  1SYQ A;  2D4U A;  3VF0 A;  5BUO A;  2J0X A;  2LSE A;  2WZG A;  3H65 A;  3L1M A;  4MVO A;  4KI2 A;  4C7O A;  4YT5 A;  1KU2 A;  3S28 A;  4EWC A;  2R05 A;  5KYW B;  4J30 B;  1HW1 A;  1FAP B;  2G62 A;  3IQC A;  4FX5 A;  4IAO A;  1CGO A;  3DAG A;  2GAQ A;  1UG7 A;  2WZF A;  3GAN A;  4I1M A;  1FMV A;  2FAP B;  3JRM O;  3M79 A;  3EQL F;  2NPU A;  4U9E A;  3JT1 A;  4YK5 A;  3WG7 C;  4BEM J;  4DBQ A;  5CIV A;  1NZE A;  2WB7 A;  2Y69 C;  3EHM A;  4FES A;  5F5H A;  3B0V C;  1PCX A;  2ZXP A;  4U5H A;  4RBN A;  4YL0 A;  1D0X A;  3E9V A;  3NKD A;  4MVM A;  2NUP B;  1D1A A;  3POV A;  2NG1 A;  3EGX A;  1OCZ C;  1JR8 A;  3FAJ A;  1I4Z A;  1KNY A;  3I5P A;  1XWJ A;  4NCQ A;  3VAY A;  2AP3 A;  3K6B A;  4N06 A;  3KL4 A;  1YDI A;  1Z7Q c;  3TJ6 A;  4DXW A;  3U9J A;  2W45 A;  3RVY A;  2I8B A;  1Y6D A;  2NUT A;  4PFO A;  2LCH A;  3KKB A;  4AK9 A;  4DVZ A;  2DB4 A;  5BQG A;  4E17 A;  2JX0 A;  1V54 C;  1LM3 B;  4JW1 A;  5T3T A;  2C04 A;  1SR2 A;  2XLE A;  4NC3 A;  4DRH B;  3AG1 C;  3U2L A;  4XPY A;  1YA9 A;  4MW3 A;  1HY5 A;  4C3D A;  4MVQ A;  2BL2 A;  4AE4 A;  1L3P A;  1T5O A;  3L0I A;  2J0W A;  5KYU B;  4IAR A;  1ZVZ A;  1LKX A;  2EPN A;  2PX0 A;  3CEX A;  3ITF A;  1OW7 A;  2YL1 A;  3UMH A;  3U5S A;  4CS9 C;  4E0H A;  4EIY A;  4JKV A;  2ZXW C;  1M2V B;  1TWC A;  2ZXO A;  4C3B A;  4E18 A;  3EFO A;  1JPJ A;  4ER9 A;  2Q7R A;  2FFH A;  3SEO A;  3TOL A;  1ZU5 A;  2JPU A;  1Q0D A;  3LUT B;  1OR2 A;  2VH3 A;  4BJ6 C;  1WGW A;  1D1C A;  1E84 A;  2J9V A;  2Y3D A;  1OW8 A;  5AC5 A;  3DE8 A;  2YWA A;  3JCU Q;  3OWT A;  4XPW A;  3GOD A;  5DVW A;  2OCC C;  2BE5 F;  5JP7 A;  3SYN A;  1H9G A;  3WHN A;  4PK4 A;  1TFO B;  1OW6 A;  3T6G B;  5B3I A;  3LAY A;  5DQZ A;  2QUP A;  4JE9 A;  1OXK A;  4DBR A;  2XLD A;  4OIP F;  5E2Q A;  4ZLD A;  2Y3H A;  1K40 A;  3G4Z A;  4NY3 A;  2KJG A;  3HLZ A;  4XEV A;  2EIJ C;  2P7V A;  3I5Q A;  3S27 A;  4AL0 A;  4OIN F;  2RSE B;  1PV3 A;  2QLA A;  2IYL D;  4MVZ A;  3JRT A;  2GFH A;  1QZX A;  3S84 A;  3ZSU A;  2XS1 A;  4Q5S F;  3ABK C;  5JUA A;  2VCC A;  3LEO A;  3PCV A;  3US6 A;  3ZIB A;  4ANJ A;  4OD5 A;  5KYW A;  2HZ8 A;  4YWQ A;  2XXA A;  3VRC A;  5A6A A;  3NMK A;  4Z9J A;  2YL3 A;  1YYX A;  2MHR A;  4NQF A;  2KC3 A;  3F46 A;  256B A;  5L0C A;  4PJJ A;  1NU9 C;  4D4N A;  2Z15 A;  4CS8 C;  3G50 A;  2A0U A;  4U9D A;  3W4Y A;  1E86 A;  2OOC A;  3HNJ A;  4YT8 A;  5TJ5 E;  2H7O A;  1TR2 A;  2HKV A;  2L9J A;  3ABL C;  4HEA J;  4U5C E;  3MLG A;  3AG3 C;  3C63 A;  4FWV A;  1LE2 A;  3ZDL A;  4E7S A;  3ZG1 A;  1OXB A;  5A6K A;  4LAC B;  5K0I A;  1T9K A;  3DAF A;  2OEX A;  4EKW A;  1MNE A;  1FMW A;  4LLC A;  3LLK A;  4JIO A;  4WAB A;  4A2N B;  5T1D B;  2H7B A;  5L3Q A;  3DJN B;  3TK0 A;  4XEK A;  1U0B B;  2PF4 E;  3KYJ A;  1LIH A;  5EK0 A;  5DLJ A;  4E7Z A;  4CIH A;  5DS5 A;  2L6G A;  3ECS A;  1MMN A;  1Q0M A;  1O3U A;  1OKK D;  3U8V A;  2YLG A;  1CGM E;  3AGU A;  4CDY A;  2EIL C;  2Q3T A;  2HSB A;  2PBE A;  3FVY A;  4BEJ A;  4O6Y A;  1YZC A;  1YAR O;  2CNW D;  2XLW A;  1Q0K A;  2HS5 A;  2OQM A;  4JZA A;  4R32 A;  4XEF A;  3CAX A;  2P1A A;  4CX9 A;  2F22 A;  3DJU B;  4H54 A;  1GS9 A;  4MVR A;  1M2V A; 
#chains in the Genus database with same CATH homology
 1YAU O;  1YAR O;  3JSE O;  3JRM O;  1Z7Q c;  3IPM O;  1YA7 O;  1AVO B;  1FNT c;  3JTL O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...