3JRMO

Crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEADNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGTDHMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome subunit alpha
publication title Structural models for interactions between the 20S proteasome and its PAN/19S activators.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 87
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3jrmO01
3JRMO 1YAUO 3IPMO 1FNTc 3JSEO 1AVOB 1YARO 1Z7Qc 3JTLO 1YA7O
chains in the Genus database with same CATH superfamily
1CPRA 1RKEA 1FNTc 1WASA 3LS0A 3SYNA 3LNMB 4MW3A 2LQGA 2YLGA 1ORSC 3QVZA 3OA1A 3ZDLA 4C3BA 1QLEC 4H54A 2R7WA 2KW3C 3DD7A 2YL0A 2YL3A 1C02A 1H9GA 2H7OA 3N0TA 4GQHA 4QI0A 1AVOB 5DS4A 4O7GA 2HV7A 3JT1A 3ZWIA 5BQGA 1B68A 4BJ1A 1IW7F 1OCOC 1NFNA 1OR2A 4PACA 5IY5C 2YLIA 1JAFA 3Q6NA 4JCHA 1Z63A 3JRMO 3IPMO 3FDQA 2UUIA 1RMVA 2JX0A 2IXNA 4ANJA 3IQCA 2VB6A 3HNKA 4AE4B 4JTDB 3W8IA 4CS8A 3HNIA 5AGFA 2J9UA 3NMIA 2CCYA 1U0BB 2WVQA 4I44A 5D92A 3HTKC 1VLSA 2QE9A 1GQAA 4MQ9F 1M2VB 2YLDA 2F22A 3HNJA 4BEJA 1YARO 2Y3DA 4PJLA 2W4MA 5T3TA 3ZQVA 4CSAC 2HZ8A 2RSEB 1Z5ZA 2QTVA 3UGPA 1O3UA 5DS6A 2A6EF 2AU5A 1XWJA 3G4ZA 4FX5A 5KYUA 3X2QC 2R7TA 2VH3A 2XXAB 3S27A 2P61A 1XZPA 2L6FA 3K1IA 4JVSA 4E0HA 3G4XA 4BJ5A 2H8AA 5A6JA 2Q9CA 1D1BA 2G3VA 4OIQF 2OU6A 4PJNA 5K0IA 1W2WA 4G7HF 2NSFA 4DXWA 4IWBA 5KYXA 2P0NA 2WVOA 5E2QA 3U9JA 5A6BA 1H9TA 4BJTA 2KK1A 3TD7A 5E33A 2EPMX 4MVRA 4DOZA 4WGYA 3LLIA 3CZ6A 4D4XA 3KH2A 2OOCA 3NKEA 2DYSC 1G4US 3NDBB 2V26A 1OCCC 2LCHA 4PJMA 3NMKA 4PFPA 1K40A 1G4WR 1YA7O 2RD9A 3HLZA 4MVMA 1D1AA 2EIJC 1HY5A 1ZHXA 3T6GB 3GM3A 3MFNA 1LIHA 3DAGA 5FZTA 1PCXA 5L3VA 1MMNA 3R7CA 4IAQA 4OD4A 2YL7A 2JD3A 2W9YA 1KTMA 1G8XA 2VC9A 3PCVA 3S29A 3C63A 3KPHA 3S0XA 2XLVA 4JJFA 2TMVP 1LPEA 1OR3A 3OWTA 3V7OA 1EQ1A 1MMAA 1RKEB 4DJ9A 1YYJA 1A7EA 2NUPA 4GYTA 1T6IA 4E18A 4EBJA 5BQIA 3EH2A 2BE5F 1D0ZA 2LK4A 2EINC 3DXJF 3TJ5A 1HW1A 1V4AA 2XL6A 1DOWA 1RCPA 1A7DA 2GDCA 2GWWA 4RD9A 3U3BA 5A6KA 3PHF2 3AGTA 3RF3A 2LP4A 1ZHZA 3DWWA 4U5FE 4P9TA 2B0JA 2OQMA 3NG1A 1LE4A 2OEVA 1GGQA 3LESA 4U5GA 2YVKA 1OXKA 1S05A 3NMJA 4NCQA 3SXKA 4CX9A 3AG2C 3T9OA 4PK4A 4CBEA 1M57C 1VYKA 4YL1A 2HJ3A 3GODA 1ZYRF 1QZXA 4XEFA 1VB5A 1FFHA 1K05A 3NYJA 4AK9A 2Y3GA 4N6HA 3U2LA 3U8PA 1JRAA 1S7ZA 3B0VC 1TWGA 4DRIB 1WWPA 4CDYA 3TQOA 1O87A 1D0XA 4AL0A 3EQLF 4IB4A 4MVZA 4U5CE 4Z9IA 1T9KA 2EPKX 3L8JA 4P6IC 4CIPA 2CYDA 2FGYA 3C8ZA 1QQ3A 256BA 5COMA 1LS1A 3JSEO 2DGJA 1MNDA 2V3CC 3B71A 1G5ZA 2KC3A 5A6BD 2CGEA 1VYIA 5KYUB 2A68F 2Z15A 1Y6DA 2W45A 5KYWB 1AEPA 4XEVA 2P7VA 4U5DE 3UMKA 3CQZA 4MVQA 4KI2A 1TWCA 2AVKA 3LAYA 2MHRA 2XLEA 4KNWA 4YL3A 4IAOA 4XPWA 4CS7A 4RBNA 1YAUO 2AWYA 3IQTA 3V5YA 3KL4A 2Q00A 4CS8C 4PJJA 3MYIA 5KYXB 4P9FA 3QTHA 3ASNC 3CSKA 2PX0A 1VOMA 2DB4A 3ZIBA 4B6IA 1XZQA 1E85A 3MBGA 3J06A 3RIPA 4LLEA 2H7BA 2ZXOA 1E84A 5E3AA 1D0YA 3LEOA 2VASA 4XLNF 2Q3TA 2VCCA 2R25A 4U5EE 2ZXPA 2XLDA 1SZIA 3EZIA 5FCLA 2D4UA 4Z9JA 5JUAA 3GEIA 3ASOC 2A6HF 2L7AA 2W4BA 4G7ZF 3JCUQ 4BJ5C 3T6JA 1OKKA 3M1CB 2XS8A 3DMDA 1OQCA 3HNLA 4I1MA 1BDJB 5AC4A 1ZHWA 3A11A 4CS9A 3K33A 5L0HA 2ZXWC 3U3FA 3QMKA 1T6UA 1BR2A 2CNWA 1A7VA 4Z9HA 1Z3IX 2DYRC 3U2MA 5E3CA 2PFDA 1WTYA 3ECSA 4W8KA 3HKKA 3BEHA 2ICWG 3JTLO 2NUPB 3B9QA 4JW1A 3SZRA 4PR9A 4R32A 1E86A 4BJ6A 3JRTA 4JE9A 3EG9B 3V5ZA 3OEOA 3ZVRA 1CGOA 1YZAA 3C8GA 1M56C 2GA0A 1T5OA 1YJGA 4ULVA 3S84A 3GEHA 1SYQA 5CIVA 5TJ5E 2KQ9A 3KYJA 3UMHA 4E7SA 2EPLX 1MNEA 3DKAA 3VRCA 3K1HA 2M4EA 4M63A 5D91A 4MTGA 2NSGA 2PNOA 3L0IA 2EPNA 2KJGA 4XEKA 1R5ID 2KNHA 3UR3C 5BQHA 2C04A 5T1DB 4CJOA 3EZHA 1LM3B 3SEOA 1ZHYA 3EH1A 2J9VA 4JTCB 2KYHA 2R05A 4LDRA 2LFDA 4UDVA 1C03A 2AP3A 2NUTA 1EI7A 1WATA 3RQGA 4JZAA 4LDQA 5DVWA 4CIHA 2GFHA 4J30B 1RJ9A 3AG3C 3K6BA 3RVYA 5L0JA 3WAQA 1J8MF 1NSGB 4KC9A 4QI2A 1NU9C 4IRUA 5A69A 1VK5A 3WG7C 5JLIA 3SNHA 2XLOA 4XPYA 3QW1A 5B3IA 3O6XA 2YL1A 3A9CA 4Q7CA 3FOPA 5CI9A 3EGXA 4N4WA 4MVSA 1JMWA 3JZ0A 1BZ4A 1QKRA 3F46A 2R7RA 3ITFA 1NG1A 1ZU4A 1Z23A 2HMQA 3RKOF 1ORYA 3I5QA 5KYNA 1KU2A 2XL4A 1YA9A 4J7TA 1VLTA 4NTAA 5CI8A 5F28E 2I8BA 1YDIA 1VTMP 3VAYA 1OW7A 4MTFA 1ORJA 3AG4C 1HMDA 2G62A 3C18A 3DE8A 3BRJA 3IQ6A 4FAPB 1EA8A 4W8PA 1LE2A 3EJNA 2I15A 2WZFA 1D1CA 1OW6A 2UUHA 3VM6A 4YT4A 1FFTC 1OKKD 2D5RB 2R7SA 4BPMA 4CDAA 3PMRA 2R7UA 1K04A 4U9EA 1BR1A 5L0DA 3ZG1A 3ZSUA 1PD0A 2WZGA 4OIOF 2CW0F 3HJCA 4JEAA 2CNWD 1WOLA 4AE4A 4MS2A 1TR2A 3B0PA 4HEAJ 5BUOA 1KNYA 3SXZA 2Q9BA 2R7OA 4IGGA 3RQFA 3TOMA 3QZCA 4EHPA 3W2WA 2XRHA 4YT8A 2OEXA 2YKZA 3VYWA 3PDMP 4HFFB 4XPXA 4C3EA 2XLHA 4H4KC 2XM0A 1E2XA 5AC5A 2R7VA 3GWLA 1RKCA 1FTSA 3JYHA 1V54C 4A4AA 4Q5SF 1MQVA 3C8GD 3H2UA 4K7BA 5B1BC 1FMVA 2J46A 5F5HA 1NLXA 1LVKA 2BL2A 1ZHTA 2PX3A 3DJUB 4NTBA 1OW8A 2YRFA 1ZW2A 3EPVA 3V5XA 1IZMA 4C3DA 1O5HA 2R03A 2L6GA 3E70C 2BC5A 2YQYA 3GEEA 4E0IA 4XLPF 4OD5A 1TWHA 3KMIA 3AQBA 2FFHA 2XL8A 4NTFA 1TKNA 2HJMA 3L8IA 3AG1C 2J9BA 3F47A 3C8GB 3ATPA 5JT4A 4E17A 3DE9A 1BBHA 5JP7A 5DQZA 3IHUA 1TFKB 1PV3A 1ZVZA 1UFBA 2B0HA 4WJ0A 4CSAA 4K1OA 3I4UA 3WODF 1QVXA 3RFYA 4C7OA 5EGYA 4DRJB 5L0CA 3MX3A 5T3WA 2EILC 3RW0A 2PP4A 3GM1A 4ZLCA 2HKVA 1LI5A 1TFOB 2X0CA 3TULA 2GAQA 1HE1A 2ZD9A 3G50A 3B29A 4EWCA 2ASRA 2A1DD 4DBQA 2NUTB 3ABMC 4KBLA 2WZLA 4AL1A 3S90A 4MVOA 1FMWA 3Q6MA 3L34A 4MW8A 5COFA 1RJ9B 1OCZC 4N06A 1JPJA 2XLMA 2Y69C 3FOOA 3VF0A 3W8HA 1QPUA 3X1OA 2ZXRA 1M6TA 1FR0A 3GM2A 3LS1A 2HSQA 3TOLA 1PD1A 1GS9A 3POVA 3GANA 2NPUA 1Q0MA 5JRAA 2HUJA 4JURI 3WHNA 3T4RA 1SMYF 2KGOA 2XLWA 3K1IC 3KKBA 4L6RA 1WN0A 2O9XA 2QY9A 3NYLA 4XWJA 3RYLA 3ZQYA 4I3MA 1GM5A 2R7QA 4MTOA 1LKXA 2C03A 4JKVA 2ETSA 4YN0B 4DVZA 4YL0A 4A2NB 3TJ6A 3ZC4A 4OINF 4CJGA 1HMOA 1UG7A 3IEEA 4KNVA 4CDVA 1LS4A 1NBBA 1Q0GA 3GWNA 4FESA 3SP1A 2EIMC 3O55A 2MWQA 2VCAA 4XQ1A 4JC7A 1SR2A 4E7ZA 1QSPA 3MYFA 1ST6A 1JR8A 3AGUA 3FAJA 1SF8A 1AUEA 2J0XA 4G78A 2J7PA 4JRZA 3MLGA 4F4BA 3C7JA 2LFFA 5L0FA 5JS5A 1OXBA 1J8YF 4NY3A 4O6YA 1YLMA 4J32B 1I4ZA 1YVIA 2Y3HA 2IXOA 1OCRC 3LLKA 3TK0A 3EGDA 3IQ5A 4ONSA 3U5SA 1JPNA 3K66A 3I5PA 3AOUA 2OKUA 2XM4A 4LLCA 1A41A 1L3PA 2Q7RA 1CGME 1VMAA 1R4TA 1H7IA 2IXPA 2Y39A 3RVZA 1HE9A 3L1MA 4MVUA 3S28A 5F5FA 2QLAA 4JEBA 2PBEA 2YZSA 3DZAA 5EK0A 2OJQA 3O39A 4HFKB 4DVYP 1NFOA 2EIKC 1NU7D 1C17M 1Q0DA 3US6A 5HV9A 1U89A 3M4CA 4U9DA 1ZZPA 4U5BE 5KYYA 3DJNB 2HV6A 1YZCA 4J7YA 4O6MA 2MYSA 2G3KA 4QDLA 1F1MA 3EFOA 5L0IA 5COGA 3AJMA 2IBFA 3LJBA 2L9JA 4IJJA 1M2OA 4EBBA 4YK5A 2FAPB 3M4BA 3FXHA 5A6AA 3UNGC 2XS1A 4O79A 1NZEA 1CGNA 3Q7GA 2R7XA 2R9RB 2XSEA 1MMDA 1WGWA 1APCA 1ZW3A 4IARA 4G7OF 2P6VA 4D4NA 3H65A 3UMIA 4C7OB 3LUTB 3QVYA 2IOQA 2WVNA 4LERA 2HS5A 3DAFA 3JSZA 3R2PA 4JJGA 1Q0FA 1Z6AA 2Y3BA 3ABKC 3U8VA 3NRHA 1BR4A 4WGZA 4G0HA 3W2VA 3NKDA 1V55C 4JTAB 3DI5A 2YWAA 1LI7A 3AQCA 4EUKB 5HSWA 2A0BA 2Q9AA 4ER9A 1V74B 2J8WA 4FWVA 2P1AA 1TWAA 1HW2A 5KYWA 1Q0KA 2EPOA 2OCCC 5JSLA 3U0CA 2JPUA 5B1AC 1H6GA 3SXYA 2WL8A 4EIYA 2LSEA 4LACB 1U6HA 4N6CA 2QNLA 3DM5A 2AWCA 3JYYA 4YWQA 4DRHB 4K0DA 4BEMJ 4O6NA 1JOGA 3LEVA 5DQTA 4PFOA 3RQEA 1DOVA 2IXMA 3C62A 4NQFA 1I5NA 2IYLD 3H2VA 2ZPAA 3M15A 1M2VA 4LDKA 3S9OA 4EKWA 2J9WA 3ZTMA 2J7PD 3RH3A 4EBKA 5GPGB 3EG9A 4DBRA 4XTKA 5EHHA 2E87A 2M64A 1EKYA 2YHSA 2XXAA 1Y4CA 2VCBA 3T6BA 5B3SC 2HFIA 3LNRA 2LIGA 1N1CA 1FAPB 3DM9B 3KYIA 2H7VC 2HMZA 2LD6A 4AX2A 4OIPF 3CAXA 1CPQA 1TQGA 3Q7LA 3QW0A 2L81A 3O10A 5JVEA 4Q4ZF 4I1OB 2J0WA 1E83A 4U5HA 3CEXA 2A69F 4MNDA 3EGDB 4YT5A 4OIRF 2OJED 4X0RA 3EHMA 2IM8A 2Q4FA 4RDAA 1A0BA 2J45A 4YT2A 1T01A 5DS5A 2L6HA 4GEHA 1I4YA 4CS9C 3FAPB 2DI3A 4ULWA 1Z7Qc 1L7CA 2X51A 3E9VA 1MMGA 4BG0A 4WABA 5DLJA 2HSBA 3M79A 3N2ZB 3W4YA 5L3QA 3B0UX 1T6QA 2NG1A 3GORA 2PF4E 4JIOA 4ZLDA 4YJWA 1ZU5A 3NYMA 3SXMA 3ZTZA 3N24A 5KYYB 3K7DA 4BJ6C 4HE8D 2QUPA 2OG2A 2R02A 3ABLC 3EFOB 3FVYA 3UGOA 1RXQA 3FMSA 5L0GA 2A0UA 2YEVA 3FHDA 2WB7A 3EHNA 2KSFA 2CDQA 1YYXA 3EGXB 3U9MA 4JCZA 4NC3A
chains in the Genus database with same CATH topology
3JRMO 1YAUO 3IPMO 1FNTc 3JSEO 1AVOB 1YARO 1Z7Qc 3JTLO 1YA7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRM O;  1YAU O;  3IPM O;  1FNT c;  3JSE O;  1AVO B;  1YAR O;  1Z7Q c;  3JTL O;  1YA7 O; 
#chains in the Genus database with same CATH topology
 1CPR A;  1RKE A;  1FNT c;  1WAS A;  3LS0 A;  3SYN A;  3LNM B;  4MW3 A;  2LQG A;  2YLG A;  1ORS C;  3QVZ A;  3OA1 A;  3ZDL A;  4C3B A;  1QLE C;  4H54 A;  2R7W A;  2KW3 C;  3DD7 A;  2YL0 A;  2YL3 A;  1C02 A;  1H9G A;  2H7O A;  3N0T A;  4GQH A;  4QI0 A;  1AVO B;  5DS4 A;  4O7G A;  2HV7 A;  3JT1 A;  3ZWI A;  5BQG A;  1B68 A;  4BJ1 A;  1IW7 F;  1OCO C;  1NFN A;  1OR2 A;  4PAC A;  5IY5 C;  2YLI A;  1JAF A;  3Q6N A;  4JCH A;  1Z63 A;  3JRM O;  3IPM O;  3FDQ A;  2UUI A;  1RMV A;  2JX0 A;  2IXN A;  4ANJ A;  3IQC A;  2VB6 A;  3HNK A;  4AE4 B;  4JTD B;  3W8I A;  4CS8 A;  3HNI A;  5AGF A;  2J9U A;  3NMI A;  2CCY A;  1U0B B;  2WVQ A;  4I44 A;  5D92 A;  3HTK C;  1VLS A;  2QE9 A;  1GQA A;  4MQ9 F;  1M2V B;  2YLD A;  2F22 A;  3HNJ A;  4BEJ A;  1YAR O;  2Y3D A;  4PJL A;  2W4M A;  5T3T A;  3ZQV A;  4CSA C;  2HZ8 A;  2RSE B;  1Z5Z A;  2QTV A;  3UGP A;  1O3U A;  5DS6 A;  2A6E F;  2AU5 A;  1XWJ A;  3G4Z A;  4FX5 A;  5KYU A;  3X2Q C;  2R7T A;  2VH3 A;  2XXA B;  3S27 A;  2P61 A;  1XZP A;  2L6F A;  3K1I A;  4JVS A;  4E0H A;  3G4X A;  4BJ5 A;  2H8A A;  5A6J A;  2Q9C A;  1D1B A;  2G3V A;  4OIQ F;  2OU6 A;  4PJN A;  5K0I A;  1W2W A;  4G7H F;  2NSF A;  4DXW A;  4IWB A;  5KYX A;  2P0N A;  2WVO A;  5E2Q A;  3U9J A;  5A6B A;  1H9T A;  4BJT A;  2KK1 A;  3TD7 A;  5E33 A;  2EPM X;  4MVR A;  4DOZ A;  4WGY A;  3LLI A;  3CZ6 A;  4D4X A;  3KH2 A;  2OOC A;  3NKE A;  2DYS C;  1G4U S;  3NDB B;  2V26 A;  1OCC C;  2LCH A;  4PJM A;  3NMK A;  4PFP A;  1K40 A;  1G4W R;  1YA7 O;  2RD9 A;  3HLZ A;  4MVM A;  1D1A A;  2EIJ C;  1HY5 A;  1ZHX A;  3T6G B;  3GM3 A;  3MFN A;  1LIH A;  3DAG A;  5FZT A;  1PCX A;  5L3V A;  1MMN A;  3R7C A;  4IAQ A;  4OD4 A;  2YL7 A;  2JD3 A;  2W9Y A;  1KTM A;  1G8X A;  2VC9 A;  3PCV A;  3S29 A;  3C63 A;  3KPH A;  3S0X A;  2XLV A;  4JJF A;  2TMV P;  1LPE A;  1OR3 A;  3OWT A;  3V7O A;  1EQ1 A;  1MMA A;  1RKE B;  4DJ9 A;  1YYJ A;  1A7E A;  2NUP A;  4GYT A;  1T6I A;  4E18 A;  4EBJ A;  5BQI A;  3EH2 A;  2BE5 F;  1D0Z A;  2LK4 A;  2EIN C;  3DXJ F;  3TJ5 A;  1HW1 A;  1V4A A;  2XL6 A;  1DOW A;  1RCP A;  1A7D A;  2GDC A;  2GWW A;  4RD9 A;  3U3B A;  5A6K A;  3PHF 2;  3AGT A;  3RF3 A;  2LP4 A;  1ZHZ A;  3DWW A;  4U5F E;  4P9T A;  2B0J A;  2OQM A;  3NG1 A;  1LE4 A;  2OEV A;  1GGQ A;  3LES A;  4U5G A;  2YVK A;  1OXK A;  1S05 A;  3NMJ A;  4NCQ A;  3SXK A;  4CX9 A;  3AG2 C;  3T9O A;  4PK4 A;  4CBE A;  1M57 C;  1VYK A;  4YL1 A;  2HJ3 A;  3GOD A;  1ZYR F;  1QZX A;  4XEF A;  1VB5 A;  1FFH A;  1K05 A;  3NYJ A;  4AK9 A;  2Y3G A;  4N6H A;  3U2L A;  3U8P A;  1JRA A;  1S7Z A;  3B0V C;  1TWG A;  4DRI B;  1WWP A;  4CDY A;  3TQO A;  1O87 A;  1D0X A;  4AL0 A;  3EQL F;  4IB4 A;  4MVZ A;  4U5C E;  4Z9I A;  1T9K A;  2EPK X;  3L8J A;  4P6I C;  4CIP A;  2CYD A;  2FGY A;  3C8Z A;  1QQ3 A;  256B A;  5COM A;  1LS1 A;  3JSE O;  2DGJ A;  1MND A;  2V3C C;  3B71 A;  1G5Z A;  2KC3 A;  5A6B D;  2CGE A;  1VYI A;  5KYU B;  2A68 F;  2Z15 A;  1Y6D A;  2W45 A;  5KYW B;  1AEP A;  4XEV A;  2P7V A;  4U5D E;  3UMK A;  3CQZ A;  4MVQ A;  4KI2 A;  1TWC A;  2AVK A;  3LAY A;  2MHR A;  2XLE A;  4KNW A;  4YL3 A;  4IAO A;  4XPW A;  4CS7 A;  4RBN A;  1YAU O;  2AWY A;  3IQT A;  3V5Y A;  3KL4 A;  2Q00 A;  4CS8 C;  4PJJ A;  3MYI A;  5KYX B;  4P9F A;  3QTH A;  3ASN C;  3CSK A;  2PX0 A;  1VOM A;  2DB4 A;  3ZIB A;  4B6I A;  1XZQ A;  1E85 A;  3MBG A;  3J06 A;  3RIP A;  4LLE A;  2H7B A;  2ZXO A;  1E84 A;  5E3A A;  1D0Y A;  3LEO A;  2VAS A;  4XLN F;  2Q3T A;  2VCC A;  2R25 A;  4U5E E;  2ZXP A;  2XLD A;  1SZI A;  3EZI A;  5FCL A;  2D4U A;  4Z9J A;  5JUA A;  3GEI A;  3ASO C;  2A6H F;  2L7A A;  2W4B A;  4G7Z F;  3JCU Q;  4BJ5 C;  3T6J A;  1OKK A;  3M1C B;  2XS8 A;  3DMD A;  1OQC A;  3HNL A;  4I1M A;  1BDJ B;  5AC4 A;  1ZHW A;  3A11 A;  4CS9 A;  3K33 A;  5L0H A;  2ZXW C;  3U3F A;  3QMK A;  1T6U A;  1BR2 A;  2CNW A;  1A7V A;  4Z9H A;  1Z3I X;  2DYR C;  3U2M A;  5E3C A;  2PFD A;  1WTY A;  3ECS A;  4W8K A;  3HKK A;  3BEH A;  2ICW G;  3JTL O;  2NUP B;  3B9Q A;  4JW1 A;  3SZR A;  4PR9 A;  4R32 A;  1E86 A;  4BJ6 A;  3JRT A;  4JE9 A;  3EG9 B;  3V5Z A;  3OEO A;  3ZVR A;  1CGO A;  1YZA A;  3C8G A;  1M56 C;  2GA0 A;  1T5O A;  1YJG A;  4ULV A;  3S84 A;  3GEH A;  1SYQ A;  5CIV A;  5TJ5 E;  2KQ9 A;  3KYJ A;  3UMH A;  4E7S A;  2EPL X;  1MNE A;  3DKA A;  3VRC A;  3K1H A;  2M4E A;  4M63 A;  5D91 A;  4MTG A;  2NSG A;  2PNO A;  3L0I A;  2EPN A;  2KJG A;  4XEK A;  1R5I D;  2KNH A;  3UR3 C;  5BQH A;  2C04 A;  5T1D B;  4CJO A;  3EZH A;  1LM3 B;  3SEO A;  1ZHY A;  3EH1 A;  2J9V A;  4JTC B;  2KYH A;  2R05 A;  4LDR A;  2LFD A;  4UDV A;  1C03 A;  2AP3 A;  2NUT A;  1EI7 A;  1WAT A;  3RQG A;  4JZA A;  4LDQ A;  5DVW A;  4CIH A;  2GFH A;  4J30 B;  1RJ9 A;  3AG3 C;  3K6B A;  3RVY A;  5L0J A;  3WAQ A;  1J8M F;  1NSG B;  4KC9 A;  4QI2 A;  1NU9 C;  4IRU A;  5A69 A;  1VK5 A;  3WG7 C;  5JLI A;  3SNH A;  2XLO A;  4XPY A;  3QW1 A;  5B3I A;  3O6X A;  2YL1 A;  3A9C A;  4Q7C A;  3FOP A;  5CI9 A;  3EGX A;  4N4W A;  4MVS A;  1JMW A;  3JZ0 A;  1BZ4 A;  1QKR A;  3F46 A;  2R7R A;  3ITF A;  1NG1 A;  1ZU4 A;  1Z23 A;  2HMQ A;  3RKO F;  1ORY A;  3I5Q A;  5KYN A;  1KU2 A;  2XL4 A;  1YA9 A;  4J7T A;  1VLT A;  4NTA A;  5CI8 A;  5F28 E;  2I8B A;  1YDI A;  1VTM P;  3VAY A;  1OW7 A;  4MTF A;  1ORJ A;  3AG4 C;  1HMD A;  2G62 A;  3C18 A;  3DE8 A;  3BRJ A;  3IQ6 A;  4FAP B;  1EA8 A;  4W8P A;  1LE2 A;  3EJN A;  2I15 A;  2WZF A;  1D1C A;  1OW6 A;  2UUH A;  3VM6 A;  4YT4 A;  1FFT C;  1OKK D;  2D5R B;  2R7S A;  4BPM A;  4CDA A;  3PMR A;  2R7U A;  1K04 A;  4U9E A;  1BR1 A;  5L0D A;  3ZG1 A;  3ZSU A;  1PD0 A;  2WZG A;  4OIO F;  2CW0 F;  3HJC A;  4JEA A;  2CNW D;  1WOL A;  4AE4 A;  4MS2 A;  1TR2 A;  3B0P A;  4HEA J;  5BUO A;  1KNY A;  3SXZ A;  2Q9B A;  2R7O A;  4IGG A;  3RQF A;  3TOM A;  3QZC A;  4EHP A;  3W2W A;  2XRH A;  4YT8 A;  2OEX A;  2YKZ A;  3VYW A;  3PDM P;  4HFF B;  4XPX A;  4C3E A;  2XLH A;  4H4K C;  2XM0 A;  1E2X A;  5AC5 A;  2R7V A;  3GWL A;  1RKC A;  1FTS A;  3JYH A;  1V54 C;  4A4A A;  4Q5S F;  1MQV A;  3C8G D;  3H2U A;  4K7B A;  5B1B C;  1FMV A;  2J46 A;  5F5H A;  1NLX A;  1LVK A;  2BL2 A;  1ZHT A;  2PX3 A;  3DJU B;  4NTB A;  1OW8 A;  2YRF A;  1ZW2 A;  3EPV A;  3V5X A;  1IZM A;  4C3D A;  1O5H A;  2R03 A;  2L6G A;  3E70 C;  2BC5 A;  2YQY A;  3GEE A;  4E0I A;  4XLP F;  4OD5 A;  1TWH A;  3KMI A;  3AQB A;  2FFH A;  2XL8 A;  4NTF A;  1TKN A;  2HJM A;  3L8I A;  3AG1 C;  2J9B A;  3F47 A;  3C8G B;  3ATP A;  5JT4 A;  4E17 A;  3DE9 A;  1BBH A;  5JP7 A;  5DQZ A;  3IHU A;  1TFK B;  1PV3 A;  1ZVZ A;  1UFB A;  2B0H A;  4WJ0 A;  4CSA A;  4K1O A;  3I4U A;  3WOD F;  1QVX A;  3RFY A;  4C7O A;  5EGY A;  4DRJ B;  5L0C A;  3MX3 A;  5T3W A;  2EIL C;  3RW0 A;  2PP4 A;  3GM1 A;  4ZLC A;  2HKV A;  1LI5 A;  1TFO B;  2X0C A;  3TUL A;  2GAQ A;  1HE1 A;  2ZD9 A;  3G50 A;  3B29 A;  4EWC A;  2ASR A;  2A1D D;  4DBQ A;  2NUT B;  3ABM C;  4KBL A;  2WZL A;  4AL1 A;  3S90 A;  4MVO A;  1FMW A;  3Q6M A;  3L34 A;  4MW8 A;  5COF A;  1RJ9 B;  1OCZ C;  4N06 A;  1JPJ A;  2XLM A;  2Y69 C;  3FOO A;  3VF0 A;  3W8H A;  1QPU A;  3X1O A;  2ZXR A;  1M6T A;  1FR0 A;  3GM2 A;  3LS1 A;  2HSQ A;  3TOL A;  1PD1 A;  1GS9 A;  3POV A;  3GAN A;  2NPU A;  1Q0M A;  5JRA A;  2HUJ A;  4JUR I;  3WHN A;  3T4R A;  1SMY F;  2KGO A;  2XLW A;  3K1I C;  3KKB A;  4L6R A;  1WN0 A;  2O9X A;  2QY9 A;  3NYL A;  4XWJ A;  3RYL A;  3ZQY A;  4I3M A;  1GM5 A;  2R7Q A;  4MTO A;  1LKX A;  2C03 A;  4JKV A;  2ETS A;  4YN0 B;  4DVZ A;  4YL0 A;  4A2N B;  3TJ6 A;  3ZC4 A;  4OIN F;  4CJG A;  1HMO A;  1UG7 A;  3IEE A;  4KNV A;  4CDV A;  1LS4 A;  1NBB A;  1Q0G A;  3GWN A;  4FES A;  3SP1 A;  2EIM C;  3O55 A;  2MWQ A;  2VCA A;  4XQ1 A;  4JC7 A;  1SR2 A;  4E7Z A;  1QSP A;  3MYF A;  1ST6 A;  1JR8 A;  3AGU A;  3FAJ A;  1SF8 A;  1AUE A;  2J0X A;  4G78 A;  2J7P A;  4JRZ A;  3MLG A;  4F4B A;  3C7J A;  2LFF A;  5L0F A;  5JS5 A;  1OXB A;  1J8Y F;  4NY3 A;  4O6Y A;  1YLM A;  4J32 B;  1I4Z A;  1YVI A;  2Y3H A;  2IXO A;  1OCR C;  3LLK A;  3TK0 A;  3EGD A;  3IQ5 A;  4ONS A;  3U5S A;  1JPN A;  3K66 A;  3I5P A;  3AOU A;  2OKU A;  2XM4 A;  4LLC A;  1A41 A;  1L3P A;  2Q7R A;  1CGM E;  1VMA A;  1R4T A;  1H7I A;  2IXP A;  2Y39 A;  3RVZ A;  1HE9 A;  3L1M A;  4MVU A;  3S28 A;  5F5F A;  2QLA A;  4JEB A;  2PBE A;  2YZS A;  3DZA A;  5EK0 A;  2OJQ A;  3O39 A;  4HFK B;  4DVY P;  1NFO A;  2EIK C;  1NU7 D;  1C17 M;  1Q0D A;  3US6 A;  5HV9 A;  1U89 A;  3M4C A;  4U9D A;  1ZZP A;  4U5B E;  5KYY A;  3DJN B;  2HV6 A;  1YZC A;  4J7Y A;  4O6M A;  2MYS A;  2G3K A;  4QDL A;  1F1M A;  3EFO A;  5L0I A;  5COG A;  3AJM A;  2IBF A;  3LJB A;  2L9J A;  4IJJ A;  1M2O A;  4EBB A;  4YK5 A;  2FAP B;  3M4B A;  3FXH A;  5A6A A;  3UNG C;  2XS1 A;  4O79 A;  1NZE A;  1CGN A;  3Q7G A;  2R7X A;  2R9R B;  2XSE A;  1MMD A;  1WGW A;  1APC A;  1ZW3 A;  4IAR A;  4G7O F;  2P6V A;  4D4N A;  3H65 A;  3UMI A;  4C7O B;  3LUT B;  3QVY A;  2IOQ A;  2WVN A;  4LER A;  2HS5 A;  3DAF A;  3JSZ A;  3R2P A;  4JJG A;  1Q0F A;  1Z6A A;  2Y3B A;  3ABK C;  3U8V A;  3NRH A;  1BR4 A;  4WGZ A;  4G0H A;  3W2V A;  3NKD A;  1V55 C;  4JTA B;  3DI5 A;  2YWA A;  1LI7 A;  3AQC A;  4EUK B;  5HSW A;  2A0B A;  2Q9A A;  4ER9 A;  1V74 B;  2J8W A;  4FWV A;  2P1A A;  1TWA A;  1HW2 A;  5KYW A;  1Q0K A;  2EPO A;  2OCC C;  5JSL A;  3U0C A;  2JPU A;  5B1A C;  1H6G A;  3SXY A;  2WL8 A;  4EIY A;  2LSE A;  4LAC B;  1U6H A;  4N6C A;  2QNL A;  3DM5 A;  2AWC A;  3JYY A;  4YWQ A;  4DRH B;  4K0D A;  4BEM J;  4O6N A;  1JOG A;  3LEV A;  5DQT A;  4PFO A;  3RQE A;  1DOV A;  2IXM A;  3C62 A;  4NQF A;  1I5N A;  2IYL D;  3H2V A;  2ZPA A;  3M15 A;  1M2V A;  4LDK A;  3S9O A;  4EKW A;  2J9W A;  3ZTM A;  2J7P D;  3RH3 A;  4EBK A;  5GPG B;  3EG9 A;  4DBR A;  4XTK A;  5EHH A;  2E87 A;  2M64 A;  1EKY A;  2YHS A;  2XXA A;  1Y4C A;  2VCB A;  3T6B A;  5B3S C;  2HFI A;  3LNR A;  2LIG A;  1N1C A;  1FAP B;  3DM9 B;  3KYI A;  2H7V C;  2HMZ A;  2LD6 A;  4AX2 A;  4OIP F;  3CAX A;  1CPQ A;  1TQG A;  3Q7L A;  3QW0 A;  2L81 A;  3O10 A;  5JVE A;  4Q4Z F;  4I1O B;  2J0W A;  1E83 A;  4U5H A;  3CEX A;  2A69 F;  4MND A;  3EGD B;  4YT5 A;  4OIR F;  2OJE D;  4X0R A;  3EHM A;  2IM8 A;  2Q4F A;  4RDA A;  1A0B A;  2J45 A;  4YT2 A;  1T01 A;  5DS5 A;  2L6H A;  4GEH A;  1I4Y A;  4CS9 C;  3FAP B;  2DI3 A;  4ULW A;  1Z7Q c;  1L7C A;  2X51 A;  3E9V A;  1MMG A;  4BG0 A;  4WAB A;  5DLJ A;  2HSB A;  3M79 A;  3N2Z B;  3W4Y A;  5L3Q A;  3B0U X;  1T6Q A;  2NG1 A;  3GOR A;  2PF4 E;  4JIO A;  4ZLD A;  4YJW A;  1ZU5 A;  3NYM A;  3SXM A;  3ZTZ A;  3N24 A;  5KYY B;  3K7D A;  4BJ6 C;  4HE8 D;  2QUP A;  2OG2 A;  2R02 A;  3ABL C;  3EFO B;  3FVY A;  3UGO A;  1RXQ A;  3FMS A;  5L0G A;  2A0U A;  2YEV A;  3FHD A;  2WB7 A;  3EHN A;  2KSF A;  2CDQ A;  1YYX A;  3EGX B;  3U9M A;  4JCZ A;  4NC3 A; 
#chains in the Genus database with same CATH homology
 3JRM O;  1YAU O;  3IPM O;  1FNT c;  3JSE O;  1AVO B;  1YAR O;  1Z7Q c;  3JTL O;  1YA7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...