3JRMO

Crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEADNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGTDHMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural models for interactions between the 20S proteasome and its PAN/19S activators.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome subunit alpha
total genus 87
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3jrmO01
3JSEO 3JRMO 1YARO 1YAUO 1YA7O 3IPMO 1Z7Qc 1FNTc 3JTLO 1AVOB
chains in the Genus database with same CATH superfamily
1NZEA 4U5FE 3GWLA 2V3CC 2OJED 5COMA 3T6GB 4B6IA 2Q3TA 2JD3A 2G3KA 3IHUA 4EUKB 5D92A 3E70C 2CDQA 1WGWA 3K1IA 3LNMB 4O7GA 4U9DA 1T9KA 3SXZA 3POVA 1GM5A 4MTFA 1A0BA 4WGYA 3RVYA 3AGUA 3FAJA 3TULA 2OEXA 2QTVA 4BG0A 1FMWA 3K7DA 3QW1A 3O6XA 3ZSUA 1T6IA 1N1CA 4JEBA 3KH2A 2PP4A 2P0NA 2VB6A 3IPMO 2ICWG 1LKXA 1UG7A 2R03A 1SF8A 1G8XA 1V54C 2J8WA 4BJ1A 4LDRA 4YK5A 4CS9C 1L3PA 1LS4A 1ZW3A 3NMJA 2QNLA 1K05A 1WN0A 3U5SA 5A69A 2CYDA 2XXAA 4L6RA 3FDQA 3ZQVA 2PNOA 4XWJA 4CDAA 4BJ6C 3Q6NA 2IM8A 4EWCA 1T6UA 1BDJB 2LK4A 1TWCA 3EZIA 4MQ9F 2ETSA 3RFYA 1R4TA 4DBRA 3UR3C 1CPRA 1Z3IX 2H8AA 3KL4A 2WVOA 2YVKA 3DM9B 2GFHA 4NC3A 2LSEA 3MYIA 3CSKA 4I1OB 2Q7RA 5EHHA 3DXJF 5DLJA 2EPOA 4PR9A 2QLAA 5AGFA 4I1MA 5L0HA 1D1AA 3CQZA 1VOMA 2X51A 4U5HA 3HNIA 2AWYA 4G7HF 2H7BA 3MYFA 4XEFA 1TWHA 1GGQA 2QY9A 3GEIA 2UUHA 4N4WA 4KC9A 1ZW2A 3SEOA 4EBKA 3S0XA 4EIYA 4JZAA 2Q00A 2A0BA 4Q5SF 1CPQA 1U0BB 4CIHA 3DD7A 2KGOA 4U5GA 4BPMA 4BJTA 5BQHA 4AX2A 1E85A 2PX0A 2IXPA 5KYNA 1LVKA 1HE9A 1ORSC 2YL7A 1H9TA 2Y39A 3DKAA 3MBGA 2OU6A 3IQTA 4G0HA 1YZCA 3EPVA 3K33A 1YJGA 1JPJA 4A4AA 2I15A 3ITFA 2J9WA 3IQCA 5L0FA 3RYLA 3AQCA 3N0TA 1HW1A 1TWAA 3U8VA 2OJQA 3FOPA 3ZG1A 1O3UA 1A7VA 3R7CA 1MQVA 3FVYA 4I3MA 4WGZA 5E3AA 4RBNA 4ANJA 3CEXA 4U5DE 2A6HF 1MNEA 2A6EF 3V5XA 3Q7LA 3LEOA 4ZLDA 2PFDA 3EG9A 4KNVA 5BQGA 1T5OA 1DOVA 4C7OB 1KTMA 4JCHA 3C8GD 5DQTA 3U2MA 3DAGA 1H7IA 2R7RA 3GM1A 2NPUA 3TOLA 4IJJA 1QLEC 2XS8A 4YJWA 1NU9C 5F28E 1A7DA 2PF4E 3KMIA 3QZCA 3MX3A 5KYWA 2GA0A 2TMVP 2VCCA 1CGME 1R5ID 1AEPA 3F47A 3NMIA 4P9TA 2W4BA 2AP3A 3JT1A 4LACB 2YL3A 1BR2A 2CCYA 4BEMJ 5B3IA 4GEHA 1H9GA 3NYJA 4XEKA 2ZD9A 2F22A 3AG1C 3M4CA 5L0GA 1JOGA 2OOCA 4MVQA 3HNKA 4HFKB 4MVMA 2NUTB 1DOWA 3LS0A 4MVOA 2CNWD 3EZHA 2YLGA 5KYUA 1JAFA 2W45A 3JTLO 1Z7Qc 3GM2A 3NYLA 3WAQA 2HJMA 2HV7A 2Q9CA 1ST6A 4QI0A 3A9CA 1RXQA 3NYMA 2XXAB 1A41A 3B71A 1XZQA 3GANA 2EPNA 3HLZA 1D1CA 2P61A 4N06A 2J9BA 4YT4A 2LFFA 1ZZPA 1EA8A 2W4MA 3KYJA 3HTKC 4CS9A 3NDBB 3JYHA 2KNHA 1Q0FA 3PDMP 3SYNA 3S28A 3C63A 3DWWA 1YA9A 4J30B 1MMAA 3ZIBA 4NTFA 3T6BA 4DRHB 5D91A 4U5EE 4XLPF 3M79A 2EPMX 4O6NA 2J7PD 3I5QA 2H7VC 4CS8A 5F5FA 1QKRA 4EBBA 1TFOB 4NQFA 1OW7A 1QVXA 4CSAC 3EH1A 3X1OA 2FAPB 2KSFA 3ASOC 3EHMA 3W2WA 1PV3A 4YL1A 1NU7D 3DM5A 3QVYA 1WOLA 5A6KA 4RDAA 4EHPA 5DS6A 3RQEA 1AUEA 2IOQA 3DZAA 2EPKX 3LUTB 2Q9AA 5JVEA 5JLIA 5BQIA 3W2VA 2VCAA 1IW7F 3LJBA 4CS7A 3JYYA 3ASNC 2R05A 3GWNA 4E18A 2WB7A 5HV9A 1V74B 4JVSA 3ZC4A 4PK4A 4AK9A 2ZXPA 4YL0A 1VK5A 4ONSA 2E87A 4UDVA 1YAUO 4JE9A 4FAPB 2CW0F 1H6GA 1G4WR 3H2UA 2DB4A 2L6GA 1D1BA 2M64A 1LIHA 5JSLA 4CJOA 4C7OA 2J45A 3GEHA 1YDIA 2NUPA 2YL0A 3S9OA 4XLNF 1NLXA 4LLCA 4MS2A 2Q9BA 1EQ1A 3QTHA 3RIPA 3U3BA 3C18A 1KNYA 3ECSA 3QMKA 4YWQA 2JPUA 4IRUA 2PBEA 1MMGA 2XLHA 3AJMA 2KQ9A 3ABLC 1J8YF 2Y3BA 4MVUA 3T4RA 1OW8A 1LM3B 1OR2A 3AG3C 5TJ5E 4NY3A 1OR3A 2Q4FA 3MLGA 4JRZA 4CIPA 2O9XA 1EKYA 1I5NA 2YRFA 5B3SC 4PJLA 4GQHA 3V5YA 2R9RB 4DRIB 1KU2A 5KYYB 3EGDB 4O6MA 4YL3A 2LD6A 4LDKA 4DVZA 2D4UA 3N24A 1C02A 5AC4A 4BJ5C 5KYYA 5L3QA 4FWVA 5A6BD 2P1AA 1ZU5A 3B0PA 2YHSA 4RD9A 2VASA 1E86A 1OXBA 2LP4A 2XM4A 1MMNA 4Z9JA 2J0XA 1HW2A 4EBJA 3C8GB 3AG2C 4JURI 3K66A 1FAPB 3LNRA 2WZLA 2B0HA 4IARA 1NSGB 1OCRC 2WZGA 3LAYA 4IB4A 2P6VA 2D5RB 2OQMA 1E2XA 1LI7A 4PFOA 3GORA 2L6FA 3QVZA 1T01A 5COGA 4DBQA 1EI7A 1ORJA 2FGYA 5E33A 3LLIA 1Y4CA 3M1CB 1LE2A 3VM6A 1OCOC 3DAFA 2BC5A 2DYSC 5KYXB 3C8ZA 1QZXA 3EGXB 4FESA 4OINF 2XLEA 2IXMA 3EHNA 4K7BA 2GDCA 3U8PA 3AGTA 1APCA 2WVNA 3ZTMA 2R7TA 2XL8A 1C17M 1LPEA 4AE4B 3SP1A 3Q7GA 3TJ5A 3M15A 3KPHA 5F5HA 4D4NA 2A1DD 3HNJA 3UNGC 2XRHA 2R7QA 2KK1A 4CDYA 3NKDA 1M2VB 2HKVA 2ZXWC 2P7VA 3TQOA 5AC5A 2YLDA 1RKCA 3ZQYA 3IEEA 4J32B 1M2OA 3EQLF 3RF3A 3NG1A 5IY5C 3S90A 5E2QA 2J46A 3B9QA 2RSEB 2KJGA 3L1MA 3K1IC 1HMOA 2YWAA 4IGGA 4IAOA 1BR1A 2MHRA 3TOMA 4E0IA 3EFOB 2IXNA 4C3EA 4EKWA 2EIMC 1OQCA 4JKVA 3UGPA 2XLMA 4C3BA 3L0IA 3O10A 3ZDLA 4F4BA 4J7YA 4AL1A 4DXWA 5HSWA 2EPLX 1YVIA 5L3VA 1SR2A 1ZHYA 2MYSA 4K0DA 5L0IA 4Q7CA 2J9UA 3FAPB 3B29A 4AL0A 2L6HA 1WATA 4XTKA 1K40A 3EGDA 1D0XA 2M4EA 3WODF 4Z9IA 2R7UA 5FCLA 2LQGA 4JC7A 4JTDB 4HFFB 1QQ3A 1TWGA 4NTBA 5CI9A 4Q4ZF 2J9VA 2J0WA 2EILC 1OW6A 1M57C 2BL2A 2HUJA 256BA 2HFIA 4FX5A 4MVZA 1JRAA 4MW3A 2XM0A 3SXKA 3BRJA 3NKEA 4YT8A 1B68A 2DYRC 1BZ4A 3DE8A 3O55A 2NUTA 1CGOA 2R25A 5CI8A 2NG1A 2C04A 2CGEA 2RD9A 2V26A 4U9EA 3L8IA 1TKNA 4DJ9A 2AWCA 3H2VA 1OKKD 2OCCC 3AOUA 5COFA 4HE8D 3IQ5A 2XSEA 3EGXA 2Y3HA 4CJGA 1RJ9B 4BJ5A 3PMRA 4N6CA 1Z6AA 4K1OA 1Z63A 1G4US 1S7ZA 2EIKC 1SMYF 2GAQA 1FFTC 2VCBA 1YYJA 4JTAB 4N6HA 2XLVA 2YLIA 1GQAA 1NG1A 4H54A 1OKKA 1HE1A 3R2PA 1A7EA 4JTCB 4QDLA 3G4XA 3E9VA 4XPYA 5CIVA 3EG9B 3ABKC 1AVOB 1VLSA 3H65A 3LESA 3W4YA 2HS5A 3W8IA 4CDVA 2XL4A 5FZTA 1FR0A 3KKBA 1SYQA 4ULVA 3DJUB 2ZPAA 3C8GA 2YZSA 4OD4A 5DVWA 4U5CE 3DMDA 4XQ1A 3VRCA 2L81A 3L34A 5DS4A 4U5BE 2XLWA 3N2ZB 1T6QA 3X2QC 3J06A 5L0CA 3T6JA 1M2VA 3AQBA 3JSEO 4NCQA 5L0JA 4LERA 1J8MF 5A6BA 5JP7A 1VTMP 4CS8C 1NFOA 2HZ8A 4PJMA 3GEEA 3PHF2 5KYUB 3C62A 3US6A 1XWJA 4AE4A 1OCZC 3VF0A 1IZMA 4BEJA 1V4AA 4KI2A 2R7WA 4YN0B 4WABA 3U0CA 4PACA 1ZVZA 4OIOF 4IWBA 5JT4A 1PCXA 1UFBA 3UGOA 3O39A 2AVKA 4G7ZF 4JJGA 3G50A 2WVQA 2IXOA 3SXYA 4XEVA 2Z15A 1ZHZA 4YT5A 2IBFA 3U2LA 3VYWA 2QUPA 4Z9HA 4JW1A 1FFHA 4MNDA 1NFNA 2C03A 2B0JA 3HKKA 4CSAA 1JPNA 3LS1A 4GYTA 1S05A 2YEVA 5EK0A 1YA7O 3OA1A 3TD7A 3WHNA 1D0YA 2XLDA 2L9JA 5B1AC 4ER9A 2OEVA 1QSPA 1VMAA 3ABMC 3RH3A 3K1HA 5L0DA 1W2WA 3UMHA 3VAYA 3IQ6A 3JRMO 4OD5A 3U3FA 2R02A 5KYXA 2HSBA 2LFDA 2OG2A 3NMKA 2ASRA 3CZ6A 1ZHTA 2AU5A 4JEAA 2HMZA 2DI3A 5GPGB 1I4YA 1Q0KA 3JZ0A 5A6JA 1GS9A 2IYLD 4QI2A 1D0ZA 4JIOA 2J7PA 1M6TA 1OCCC 1V55C 4R32A 3RKOF 1QPUA 3HNLA 5T1DB 3SZRA 4C3DA 3T9OA 3SNHA 5JS5A 4LLEA 1LS1A 1BR4A 1JR8A 1XZPA 2JX0A 2YKZA 4PJNA 1SZIA 1Z5ZA 1ZHWA 3ZTZA 1NBBA 3A11A 1O5HA 3BEHA 3K6BA 3DJNB 3U9JA 1ZYRF 4OIRF 4DVYP 3TK0A 4OIPF 2R7OA 1BBHA 3V5ZA 2HJ3A 3JCUQ 3LEVA 2XLOA 3F46A 3V7OA 3ZVRA 2WZFA 2MWQA 2EIJC 3I5PA 1YLMA 3FMSA 1RJ9A 1VYKA 5DS5A 1WASA 2BE5F 4PJJA 3S29A 1OXKA 2FFHA 2X0CA 4JJFA 2A68F 2NSFA 1JMWA 2XS1A 2YL1A 4G78A 3AG4C 5T3TA 3RW0A 1Q0GA 1ORYA 4XPXA 2I8BA 3NRHA 2GWWA 3FXHA 3RQFA 1K04A 1C03A 4XPWA 4DRJB 1Z23A 4W8KA 1Q0MA 1FTSA 1YARO 3G4ZA 3QW0A 4NTAA 4E0HA 5E3CA 2NUPB 3ATPA 4KBLA 3S84A 1FMVA 1PD0A 2VH3A 4OIQF 5T3WA 3MFNA 1L7CA 4IAQA 1Q0DA 1WWPA 4X0RA 4D4XA 2ZXOA 4WJ0A 3C7JA 3GODA 2YQYA 4H4KC 3OWTA 4O6YA 3RVZA 3SXMA 3UMIA 4MW8A 3EH2A 1RMVA 1M56C 3M4BA 4MTGA 4A2NB 1E84A 2KC3A 4O79A 1TQGA 1LE4A 3JSZA 2KW3C 3DI5A 3TJ6A 2Y69C 4P6IC 3PCVA 3ZWIA 5DQZA 1Y6DA 5K0IA 2W9YA 1HY5A 1YZAA 4KNWA 4MTOA 4CBEA 1RKEA 3S27A 5A6AA 1G5ZA 2PX3A 1ZHXA 3RQGA 4M63A 1O87A 2ZXRA 1TR2A 1E83A 2KYHA 2G3VA 4JCZA 4G7OF 1RKEB 4W8PA 2NSGA 2OKUA 4E7SA 5EGYA 2Y3GA 2HV6A 2R7XA 3L8JA 1YYXA 3U9MA 4DOZA 4HEAJ 2Y3DA 1CGNA 1VB5A 2EINC 2H7OA 1F1MA 3FOOA 3JRTA 3W8HA 3LLKA 1I4ZA 1U89A 3EFOA 4ZLCA 2VC9A 2CNWA 1ZU4A 3FHDA 1VYIA 4MVSA 3UMKA 4BJ6A 4PFPA 4CX9A 4P9FA 4YT2A 4I44A 3OEOA 5KYWB 2LCHA 2HSQA 1RCPA 3DE9A 4J7TA 2R7VA 4MVRA 3B0VC 1U6HA 4E17A 1MNDA 3I4UA 3Q6MA 1LI5A 4ULWA 2DGJA 5JRAA 1MMDA 2L7AA 5BUOA 2QE9A 3WG7C 1TFKB 2A69F 4E7ZA 2HMQA 3B0UX 1PD1A 3CAXA 2R7SA 1VLTA 2WL8A 1FNTc 2XL6A 2G62A 3HJCA 3GM3A 3EJNA 1WTYA 2A0UA 4LDQA 5JUAA 2UUIA 5B1BC 2LIGA 3KYIA 1HMDA
chains in the Genus database with same CATH topology
3JSEO 3JRMO 1YARO 1YAUO 1YA7O 3IPMO 1Z7Qc 1FNTc 3JTLO 1AVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSE O;  3JRM O;  1YAR O;  1YAU O;  1YA7 O;  3IPM O;  1Z7Q c;  1FNT c;  3JTL O;  1AVO B; 
#chains in the Genus database with same CATH topology
 1NZE A;  4U5F E;  3GWL A;  2V3C C;  2OJE D;  5COM A;  3T6G B;  4B6I A;  2Q3T A;  2JD3 A;  2G3K A;  3IHU A;  4EUK B;  5D92 A;  3E70 C;  2CDQ A;  1WGW A;  3K1I A;  3LNM B;  4O7G A;  4U9D A;  1T9K A;  3SXZ A;  3POV A;  1GM5 A;  4MTF A;  1A0B A;  4WGY A;  3RVY A;  3AGU A;  3FAJ A;  3TUL A;  2OEX A;  2QTV A;  4BG0 A;  1FMW A;  3K7D A;  3QW1 A;  3O6X A;  3ZSU A;  1T6I A;  1N1C A;  4JEB A;  3KH2 A;  2PP4 A;  2P0N A;  2VB6 A;  3IPM O;  2ICW G;  1LKX A;  1UG7 A;  2R03 A;  1SF8 A;  1G8X A;  1V54 C;  2J8W A;  4BJ1 A;  4LDR A;  4YK5 A;  4CS9 C;  1L3P A;  1LS4 A;  1ZW3 A;  3NMJ A;  2QNL A;  1K05 A;  1WN0 A;  3U5S A;  5A69 A;  2CYD A;  2XXA A;  4L6R A;  3FDQ A;  3ZQV A;  2PNO A;  4XWJ A;  4CDA A;  4BJ6 C;  3Q6N A;  2IM8 A;  4EWC A;  1T6U A;  1BDJ B;  2LK4 A;  1TWC A;  3EZI A;  4MQ9 F;  2ETS A;  3RFY A;  1R4T A;  4DBR A;  3UR3 C;  1CPR A;  1Z3I X;  2H8A A;  3KL4 A;  2WVO A;  2YVK A;  3DM9 B;  2GFH A;  4NC3 A;  2LSE A;  3MYI A;  3CSK A;  4I1O B;  2Q7R A;  5EHH A;  3DXJ F;  5DLJ A;  2EPO A;  4PR9 A;  2QLA A;  5AGF A;  4I1M A;  5L0H A;  1D1A A;  3CQZ A;  1VOM A;  2X51 A;  4U5H A;  3HNI A;  2AWY A;  4G7H F;  2H7B A;  3MYF A;  4XEF A;  1TWH A;  1GGQ A;  2QY9 A;  3GEI A;  2UUH A;  4N4W A;  4KC9 A;  1ZW2 A;  3SEO A;  4EBK A;  3S0X A;  4EIY A;  4JZA A;  2Q00 A;  2A0B A;  4Q5S F;  1CPQ A;  1U0B B;  4CIH A;  3DD7 A;  2KGO A;  4U5G A;  4BPM A;  4BJT A;  5BQH A;  4AX2 A;  1E85 A;  2PX0 A;  2IXP A;  5KYN A;  1LVK A;  1HE9 A;  1ORS C;  2YL7 A;  1H9T A;  2Y39 A;  3DKA A;  3MBG A;  2OU6 A;  3IQT A;  4G0H A;  1YZC A;  3EPV A;  3K33 A;  1YJG A;  1JPJ A;  4A4A A;  2I15 A;  3ITF A;  2J9W A;  3IQC A;  5L0F A;  3RYL A;  3AQC A;  3N0T A;  1HW1 A;  1TWA A;  3U8V A;  2OJQ A;  3FOP A;  3ZG1 A;  1O3U A;  1A7V A;  3R7C A;  1MQV A;  3FVY A;  4I3M A;  4WGZ A;  5E3A A;  4RBN A;  4ANJ A;  3CEX A;  4U5D E;  2A6H F;  1MNE A;  2A6E F;  3V5X A;  3Q7L A;  3LEO A;  4ZLD A;  2PFD A;  3EG9 A;  4KNV A;  5BQG A;  1T5O A;  1DOV A;  4C7O B;  1KTM A;  4JCH A;  3C8G D;  5DQT A;  3U2M A;  3DAG A;  1H7I A;  2R7R A;  3GM1 A;  2NPU A;  3TOL A;  4IJJ A;  1QLE C;  2XS8 A;  4YJW A;  1NU9 C;  5F28 E;  1A7D A;  2PF4 E;  3KMI A;  3QZC A;  3MX3 A;  5KYW A;  2GA0 A;  2TMV P;  2VCC A;  1CGM E;  1R5I D;  1AEP A;  3F47 A;  3NMI A;  4P9T A;  2W4B A;  2AP3 A;  3JT1 A;  4LAC B;  2YL3 A;  1BR2 A;  2CCY A;  4BEM J;  5B3I A;  4GEH A;  1H9G A;  3NYJ A;  4XEK A;  2ZD9 A;  2F22 A;  3AG1 C;  3M4C A;  5L0G A;  1JOG A;  2OOC A;  4MVQ A;  3HNK A;  4HFK B;  4MVM A;  2NUT B;  1DOW A;  3LS0 A;  4MVO A;  2CNW D;  3EZH A;  2YLG A;  5KYU A;  1JAF A;  2W45 A;  3JTL O;  1Z7Q c;  3GM2 A;  3NYL A;  3WAQ A;  2HJM A;  2HV7 A;  2Q9C A;  1ST6 A;  4QI0 A;  3A9C A;  1RXQ A;  3NYM A;  2XXA B;  1A41 A;  3B71 A;  1XZQ A;  3GAN A;  2EPN A;  3HLZ A;  1D1C A;  2P61 A;  4N06 A;  2J9B A;  4YT4 A;  2LFF A;  1ZZP A;  1EA8 A;  2W4M A;  3KYJ A;  3HTK C;  4CS9 A;  3NDB B;  3JYH A;  2KNH A;  1Q0F A;  3PDM P;  3SYN A;  3S28 A;  3C63 A;  3DWW A;  1YA9 A;  4J30 B;  1MMA A;  3ZIB A;  4NTF A;  3T6B A;  4DRH B;  5D91 A;  4U5E E;  4XLP F;  3M79 A;  2EPM X;  4O6N A;  2J7P D;  3I5Q A;  2H7V C;  4CS8 A;  5F5F A;  1QKR A;  4EBB A;  1TFO B;  4NQF A;  1OW7 A;  1QVX A;  4CSA C;  3EH1 A;  3X1O A;  2FAP B;  2KSF A;  3ASO C;  3EHM A;  3W2W A;  1PV3 A;  4YL1 A;  1NU7 D;  3DM5 A;  3QVY A;  1WOL A;  5A6K A;  4RDA A;  4EHP A;  5DS6 A;  3RQE A;  1AUE A;  2IOQ A;  3DZA A;  2EPK X;  3LUT B;  2Q9A A;  5JVE A;  5JLI A;  5BQI A;  3W2V A;  2VCA A;  1IW7 F;  3LJB A;  4CS7 A;  3JYY A;  3ASN C;  2R05 A;  3GWN A;  4E18 A;  2WB7 A;  5HV9 A;  1V74 B;  4JVS A;  3ZC4 A;  4PK4 A;  4AK9 A;  2ZXP A;  4YL0 A;  1VK5 A;  4ONS A;  2E87 A;  4UDV A;  1YAU O;  4JE9 A;  4FAP B;  2CW0 F;  1H6G A;  1G4W R;  3H2U A;  2DB4 A;  2L6G A;  1D1B A;  2M64 A;  1LIH A;  5JSL A;  4CJO A;  4C7O A;  2J45 A;  3GEH A;  1YDI A;  2NUP A;  2YL0 A;  3S9O A;  4XLN F;  1NLX A;  4LLC A;  4MS2 A;  2Q9B A;  1EQ1 A;  3QTH A;  3RIP A;  3U3B A;  3C18 A;  1KNY A;  3ECS A;  3QMK A;  4YWQ A;  2JPU A;  4IRU A;  2PBE A;  1MMG A;  2XLH A;  3AJM A;  2KQ9 A;  3ABL C;  1J8Y F;  2Y3B A;  4MVU A;  3T4R A;  1OW8 A;  1LM3 B;  1OR2 A;  3AG3 C;  5TJ5 E;  4NY3 A;  1OR3 A;  2Q4F A;  3MLG A;  4JRZ A;  4CIP A;  2O9X A;  1EKY A;  1I5N A;  2YRF A;  5B3S C;  4PJL A;  4GQH A;  3V5Y A;  2R9R B;  4DRI B;  1KU2 A;  5KYY B;  3EGD B;  4O6M A;  4YL3 A;  2LD6 A;  4LDK A;  4DVZ A;  2D4U A;  3N24 A;  1C02 A;  5AC4 A;  4BJ5 C;  5KYY A;  5L3Q A;  4FWV A;  5A6B D;  2P1A A;  1ZU5 A;  3B0P A;  2YHS A;  4RD9 A;  2VAS A;  1E86 A;  1OXB A;  2LP4 A;  2XM4 A;  1MMN A;  4Z9J A;  2J0X A;  1HW2 A;  4EBJ A;  3C8G B;  3AG2 C;  4JUR I;  3K66 A;  1FAP B;  3LNR A;  2WZL A;  2B0H A;  4IAR A;  1NSG B;  1OCR C;  2WZG A;  3LAY A;  4IB4 A;  2P6V A;  2D5R B;  2OQM A;  1E2X A;  1LI7 A;  4PFO A;  3GOR A;  2L6F A;  3QVZ A;  1T01 A;  5COG A;  4DBQ A;  1EI7 A;  1ORJ A;  2FGY A;  5E33 A;  3LLI A;  1Y4C A;  3M1C B;  1LE2 A;  3VM6 A;  1OCO C;  3DAF A;  2BC5 A;  2DYS C;  5KYX B;  3C8Z A;  1QZX A;  3EGX B;  4FES A;  4OIN F;  2XLE A;  2IXM A;  3EHN A;  4K7B A;  2GDC A;  3U8P A;  3AGT A;  1APC A;  2WVN A;  3ZTM A;  2R7T A;  2XL8 A;  1C17 M;  1LPE A;  4AE4 B;  3SP1 A;  3Q7G A;  3TJ5 A;  3M15 A;  3KPH A;  5F5H A;  4D4N A;  2A1D D;  3HNJ A;  3UNG C;  2XRH A;  2R7Q A;  2KK1 A;  4CDY A;  3NKD A;  1M2V B;  2HKV A;  2ZXW C;  2P7V A;  3TQO A;  5AC5 A;  2YLD A;  1RKC A;  3ZQY A;  3IEE A;  4J32 B;  1M2O A;  3EQL F;  3RF3 A;  3NG1 A;  5IY5 C;  3S90 A;  5E2Q A;  2J46 A;  3B9Q A;  2RSE B;  2KJG A;  3L1M A;  3K1I C;  1HMO A;  2YWA A;  4IGG A;  4IAO A;  1BR1 A;  2MHR A;  3TOM A;  4E0I A;  3EFO B;  2IXN A;  4C3E A;  4EKW A;  2EIM C;  1OQC A;  4JKV A;  3UGP A;  2XLM A;  4C3B A;  3L0I A;  3O10 A;  3ZDL A;  4F4B A;  4J7Y A;  4AL1 A;  4DXW A;  5HSW A;  2EPL X;  1YVI A;  5L3V A;  1SR2 A;  1ZHY A;  2MYS A;  4K0D A;  5L0I A;  4Q7C A;  2J9U A;  3FAP B;  3B29 A;  4AL0 A;  2L6H A;  1WAT A;  4XTK A;  1K40 A;  3EGD A;  1D0X A;  2M4E A;  3WOD F;  4Z9I A;  2R7U A;  5FCL A;  2LQG A;  4JC7 A;  4JTD B;  4HFF B;  1QQ3 A;  1TWG A;  4NTB A;  5CI9 A;  4Q4Z F;  2J9V A;  2J0W A;  2EIL C;  1OW6 A;  1M57 C;  2BL2 A;  2HUJ A;  256B A;  2HFI A;  4FX5 A;  4MVZ A;  1JRA A;  4MW3 A;  2XM0 A;  3SXK A;  3BRJ A;  3NKE A;  4YT8 A;  1B68 A;  2DYR C;  1BZ4 A;  3DE8 A;  3O55 A;  2NUT A;  1CGO A;  2R25 A;  5CI8 A;  2NG1 A;  2C04 A;  2CGE A;  2RD9 A;  2V26 A;  4U9E A;  3L8I A;  1TKN A;  4DJ9 A;  2AWC A;  3H2V A;  1OKK D;  2OCC C;  3AOU A;  5COF A;  4HE8 D;  3IQ5 A;  2XSE A;  3EGX A;  2Y3H A;  4CJG A;  1RJ9 B;  4BJ5 A;  3PMR A;  4N6C A;  1Z6A A;  4K1O A;  1Z63 A;  1G4U S;  1S7Z A;  2EIK C;  1SMY F;  2GAQ A;  1FFT C;  2VCB A;  1YYJ A;  4JTA B;  4N6H A;  2XLV A;  2YLI A;  1GQA A;  1NG1 A;  4H54 A;  1OKK A;  1HE1 A;  3R2P A;  1A7E A;  4JTC B;  4QDL A;  3G4X A;  3E9V A;  4XPY A;  5CIV A;  3EG9 B;  3ABK C;  1AVO B;  1VLS A;  3H65 A;  3LES A;  3W4Y A;  2HS5 A;  3W8I A;  4CDV A;  2XL4 A;  5FZT A;  1FR0 A;  3KKB A;  1SYQ A;  4ULV A;  3DJU B;  2ZPA A;  3C8G A;  2YZS A;  4OD4 A;  5DVW A;  4U5C E;  3DMD A;  4XQ1 A;  3VRC A;  2L81 A;  3L34 A;  5DS4 A;  4U5B E;  2XLW A;  3N2Z B;  1T6Q A;  3X2Q C;  3J06 A;  5L0C A;  3T6J A;  1M2V A;  3AQB A;  3JSE O;  4NCQ A;  5L0J A;  4LER A;  1J8M F;  5A6B A;  5JP7 A;  1VTM P;  4CS8 C;  1NFO A;  2HZ8 A;  4PJM A;  3GEE A;  3PHF 2;  5KYU B;  3C62 A;  3US6 A;  1XWJ A;  4AE4 A;  1OCZ C;  3VF0 A;  1IZM A;  4BEJ A;  1V4A A;  4KI2 A;  2R7W A;  4YN0 B;  4WAB A;  3U0C A;  4PAC A;  1ZVZ A;  4OIO F;  4IWB A;  5JT4 A;  1PCX A;  1UFB A;  3UGO A;  3O39 A;  2AVK A;  4G7Z F;  4JJG A;  3G50 A;  2WVQ A;  2IXO A;  3SXY A;  4XEV A;  2Z15 A;  1ZHZ A;  4YT5 A;  2IBF A;  3U2L A;  3VYW A;  2QUP A;  4Z9H A;  4JW1 A;  1FFH A;  4MND A;  1NFN A;  2C03 A;  2B0J A;  3HKK A;  4CSA A;  1JPN A;  3LS1 A;  4GYT A;  1S05 A;  2YEV A;  5EK0 A;  1YA7 O;  3OA1 A;  3TD7 A;  3WHN A;  1D0Y A;  2XLD A;  2L9J A;  5B1A C;  4ER9 A;  2OEV A;  1QSP A;  1VMA A;  3ABM C;  3RH3 A;  3K1H A;  5L0D A;  1W2W A;  3UMH A;  3VAY A;  3IQ6 A;  3JRM O;  4OD5 A;  3U3F A;  2R02 A;  5KYX A;  2HSB A;  2LFD A;  2OG2 A;  3NMK A;  2ASR A;  3CZ6 A;  1ZHT A;  2AU5 A;  4JEA A;  2HMZ A;  2DI3 A;  5GPG B;  1I4Y A;  1Q0K A;  3JZ0 A;  5A6J A;  1GS9 A;  2IYL D;  4QI2 A;  1D0Z A;  4JIO A;  2J7P A;  1M6T A;  1OCC C;  1V55 C;  4R32 A;  3RKO F;  1QPU A;  3HNL A;  5T1D B;  3SZR A;  4C3D A;  3T9O A;  3SNH A;  5JS5 A;  4LLE A;  1LS1 A;  1BR4 A;  1JR8 A;  1XZP A;  2JX0 A;  2YKZ A;  4PJN A;  1SZI A;  1Z5Z A;  1ZHW A;  3ZTZ A;  1NBB A;  3A11 A;  1O5H A;  3BEH A;  3K6B A;  3DJN B;  3U9J A;  1ZYR F;  4OIR F;  4DVY P;  3TK0 A;  4OIP F;  2R7O A;  1BBH A;  3V5Z A;  2HJ3 A;  3JCU Q;  3LEV A;  2XLO A;  3F46 A;  3V7O A;  3ZVR A;  2WZF A;  2MWQ A;  2EIJ C;  3I5P A;  1YLM A;  3FMS A;  1RJ9 A;  1VYK A;  5DS5 A;  1WAS A;  2BE5 F;  4PJJ A;  3S29 A;  1OXK A;  2FFH A;  2X0C A;  4JJF A;  2A68 F;  2NSF A;  1JMW A;  2XS1 A;  2YL1 A;  4G78 A;  3AG4 C;  5T3T A;  3RW0 A;  1Q0G A;  1ORY A;  4XPX A;  2I8B A;  3NRH A;  2GWW A;  3FXH A;  3RQF A;  1K04 A;  1C03 A;  4XPW A;  4DRJ B;  1Z23 A;  4W8K A;  1Q0M A;  1FTS A;  1YAR O;  3G4Z A;  3QW0 A;  4NTA A;  4E0H A;  5E3C A;  2NUP B;  3ATP A;  4KBL A;  3S84 A;  1FMV A;  1PD0 A;  2VH3 A;  4OIQ F;  5T3W A;  3MFN A;  1L7C A;  4IAQ A;  1Q0D A;  1WWP A;  4X0R A;  4D4X A;  2ZXO A;  4WJ0 A;  3C7J A;  3GOD A;  2YQY A;  4H4K C;  3OWT A;  4O6Y A;  3RVZ A;  3SXM A;  3UMI A;  4MW8 A;  3EH2 A;  1RMV A;  1M56 C;  3M4B A;  4MTG A;  4A2N B;  1E84 A;  2KC3 A;  4O79 A;  1TQG A;  1LE4 A;  3JSZ A;  2KW3 C;  3DI5 A;  3TJ6 A;  2Y69 C;  4P6I C;  3PCV A;  3ZWI A;  5DQZ A;  1Y6D A;  5K0I A;  2W9Y A;  1HY5 A;  1YZA A;  4KNW A;  4MTO A;  4CBE A;  1RKE A;  3S27 A;  5A6A A;  1G5Z A;  2PX3 A;  1ZHX A;  3RQG A;  4M63 A;  1O87 A;  2ZXR A;  1TR2 A;  1E83 A;  2KYH A;  2G3V A;  4JCZ A;  4G7O F;  1RKE B;  4W8P A;  2NSG A;  2OKU A;  4E7S A;  5EGY A;  2Y3G A;  2HV6 A;  2R7X A;  3L8J A;  1YYX A;  3U9M A;  4DOZ A;  4HEA J;  2Y3D A;  1CGN A;  1VB5 A;  2EIN C;  2H7O A;  1F1M A;  3FOO A;  3JRT A;  3W8H A;  3LLK A;  1I4Z A;  1U89 A;  3EFO A;  4ZLC A;  2VC9 A;  2CNW A;  1ZU4 A;  3FHD A;  1VYI A;  4MVS A;  3UMK A;  4BJ6 A;  4PFP A;  4CX9 A;  4P9F A;  4YT2 A;  4I44 A;  3OEO A;  5KYW B;  2LCH A;  2HSQ A;  1RCP A;  3DE9 A;  4J7T A;  2R7V A;  4MVR A;  3B0V C;  1U6H A;  4E17 A;  1MND A;  3I4U A;  3Q6M A;  1LI5 A;  4ULW A;  2DGJ A;  5JRA A;  1MMD A;  2L7A A;  5BUO A;  2QE9 A;  3WG7 C;  1TFK B;  2A69 F;  4E7Z A;  2HMQ A;  3B0U X;  1PD1 A;  3CAX A;  2R7S A;  1VLT A;  2WL8 A;  1FNT c;  2XL6 A;  2G62 A;  3HJC A;  3GM3 A;  3EJN A;  1WTY A;  2A0U A;  4LDQ A;  5JUA A;  2UUI A;  5B1B C;  2LIG A;  3KYI A;  1HMD A; 
#chains in the Genus database with same CATH homology
 3JSE O;  3JRM O;  1YAR O;  1YAU O;  1YA7 O;  3IPM O;  1Z7Q c;  1FNT c;  3JTL O;  1AVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...