3G4XA

Crystal structure of nisod y9f mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Role of conserved tyrosine residues in NiSOD catalysis: a case of convergent evolution
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 49
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 3g4xA00
3G4ZA 3G50A 3G4XA 1T6QA 1Q0FA 1T6IA 1Q0KA 1Q0DA 1Q0MA 1T6UA 1Q0GA 4NCQA
chains in the Genus database with same CATH superfamily
2MWQA 4N06A 3LLIA 5T3TA 1VLTA 2XLEA 2L7AA 2AP3A 5DQZA 1YA9A 4BJ1A 4L6RA 2HV7A 2IYLD 2XXAB 1JOGA 1MMGA 1YVIA 4DRJB 1M56C 2GDCA 2A69F 2HKVA 2GA0A 4QDLA 4EHPA 4DXWA 4Q5SF 2YL7A 4XQ1A 3HJCA 2Q7RA 5A6KA 2P1AA 2NPUA 4MVRA 2CGEA 3ZQVA 4O79A 4WABA 1R5ID 2R7QA 2CYDA 2ICWG 1AEPA 1TFKB 4IWBA 4ANJA 4JKVA 4Z9JA 1JAFA 1NLXA 2YEVA 1TQGA 3O6XA 2FFHA 3PCVA 2VH3A 3ASNC 5EGYA 1B68A 4EBBA 1FR0A 2A6EF 1Q0GA 1RKEB 4LLCA 4DBQA 5A69A 4OIPF 4LDRA 1MMAA 3ZVRA 1ZW3A 4LDQA 2EILC 1C02A 2J9BA 5CI8A 1VK5A 5AGFA 1ZHWA 2PNOA 3JCUQ 4U5DE 4XEVA 3GWNA 2XS8A 1PD0A 1LM3B 2UUHA 5E3AA 5BQIA 3DJUB 1ZU4A 1OXBA 3NKDA 4QI2A 1VYKA 3KYIA 1BR1A 1V54C 4LACB 3RH3A 4JEAA 4MVUA 3RVYA 4OD5A 3VAYA 4OIQF 1OW7A 2A0BA 3EGDA 2J46A 3GM2A 4X0RA 5DVWA 2LK4A 4IRUA 4BJ5C 3DKAA 3M79A 3WAQA 2A0UA 3JRMO 3HNKA 1VYIA 2L6GA 3M1CB 3KKBA 2DGJA 1GS9A 1Z5ZA 4XLPF 2PF4E 5COFA 3UMHA 3JTLO 1RKEA 5JS5A 2IXMA 1U0BB 3RQEA 1VLSA 3TD7A 2WZLA 2CW0F 3T6JA 2H7OA 1XZPA 3W4YA 1QKRA 2ETSA 1TR2A 3C8GB 2HMQA 1V55C 4JW1A 3RYLA 4WGZA 2W4BA 1C03A 2J45A 256BA 1Q0KA 3U9JA 3DI5A 2EPMX 4DVYP 2HJMA 2AU5A 2NG1A 3Q6MA 5F28E 3SXYA 3K1HA 5JP7A 3TK0A 4D4XA 1Q0FA 3GORA 3IEEA 3S9OA 4AL0A 3T4RA 1JPJA 1H6GA 2JD3A 3G4ZA 3ITFA 3Q7LA 3TOLA 2ASRA 3LUTB 3QVZA 5JVEA 4CSAA 2W4MA 4XEKA 3U3BA 3B0UX 4YK5A 3A9CA 4CSAC 3T6GB 4OIOF 2OG2A 2V26A 3C63A 4GQHA 3C18A 1TFOB 1ZVZA 3HTKC 4PACA 1L3PA 3JSEO 1C17M 1G4US 2YQYA 3Q7GA 4KBLA 3X2QC 2DYRC 1OKKA 3DXJF 1LS4A 3AG1C 3C8GA 2Q9AA 3ZTMA 1JMWA 1A7DA 2DYSC 3DM9B 4P9FA 1SYQA 2EIJC 1NU9C 3FXHA 4NC3A 4U5HA 1UG7A 2JX0A 2W45A 3TQOA 4P6IC 2XL6A 4IAOA 2XLWA 1HW1A 2G3VA 1N1CA 1YARO 1GGQA 2KYHA 2L9JA 2YLGA 3FOOA 3KH2A 4LERA 1K05A 1I4ZA 3KYJA 3LNRA 4N6HA 3U2MA 1Z23A 4AE4A 3V5YA 5FCLA 1WTYA 2D4UA 1VTMP 5T1DB 2KSFA 5KYUA 4BG0A 2L6HA 3EHMA 1BZ4A 1YAUO 2GAQA 2B0HA 3M4CA 4KC9A 5KYXA 4YT4A 2P7VA 3N2ZB 3ZSUA 4U9DA 4AX2A 2PX3A 3NDBB 3L8IA 1D1BA 3DD7A 4XPYA 2H7VC 2OKUA 3DAFA 4OD4A 1DOWA 1V4AA 1RXQA 2Y3DA 4Z9HA 3VRCA 5F5FA 4PK4A 1FAPB 1JR8A 3I4UA 3SXMA 3U3FA 1WATA 1CPQA 4BJ6A 1EA8A 3LJBA 1OW6A 3RQFA 2XLVA 2MHRA 2EPLX 4BJ6C 4JC7A 1LI5A 1YDIA 1M2VB 4BEJA 1YZCA 1ZW2A 1OCOC 2Q3TA 1QZXA 4JEBA 2KNHA 3E9VA 2W9YA 1YZAA 3DZAA 4XPWA 3U8PA 4FWVA 3MFNA 3UMIA 1BBHA 4XEFA 3FVYA 3QW1A 5F5HA 4DVZA 3L8JA 2X51A 4I3MA 4BEMJ 1OCCC 1ZHZA 5B1AC 3UMKA 4J32B 2BL2A 2WL8A 2YLDA 5DS5A 3H2VA 4C3EA 5AC5A 3WODF 4NTBA 5FZTA 3EGDB 4MTGA 3QVYA 4W8KA 2G3KA 5L0FA 2HFIA 5E2QA 2XS1A 4JTCB 5E3CA 3NRHA 5JLIA 1AVOB 1J8MF 2VCAA 4HFKB 3O10A 4YJWA 4YT2A 3AQCA 2TMVP 5T3WA 3U0CA 4E7ZA 3W8IA 5L3QA 3IQCA 4A4AA 1VB5A 3DE8A 4HEAJ 2H8AA 4WJ0A 3L1MA 4E17A 3C8GD 1R4TA 1NFNA 4PJMA 4RBNA 1RJ9B 1M2VA 1NSGB 3SP1A 2IXPA 4M63A 1MMNA 4GYTA 3ZIBA 1WWPA 2OCCC 1Z3IX 3FOPA 3MLGA 4U9EA 2KK1A 5KYWB 3O39A 4QI0A 1I5NA 2XLDA 4K0DA 4DRHB 2YVKA 1D0ZA 2AWYA 4YL1A 3ABMC 4U5BE 4CJOA 4Z9IA 1S7ZA 3S27A 2EINC 3DWWA 1YA7O 2F22A 2YL3A 3GM3A 4XWJA 4K7BA 3U5SA 3FHDA 2Y3BA 1V74B 3EH1A 1T6IA 3U2LA 4BJ5A 2OEVA 2YL1A 4GEHA 3EG9B 4JRZA 1LE4A 5L0IA 1L7CA 2LFFA 1FNTc 2HSBA 2BC5A 4JJGA 3FAPB 2IM8A 4MVZA 4OINF 3WHNA 1ZHTA 2PBEA 3A11A 3GEIA 5IY5C 2R25A 2OJQA 1Y6DA 1LPEA 4O6YA 3V5ZA 5EHHA 4CX9A 4C7OB 5DLJA 2LSEA 2Q4FA 4WGYA 3S28A 4C3BA 4IGGA 5JT4A 3N24A 1T01A 1RJ9A 4DOZA 5DQTA 3H65A 1LVKA 2Q9BA 4G0HA 1TKNA 2HUJA 3SEOA 2UUIA 5KYWA 1LI7A 2NSGA 2O9XA 3RQGA 3VYWA 3ZWIA 1E83A 2J9UA 4DRIB 4E0IA 3AGTA 4E0HA 1GQAA 3EZIA 2LIGA 3B9QA 3K6BA 3MBGA 4U5FE 3ZTZA 3F46A 4NTFA 2XLMA 5L3VA 1G8XA 4LDKA 2ZXOA 2M4EA 4I44A 4MVMA 1ZHXA 2IOQA 2BE5F 3EG9A 3Q6NA 4AE4B 1SMYF 1CGME 2CNWA 1TWGA 1OXKA 2J9VA 3B71A 3K66A 3L0IA 3MYIA 2L81A 5BQHA 1ORJA 4JIOA 5KYUB 2PX0A 5KYXB 2YHSA 3EGXA 1QQ3A 3GEEA 2LD6A 3BEHA 4J30B 2FAPB 3W2WA 5B3IA 1H9GA 3RKOF 4C7OA 1A7VA 4OIRF 2GWWA 5COMA 4MNDA 5CIVA 3HKKA 3JRTA 4JCZA 2NSFA 4CJGA 3EFOA 2IXOA 2Q9CA 1D0YA 2QTVA 4JURI 2XM0A 5DS4A 1O5HA 2H7BA 4ZLDA 2R7VA 3LEOA 3SYNA 2XM4A 3LESA 1XWJA 2CCYA 2JPUA 1W2WA 4PR9A 2CDQA 2XL8A 2EIMC 3EPVA 2LFDA 2VC9A 2NUTB 4J7TA 1Z6AA 5D92A 3ATPA 4MQ9F 3LS1A 2R7RA 4JTAB 3G4XA 5JSLA 4FX5A 4I1OB 3NMIA 3S84A 2R7SA 5JRAA 3E70C 5D91A 1YYJA 4EUKB 4E18A 2VB6A 2DB4A 4CDYA 3PHF2 1NU7D 2R03A 2VCBA 3LNMB 3UR3C 3RVZA 1QLEC 4MVQA 2QUPA 4A2NB 5DS6A 2KJGA 3N0TA 5A6AA 3NYLA 4CIPA 1ORSC 1KU2A 2YL0A 1Q0DA 4NY3A 3U8VA 4KNWA 3QMKA 4D4NA 1QVXA 3US6A 2WZGA 2YWAA 3NYJA 5B1BC 2R7UA 2QNLA 2ZD9A 3POVA 3SXKA 1NFOA 4BPMA 2R02A 2Y39A 3W8HA 2RD9A 1FTSA 2XSEA 3FMSA 3DM5A 3NMJA 1NBBA 2LQGA 2P6VA 4PFPA 2HSQA 3H2UA 4N4WA 1HMDA 2NUTA 3AG4C 1ZZPA 3IQTA 4XLNF 3DE9A 2J7PA 1PD1A 3AJMA 3PDMP 4JCHA 4JVSA 3IQ6A 3QW0A 1CGOA 1YLMA 1XZQA 3FAJA 3IQ5A 4B6IA 4O6NA 3G50A 2OU6A 5L0DA 3TULA 1Y4CA 2VASA 1EQ1A 1T6QA 2J8WA 3IHUA 4I1MA 4YT8A 1HY5A 4MTFA 2I15A 5HSWA 4YWQA 1O87A 5A6BA 4AK9A 2NUPB 1BDJB 1VOMA 4FESA 3NG1A 1OKKD 1OR3A 4R32A 4RD9A 4CDAA 5L0CA 1AUEA 3ASOC 3JT1A 5BUOA 4K1OA 2C04A 2Z15A 3LS0A 1E84A 2YLIA 1FFTC 1KNYA 2A6HF 4FAPB 3NKEA 2V3CC 4EIYA 2HS5A 2VCCA 1VMAA 3AOUA 3SXZA 1OQCA 2XLHA 2HV6A 3OA1A 3V7OA 4JZAA 4U5GA 3UNGC 1E2XA 1U89A 2QY9A 2B0JA 4U5CE 2M64A 3JYHA 2IBFA 3I5PA 2A1DD 3ABKC 2ZXWC 3GWLA 1DOVA 1HE1A 3NMKA 3AG3C 2G62A 1OCRC 4MVOA 4YL3A 1Z7Qc 5L0JA 1G5ZA 1OCZC 3C8ZA 4Q7CA 1J8YF 4CS8A 3JSZA 1H7IA 3GANA 4ZLCA 4E7SA 3DJNB 2KQ9A 3L34A 1IW7F 3DAGA 4CS8C 2EPKX 1JPNA 5KYYB 3BRJA 3NYMA 4PJJA 3UGPA 2XLOA 1NG1A 3EGXB 4DJ9A 2D5RB 2NUPA 1G4WR 1T9KA 1M57C 5CI9A 1OR2A 1WGWA 2MYSA 3LLKA 4U5EE 1YYXA 2PP4A 1A41A 3ECSA 4NCQA 3AGUA 4XTKA 4YT5A 2XXAA 3K33A 3EFOB 1SZIA 2OEXA 1RCPA 4W8PA 3WG7C 3JYYA 4J7YA 2J7PD 3UGOA 1TWCA 1M2OA 1PCXA 2XL4A 3GM1A 4EWCA 3RF3A 2P61A 2QE9A 2WVQA 4G7ZF 1SF8A 4IAQA 4PJLA 1T6UA 2OOCA 2WZFA 2R7WA 3TOMA 3HLZA 4Q4ZF 1MNDA 1NZEA 1WOLA 2IXNA 3CQZA 3LEVA 3OWTA 3ABLC 1U6HA 2J0XA 3QTHA 4IB4A 4EKWA 5KYNA 1GM5A 3C62A 3EJNA 3ZG1A 1H9TA 4HE8D 4CS7A 4NTAA 2LCHA 2J0WA 5A6BD 2QLAA 4MVSA 1SR2A 4LLEA 4G7HF 4F4BA 4CIHA 5JUAA 1Q0MA 3B0VC 1Z63A 3TJ6A 1M6TA 4G78A 3VM6A 2Y3HA 2HJ3A 1YJGA 4YL0A 2J9WA 1K04A 2DI3A 2EPOA 5EK0A 3O55A 3V5XA 3ZDLA 1HMOA 5L0GA 1D0XA 1LE2A 1D1AA 1TWAA 3S29A 4AL1A 4C3DA 5TJ5E 4CDVA 2HMZA 2YZSA 3J06A 3GODA 4KI2A 2AVKA 1RKCA 1A7EA 1FFHA 1LKXA 5COGA 1IZMA 1LS1A 2KC3A 2WVNA 1QSPA 2GFHA 1HW2A 3AG2C 4H54A 2E87A 5AC4A 2KGOA 3KL4A 1T5OA 2ZXRA 4PFOA 4EBKA 3S0XA 4PJNA 3M15A 3QZCA 3EHNA 5A6JA 3KMIA 2R7OA 3LAYA 4ULVA 4G7OF 2OJED 1JRAA 2L6FA 3EQLF 2AWCA 4BJTA 4DBRA 3CZ6A 1WN0A 1ZYRF 3FDQA 3DMDA 4IARA 3HNIA 1ST6A 3IPMO 1TWHA 1FMWA 3ZC4A 3EH2A 4O7GA 3R7CA 3JZ0A 4EBJA 1KTMA 2WB7A 1BR4A 3F47A 3S90A 4HFFB 4O6MA 3KPHA 3X1OA 4ONSA 2EIKC 3MYFA 1E85A 3PMRA 3MX3A 1APCA 3M4BA 1S05A 5BQGA 5GPGB 2YRFA 1D1CA 2R9RB 2A68F 3GEHA 3I5QA 1RMVA 3HNJA 2P0NA 2FGYA 4MTOA 4MW8A 2I8BA 4ULWA 1EKYA 1PV3A 2ZPAA 3T9OA 2Y3GA 4RDAA 4MW3A 3SNHA 1K40A 1ZU5A 3K7DA 3W2VA 1LIHA 3EZHA 2OQMA 1EI7A 3B0PA 4N6CA 3K1IA 2PFDA 3CSKA 2KW3C 2HZ8A 3RIPA 4MS2A 3T6BA 5B3SC 1OW8A 2R05A 1E86A 2R7TA 3K1IC 3OEOA 2C03A 1WASA 3AQBA 5L0HA 4JE9A 3U9MA 4P9TA 1MQVA 3HNLA 2Q00A 3RFYA 2YKZA 3VF0A 3ZQYA 4ER9A 2CNWD 1CGNA 3TJ5A 3CAXA 4NQFA 1CPRA 5K0IA 1BR2A 2LP4A 1FMVA 2XRHA 4JTDB 1ORYA 3B29A 4XPXA 2RSEB 3C7JA 1O3UA 2Y69C 4KNVA 5HV9A 2WVOA 3CEXA 1A0BA 3R2PA 4UDVA 1F1MA 1MMDA 2ZXPA 1UFBA 4JJFA 1HE9A 5E33A 1MNEA 2EPNA 3RW0A 4YN0B 2X0CA 4CBEA 4CS9A 2R7XA 1I4YA 4IJJA 1QPUA 1ZHYA 5KYYA 4CS9C 3SZRA 4H4KC
chains in the Genus database with same CATH topology
3G4ZA 3G50A 3G4XA 1T6QA 1Q0FA 1T6IA 1Q0KA 1Q0DA 1Q0MA 1T6UA 1Q0GA 4NCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4Z A;  3G50 A;  3G4X A;  1T6Q A;  1Q0F A;  1T6I A;  1Q0K A;  1Q0D A;  1Q0M A;  1T6U A;  1Q0G A;  4NCQ A; 
#chains in the Genus database with same CATH topology
 2MWQ A;  4N06 A;  3LLI A;  5T3T A;  1VLT A;  2XLE A;  2L7A A;  2AP3 A;  5DQZ A;  1YA9 A;  4BJ1 A;  4L6R A;  2HV7 A;  2IYL D;  2XXA B;  1JOG A;  1MMG A;  1YVI A;  4DRJ B;  1M56 C;  2GDC A;  2A69 F;  2HKV A;  2GA0 A;  4QDL A;  4EHP A;  4DXW A;  4Q5S F;  2YL7 A;  4XQ1 A;  3HJC A;  2Q7R A;  5A6K A;  2P1A A;  2NPU A;  4MVR A;  2CGE A;  3ZQV A;  4O79 A;  4WAB A;  1R5I D;  2R7Q A;  2CYD A;  2ICW G;  1AEP A;  1TFK B;  4IWB A;  4ANJ A;  4JKV A;  4Z9J A;  1JAF A;  1NLX A;  2YEV A;  1TQG A;  3O6X A;  2FFH A;  3PCV A;  2VH3 A;  3ASN C;  5EGY A;  1B68 A;  4EBB A;  1FR0 A;  2A6E F;  1Q0G A;  1RKE B;  4LLC A;  4DBQ A;  5A69 A;  4OIP F;  4LDR A;  1MMA A;  3ZVR A;  1ZW3 A;  4LDQ A;  2EIL C;  1C02 A;  2J9B A;  5CI8 A;  1VK5 A;  5AGF A;  1ZHW A;  2PNO A;  3JCU Q;  4U5D E;  4XEV A;  3GWN A;  2XS8 A;  1PD0 A;  1LM3 B;  2UUH A;  5E3A A;  5BQI A;  3DJU B;  1ZU4 A;  1OXB A;  3NKD A;  4QI2 A;  1VYK A;  3KYI A;  1BR1 A;  1V54 C;  4LAC B;  3RH3 A;  4JEA A;  4MVU A;  3RVY A;  4OD5 A;  3VAY A;  4OIQ F;  1OW7 A;  2A0B A;  3EGD A;  2J46 A;  3GM2 A;  4X0R A;  5DVW A;  2LK4 A;  4IRU A;  4BJ5 C;  3DKA A;  3M79 A;  3WAQ A;  2A0U A;  3JRM O;  3HNK A;  1VYI A;  2L6G A;  3M1C B;  3KKB A;  2DGJ A;  1GS9 A;  1Z5Z A;  4XLP F;  2PF4 E;  5COF A;  3UMH A;  3JTL O;  1RKE A;  5JS5 A;  2IXM A;  1U0B B;  3RQE A;  1VLS A;  3TD7 A;  2WZL A;  2CW0 F;  3T6J A;  2H7O A;  1XZP A;  3W4Y A;  1QKR A;  2ETS A;  1TR2 A;  3C8G B;  2HMQ A;  1V55 C;  4JW1 A;  3RYL A;  4WGZ A;  2W4B A;  1C03 A;  2J45 A;  256B A;  1Q0K A;  3U9J A;  3DI5 A;  2EPM X;  4DVY P;  2HJM A;  2AU5 A;  2NG1 A;  3Q6M A;  5F28 E;  3SXY A;  3K1H A;  5JP7 A;  3TK0 A;  4D4X A;  1Q0F A;  3GOR A;  3IEE A;  3S9O A;  4AL0 A;  3T4R A;  1JPJ A;  1H6G A;  2JD3 A;  3G4Z A;  3ITF A;  3Q7L A;  3TOL A;  2ASR A;  3LUT B;  3QVZ A;  5JVE A;  4CSA A;  2W4M A;  4XEK A;  3U3B A;  3B0U X;  4YK5 A;  3A9C A;  4CSA C;  3T6G B;  4OIO F;  2OG2 A;  2V26 A;  3C63 A;  4GQH A;  3C18 A;  1TFO B;  1ZVZ A;  3HTK C;  4PAC A;  1L3P A;  3JSE O;  1C17 M;  1G4U S;  2YQY A;  3Q7G A;  4KBL A;  3X2Q C;  2DYR C;  1OKK A;  3DXJ F;  1LS4 A;  3AG1 C;  3C8G A;  2Q9A A;  3ZTM A;  1JMW A;  1A7D A;  2DYS C;  3DM9 B;  4P9F A;  1SYQ A;  2EIJ C;  1NU9 C;  3FXH A;  4NC3 A;  4U5H A;  1UG7 A;  2JX0 A;  2W45 A;  3TQO A;  4P6I C;  2XL6 A;  4IAO A;  2XLW A;  1HW1 A;  2G3V A;  1N1C A;  1YAR O;  1GGQ A;  2KYH A;  2L9J A;  2YLG A;  3FOO A;  3KH2 A;  4LER A;  1K05 A;  1I4Z A;  3KYJ A;  3LNR A;  4N6H A;  3U2M A;  1Z23 A;  4AE4 A;  3V5Y A;  5FCL A;  1WTY A;  2D4U A;  1VTM P;  5T1D B;  2KSF A;  5KYU A;  4BG0 A;  2L6H A;  3EHM A;  1BZ4 A;  1YAU O;  2GAQ A;  2B0H A;  3M4C A;  4KC9 A;  5KYX A;  4YT4 A;  2P7V A;  3N2Z B;  3ZSU A;  4U9D A;  4AX2 A;  2PX3 A;  3NDB B;  3L8I A;  1D1B A;  3DD7 A;  4XPY A;  2H7V C;  2OKU A;  3DAF A;  4OD4 A;  1DOW A;  1V4A A;  1RXQ A;  2Y3D A;  4Z9H A;  3VRC A;  5F5F A;  4PK4 A;  1FAP B;  1JR8 A;  3I4U A;  3SXM A;  3U3F A;  1WAT A;  1CPQ A;  4BJ6 A;  1EA8 A;  3LJB A;  1OW6 A;  3RQF A;  2XLV A;  2MHR A;  2EPL X;  4BJ6 C;  4JC7 A;  1LI5 A;  1YDI A;  1M2V B;  4BEJ A;  1YZC A;  1ZW2 A;  1OCO C;  2Q3T A;  1QZX A;  4JEB A;  2KNH A;  3E9V A;  2W9Y A;  1YZA A;  3DZA A;  4XPW A;  3U8P A;  4FWV A;  3MFN A;  3UMI A;  1BBH A;  4XEF A;  3FVY A;  3QW1 A;  5F5H A;  4DVZ A;  3L8J A;  2X51 A;  4I3M A;  4BEM J;  1OCC C;  1ZHZ A;  5B1A C;  3UMK A;  4J32 B;  2BL2 A;  2WL8 A;  2YLD A;  5DS5 A;  3H2V A;  4C3E A;  5AC5 A;  3WOD F;  4NTB A;  5FZT A;  3EGD B;  4MTG A;  3QVY A;  4W8K A;  2G3K A;  5L0F A;  2HFI A;  5E2Q A;  2XS1 A;  4JTC B;  5E3C A;  3NRH A;  5JLI A;  1AVO B;  1J8M F;  2VCA A;  4HFK B;  3O10 A;  4YJW A;  4YT2 A;  3AQC A;  2TMV P;  5T3W A;  3U0C A;  4E7Z A;  3W8I A;  5L3Q A;  3IQC A;  4A4A A;  1VB5 A;  3DE8 A;  4HEA J;  2H8A A;  4WJ0 A;  3L1M A;  4E17 A;  3C8G D;  1R4T A;  1NFN A;  4PJM A;  4RBN A;  1RJ9 B;  1M2V A;  1NSG B;  3SP1 A;  2IXP A;  4M63 A;  1MMN A;  4GYT A;  3ZIB A;  1WWP A;  2OCC C;  1Z3I X;  3FOP A;  3MLG A;  4U9E A;  2KK1 A;  5KYW B;  3O39 A;  4QI0 A;  1I5N A;  2XLD A;  4K0D A;  4DRH B;  2YVK A;  1D0Z A;  2AWY A;  4YL1 A;  3ABM C;  4U5B E;  4CJO A;  4Z9I A;  1S7Z A;  3S27 A;  2EIN C;  3DWW A;  1YA7 O;  2F22 A;  2YL3 A;  3GM3 A;  4XWJ A;  4K7B A;  3U5S A;  3FHD A;  2Y3B A;  1V74 B;  3EH1 A;  1T6I A;  3U2L A;  4BJ5 A;  2OEV A;  2YL1 A;  4GEH A;  3EG9 B;  4JRZ A;  1LE4 A;  5L0I A;  1L7C A;  2LFF A;  1FNT c;  2HSB A;  2BC5 A;  4JJG A;  3FAP B;  2IM8 A;  4MVZ A;  4OIN F;  3WHN A;  1ZHT A;  2PBE A;  3A11 A;  3GEI A;  5IY5 C;  2R25 A;  2OJQ A;  1Y6D A;  1LPE A;  4O6Y A;  3V5Z A;  5EHH A;  4CX9 A;  4C7O B;  5DLJ A;  2LSE A;  2Q4F A;  4WGY A;  3S28 A;  4C3B A;  4IGG A;  5JT4 A;  3N24 A;  1T01 A;  1RJ9 A;  4DOZ A;  5DQT A;  3H65 A;  1LVK A;  2Q9B A;  4G0H A;  1TKN A;  2HUJ A;  3SEO A;  2UUI A;  5KYW A;  1LI7 A;  2NSG A;  2O9X A;  3RQG A;  3VYW A;  3ZWI A;  1E83 A;  2J9U A;  4DRI B;  4E0I A;  3AGT A;  4E0H A;  1GQA A;  3EZI A;  2LIG A;  3B9Q A;  3K6B A;  3MBG A;  4U5F E;  3ZTZ A;  3F46 A;  4NTF A;  2XLM A;  5L3V A;  1G8X A;  4LDK A;  2ZXO A;  2M4E A;  4I44 A;  4MVM A;  1ZHX A;  2IOQ A;  2BE5 F;  3EG9 A;  3Q6N A;  4AE4 B;  1SMY F;  1CGM E;  2CNW A;  1TWG A;  1OXK A;  2J9V A;  3B71 A;  3K66 A;  3L0I A;  3MYI A;  2L81 A;  5BQH A;  1ORJ A;  4JIO A;  5KYU B;  2PX0 A;  5KYX B;  2YHS A;  3EGX A;  1QQ3 A;  3GEE A;  2LD6 A;  3BEH A;  4J30 B;  2FAP B;  3W2W A;  5B3I A;  1H9G A;  3RKO F;  4C7O A;  1A7V A;  4OIR F;  2GWW A;  5COM A;  4MND A;  5CIV A;  3HKK A;  3JRT A;  4JCZ A;  2NSF A;  4CJG A;  3EFO A;  2IXO A;  2Q9C A;  1D0Y A;  2QTV A;  4JUR I;  2XM0 A;  5DS4 A;  1O5H A;  2H7B A;  4ZLD A;  2R7V A;  3LEO A;  3SYN A;  2XM4 A;  3LES A;  1XWJ A;  2CCY A;  2JPU A;  1W2W A;  4PR9 A;  2CDQ A;  2XL8 A;  2EIM C;  3EPV A;  2LFD A;  2VC9 A;  2NUT B;  4J7T A;  1Z6A A;  5D92 A;  3ATP A;  4MQ9 F;  3LS1 A;  2R7R A;  4JTA B;  3G4X A;  5JSL A;  4FX5 A;  4I1O B;  3NMI A;  3S84 A;  2R7S A;  5JRA A;  3E70 C;  5D91 A;  1YYJ A;  4EUK B;  4E18 A;  2VB6 A;  2DB4 A;  4CDY A;  3PHF 2;  1NU7 D;  2R03 A;  2VCB A;  3LNM B;  3UR3 C;  3RVZ A;  1QLE C;  4MVQ A;  2QUP A;  4A2N B;  5DS6 A;  2KJG A;  3N0T A;  5A6A A;  3NYL A;  4CIP A;  1ORS C;  1KU2 A;  2YL0 A;  1Q0D A;  4NY3 A;  3U8V A;  4KNW A;  3QMK A;  4D4N A;  1QVX A;  3US6 A;  2WZG A;  2YWA A;  3NYJ A;  5B1B C;  2R7U A;  2QNL A;  2ZD9 A;  3POV A;  3SXK A;  1NFO A;  4BPM A;  2R02 A;  2Y39 A;  3W8H A;  2RD9 A;  1FTS A;  2XSE A;  3FMS A;  3DM5 A;  3NMJ A;  1NBB A;  2LQG A;  2P6V A;  4PFP A;  2HSQ A;  3H2U A;  4N4W A;  1HMD A;  2NUT A;  3AG4 C;  1ZZP A;  3IQT A;  4XLN F;  3DE9 A;  2J7P A;  1PD1 A;  3AJM A;  3PDM P;  4JCH A;  4JVS A;  3IQ6 A;  3QW0 A;  1CGO A;  1YLM A;  1XZQ A;  3FAJ A;  3IQ5 A;  4B6I A;  4O6N A;  3G50 A;  2OU6 A;  5L0D A;  3TUL A;  1Y4C A;  2VAS A;  1EQ1 A;  1T6Q A;  2J8W A;  3IHU A;  4I1M A;  4YT8 A;  1HY5 A;  4MTF A;  2I15 A;  5HSW A;  4YWQ A;  1O87 A;  5A6B A;  4AK9 A;  2NUP B;  1BDJ B;  1VOM A;  4FES A;  3NG1 A;  1OKK D;  1OR3 A;  4R32 A;  4RD9 A;  4CDA A;  5L0C A;  1AUE A;  3ASO C;  3JT1 A;  5BUO A;  4K1O A;  2C04 A;  2Z15 A;  3LS0 A;  1E84 A;  2YLI A;  1FFT C;  1KNY A;  2A6H F;  4FAP B;  3NKE A;  2V3C C;  4EIY A;  2HS5 A;  2VCC A;  1VMA A;  3AOU A;  3SXZ A;  1OQC A;  2XLH A;  2HV6 A;  3OA1 A;  3V7O A;  4JZA A;  4U5G A;  3UNG C;  1E2X A;  1U89 A;  2QY9 A;  2B0J A;  4U5C E;  2M64 A;  3JYH A;  2IBF A;  3I5P A;  2A1D D;  3ABK C;  2ZXW C;  3GWL A;  1DOV A;  1HE1 A;  3NMK A;  3AG3 C;  2G62 A;  1OCR C;  4MVO A;  4YL3 A;  1Z7Q c;  5L0J A;  1G5Z A;  1OCZ C;  3C8Z A;  4Q7C A;  1J8Y F;  4CS8 A;  3JSZ A;  1H7I A;  3GAN A;  4ZLC A;  4E7S A;  3DJN B;  2KQ9 A;  3L34 A;  1IW7 F;  3DAG A;  4CS8 C;  2EPK X;  1JPN A;  5KYY B;  3BRJ A;  3NYM A;  4PJJ A;  3UGP A;  2XLO A;  1NG1 A;  3EGX B;  4DJ9 A;  2D5R B;  2NUP A;  1G4W R;  1T9K A;  1M57 C;  5CI9 A;  1OR2 A;  1WGW A;  2MYS A;  3LLK A;  4U5E E;  1YYX A;  2PP4 A;  1A41 A;  3ECS A;  4NCQ A;  3AGU A;  4XTK A;  4YT5 A;  2XXA A;  3K33 A;  3EFO B;  1SZI A;  2OEX A;  1RCP A;  4W8P A;  3WG7 C;  3JYY A;  4J7Y A;  2J7P D;  3UGO A;  1TWC A;  1M2O A;  1PCX A;  2XL4 A;  3GM1 A;  4EWC A;  3RF3 A;  2P61 A;  2QE9 A;  2WVQ A;  4G7Z F;  1SF8 A;  4IAQ A;  4PJL A;  1T6U A;  2OOC A;  2WZF A;  2R7W A;  3TOM A;  3HLZ A;  4Q4Z F;  1MND A;  1NZE A;  1WOL A;  2IXN A;  3CQZ A;  3LEV A;  3OWT A;  3ABL C;  1U6H A;  2J0X A;  3QTH A;  4IB4 A;  4EKW A;  5KYN A;  1GM5 A;  3C62 A;  3EJN A;  3ZG1 A;  1H9T A;  4HE8 D;  4CS7 A;  4NTA A;  2LCH A;  2J0W A;  5A6B D;  2QLA A;  4MVS A;  1SR2 A;  4LLE A;  4G7H F;  4F4B A;  4CIH A;  5JUA A;  1Q0M A;  3B0V C;  1Z63 A;  3TJ6 A;  1M6T A;  4G78 A;  3VM6 A;  2Y3H A;  2HJ3 A;  1YJG A;  4YL0 A;  2J9W A;  1K04 A;  2DI3 A;  2EPO A;  5EK0 A;  3O55 A;  3V5X A;  3ZDL A;  1HMO A;  5L0G A;  1D0X A;  1LE2 A;  1D1A A;  1TWA A;  3S29 A;  4AL1 A;  4C3D A;  5TJ5 E;  4CDV A;  2HMZ A;  2YZS A;  3J06 A;  3GOD A;  4KI2 A;  2AVK A;  1RKC A;  1A7E A;  1FFH A;  1LKX A;  5COG A;  1IZM A;  1LS1 A;  2KC3 A;  2WVN A;  1QSP A;  2GFH A;  1HW2 A;  3AG2 C;  4H54 A;  2E87 A;  5AC4 A;  2KGO A;  3KL4 A;  1T5O A;  2ZXR A;  4PFO A;  4EBK A;  3S0X A;  4PJN A;  3M15 A;  3QZC A;  3EHN A;  5A6J A;  3KMI A;  2R7O A;  3LAY A;  4ULV A;  4G7O F;  2OJE D;  1JRA A;  2L6F A;  3EQL F;  2AWC A;  4BJT A;  4DBR A;  3CZ6 A;  1WN0 A;  1ZYR F;  3FDQ A;  3DMD A;  4IAR A;  3HNI A;  1ST6 A;  3IPM O;  1TWH A;  1FMW A;  3ZC4 A;  3EH2 A;  4O7G A;  3R7C A;  3JZ0 A;  4EBJ A;  1KTM A;  2WB7 A;  1BR4 A;  3F47 A;  3S90 A;  4HFF B;  4O6M A;  3KPH A;  3X1O A;  4ONS A;  2EIK C;  3MYF A;  1E85 A;  3PMR A;  3MX3 A;  1APC A;  3M4B A;  1S05 A;  5BQG A;  5GPG B;  2YRF A;  1D1C A;  2R9R B;  2A68 F;  3GEH A;  3I5Q A;  1RMV A;  3HNJ A;  2P0N A;  2FGY A;  4MTO A;  4MW8 A;  2I8B A;  4ULW A;  1EKY A;  1PV3 A;  2ZPA A;  3T9O A;  2Y3G A;  4RDA A;  4MW3 A;  3SNH A;  1K40 A;  1ZU5 A;  3K7D A;  3W2V A;  1LIH A;  3EZH A;  2OQM A;  1EI7 A;  3B0P A;  4N6C A;  3K1I A;  2PFD A;  3CSK A;  2KW3 C;  2HZ8 A;  3RIP A;  4MS2 A;  3T6B A;  5B3S C;  1OW8 A;  2R05 A;  1E86 A;  2R7T A;  3K1I C;  3OEO A;  2C03 A;  1WAS A;  3AQB A;  5L0H A;  4JE9 A;  3U9M A;  4P9T A;  1MQV A;  3HNL A;  2Q00 A;  3RFY A;  2YKZ A;  3VF0 A;  3ZQY A;  4ER9 A;  2CNW D;  1CGN A;  3TJ5 A;  3CAX A;  4NQF A;  1CPR A;  5K0I A;  1BR2 A;  2LP4 A;  1FMV A;  2XRH A;  4JTD B;  1ORY A;  3B29 A;  4XPX A;  2RSE B;  3C7J A;  1O3U A;  2Y69 C;  4KNV A;  5HV9 A;  2WVO A;  3CEX A;  1A0B A;  3R2P A;  4UDV A;  1F1M A;  1MMD A;  2ZXP A;  1UFB A;  4JJF A;  1HE9 A;  5E33 A;  1MNE A;  2EPN A;  3RW0 A;  4YN0 B;  2X0C A;  4CBE A;  4CS9 A;  2R7X A;  1I4Y A;  4IJJ A;  1QPU A;  1ZHY A;  5KYY A;  4CS9 C;  3SZR A;  4H4K C; 
#chains in the Genus database with same CATH homology
 3G4Z A;  3G50 A;  3G4X A;  1T6Q A;  1Q0F A;  1T6I A;  1Q0K A;  1Q0D A;  1Q0M A;  1T6U A;  1Q0G A;  4NCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...