3G4XA

Crystal structure of nisod y9f mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
publication title Role of conserved tyrosine residues in NiSOD catalysis: a case of convergent evolution
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 49
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 3g4xA00
1Q0FA 1T6QA 1Q0KA 1Q0GA 1Q0DA 1Q0MA 1T6UA 3G4ZA 1T6IA 4NCQA 3G50A 3G4XA
chains in the Genus database with same CATH superfamily
2PX3A 1A7EA 2D4UA 2Q9CA 3MX3A 4GEHA 2A1DD 2A0UA 4ER9A 4CSAC 2LK4A 2R25A 3GORA 3JSZA 4N4WA 4CX9A 1ZVZA 1VLSA 2GAQA 2OOCA 2YL7A 2H8AA 3PCVA 4GQHA 4EBKA 5JLIA 4CDVA 4CS9C 3RW0A 3SEOA 4JW1A 1M2VA 4A2NB 1BDJB 4AE4A 2KK1A 3LUTB 1Z5ZA 4BJ1A 4E0HA 1VTMP 2XS8A 2YL0A 3AG2C 3KH2A 4F4BA 2EILC 2PBEA 4MVZA 2WZLA 4XWJA 3R2PA 1H9TA 4EIYA 3LS0A 2WB7A 4DJ9A 2CNWD 3T9OA 4H54A 2Y3BA 4JKVA 1RCPA 4G7OF 2FFHA 2PX0A 3GM1A 1T01A 3HNJA 3JRTA 2VC9A 2WZFA 2Q00A 3BEHA 3JT1A 4G0HA 4U5HA 2NUTA 3GEHA 2FGYA 5IY5C 3GANA 3U8PA 3Q6NA 3M4CA 2J0XA 2JX0A 3AGUA 2GFHA 1NG1A 4BJ5C 4KBLA 3PDMP 4AL0A 4BG0A 1FFTC 1OW7A 1XWJA 2HJ3A 3FOPA 3C8ZA 1CPQA 2Y69C 3HLZA 3LJBA 4D4XA 3S0XA 3EZHA 4PJNA 3EFOB 1RKCA 4MTFA 3EHMA 4CIHA 2EPKX 2LD6A 5KYUA 4OIPF 2HMQA 3M79A 4PACA 1ORSC 3VM6A 3C8GD 2PF4E 3I5QA 3C62A 5HV9A 1GQAA 1VYIA 4G78A 4NTFA 3K1IA 5L0CA 1XZPA 4Q4ZF 1Z7Qc 5A69A 4P9TA 4YJWA 4CS7A 4C7OA 4NQFA 1QLEC 2Y3HA 1OQCA 1WN0A 4NCQA 4RDAA 3EJNA 2RD9A 2P61A 5BQIA 2EPMX 2BE5F 2GA0A 3W2VA 5CIVA 4OIQF 4XPXA 2YZSA 4JCHA 3B0VC 4N6CA 1M2VB 2Y3DA 2YLIA 2KNHA 3WHNA 2KGOA 2L6HA 3JRMO 4YL1A 1M2OA 1WTYA 5DS5A 3SZRA 1LVKA 1T6UA 4XLNF 2VH3A 3AG1C 1ZU4A 2OEVA 1FFHA 1K05A 3UR3C 5COGA 1H7IA 4Z9IA 4W8PA 1AEPA 2NUTB 2IM8A 4U5BE 1OW6A 3ZC4A 2HFIA 3GM2A 3EG9A 3Q6MA 1E86A 5D92A 3EGXA 5JUAA 4WJ0A 3OWTA 1LM3B 2Z15A 4H4KC 1FTSA 1SMYF 1T5OA 2XXAA 3X2QC 2RSEB 1QZXA 4KI2A 1A0BA 4JTCB 2DYSC 4MVSA 5D91A 3ZVRA 1FR0A 3O10A 1DOVA 4YL0A 3J06A 1BBHA 2ZXRA 2YKZA 2IXMA 4K7BA 2L6GA 2IXOA 1H9GA 2MHRA 3NG1A 4MNDA 4YWQA 3ATPA 5K0IA 1Q0FA 2CYDA 3LEOA 1D1CA 1N1CA 2XS1A 3NMJA 1KTMA 2G62A 2O9XA 3NYJA 4CDYA 3QVZA 2OQMA 1OR3A 1VOMA 2LCHA 4FESA 1O87A 4XTKA 1G4WR 2HKVA 5A6AA 4PR9A 2F22A 1QKRA 2JPUA 4OIRF 4C7OB 4HFKB 1HE9A 3L8JA 3VAYA 1JRAA 2EPOA 1APCA 2HSBA 2B0HA 1GGQA 3HKKA 2A68F 4XEFA 3I4UA 1QPUA 5E33A 3U3BA 3QW1A 3LLKA 1H6GA 4JE9A 1TFOB 3HTKC 4U5GA 1A41A 1E83A 1MNEA 4MVOA 1L7CA 2EPNA 4P6IC 4J30B 4IAOA 2EIKC 3QTHA 3UGOA 4KC9A 3S27A 2NUPA 1ORYA 2Q4FA 4NY3A 3TJ6A 3HNLA 4XQ1A 4C3BA 3U0CA 2I8BA 3TULA 2OKUA 1JOGA 1LE4A 2Q3TA 4P9FA 1FMWA 1O3UA 3DJUB 5FZTA 2X0CA 4IAQA 3IQCA 2R7SA 4O79A 3IPMO 1TKNA 4J7TA 2AU5A 4L6RA 4QDLA 2PP4A 2ETSA 3CZ6A 2AWYA 4Q5SF 2HMZA 2MWQA 4JCZA 1OCZC 3GWNA 4XEKA 3W8HA 1UFBA 4BJ6C 2LFFA 1JPJA 4DBRA 2X51A 2XXAB 4CBEA 3G4XA 1OKKA 3I5PA 1MMGA 4YT2A 1Z63A 2L6FA 1PCXA 3MYFA 1RJ9B 5FCLA 1WWPA 2PFDA 2M64A 1RMVA 4LDQA 1PV3A 1C17M 5DVWA 1PD1A 1T6QA 3KYJA 3C8GA 4U5EE 5COMA 3R7CA 3V5YA 1WGWA 3ABKC 3N2ZB 2ICWG 4N06A 3RIPA 2HZ8A 4EUKB 3RVYA 3SXMA 3O6XA 4LDRA 2L81A 1Q0DA 3H2VA 3NMIA 1D0XA 3DM9B 4AE4B 4CS8C 2KJGA 4OD5A 1LS4A 5TJ5E 1M56C 4PFOA 4BEMJ 4JRZA 2HJMA 1Q0KA 2J9BA 1ZZPA 1DOWA 2VCAA 2Y39A 2IXNA 2HV6A 4JIOA 1I4ZA 3UMIA 4A4AA 2YL1A 3DI5A 3S28A 1HW1A 2R02A 3N0TA 1YA7O 3TK0A 1YYXA 5JRAA 1D0ZA 3GODA 1HMDA 2NUPB 4XPWA 1G5ZA 3DMDA 3EPVA 4MQ9F 5CI8A 3NMKA 3QW0A 2ZPAA 5A6JA 1OXKA 2J0WA 2GDCA 1NBBA 2A69F 5HSWA 4MS2A 1TFKB 4ULVA 4BJ5A 1V74B 2W4MA 3CSKA 3MYIA 2UUHA 2P0NA 5COFA 4AL1A 5KYWA 2LQGA 3G4ZA 1A7DA 1WASA 2CGEA 1OKKD 2OJQA 3H65A 3MFNA 4GYTA 5T1DB 1BR4A 3VRCA 1MMNA 1RKEA 5JSLA 4JURI 3RKOF 4IARA 4ZLCA 1L3PA 3AG4C 3WG7C 3KKBA 1SR2A 3B0PA 1EI7A 4M63A 4CDAA 3FXHA 2XLVA 3U8VA 2CCYA 2LFDA 2Q9BA 4CJGA 3C63A 3C8GB 3K1HA 4DVZA 4JTAB 2YRFA 3DD7A 2KSFA 2XM0A 3JTLO 1JMWA 2JD3A 2DGJA 2HV7A 3GEEA 3ZG1A 1BR2A 4YN0B 3RH3A 3S29A 5B3SC 1E85A 3W4YA 2EIJC 1T6IA 2A0BA 1EQ1A 2XL6A 2J9UA 3US6A 1C03A 2LIGA 3DJNB 4LDKA 4NC3A 4U5DE 3FHDA 1Q0GA 3EH2A 3ZTZA 3UNGC 3LAYA 1OCCC 1SZIA 5E3CA 2NG1A 2XLEA 3ABLC 3SXKA 3CQZA 3U2LA 3VYWA 3T4RA 3TJ5A 4QI0A 1B68A 4WGYA 1J8YF 4U9DA 2L9JA 2OG2A 3SP1A 3FDQA 3DAGA 3K33A 5AGFA 5KYNA 4K1OA 1D1AA 1AUEA 5GPGB 4MVRA 5A6KA 2KC3A 3FAPB 4MTGA 5EHHA 5L0GA 1SF8A 3VF0A 1E84A 1NU7D 3EHNA 1BR1A 5L0HA 5A6BA 3CEXA 4NTBA 1YYJA 4LERA 1VYKA 2R03A 2R7OA 1VMAA 2XLMA 3KPHA 5KYWB 3OEOA 5B3IA 3UMKA 1FMVA 3FMSA 5T3TA 3S9OA 2DI3A 3C18A 4EWCA 2XSEA 4HFFB 1RKEB 1NU9C 2A6EF 2G3VA 1EKYA 2R7WA 5KYUB 1K40A 2FAPB 3UGPA 2W45A 1JAFA 2DB4A 3TQOA 5L0IA 4YT8A 2XL8A 4ANJA 1CGME 1KNYA 3QZCA 4JEBA 1LPEA 3IHUA 4BEJA 4IGGA 2D5RB 3DM5A 1HMOA 2J45A 3U2MA 2M4EA 4JEAA 1I5NA 3OA1A 4O6YA 4PJMA 3M1CB 3T6JA 5DQTA 4B6IA 4EKWA 4W8KA 3H2UA 2H7OA 1G8XA 1U0BB 4I3MA 3NKEA 1GS9A 4MW8A 1CGOA 1YJGA 5BQHA 1RXQA 3HNKA 1Y6DA 4ULWA 1U89A 1NSGB 2W9YA 2NSGA 1BZ4A 3L8IA 3LLIA 3A9CA 4U5FE 2P1AA 3RFYA 5JVEA 2PNOA 1YZCA 5E3AA 2YLGA 1V54C 3EG9B 3JZ0A 2GWWA 2WVOA 3EQLF 2WVQA 3EGXB 4HE8D 4LACB 4X0RA 2YWAA 3B71A 3F46A 3TD7A 3U9MA 3GM3A 2CDQA 2DYRC 1MMAA 1YVIA 4MTOA 5E2QA 5A6BD 2E87A 4IWBA 4O7GA 3X1OA 2WZGA 2IYLD 1TWAA 2XRHA 3ZDLA 4ZLDA 4EBJA 1NFNA 3ECSA 4NTAA 1YZAA 1ZU5A 2QTVA 2XLDA 5JT4A 4XPYA 3K66A 2YHSA 4FX5A 3E9VA 1ZHXA 2XLHA 4JTDB 1V55C 4DBQA 1LKXA 1MNDA 1OCOC 4RD9A 4CSAA 2QLAA 5AC5A 2AP3A 4G7ZF 2VCCA 1D0YA 3K7DA 3K6BA 1YARO 2TMVP 5B1BC 3DXJF 1HW2A 3IQ6A 2P7VA 1QQ3A 3ASOC 3EFOA 4J32B 2BC5A 4CS9A 2ZXOA 3N24A 5EK0A 3DAFA 2NPUA 1TWHA 3SYNA 3IQTA 3ZSUA 3LNRA 5L0DA 4O6NA 4MW3A 3ZQYA 1ZHTA 3RQFA 4U5CE 4EBBA 3NDBB 1ST6A 1S05A 2J9WA 1S7ZA 2OCCC 2R7VA 3TOMA 4LLEA 3PHF2 2L7AA 3V7OA 2OJED 2UUIA 2R9RB 3FOOA 4R32A 2EPLX 2LSEA 3ASNC 3W2WA 1FNTc 3LNMB 1ZYRF 3S84A 1MQVA 2WL8A 3ABMC 5DQZA 3LESA 1HY5A 2R7UA 4E7SA 4JC7A 3WODF 2Y3GA 4AK9A 2QUPA 4PFPA 2HUJA 2ZXWC 3G50A 4D4NA 1IZMA 4FWVA 4RBNA 3ITFA 4E7ZA 4C3EA 3ZTMA 4N6HA 3BRJA 1ZHWA 3JYHA 3B29A 3T6BA 4K0DA 5L0FA 4C3DA 1G4US 1YAUO 4QI2A 1OW8A 2LP4A 2OU6A 1ZW2A 4ONSA 4JZAA 5CI9A 4E0IA 1QVXA 1T9KA 5L0JA 4Q7CA 2YL3A 3KYIA 4O6MA 3JYYA 3KMIA 2KQ9A 3SNHA 3SXZA 5JS5A 1LI5A 3AGTA 1KU2A 5AC4A 1Z3IX 3Q7GA 2EINC 3DZAA 1F1MA 4I1OB 3ZWIA 3Q7LA 3A11A 4IB4A 3EGDA 3EH1A 3V5ZA 1ZHYA 3M15A 2CW0F 2EIMC 4HEAJ 1AVOB 3IQ5A 4KNVA 2R7RA 1CPRA 2IOQA 4OD4A 3U9JA 5KYYA 3NRHA 4DRHB 1K04A 3L34A 3QVYA 2ZD9A 4MVMA 1UG7A 2YLDA 4BPMA 2J7PA 4IJJA 3L1MA 3K1IC 4CJOA 4DOZA 4CIPA 3QMKA 3FAJA 1JR8A 2C03A 2HSQA 1MMDA 1LS1A 1SYQA 1TWGA 5F5HA 3B0UX 3ZQVA 2XLOA 1WATA 1Z6AA 1VLTA 4JJGA 1OXBA 2YQYA 3EZIA 1Q0MA 3JSEO 3O39A 2J46A 2R7QA 2R05A 1VK5A 1IW7F 3U3FA 3ZIBA 1J8MF 1V4AA 4J7YA 3SXYA 2I15A 3S90A 1M6TA 1LI7A 3AOUA 3GWLA 3IEEA 3M4BA 3NKDA 3FVYA 3RQGA 5KYXA 2NSFA 1JPNA 2XLWA 1C02A 1OR2A 2XM4A 2R7XA 1ORJA 2H7BA 3DKAA 3E70C 4JJFA 2R7TA 1HE1A 1U6HA 2XL4A 2QY9A 4MVQA 5T3WA 2G3KA 3HJCA 4Z9JA 3T6GB 3V5XA 5DS4A 3RVZA 4UDVA 5DS6A 3LEVA 4G7HF 3UMHA 1XZQA 2V3CC 1WOLA 3RYLA 4DRJB 3MBGA 3NYMA 5F5FA 4EHPA 2J8WA 3DWWA 2P6VA 3C7JA 4FAPB 1YA9A 5L3VA 4PJJA 4JVSA 3F47A 2VASA 3CAXA 2BL2A 1RJ9A 2VB6A 2QE9A 3EGDB 4E18A 1D1BA 1YDIA 1TWCA 1NFOA 2VCBA 5DLJA 3JCUQ 3U5SA 3RF3A 1GM5A 1W2WA 1Y4CA 3MLGA 2WVNA 5KYYB 1A7VA 3POVA 4DVYP 2J7PD 3O55A 3TOLA 3DE9A 4E17A 4YK5A 3GEIA 4YT5A 1EA8A 4DXWA 1R5ID 2J9VA 2IBFA 2QNLA 4U9EA 4OINF 1ZW3A 1TQGA 2KYHA 1M57C 1TR2A 3AQCA 4YT4A 3PMRA 2B0JA 4I44A 1Z23A 2OEXA 5B1AC 2C04A 2V26A 4OIOF 4BJ6A 5EGYA 2AWCA 3KL4A 4PJLA 5KYXB 4XEVA 3W8IA 1PD0A 1R4TA 2YEVA 1I4YA 1O5HA 1NLXA 2CNWA 4LLCA 4WGZA 1FAPB 2ZXPA 5JP7A 1E2XA 2AVKA 5BQGA 2MYSA 2HS5A 4WABA 3DE8A 3LS1A 1LIHA 4IRUA 2H7VC 2YVKA 3NYLA 3RQEA 1QSPA 4Z9HA 2A6HF 1NZEA 1YLMA 5BUOA 4MVUA 1LE2A 3AQBA 4DRIB 4XLPF 3L0IA 4CS8A 2Q9AA 4KNWA 1CGNA 3HNIA 3AG3C 2Q7RA 1VB5A 5F28E 2ASRA 4YL3A 4BJTA 256BA 5L3QA 4I1MA 1OCRC 3AJMA 4PK4A 3B9QA 3WAQA 4AX2A 1ZHZA 2KW3C 2IXPA 2W4BA
chains in the Genus database with same CATH topology
1Q0FA 1T6QA 1Q0KA 1Q0GA 1Q0DA 1Q0MA 1T6UA 3G4ZA 1T6IA 4NCQA 3G50A 3G4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0F A;  1T6Q A;  1Q0K A;  1Q0G A;  1Q0D A;  1Q0M A;  1T6U A;  3G4Z A;  1T6I A;  4NCQ A;  3G50 A;  3G4X A; 
#chains in the Genus database with same CATH topology
 2PX3 A;  1A7E A;  2D4U A;  2Q9C A;  3MX3 A;  4GEH A;  2A1D D;  2A0U A;  4ER9 A;  4CSA C;  2LK4 A;  2R25 A;  3GOR A;  3JSZ A;  4N4W A;  4CX9 A;  1ZVZ A;  1VLS A;  2GAQ A;  2OOC A;  2YL7 A;  2H8A A;  3PCV A;  4GQH A;  4EBK A;  5JLI A;  4CDV A;  4CS9 C;  3RW0 A;  3SEO A;  4JW1 A;  1M2V A;  4A2N B;  1BDJ B;  4AE4 A;  2KK1 A;  3LUT B;  1Z5Z A;  4BJ1 A;  4E0H A;  1VTM P;  2XS8 A;  2YL0 A;  3AG2 C;  3KH2 A;  4F4B A;  2EIL C;  2PBE A;  4MVZ A;  2WZL A;  4XWJ A;  3R2P A;  1H9T A;  4EIY A;  3LS0 A;  2WB7 A;  4DJ9 A;  2CNW D;  3T9O A;  4H54 A;  2Y3B A;  4JKV A;  1RCP A;  4G7O F;  2FFH A;  2PX0 A;  3GM1 A;  1T01 A;  3HNJ A;  3JRT A;  2VC9 A;  2WZF A;  2Q00 A;  3BEH A;  3JT1 A;  4G0H A;  4U5H A;  2NUT A;  3GEH A;  2FGY A;  5IY5 C;  3GAN A;  3U8P A;  3Q6N A;  3M4C A;  2J0X A;  2JX0 A;  3AGU A;  2GFH A;  1NG1 A;  4BJ5 C;  4KBL A;  3PDM P;  4AL0 A;  4BG0 A;  1FFT C;  1OW7 A;  1XWJ A;  2HJ3 A;  3FOP A;  3C8Z A;  1CPQ A;  2Y69 C;  3HLZ A;  3LJB A;  4D4X A;  3S0X A;  3EZH A;  4PJN A;  3EFO B;  1RKC A;  4MTF A;  3EHM A;  4CIH A;  2EPK X;  2LD6 A;  5KYU A;  4OIP F;  2HMQ A;  3M79 A;  4PAC A;  1ORS C;  3VM6 A;  3C8G D;  2PF4 E;  3I5Q A;  3C62 A;  5HV9 A;  1GQA A;  1VYI A;  4G78 A;  4NTF A;  3K1I A;  5L0C A;  1XZP A;  4Q4Z F;  1Z7Q c;  5A69 A;  4P9T A;  4YJW A;  4CS7 A;  4C7O A;  4NQF A;  1QLE C;  2Y3H A;  1OQC A;  1WN0 A;  4NCQ A;  4RDA A;  3EJN A;  2RD9 A;  2P61 A;  5BQI A;  2EPM X;  2BE5 F;  2GA0 A;  3W2V A;  5CIV A;  4OIQ F;  4XPX A;  2YZS A;  4JCH A;  3B0V C;  4N6C A;  1M2V B;  2Y3D A;  2YLI A;  2KNH A;  3WHN A;  2KGO A;  2L6H A;  3JRM O;  4YL1 A;  1M2O A;  1WTY A;  5DS5 A;  3SZR A;  1LVK A;  1T6U A;  4XLN F;  2VH3 A;  3AG1 C;  1ZU4 A;  2OEV A;  1FFH A;  1K05 A;  3UR3 C;  5COG A;  1H7I A;  4Z9I A;  4W8P A;  1AEP A;  2NUT B;  2IM8 A;  4U5B E;  1OW6 A;  3ZC4 A;  2HFI A;  3GM2 A;  3EG9 A;  3Q6M A;  1E86 A;  5D92 A;  3EGX A;  5JUA A;  4WJ0 A;  3OWT A;  1LM3 B;  2Z15 A;  4H4K C;  1FTS A;  1SMY F;  1T5O A;  2XXA A;  3X2Q C;  2RSE B;  1QZX A;  4KI2 A;  1A0B A;  4JTC B;  2DYS C;  4MVS A;  5D91 A;  3ZVR A;  1FR0 A;  3O10 A;  1DOV A;  4YL0 A;  3J06 A;  1BBH A;  2ZXR A;  2YKZ A;  2IXM A;  4K7B A;  2L6G A;  2IXO A;  1H9G A;  2MHR A;  3NG1 A;  4MND A;  4YWQ A;  3ATP A;  5K0I A;  1Q0F A;  2CYD A;  3LEO A;  1D1C A;  1N1C A;  2XS1 A;  3NMJ A;  1KTM A;  2G62 A;  2O9X A;  3NYJ A;  4CDY A;  3QVZ A;  2OQM A;  1OR3 A;  1VOM A;  2LCH A;  4FES A;  1O87 A;  4XTK A;  1G4W R;  2HKV A;  5A6A A;  4PR9 A;  2F22 A;  1QKR A;  2JPU A;  4OIR F;  4C7O B;  4HFK B;  1HE9 A;  3L8J A;  3VAY A;  1JRA A;  2EPO A;  1APC A;  2HSB A;  2B0H A;  1GGQ A;  3HKK A;  2A68 F;  4XEF A;  3I4U A;  1QPU A;  5E33 A;  3U3B A;  3QW1 A;  3LLK A;  1H6G A;  4JE9 A;  1TFO B;  3HTK C;  4U5G A;  1A41 A;  1E83 A;  1MNE A;  4MVO A;  1L7C A;  2EPN A;  4P6I C;  4J30 B;  4IAO A;  2EIK C;  3QTH A;  3UGO A;  4KC9 A;  3S27 A;  2NUP A;  1ORY A;  2Q4F A;  4NY3 A;  3TJ6 A;  3HNL A;  4XQ1 A;  4C3B A;  3U0C A;  2I8B A;  3TUL A;  2OKU A;  1JOG A;  1LE4 A;  2Q3T A;  4P9F A;  1FMW A;  1O3U A;  3DJU B;  5FZT A;  2X0C A;  4IAQ A;  3IQC A;  2R7S A;  4O79 A;  3IPM O;  1TKN A;  4J7T A;  2AU5 A;  4L6R A;  4QDL A;  2PP4 A;  2ETS A;  3CZ6 A;  2AWY A;  4Q5S F;  2HMZ A;  2MWQ A;  4JCZ A;  1OCZ C;  3GWN A;  4XEK A;  3W8H A;  1UFB A;  4BJ6 C;  2LFF A;  1JPJ A;  4DBR A;  2X51 A;  2XXA B;  4CBE A;  3G4X A;  1OKK A;  3I5P A;  1MMG A;  4YT2 A;  1Z63 A;  2L6F A;  1PCX A;  3MYF A;  1RJ9 B;  5FCL A;  1WWP A;  2PFD A;  2M64 A;  1RMV A;  4LDQ A;  1PV3 A;  1C17 M;  5DVW A;  1PD1 A;  1T6Q A;  3KYJ A;  3C8G A;  4U5E E;  5COM A;  3R7C A;  3V5Y A;  1WGW A;  3ABK C;  3N2Z B;  2ICW G;  4N06 A;  3RIP A;  2HZ8 A;  4EUK B;  3RVY A;  3SXM A;  3O6X A;  4LDR A;  2L81 A;  1Q0D A;  3H2V A;  3NMI A;  1D0X A;  3DM9 B;  4AE4 B;  4CS8 C;  2KJG A;  4OD5 A;  1LS4 A;  5TJ5 E;  1M56 C;  4PFO A;  4BEM J;  4JRZ A;  2HJM A;  1Q0K A;  2J9B A;  1ZZP A;  1DOW A;  2VCA A;  2Y39 A;  2IXN A;  2HV6 A;  4JIO A;  1I4Z A;  3UMI A;  4A4A A;  2YL1 A;  3DI5 A;  3S28 A;  1HW1 A;  2R02 A;  3N0T A;  1YA7 O;  3TK0 A;  1YYX A;  5JRA A;  1D0Z A;  3GOD A;  1HMD A;  2NUP B;  4XPW A;  1G5Z A;  3DMD A;  3EPV A;  4MQ9 F;  5CI8 A;  3NMK A;  3QW0 A;  2ZPA A;  5A6J A;  1OXK A;  2J0W A;  2GDC A;  1NBB A;  2A69 F;  5HSW A;  4MS2 A;  1TFK B;  4ULV A;  4BJ5 A;  1V74 B;  2W4M A;  3CSK A;  3MYI A;  2UUH A;  2P0N A;  5COF A;  4AL1 A;  5KYW A;  2LQG A;  3G4Z A;  1A7D A;  1WAS A;  2CGE A;  1OKK D;  2OJQ A;  3H65 A;  3MFN A;  4GYT A;  5T1D B;  1BR4 A;  3VRC A;  1MMN A;  1RKE A;  5JSL A;  4JUR I;  3RKO F;  4IAR A;  4ZLC A;  1L3P A;  3AG4 C;  3WG7 C;  3KKB A;  1SR2 A;  3B0P A;  1EI7 A;  4M63 A;  4CDA A;  3FXH A;  2XLV A;  3U8V A;  2CCY A;  2LFD A;  2Q9B A;  4CJG A;  3C63 A;  3C8G B;  3K1H A;  4DVZ A;  4JTA B;  2YRF A;  3DD7 A;  2KSF A;  2XM0 A;  3JTL O;  1JMW A;  2JD3 A;  2DGJ A;  2HV7 A;  3GEE A;  3ZG1 A;  1BR2 A;  4YN0 B;  3RH3 A;  3S29 A;  5B3S C;  1E85 A;  3W4Y A;  2EIJ C;  1T6I A;  2A0B A;  1EQ1 A;  2XL6 A;  2J9U A;  3US6 A;  1C03 A;  2LIG A;  3DJN B;  4LDK A;  4NC3 A;  4U5D E;  3FHD A;  1Q0G A;  3EH2 A;  3ZTZ A;  3UNG C;  3LAY A;  1OCC C;  1SZI A;  5E3C A;  2NG1 A;  2XLE A;  3ABL C;  3SXK A;  3CQZ A;  3U2L A;  3VYW A;  3T4R A;  3TJ5 A;  4QI0 A;  1B68 A;  4WGY A;  1J8Y F;  4U9D A;  2L9J A;  2OG2 A;  3SP1 A;  3FDQ A;  3DAG A;  3K33 A;  5AGF A;  5KYN A;  4K1O A;  1D1A A;  1AUE A;  5GPG B;  4MVR A;  5A6K A;  2KC3 A;  3FAP B;  4MTG A;  5EHH A;  5L0G A;  1SF8 A;  3VF0 A;  1E84 A;  1NU7 D;  3EHN A;  1BR1 A;  5L0H A;  5A6B A;  3CEX A;  4NTB A;  1YYJ A;  4LER A;  1VYK A;  2R03 A;  2R7O A;  1VMA A;  2XLM A;  3KPH A;  5KYW B;  3OEO A;  5B3I A;  3UMK A;  1FMV A;  3FMS A;  5T3T A;  3S9O A;  2DI3 A;  3C18 A;  4EWC A;  2XSE A;  4HFF B;  1RKE B;  1NU9 C;  2A6E F;  2G3V A;  1EKY A;  2R7W A;  5KYU B;  1K40 A;  2FAP B;  3UGP A;  2W45 A;  1JAF A;  2DB4 A;  3TQO A;  5L0I A;  4YT8 A;  2XL8 A;  4ANJ A;  1CGM E;  1KNY A;  3QZC A;  4JEB A;  1LPE A;  3IHU A;  4BEJ A;  4IGG A;  2D5R B;  3DM5 A;  1HMO A;  2J45 A;  3U2M A;  2M4E A;  4JEA A;  1I5N A;  3OA1 A;  4O6Y A;  4PJM A;  3M1C B;  3T6J A;  5DQT A;  4B6I A;  4EKW A;  4W8K A;  3H2U A;  2H7O A;  1G8X A;  1U0B B;  4I3M A;  3NKE A;  1GS9 A;  4MW8 A;  1CGO A;  1YJG A;  5BQH A;  1RXQ A;  3HNK A;  1Y6D A;  4ULW A;  1U89 A;  1NSG B;  2W9Y A;  2NSG A;  1BZ4 A;  3L8I A;  3LLI A;  3A9C A;  4U5F E;  2P1A A;  3RFY A;  5JVE A;  2PNO A;  1YZC A;  5E3A A;  2YLG A;  1V54 C;  3EG9 B;  3JZ0 A;  2GWW A;  2WVO A;  3EQL F;  2WVQ A;  3EGX B;  4HE8 D;  4LAC B;  4X0R A;  2YWA A;  3B71 A;  3F46 A;  3TD7 A;  3U9M A;  3GM3 A;  2CDQ A;  2DYR C;  1MMA A;  1YVI A;  4MTO A;  5E2Q A;  5A6B D;  2E87 A;  4IWB A;  4O7G A;  3X1O A;  2WZG A;  2IYL D;  1TWA A;  2XRH A;  3ZDL A;  4ZLD A;  4EBJ A;  1NFN A;  3ECS A;  4NTA A;  1YZA A;  1ZU5 A;  2QTV A;  2XLD A;  5JT4 A;  4XPY A;  3K66 A;  2YHS A;  4FX5 A;  3E9V A;  1ZHX A;  2XLH A;  4JTD B;  1V55 C;  4DBQ A;  1LKX A;  1MND A;  1OCO C;  4RD9 A;  4CSA A;  2QLA A;  5AC5 A;  2AP3 A;  4G7Z F;  2VCC A;  1D0Y A;  3K7D A;  3K6B A;  1YAR O;  2TMV P;  5B1B C;  3DXJ F;  1HW2 A;  3IQ6 A;  2P7V A;  1QQ3 A;  3ASO C;  3EFO A;  4J32 B;  2BC5 A;  4CS9 A;  2ZXO A;  3N24 A;  5EK0 A;  3DAF A;  2NPU A;  1TWH A;  3SYN A;  3IQT A;  3ZSU A;  3LNR A;  5L0D A;  4O6N A;  4MW3 A;  3ZQY A;  1ZHT A;  3RQF A;  4U5C E;  4EBB A;  3NDB B;  1ST6 A;  1S05 A;  2J9W A;  1S7Z A;  2OCC C;  2R7V A;  3TOM A;  4LLE A;  3PHF 2;  2L7A A;  3V7O A;  2OJE D;  2UUI A;  2R9R B;  3FOO A;  4R32 A;  2EPL X;  2LSE A;  3ASN C;  3W2W A;  1FNT c;  3LNM B;  1ZYR F;  3S84 A;  1MQV A;  2WL8 A;  3ABM C;  5DQZ A;  3LES A;  1HY5 A;  2R7U A;  4E7S A;  4JC7 A;  3WOD F;  2Y3G A;  4AK9 A;  2QUP A;  4PFP A;  2HUJ A;  2ZXW C;  3G50 A;  4D4N A;  1IZM A;  4FWV A;  4RBN A;  3ITF A;  4E7Z A;  4C3E A;  3ZTM A;  4N6H A;  3BRJ A;  1ZHW A;  3JYH A;  3B29 A;  3T6B A;  4K0D A;  5L0F A;  4C3D A;  1G4U S;  1YAU O;  4QI2 A;  1OW8 A;  2LP4 A;  2OU6 A;  1ZW2 A;  4ONS A;  4JZA A;  5CI9 A;  4E0I A;  1QVX A;  1T9K A;  5L0J A;  4Q7C A;  2YL3 A;  3KYI A;  4O6M A;  3JYY A;  3KMI A;  2KQ9 A;  3SNH A;  3SXZ A;  5JS5 A;  1LI5 A;  3AGT A;  1KU2 A;  5AC4 A;  1Z3I X;  3Q7G A;  2EIN C;  3DZA A;  1F1M A;  4I1O B;  3ZWI A;  3Q7L A;  3A11 A;  4IB4 A;  3EGD A;  3EH1 A;  3V5Z A;  1ZHY A;  3M15 A;  2CW0 F;  2EIM C;  4HEA J;  1AVO B;  3IQ5 A;  4KNV A;  2R7R A;  1CPR A;  2IOQ A;  4OD4 A;  3U9J A;  5KYY A;  3NRH A;  4DRH B;  1K04 A;  3L34 A;  3QVY A;  2ZD9 A;  4MVM A;  1UG7 A;  2YLD A;  4BPM A;  2J7P A;  4IJJ A;  3L1M A;  3K1I C;  4CJO A;  4DOZ A;  4CIP A;  3QMK A;  3FAJ A;  1JR8 A;  2C03 A;  2HSQ A;  1MMD A;  1LS1 A;  1SYQ A;  1TWG A;  5F5H A;  3B0U X;  3ZQV A;  2XLO A;  1WAT A;  1Z6A A;  1VLT A;  4JJG A;  1OXB A;  2YQY A;  3EZI A;  1Q0M A;  3JSE O;  3O39 A;  2J46 A;  2R7Q A;  2R05 A;  1VK5 A;  1IW7 F;  3U3F A;  3ZIB A;  1J8M F;  1V4A A;  4J7Y A;  3SXY A;  2I15 A;  3S90 A;  1M6T A;  1LI7 A;  3AOU A;  3GWL A;  3IEE A;  3M4B A;  3NKD A;  3FVY A;  3RQG A;  5KYX A;  2NSF A;  1JPN A;  2XLW A;  1C02 A;  1OR2 A;  2XM4 A;  2R7X A;  1ORJ A;  2H7B A;  3DKA A;  3E70 C;  4JJF A;  2R7T A;  1HE1 A;  1U6H A;  2XL4 A;  2QY9 A;  4MVQ A;  5T3W A;  2G3K A;  3HJC A;  4Z9J A;  3T6G B;  3V5X A;  5DS4 A;  3RVZ A;  4UDV A;  5DS6 A;  3LEV A;  4G7H F;  3UMH A;  1XZQ A;  2V3C C;  1WOL A;  3RYL A;  4DRJ B;  3MBG A;  3NYM A;  5F5F A;  4EHP A;  2J8W A;  3DWW A;  2P6V A;  3C7J A;  4FAP B;  1YA9 A;  5L3V A;  4PJJ A;  4JVS A;  3F47 A;  2VAS A;  3CAX A;  2BL2 A;  1RJ9 A;  2VB6 A;  2QE9 A;  3EGD B;  4E18 A;  1D1B A;  1YDI A;  1TWC A;  1NFO A;  2VCB A;  5DLJ A;  3JCU Q;  3U5S A;  3RF3 A;  1GM5 A;  1W2W A;  1Y4C A;  3MLG A;  2WVN A;  5KYY B;  1A7V A;  3POV A;  4DVY P;  2J7P D;  3O55 A;  3TOL A;  3DE9 A;  4E17 A;  4YK5 A;  3GEI A;  4YT5 A;  1EA8 A;  4DXW A;  1R5I D;  2J9V A;  2IBF A;  2QNL A;  4U9E A;  4OIN F;  1ZW3 A;  1TQG A;  2KYH A;  1M57 C;  1TR2 A;  3AQC A;  4YT4 A;  3PMR A;  2B0J A;  4I44 A;  1Z23 A;  2OEX A;  5B1A C;  2C04 A;  2V26 A;  4OIO F;  4BJ6 A;  5EGY A;  2AWC A;  3KL4 A;  4PJL A;  5KYX B;  4XEV A;  3W8I A;  1PD0 A;  1R4T A;  2YEV A;  1I4Y A;  1O5H A;  1NLX A;  2CNW A;  4LLC A;  4WGZ A;  1FAP B;  2ZXP A;  5JP7 A;  1E2X A;  2AVK A;  5BQG A;  2MYS A;  2HS5 A;  4WAB A;  3DE8 A;  3LS1 A;  1LIH A;  4IRU A;  2H7V C;  2YVK A;  3NYL A;  3RQE A;  1QSP A;  4Z9H A;  2A6H F;  1NZE A;  1YLM A;  5BUO A;  4MVU A;  1LE2 A;  3AQB A;  4DRI B;  4XLP F;  3L0I A;  4CS8 A;  2Q9A A;  4KNW A;  1CGN A;  3HNI A;  3AG3 C;  2Q7R A;  1VB5 A;  5F28 E;  2ASR A;  4YL3 A;  4BJT A;  256B A;  5L3Q A;  4I1M A;  1OCR C;  3AJM A;  4PK4 A;  3B9Q A;  3WAQ A;  4AX2 A;  1ZHZ A;  2KW3 C;  2IXP A;  2W4B A; 
#chains in the Genus database with same CATH homology
 1Q0F A;  1T6Q A;  1Q0K A;  1Q0G A;  1Q0D A;  1Q0M A;  1T6U A;  3G4Z A;  1T6I A;  4NCQ A;  3G50 A;  3G4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...