3G4XA

Crystal structure of nisod y9f mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
117
structure length
117
Chain Sequence
b'HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Role of conserved tyrosine residues in NiSOD catalysis: a case of convergent evolution
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 49
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 3g4xA00
1Q0KA 3G50A 4NCQA 1Q0GA 1Q0DA 1T6QA 1T6IA 1Q0MA 3G4ZA 1T6UA 3G4XA 1Q0FA
chains in the Genus database with same CATH superfamily
5HSWA 3O39A 4AX2A 1IW7F 1M56C 2FGYA 2P0NA 2J0WA 1WATA 5AGFA 1LS4A 3C8ZA 4RD9A 1MMAA 2BC5A 2AWYA 1M2VA 1H9GA 2NG1A 4XEFA 3SZRA 3TK0A 3VF0A 1D0YA 2WB7A 2XLDA 5L0IA 3TULA 4CS7A 2J7PA 1WASA 3ZTMA 2UUHA 4FAPB 3AG1C 4MVRA 3RKOF 4J7TA 5HV9A 4KI2A 1HY5A 1G8XA 5KYYB 4PFPA 1NSGB 2EPKX 2PF4E 1LS1A 2KGOA 1JPJA 4C7OA 1U89A 3I4UA 2J7PD 2QNLA 4O6YA 3IQ6A 2CDQA 5JVEA 1OCRC 2LFDA 5L0GA 4YL1A 1W2WA 3T6BA 4FX5A 3MLGA 5DS6A 3IPMO 4LLEA 4EBBA 3M79A 2A68F 3A9CA 4JEAA 3S27A 3JYYA 2HJ3A 3LLIA 3KMIA 3ZG1A 2VCBA 4BJ5C 4MTFA 3U2LA 4JE9A 2ICWG 4JRZA 2VASA 1TR2A 2EPNA 3DE9A 3PCVA 3RQEA 3V5ZA 5DS5A 3AG4C 3OEOA 2R7UA 1RXQA 3DAGA 1ZU4A 1LE4A 1ZW3A 2W45A 1M2OA 1Z6AA 2EPOA 3FXHA 1HW2A 4LERA 1LI7A 3QVZA 1ZW2A 1PV3A 3GODA 4KNVA 5L0FA 1MNEA 2NUPA 2D5RB 2C03A 3RIPA 3B0UX 2YKZA 4DOZA 2YQYA 1OW8A 5KYXB 3ABLC 1S05A 4AK9A 2XXAA 2HSBA 1KTMA 4JEBA 5L0HA 3LAYA 3SXZA 1FMWA 2Y3DA 2CCYA 4DRHB 3ASOC 1UFBA 3FAJA 4JW1A 4U5EE 5B3SC 1QQ3A 4DJ9A 3IHUA 3NMJA 2V3CC 1T6QA 1JOGA 3VRCA 1NU7D 1RJ9B 4ULWA 4ZLCA 2R7RA 2LFFA 3UMIA 2L81A 1IZMA 1YLMA 2NUTA 3EG9A 2A0BA 3WG7C 1L3PA 2P6VA 1C03A 2UUIA 3QVYA 4PJLA 5E3CA 3ASNC 1FFHA 1M6TA 4MW3A 4ONSA 3FDQA 1VYIA 3IEEA 4ZLDA 2VH3A 2YL0A 5GPGB 3TJ5A 5KYUB 3F47A 5EGYA 4MVUA 1OR2A 3HKKA 4U5GA 4FESA 4Q7CA 4H4KC 1YJGA 4EWCA 3AG2C 1HMDA 1HMOA 3RVYA 3RVZA 3JT1A 4KNWA 4BJ5A 2IYLD 4U5CE 3EH1A 4DBQA 1Q0DA 2DYRC 3CEXA 4AL1A 1YAUO 1YDIA 1KU2A 2LCHA 3RQFA 5KYNA 3TOMA 2IXOA 2KC3A 1NU9C 2MHRA 2OKUA 2QLAA 2RD9A 1ZHZA 3Q6MA 3C62A 1E85A 1ST6A 3U2MA 2P7VA 1XWJA 5DLJA 5A69A 1ZHXA 2XM4A 1JMWA 2Y3HA 3GM1A 3OA1A 3X1OA 2KSFA 1G4US 4MQ9F 3SEOA 2HV6A 3U5SA 2CW0F 3C63A 4IARA 4HFKB 4L6RA 1NG1A 5EK0A 3KPHA 1TWCA 1D1BA 2AU5A 1VB5A 2BE5F 2EPLX 1TWGA 3K7DA 4E7SA 5B3IA 1RJ9A 1PCXA 4DRIB 4OIQF 1D1CA 1OW6A 4BJ1A 2XSEA 3EFOA 1VLSA 3JRMO 2BL2A 4CIHA 4YK5A 2Z15A 1F1MA 3QTHA 1XZPA 3B0PA 3TJ6A 2KK1A 3UNGC 3K1HA 5KYUA 3RW0A 5F28E 3DM5A 4FWVA 1VLTA 1AVOB 1OKKA 3Q7LA 3E70C 3KYJA 4CJOA 1CPQA 3MYFA 4IWBA 2W4MA 2LQGA 3LNRA 3PMRA 3CQZA 2G62A 1QPUA 2Q9BA 1XZQA 4MS2A 3C8GD 1EQ1A 1OKKD 3HNLA 4DRJB 4E0IA 4U5HA 3V5YA 1HW1A 4Z9JA 1ZZPA 3H2VA 3L8IA 4XEKA 5E33A 2DB4A 3DM9B 1SMYF 2XLWA 1D0ZA 1VMAA 1I4ZA 1J8MF 3U9JA 1LIHA 4LDRA 2A1DD 2EILC 1LKXA 2R7QA 2F22A 2J9UA 4K7BA 4LDQA 2LP4A 5T1DB 1J8YF 2ZXWC 3GANA 3IQCA 3ZDLA 1FR0A 1APCA 2OJQA 2I8BA 1EI7A 1MMNA 3K6BA 1NFNA 1YA9A 1YARO 1G5ZA 3RFYA 1ORYA 4AL0A 2J46A 4GEHA 2A69F 2YLIA 3F46A 2ZPAA 3H2UA 3NG1A 4BJ6C 4XTKA 4PR9A 2A6EF 3ABMC 2HMZA 3ITFA 2HJMA 2FFHA 2ETSA 5A6JA 3POVA 2A6HF 3O55A 4I1OB 4G7HF 3S84A 1FTSA 4PK4A 3MBGA 3T6JA 1WTYA 4AE4A 1N1CA 1UG7A 5A6KA 4QI2A 3FMSA 3TQOA 5B1BC 2R7VA 4YN0B 4DXWA 2H8AA 5E3AA 2PP4A 3AQCA 4WGYA 3R7CA 4C3DA 4EBKA 3AG3C 2VB6A 2E87A 2VC9A 2OJED 2G3KA 2X51A 1ORSC 3QMKA 4QDLA 1OR3A 5BUOA 3GEEA 1MNDA 4RDAA 4XLPF 3DXJF 1QVXA 1T6IA 1FMVA 2P61A 3R2PA 1NZEA 1V4AA 4PJJA 2YLDA 5KYWB 3U0CA 2WZFA 3DJUB 3SXYA 4JCZA 3K33A 2YZSA 3DZAA 3UGOA 1G4WR 3ABKC 3CSKA 5E2QA 1VTMP 2HS5A 5JT4A 4QI0A 1TWHA 4NCQA 3DMDA 4D4NA 4G7OF 2JPUA 1SF8A 2GWWA 1H7IA 1V54C 5COMA 3US6A 2L6HA 5CIVA 4CSAC 1M57C 2XS8A 3EGDB 4O79A 3QZCA 3U8PA 2HUJA 4E0HA 2R7XA 2OCCC 1AEPA 3AQBA 4YL3A 2R05A 5JSLA 4BJ6A 4YT8A 4BEMJ 4RBNA 5KYYA 2AWCA 2Q00A 3G4XA 1RKEB 4OINF 2Q9CA 4CJGA 1D1AA 2WL8A 4XQ1A 3FOPA 2X0CA 3ZQVA 1OW7A 3UGPA 2IM8A 1T01A 1TQGA 2HV7A 2IOQA 2ZXOA 4G0HA 4R32A 3ZC4A 5F5FA 4JIOA 4LDKA 2JD3A 3M4BA 3WAQA 1DOWA 2QUPA 4MVSA 1GQAA 2EINC 4A4AA 2L9JA 1S7ZA 1Z5ZA 1R5ID 1VYKA 1AUEA 2O9XA 3MYIA 4IB4A 3K1IC 1EKYA 1ZHWA 2G3VA 2XRHA 3HJCA 1JRAA 1ZYRF 3EZHA 3LEVA 4I1MA 3AOUA 3SXMA 4CIPA 2MYSA 4JVSA 1SYQA 1CGME 4LLCA 1YYJA 2KYHA 2LIGA 1V55C 2XL8A 4UDVA 4U5BE 4DVYP 4BEJA 2ASRA 2YLGA 3PHF2 4MNDA 2EIMC 3SNHA 1ZHTA 4JURI 4W8PA 1ZU5A 3S9OA 4C3BA 3NKEA 3JCUQ 1E86A 1GS9A 4NTAA 1QKRA 5KYXA 3B9QA 2YVKA 3EGDA 2J45A 3ZVRA 3W8IA 3KH2A 1VOMA 2PBEA 1BBHA 4MVOA 4PACA 3T4RA 4JZAA 3DAFA 4U5DE 5CI9A 3TD7A 2IBFA 2W4BA 4A2NB 2PX3A 4NC3A 5L0DA 3L1MA 2PX0A 4N6HA 1PD0A 1YVIA 1PD1A 3QW1A 3NMKA 4BJTA 3BEHA 4IAOA 4O6MA 2YL7A 4O6NA 3EZIA 1Q0GA 3TOLA 1D0XA 3LS0A 1VK5A 4U5FE 2V26A 3RYLA 4JTAB 1K05A 3EPVA 5L0CA 1GM5A 1WN0A 1A0BA 2B0HA 2OQMA 4P9TA 2Q9AA 3VM6A 1Z63A 1RMVA 2HZ8A 2WVNA 3U3FA 2EIKC 4IAQA 3VAYA 3K1IA 4JKVA 3G50A 1H9TA 3L0IA 1V74B 3T6GB 3ZSUA 4EUKB 256BA 1YZAA 2IXNA 2XLVA 3KKBA 4EBJA 2YL1A 1LVKA 2M4EA 4MVZA 2QE9A 2ZD9A 1E2XA 3JRTA 1JR8A 4U9DA 1BZ4A 3DJNB 1CGOA 1ZVZA 5BQGA 3NMIA 2ZXRA 4MVMA 1WOLA 2GA0A 3T9OA 3EGXB 2VCCA 2LK4A 1QLEC 1M2VB 2R7TA 1Y4CA 3M15A 3V5XA 3UMHA 1T6UA 1T9KA 4EHPA 1C17M 4Z9IA 2GAQA 2XS1A 2YWAA 1K04A 2AP3A 3EHNA 5A6AA 3B0VC 3S90A 2H7BA 4MTGA 4JJGA 1SZIA 1A41A 2WZGA 4JTCB 2HKVA 2YRFA 3N2ZB 3X2QC 1RKCA 3BRJA 1LI5A 2J9WA 1NBBA 4I44A 4B6IA 2D4UA 1YYXA 3GM3A 2HMQA 1BDJB 3JZ0A 3N24A 1E84A 3J06A 3LJBA 4YT4A 4IJJA 4K1OA 1MQVA 2ZXPA 5L0JA 2Y3BA 4H54A 5AC5A 1WGWA 1Z7Qc 4D4XA 1L7CA 2Q3TA 3GEHA 3K66A 2WVQA 3DKAA 3QW0A 1YZCA 1A7DA 3DI5A 2B0JA 1T5OA 3NDBB 2XLOA 1OCCC 3DE8A 3SYNA 2P1AA 2PNOA 2YHSA 3JSEO 1OXBA 3AGTA 2QY9A 1ZHYA 4K0DA 3CZ6A 2Q7RA 4CDVA 2R7SA 3MX3A 3EGXA 1WWPA 2RSEB 2IXPA 2MWQA 3GWNA 4O7GA 5JLIA 5L3VA 1Q0KA 3HNKA 1O5HA 2NUPB 3S29A 4CS9A 3UMKA 3I5PA 2FAPB 5JUAA 5T3TA 4WABA 1U0BB 5BQHA 3GM2A 2XXAB 4MTOA 1MMDA 2L6FA 1LPEA 3KL4A 4WJ0A 4LACB 4XLNF 1NFOA 2R25A 2J9BA 2XLMA 3JSZA 4KBLA 3A11A 1NLXA 3Q7GA 5DVWA 4OD5A 3FHDA 2OU6A 3M4CA 3M1CB 3DWWA 3GWLA 3O10A 4IRUA 5AC4A 1TWAA 2YL3A 1FAPB 4CSAA 3N0TA 2WZLA 2NSFA 2AVKA 2NUTB 2GDCA 3EG9B 2R7OA 3OWTA 4Q4ZF 3AGUA 4P9FA 4GYTA 3G4ZA 4NTFA 5K0IA 2CGEA 1OCZC 3FVYA 3U9MA 3ZIBA 4NTBA 3LNMB 2Q4FA 2R03A 4JTDB 4CX9A 2Y39A 4YL0A 3IQ5A 1Q0FA 1OCOC 1Y6DA 2H7OA 2QTVA 2KQ9A 4YT5A 4EKWA 3W4YA 5JRAA 4N06A 2L7AA 4XPWA 1HE9A 3HNIA 2YEVA 3O6XA 1BR1A 3LUTB 3EH2A 2XLEA 2R9RB 3NYJA 1OXKA 4PJNA 4ULVA 5DQTA 5A6BA 2DI3A 2XL6A 4XEVA 3RF3A 3L8JA 4PFOA 4WGZA 5KYWA 2CYDA 3NRHA 4XPXA 1U6HA 1CPRA 4OD4A 3SP1A 4HE8D 1LM3B 2H7VC 2DGJA 1QSPA 1HE1A 5A6BD 4Q5SF 2R02A 4HEAJ 2TMVP 5D91A 4PJMA 3ECSA 1JAFA 2OOCA 3IQTA 2C04A 3S28A 2J8WA 1TFKB 2NPUA 4GQHA 3W8HA 4CBEA 3EFOB 1TKNA 1ORJA 5EHHA 3L34A 1H6GA 2M64A 2HSQA 3Q6NA 3U8VA 2W9YA 1Z23A 3HLZA 1B68A 1RKEA 3I5QA 4BPMA 4NY3A 3B71A 2PFDA 2OEVA 5JP7A 3ZWIA 1Z3IX 2GFHA 2LSEA 3C8GB 4E18A 3W2VA 4NQFA 4G7ZF 5F5HA 4OIOF 1QZXA 3B29A 4OIPF 5B1AC 3RQGA 2CNWA 4MW8A 4I3MA 4DBRA 1C02A 4CDAA 3KYIA 4XWJA 3LESA 4CS8C 1K40A 4F4BA 1DOVA 3LLKA 3PDMP 3LS1A 2KJGA 2NSGA 3E9VA 4X0RA 4YJWA 5FZTA 4YWQA 3MFNA 3NYMA 3AJMA 4MVQA 2Y3GA 3C18A 2Y69C 3EQLF 2WVOA 2CNWD 5COGA 2KW3C 3DD7A 3V7OA 5DS4A 5L3QA 3ZTZA 2R7WA 2EPMX 3ATPA 1LE2A 4G78A 3WHNA 3NYLA 4OIRF 3H65A 4J30B 1Q0MA 4E7ZA 2I15A 2XLHA 1R4TA 5CI8A 3JTLO 2VCAA 1O3UA 2J9VA 4M63A 2EIJC 4CS9C 3C7JA 4KC9A 1SR2A 4HFFB 3WODF 4N6CA 1KNYA 4JC7A 4XPYA 3NKDA 4JCHA 1I4YA 1RCPA 1BR2A 5FCLA 1BR4A 3CAXA 2KNHA 4W8KA 5IY5C 2A0UA 2XM0A 4EIYA 2LD6A 4U9EA 1EA8A 2L6GA 3SXKA 1FFTC 3EHMA 4J32B 1A7EA 4Z9HA 1JPNA 4IGGA 4AE4B 3C8GA 4C7OB 3VYWA 1I5NA 4JJFA 3HTKC 3RH3A 1A7VA 1O87A 4ER9A 3ZQYA 5D92A 1E83A 3EJNA 4BG0A 4DVZA 4P6IC 1CGNA 2OG2A 4E17A 3W2WA 4CDYA 1MMGA 3U3BA 3S0XA 1YA7O 2IXMA 3GORA 5JS5A 2XL4A 1TFOB 2HFIA 4CS8A 3LEOA 5T3WA 5COFA 5BQIA 3JYHA 2J0XA 4ANJA 3GEIA 3FAPB 4N4WA 1FNTc 4J7YA 4YT2A 5TJ5E 1OQCA 2DYSC 4C3EA 3FOOA 3HNJA 5DQZA 2OEXA 3UR3C 1GGQA 2JX0A
chains in the Genus database with same CATH topology
1Q0KA 3G50A 4NCQA 1Q0GA 1Q0DA 1T6QA 1T6IA 1Q0MA 3G4ZA 1T6UA 3G4XA 1Q0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0K A;  3G50 A;  4NCQ A;  1Q0G A;  1Q0D A;  1T6Q A;  1T6I A;  1Q0M A;  3G4Z A;  1T6U A;  3G4X A;  1Q0F A; 
#chains in the Genus database with same CATH topology
 5HSW A;  3O39 A;  4AX2 A;  1IW7 F;  1M56 C;  2FGY A;  2P0N A;  2J0W A;  1WAT A;  5AGF A;  1LS4 A;  3C8Z A;  4RD9 A;  1MMA A;  2BC5 A;  2AWY A;  1M2V A;  1H9G A;  2NG1 A;  4XEF A;  3SZR A;  3TK0 A;  3VF0 A;  1D0Y A;  2WB7 A;  2XLD A;  5L0I A;  3TUL A;  4CS7 A;  2J7P A;  1WAS A;  3ZTM A;  2UUH A;  4FAP B;  3AG1 C;  4MVR A;  3RKO F;  4J7T A;  5HV9 A;  4KI2 A;  1HY5 A;  1G8X A;  5KYY B;  4PFP A;  1NSG B;  2EPK X;  2PF4 E;  1LS1 A;  2KGO A;  1JPJ A;  4C7O A;  1U89 A;  3I4U A;  2J7P D;  2QNL A;  4O6Y A;  3IQ6 A;  2CDQ A;  5JVE A;  1OCR C;  2LFD A;  5L0G A;  4YL1 A;  1W2W A;  3T6B A;  4FX5 A;  3MLG A;  5DS6 A;  3IPM O;  4LLE A;  4EBB A;  3M79 A;  2A68 F;  3A9C A;  4JEA A;  3S27 A;  3JYY A;  2HJ3 A;  3LLI A;  3KMI A;  3ZG1 A;  2VCB A;  4BJ5 C;  4MTF A;  3U2L A;  4JE9 A;  2ICW G;  4JRZ A;  2VAS A;  1TR2 A;  2EPN A;  3DE9 A;  3PCV A;  3RQE A;  3V5Z A;  5DS5 A;  3AG4 C;  3OEO A;  2R7U A;  1RXQ A;  3DAG A;  1ZU4 A;  1LE4 A;  1ZW3 A;  2W45 A;  1M2O A;  1Z6A A;  2EPO A;  3FXH A;  1HW2 A;  4LER A;  1LI7 A;  3QVZ A;  1ZW2 A;  1PV3 A;  3GOD A;  4KNV A;  5L0F A;  1MNE A;  2NUP A;  2D5R B;  2C03 A;  3RIP A;  3B0U X;  2YKZ A;  4DOZ A;  2YQY A;  1OW8 A;  5KYX B;  3ABL C;  1S05 A;  4AK9 A;  2XXA A;  2HSB A;  1KTM A;  4JEB A;  5L0H A;  3LAY A;  3SXZ A;  1FMW A;  2Y3D A;  2CCY A;  4DRH B;  3ASO C;  1UFB A;  3FAJ A;  4JW1 A;  4U5E E;  5B3S C;  1QQ3 A;  4DJ9 A;  3IHU A;  3NMJ A;  2V3C C;  1T6Q A;  1JOG A;  3VRC A;  1NU7 D;  1RJ9 B;  4ULW A;  4ZLC A;  2R7R A;  2LFF A;  3UMI A;  2L81 A;  1IZM A;  1YLM A;  2NUT A;  3EG9 A;  2A0B A;  3WG7 C;  1L3P A;  2P6V A;  1C03 A;  2UUI A;  3QVY A;  4PJL A;  5E3C A;  3ASN C;  1FFH A;  1M6T A;  4MW3 A;  4ONS A;  3FDQ A;  1VYI A;  3IEE A;  4ZLD A;  2VH3 A;  2YL0 A;  5GPG B;  3TJ5 A;  5KYU B;  3F47 A;  5EGY A;  4MVU A;  1OR2 A;  3HKK A;  4U5G A;  4FES A;  4Q7C A;  4H4K C;  1YJG A;  4EWC A;  3AG2 C;  1HMD A;  1HMO A;  3RVY A;  3RVZ A;  3JT1 A;  4KNW A;  4BJ5 A;  2IYL D;  4U5C E;  3EH1 A;  4DBQ A;  1Q0D A;  2DYR C;  3CEX A;  4AL1 A;  1YAU O;  1YDI A;  1KU2 A;  2LCH A;  3RQF A;  5KYN A;  3TOM A;  2IXO A;  2KC3 A;  1NU9 C;  2MHR A;  2OKU A;  2QLA A;  2RD9 A;  1ZHZ A;  3Q6M A;  3C62 A;  1E85 A;  1ST6 A;  3U2M A;  2P7V A;  1XWJ A;  5DLJ A;  5A69 A;  1ZHX A;  2XM4 A;  1JMW A;  2Y3H A;  3GM1 A;  3OA1 A;  3X1O A;  2KSF A;  1G4U S;  4MQ9 F;  3SEO A;  2HV6 A;  3U5S A;  2CW0 F;  3C63 A;  4IAR A;  4HFK B;  4L6R A;  1NG1 A;  5EK0 A;  3KPH A;  1TWC A;  1D1B A;  2AU5 A;  1VB5 A;  2BE5 F;  2EPL X;  1TWG A;  3K7D A;  4E7S A;  5B3I A;  1RJ9 A;  1PCX A;  4DRI B;  4OIQ F;  1D1C A;  1OW6 A;  4BJ1 A;  2XSE A;  3EFO A;  1VLS A;  3JRM O;  2BL2 A;  4CIH A;  4YK5 A;  2Z15 A;  1F1M A;  3QTH A;  1XZP A;  3B0P A;  3TJ6 A;  2KK1 A;  3UNG C;  3K1H A;  5KYU A;  3RW0 A;  5F28 E;  3DM5 A;  4FWV A;  1VLT A;  1AVO B;  1OKK A;  3Q7L A;  3E70 C;  3KYJ A;  4CJO A;  1CPQ A;  3MYF A;  4IWB A;  2W4M A;  2LQG A;  3LNR A;  3PMR A;  3CQZ A;  2G62 A;  1QPU A;  2Q9B A;  1XZQ A;  4MS2 A;  3C8G D;  1EQ1 A;  1OKK D;  3HNL A;  4DRJ B;  4E0I A;  4U5H A;  3V5Y A;  1HW1 A;  4Z9J A;  1ZZP A;  3H2V A;  3L8I A;  4XEK A;  5E33 A;  2DB4 A;  3DM9 B;  1SMY F;  2XLW A;  1D0Z A;  1VMA A;  1I4Z A;  1J8M F;  3U9J A;  1LIH A;  4LDR A;  2A1D D;  2EIL C;  1LKX A;  2R7Q A;  2F22 A;  2J9U A;  4K7B A;  4LDQ A;  2LP4 A;  5T1D B;  1J8Y F;  2ZXW C;  3GAN A;  3IQC A;  3ZDL A;  1FR0 A;  1APC A;  2OJQ A;  2I8B A;  1EI7 A;  1MMN A;  3K6B A;  1NFN A;  1YA9 A;  1YAR O;  1G5Z A;  3RFY A;  1ORY A;  4AL0 A;  2J46 A;  4GEH A;  2A69 F;  2YLI A;  3F46 A;  2ZPA A;  3H2U A;  3NG1 A;  4BJ6 C;  4XTK A;  4PR9 A;  2A6E F;  3ABM C;  2HMZ A;  3ITF A;  2HJM A;  2FFH A;  2ETS A;  5A6J A;  3POV A;  2A6H F;  3O55 A;  4I1O B;  4G7H F;  3S84 A;  1FTS A;  4PK4 A;  3MBG A;  3T6J A;  1WTY A;  4AE4 A;  1N1C A;  1UG7 A;  5A6K A;  4QI2 A;  3FMS A;  3TQO A;  5B1B C;  2R7V A;  4YN0 B;  4DXW A;  2H8A A;  5E3A A;  2PP4 A;  3AQC A;  4WGY A;  3R7C A;  4C3D A;  4EBK A;  3AG3 C;  2VB6 A;  2E87 A;  2VC9 A;  2OJE D;  2G3K A;  2X51 A;  1ORS C;  3QMK A;  4QDL A;  1OR3 A;  5BUO A;  3GEE A;  1MND A;  4RDA A;  4XLP F;  3DXJ F;  1QVX A;  1T6I A;  1FMV A;  2P61 A;  3R2P A;  1NZE A;  1V4A A;  4PJJ A;  2YLD A;  5KYW B;  3U0C A;  2WZF A;  3DJU B;  3SXY A;  4JCZ A;  3K33 A;  2YZS A;  3DZA A;  3UGO A;  1G4W R;  3ABK C;  3CSK A;  5E2Q A;  1VTM P;  2HS5 A;  5JT4 A;  4QI0 A;  1TWH A;  4NCQ A;  3DMD A;  4D4N A;  4G7O F;  2JPU A;  1SF8 A;  2GWW A;  1H7I A;  1V54 C;  5COM A;  3US6 A;  2L6H A;  5CIV A;  4CSA C;  1M57 C;  2XS8 A;  3EGD B;  4O79 A;  3QZC A;  3U8P A;  2HUJ A;  4E0H A;  2R7X A;  2OCC C;  1AEP A;  3AQB A;  4YL3 A;  2R05 A;  5JSL A;  4BJ6 A;  4YT8 A;  4BEM J;  4RBN A;  5KYY A;  2AWC A;  2Q00 A;  3G4X A;  1RKE B;  4OIN F;  2Q9C A;  4CJG A;  1D1A A;  2WL8 A;  4XQ1 A;  3FOP A;  2X0C A;  3ZQV A;  1OW7 A;  3UGP A;  2IM8 A;  1T01 A;  1TQG A;  2HV7 A;  2IOQ A;  2ZXO A;  4G0H A;  4R32 A;  3ZC4 A;  5F5F A;  4JIO A;  4LDK A;  2JD3 A;  3M4B A;  3WAQ A;  1DOW A;  2QUP A;  4MVS A;  1GQA A;  2EIN C;  4A4A A;  2L9J A;  1S7Z A;  1Z5Z A;  1R5I D;  1VYK A;  1AUE A;  2O9X A;  3MYI A;  4IB4 A;  3K1I C;  1EKY A;  1ZHW A;  2G3V A;  2XRH A;  3HJC A;  1JRA A;  1ZYR F;  3EZH A;  3LEV A;  4I1M A;  3AOU A;  3SXM A;  4CIP A;  2MYS A;  4JVS A;  1SYQ A;  1CGM E;  4LLC A;  1YYJ A;  2KYH A;  2LIG A;  1V55 C;  2XL8 A;  4UDV A;  4U5B E;  4DVY P;  4BEJ A;  2ASR A;  2YLG A;  3PHF 2;  4MND A;  2EIM C;  3SNH A;  1ZHT A;  4JUR I;  4W8P A;  1ZU5 A;  3S9O A;  4C3B A;  3NKE A;  3JCU Q;  1E86 A;  1GS9 A;  4NTA A;  1QKR A;  5KYX A;  3B9Q A;  2YVK A;  3EGD A;  2J45 A;  3ZVR A;  3W8I A;  3KH2 A;  1VOM A;  2PBE A;  1BBH A;  4MVO A;  4PAC A;  3T4R A;  4JZA A;  3DAF A;  4U5D E;  5CI9 A;  3TD7 A;  2IBF A;  2W4B A;  4A2N B;  2PX3 A;  4NC3 A;  5L0D A;  3L1M A;  2PX0 A;  4N6H A;  1PD0 A;  1YVI A;  1PD1 A;  3QW1 A;  3NMK A;  4BJT A;  3BEH A;  4IAO A;  4O6M A;  2YL7 A;  4O6N A;  3EZI A;  1Q0G A;  3TOL A;  1D0X A;  3LS0 A;  1VK5 A;  4U5F E;  2V26 A;  3RYL A;  4JTA B;  1K05 A;  3EPV A;  5L0C A;  1GM5 A;  1WN0 A;  1A0B A;  2B0H A;  2OQM A;  4P9T A;  2Q9A A;  3VM6 A;  1Z63 A;  1RMV A;  2HZ8 A;  2WVN A;  3U3F A;  2EIK C;  4IAQ A;  3VAY A;  3K1I A;  4JKV A;  3G50 A;  1H9T A;  3L0I A;  1V74 B;  3T6G B;  3ZSU A;  4EUK B;  256B A;  1YZA A;  2IXN A;  2XLV A;  3KKB A;  4EBJ A;  2YL1 A;  1LVK A;  2M4E A;  4MVZ A;  2QE9 A;  2ZD9 A;  1E2X A;  3JRT A;  1JR8 A;  4U9D A;  1BZ4 A;  3DJN B;  1CGO A;  1ZVZ A;  5BQG A;  3NMI A;  2ZXR A;  4MVM A;  1WOL A;  2GA0 A;  3T9O A;  3EGX B;  2VCC A;  2LK4 A;  1QLE C;  1M2V B;  2R7T A;  1Y4C A;  3M15 A;  3V5X A;  3UMH A;  1T6U A;  1T9K A;  4EHP A;  1C17 M;  4Z9I A;  2GAQ A;  2XS1 A;  2YWA A;  1K04 A;  2AP3 A;  3EHN A;  5A6A A;  3B0V C;  3S90 A;  2H7B A;  4MTG A;  4JJG A;  1SZI A;  1A41 A;  2WZG A;  4JTC B;  2HKV A;  2YRF A;  3N2Z B;  3X2Q C;  1RKC A;  3BRJ A;  1LI5 A;  2J9W A;  1NBB A;  4I44 A;  4B6I A;  2D4U A;  1YYX A;  3GM3 A;  2HMQ A;  1BDJ B;  3JZ0 A;  3N24 A;  1E84 A;  3J06 A;  3LJB A;  4YT4 A;  4IJJ A;  4K1O A;  1MQV A;  2ZXP A;  5L0J A;  2Y3B A;  4H54 A;  5AC5 A;  1WGW A;  1Z7Q c;  4D4X A;  1L7C A;  2Q3T A;  3GEH A;  3K66 A;  2WVQ A;  3DKA A;  3QW0 A;  1YZC A;  1A7D A;  3DI5 A;  2B0J A;  1T5O A;  3NDB B;  2XLO A;  1OCC C;  3DE8 A;  3SYN A;  2P1A A;  2PNO A;  2YHS A;  3JSE O;  1OXB A;  3AGT A;  2QY9 A;  1ZHY A;  4K0D A;  3CZ6 A;  2Q7R A;  4CDV A;  2R7S A;  3MX3 A;  3EGX A;  1WWP A;  2RSE B;  2IXP A;  2MWQ A;  3GWN A;  4O7G A;  5JLI A;  5L3V A;  1Q0K A;  3HNK A;  1O5H A;  2NUP B;  3S29 A;  4CS9 A;  3UMK A;  3I5P A;  2FAP B;  5JUA A;  5T3T A;  4WAB A;  1U0B B;  5BQH A;  3GM2 A;  2XXA B;  4MTO A;  1MMD A;  2L6F A;  1LPE A;  3KL4 A;  4WJ0 A;  4LAC B;  4XLN F;  1NFO A;  2R25 A;  2J9B A;  2XLM A;  3JSZ A;  4KBL A;  3A11 A;  1NLX A;  3Q7G A;  5DVW A;  4OD5 A;  3FHD A;  2OU6 A;  3M4C A;  3M1C B;  3DWW A;  3GWL A;  3O10 A;  4IRU A;  5AC4 A;  1TWA A;  2YL3 A;  1FAP B;  4CSA A;  3N0T A;  2WZL A;  2NSF A;  2AVK A;  2NUT B;  2GDC A;  3EG9 B;  2R7O A;  3OWT A;  4Q4Z F;  3AGU A;  4P9F A;  4GYT A;  3G4Z A;  4NTF A;  5K0I A;  2CGE A;  1OCZ C;  3FVY A;  3U9M A;  3ZIB A;  4NTB A;  3LNM B;  2Q4F A;  2R03 A;  4JTD B;  4CX9 A;  2Y39 A;  4YL0 A;  3IQ5 A;  1Q0F A;  1OCO C;  1Y6D A;  2H7O A;  2QTV A;  2KQ9 A;  4YT5 A;  4EKW A;  3W4Y A;  5JRA A;  4N06 A;  2L7A A;  4XPW A;  1HE9 A;  3HNI A;  2YEV A;  3O6X A;  1BR1 A;  3LUT B;  3EH2 A;  2XLE A;  2R9R B;  3NYJ A;  1OXK A;  4PJN A;  4ULV A;  5DQT A;  5A6B A;  2DI3 A;  2XL6 A;  4XEV A;  3RF3 A;  3L8J A;  4PFO A;  4WGZ A;  5KYW A;  2CYD A;  3NRH A;  4XPX A;  1U6H A;  1CPR A;  4OD4 A;  3SP1 A;  4HE8 D;  1LM3 B;  2H7V C;  2DGJ A;  1QSP A;  1HE1 A;  5A6B D;  4Q5S F;  2R02 A;  4HEA J;  2TMV P;  5D91 A;  4PJM A;  3ECS A;  1JAF A;  2OOC A;  3IQT A;  2C04 A;  3S28 A;  2J8W A;  1TFK B;  2NPU A;  4GQH A;  3W8H A;  4CBE A;  3EFO B;  1TKN A;  1ORJ A;  5EHH A;  3L34 A;  1H6G A;  2M64 A;  2HSQ A;  3Q6N A;  3U8V A;  2W9Y A;  1Z23 A;  3HLZ A;  1B68 A;  1RKE A;  3I5Q A;  4BPM A;  4NY3 A;  3B71 A;  2PFD A;  2OEV A;  5JP7 A;  3ZWI A;  1Z3I X;  2GFH A;  2LSE A;  3C8G B;  4E18 A;  3W2V A;  4NQF A;  4G7Z F;  5F5H A;  4OIO F;  1QZX A;  3B29 A;  4OIP F;  5B1A C;  3RQG A;  2CNW A;  4MW8 A;  4I3M A;  4DBR A;  1C02 A;  4CDA A;  3KYI A;  4XWJ A;  3LES A;  4CS8 C;  1K40 A;  4F4B A;  1DOV A;  3LLK A;  3PDM P;  3LS1 A;  2KJG A;  2NSG A;  3E9V A;  4X0R A;  4YJW A;  5FZT A;  4YWQ A;  3MFN A;  3NYM A;  3AJM A;  4MVQ A;  2Y3G A;  3C18 A;  2Y69 C;  3EQL F;  2WVO A;  2CNW D;  5COG A;  2KW3 C;  3DD7 A;  3V7O A;  5DS4 A;  5L3Q A;  3ZTZ A;  2R7W A;  2EPM X;  3ATP A;  1LE2 A;  4G78 A;  3WHN A;  3NYL A;  4OIR F;  3H65 A;  4J30 B;  1Q0M A;  4E7Z A;  2I15 A;  2XLH A;  1R4T A;  5CI8 A;  3JTL O;  2VCA A;  1O3U A;  2J9V A;  4M63 A;  2EIJ C;  4CS9 C;  3C7J A;  4KC9 A;  1SR2 A;  4HFF B;  3WOD F;  4N6C A;  1KNY A;  4JC7 A;  4XPY A;  3NKD A;  4JCH A;  1I4Y A;  1RCP A;  1BR2 A;  5FCL A;  1BR4 A;  3CAX A;  2KNH A;  4W8K A;  5IY5 C;  2A0U A;  2XM0 A;  4EIY A;  2LD6 A;  4U9E A;  1EA8 A;  2L6G A;  3SXK A;  1FFT C;  3EHM A;  4J32 B;  1A7E A;  4Z9H A;  1JPN A;  4IGG A;  4AE4 B;  3C8G A;  4C7O B;  3VYW A;  1I5N A;  4JJF A;  3HTK C;  3RH3 A;  1A7V A;  1O87 A;  4ER9 A;  3ZQY A;  5D92 A;  1E83 A;  3EJN A;  4BG0 A;  4DVZ A;  4P6I C;  1CGN A;  2OG2 A;  4E17 A;  3W2W A;  4CDY A;  1MMG A;  3U3B A;  3S0X A;  1YA7 O;  2IXM A;  3GOR A;  5JS5 A;  2XL4 A;  1TFO B;  2HFI A;  4CS8 A;  3LEO A;  5T3W A;  5COF A;  5BQI A;  3JYH A;  2J0X A;  4ANJ A;  3GEI A;  3FAP B;  4N4W A;  1FNT c;  4J7Y A;  4YT2 A;  5TJ5 E;  1OQC A;  2DYS C;  4C3E A;  3FOO A;  3HNJ A;  5DQZ A;  2OEX A;  3UR3 C;  1GGQ A;  2JX0 A; 
#chains in the Genus database with same CATH homology
 1Q0K A;  3G50 A;  4NCQ A;  1Q0G A;  1Q0D A;  1T6Q A;  1T6I A;  1Q0M A;  3G4Z A;  1T6U A;  3G4X A;  1Q0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...