3G4XA

Crystal structure of nisod y9f mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Role of conserved tyrosine residues in NiSOD catalysis: a case of convergent evolution
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 49
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 3g4xA00
4NCQA 1Q0MA 1Q0GA 1T6IA 3G50A 1Q0KA 1Q0DA 1T6UA 3G4XA 3G4ZA 1Q0FA 1T6QA
chains in the Genus database with same CATH superfamily
3W4YA 2EPKX 2A6HF 5KYYB 4FX5A 4Z9IA 3T9OA 3RQEA 1OCZC 2BE5F 2XS1A 3DKAA 3OA1A 1FFHA 4XPXA 1A7DA 3EQLF 1BBHA 3DJNB 3NDBB 1G4WR 3B0UX 1DOVA 3I5QA 1VYKA 4MVZA 4C3BA 1E2XA 3LS0A 3SEOA 3V5ZA 3S84A 2J45A 3EFOA 4IJJA 2EPOA 1TWAA 4G7HF 3L34A 4O6NA 3TQOA 2J9BA 2XLVA 4WABA 1FNTc 1C03A 1WOLA 4W8KA 3VM6A 3T6BA 2EIKC 3QVYA 1V54C 1WATA 3WAQA 3UGPA 1A7EA 3CEXA 4EBBA 1T9KA 2QUPA 5JP7A 1KTMA 3KMIA 3M4BA 2PBEA 1YDIA 1D1AA 1LS1A 3JYHA 5JRAA 3ASNC 4RBNA 1ZW3A 3H2VA 3WG7C 1FMVA 1MMAA 1FFTC 4OD5A 3V7OA 2YL0A 3WHNA 3MFNA 1ZHZA 3GORA 2KSFA 3IQ5A 2A0UA 5CI9A 1AUEA 4AE4B 1MMGA 1OW6A 1OR2A 4LACB 3LS1A 1YYJA 3CSKA 2WZGA 3BRJA 4CS8C 1E85A 2VASA 2XXAA 1NSGB 3B71A 3JRTA 1UFBA 1M57C 2KGOA 3JRMO 4ONSA 4PK4A 3TJ6A 5L0DA 1LPEA 4DRIB 4K1OA 2L7AA 4JKVA 4JVSA 1M2OA 1FR0A 1V4AA 1Z63A 3W8IA 4W8PA 5D92A 4JIOA 1BZ4A 2A69F 1U6HA 2IXPA 5B3SC 1D1CA 2WZFA 3R7CA 2J9WA 3C62A 2CNWD 4BJ6A 1T01A 2KYHA 1LE4A 3RQGA 4CS9C 5AC4A 3AOUA 3EZIA 2M64A 3C8GB 1MMDA 3L8IA 4QI0A 5B3IA 4MW3A 3ZTMA 2HMQA 1W2WA 3B0PA 3SP1A 3AQBA 3AG1C 1ORJA 3MBGA 3C8ZA 2VCBA 3MYFA 1YZAA 4MQ9F 3IQTA 3L1MA 2IXOA 4XPYA 3HNKA 1JOGA 1BR1A 3AJMA 1XZQA 3OEOA 2IOQA 2Q00A 5D91A 3HJCA 4D4NA 3EGDB 3ZIBA 4CDVA 5IY5C 4KNVA 3S27A 3SNHA 2NUPA 4FESA 5F5FA 1IZMA 2FAPB 1K40A 5KYYA 3KH2A 3AGUA 2LFDA 4A4AA 3NMJA 1U0BB 1OW8A 1SR2A 3LEVA 4YL1A 4BJ5A 3QMKA 2OQMA 2BC5A 2CGEA 1HW1A 4O6MA 4XEKA 3AGTA 3PDMP 3RW0A 1Z6AA 5BUOA 1G5ZA 2YLDA 3DI5A 5HV9A 1NZEA 2HJMA 1E83A 5DS5A 2HS5A 3DD7A 5KYWB 2TMVP 1K04A 1OCRC 1E86A 4LDQA 2RSEB 2ASRA 3EZHA 4PACA 4X0RA 1F1MA 3I4UA 3Q7GA 2E87A 1HY5A 4DBRA 1KNYA 1WWPA 3A11A 2LSEA 2Y3HA 3RQFA 3UMHA 1HE1A 4CS7A 4I44A 2JPUA 2XL8A 4O79A 4QDLA 4ULVA 3VYWA 4DVZA 1JPJA 3K1IA 3VF0A 2AU5A 1Q0DA 2R25A 2IXMA 2F22A 1J8YF 4L6RA 4N6HA 4CDYA 1JPNA 1ZHXA 1OCOC 2G3KA 4DRHB 5A6BA 4LDRA 3V5YA 1BR2A 3L8JA 2WVOA 1MNEA 2LQGA 2HFIA 1EA8A 1WASA 3RKOF 2XM4A 2YL1A 2W9YA 4WGZA 5L0GA 1VK5A 3JT1A 4ULWA 2Q9AA 4AL1A 2WB7A 5AGFA 2XLWA 4BJ6C 2OJED 4MVOA 2YL7A 4Q4ZF 1LE2A 3POVA 1O87A 4GYTA 1NBBA 4K7BA 3TOLA 3EHMA 3LUTB 3UMKA 4E18A 2ZXRA 2HZ8A 2J0WA 3O39A 3ZQYA 1QLEC 4O7GA 4QI2A 3E70C 5KYUA 3I5PA 4BJTA 4Z9JA 1OR3A 1HMDA 3C8GA 3CQZA 2XL6A 3LESA 2AP3A 2OEVA 5A6JA 2XLHA 5DVWA 5A69A 5TJ5E 2DYRC 4MVMA 3C7JA 2YHSA 2B0JA 3NYMA 4DRJB 3EJNA 5DS4A 3HLZA 3QTHA 1OKKA 3NYLA 3JYYA 3IQ6A 2R05A 1Y6DA 4LLEA 4MTFA 3DAGA 2YQYA 1H9GA 2A1DD 4JCHA 2X51A 4J32B 4BJ5C 1T6QA 3EGDA 1H7IA 2PFDA 1NLXA 1VOMA 4PJNA 5A6KA 2NUPB 3LNMB 1OQCA 3HTKC 4J30B 1JAFA 1Q0KA 3V5XA 3OWTA 4F4BA 1O5HA 5L0FA 1TWGA 4U5CE 2EIMC 1E84A 1L7CA 2Y39A 3HKKA 1L3PA 3EGXB 1SF8A 3NMKA 2A68F 3U8VA 3ECSA 2KJGA 3ZQVA 1TWHA 4YT5A 2XS8A 3BEHA 3M79A 4CIHA 3ATPA 4U5EE 5T3WA 1HW2A 3LLKA 5KYWA 3GM2A 2P61A 1PD0A 3QW0A 4DJ9A 3S0XA 3SXMA 2OCCC 2W4MA 2R7OA 2VCCA 2YEVA 3U9JA 3S29A 4YL3A 2LCHA 4E7SA 3MYIA 4HEAJ 1VLSA 3K1IC 4ER9A 3FMSA 4AX2A 3GODA 4CJGA 2V26A 4IGGA 2VC9A 3H2UA 4OIQF 1ZHTA 4JTAB 3FVYA 5BQGA 2I15A 5EK0A 1LI7A 2IM8A 1YARO 2HJ3A 2Q9BA 4XLPF 1LVKA 5E33A 5DLJA 1APCA 1WGWA 1YJGA 3W8HA 5F5HA 2AVKA 3DE8A 3M1CB 4YT8A 2R7UA 3FOOA 4P9TA 3U5SA 4C7OB 2IBFA 3FHDA 4U5FE 2RD9A 1LI5A 1O3UA 2YRFA 3K7DA 3U2MA 3ABKC 2OG2A 2GWWA 4NTAA 5BQHA 2DB4A 1EKYA 4JW1A 2W4BA 5JSLA 4CX9A 1DOWA 3SYNA 1A7VA 4RDAA 4OD4A 1QKRA 5HSWA 2NUTB 2XL4A 2H7VC 4N06A 1LKXA 1QZXA 3AQCA 3T6JA 1LIHA 4YN0B 2J8WA 4WJ0A 1AEPA 4P6IC 4IWBA 2M4EA 4C3DA 1T6UA 2FFHA 3HNJA 3JTLO 3KKBA 1GM5A 3Q6NA 4DOZA 1A0BA 1CGOA 1Q0GA 1VB5A 1AVOB 4XPWA 3RYLA 4A2NB 3KPHA 4PJMA 2CCYA 1OW7A 1FAPB 2NSFA 2BL2A 1TKNA 4XWJA 1Z7Qc 1NFNA 2KK1A 4ZLCA 3U0CA 3IEEA 2NSGA 3MLGA 4MS2A 4MVQA 5DQTA 1V55C 4FWVA 3DM5A 3HNIA 3RIPA 4BG0A 2EPLX 2WZLA 2HSQA 2J7PD 4JTCB 2VCAA 4G0HA 1UG7A 3ZG1A 5A6BD 2IXNA 4JEBA 2AWYA 4CIPA 4KI2A 2L9JA 3ABMC 4RD9A 3T4RA 4C7OA 3JZ0A 2A6EF 3PMRA 3EGXA 4XEFA 2Y3DA 5COGA 5GPGB 5L3VA 4U5BE 2YWAA 2YKZA 4OIPF 4XQ1A 3DZAA 2C04A 3W2VA 1LS4A 2L6HA 5COFA 1JR8A 4GQHA 2ICWG 2XLEA 3S90A 1B68A 3SXYA 4CJOA 1ZHYA 3F47A 1GQAA 4MVUA 1MQVA 3DAFA 5DQZA 2Y3BA 2HUJA 2Z15A 1Z23A 5L0IA 4MVSA 3KYJA 3ITFA 4N6CA 4HFFB 2G62A 1ZU5A 2G3VA 3U2LA 2JX0A 2J9UA 3FOPA 2FGYA 1CPRA 2UUHA 3VAYA 1N1CA 4WGYA 4JCZA 2WL8A 3RF3A 4LLCA 4Z9HA 2L6FA 2MWQA 3LAYA 2P0NA 3GM3A 3RVZA 3DM9B 2KW3C 1YA7O 2L81A 3B29A 2QE9A 4KNWA 1PD1A 1J8MF 4CSAA 2NG1A 3U9MA 3DXJF 3GANA 3PHF2 5K0IA 1C17M 2R7SA 3NKDA 1XWJA 2VH3A 3G50A 3WODF 3M15A 2OEXA 2NUTA 4DXWA 1RKCA 2YZSA 3DWWA 4OIRF 1MMNA 1K05A 2KNHA 2XSEA 2XM0A 2PX0A 4MVRA 3SZRA 4KC9A 4P9FA 4CBEA 3MX3A 4U5GA 4OIOF 1M2VB 4IAQA 1U89A 1HE9A 4BPMA 1WTYA 2R03A 4JZAA 1XZPA 4I3MA 1M6TA 4EKWA 4GEHA 5E3AA 3QW1A 4AK9A 3DJUB 1RMVA 2ZXOA 3JSZA 3LEOA 4KBLA 1YA9A 3F46A 1H6GA 3G4ZA 2H7BA 3IQCA 1Q0FA 2DI3A 1BR4A 2EILC 2ETSA 3A9CA 1CGME 2YVKA 1CGNA 1KU2A 1NU9C 1TQGA 4PR9A 2I8BA 3JSEO 4XLNF 3UMIA 2UUIA 4E17A 4FAPB 1S05A 2R7TA 1OXKA 4G7OF 5COMA 2W45A 4U9DA 3TOMA 5KYXB 1C02A 5JS5A 3GWNA 3AG4C 4OINF 5FZTA 5JUAA 2EINC 1PCXA 5E2QA 3K66A 3S28A 1ZVZA 2PX3A 2XRHA 3PCVA 3US6A 5F28E 3GM1A 4EBJA 4HFKB 3RVYA 1JMWA 4MTGA 3EG9B 4YK5A 5T3TA 2KQ9A 5L3QA 2LP4A 4M63A 3O10A 3QZCA 4MW8A 3C18A 3N24A 4JTDB 4UDVA 3K1HA 4NY3A 1QSPA 4E7ZA 2Q4FA 2VB6A 3CAXA 3TK0A 1MNDA 2GA0A 2YLGA 4PFPA 4G7ZF 2OOCA 4JURI 4J7TA 1NU7D 4CSAC 1JRAA 256BA 2P7VA 2J0XA 2LK4A 3J06A 1GGQA 2C03A 5CI8A 2O9XA 4HE8D 4R32A 1RXQA 2A0BA 3GWLA 4CDAA 3GEHA 2R9RB 3N0TA 3TULA 3FDQA 3B9QA 3EH1A 3IHUA 2OJQA 2ZXWC 3M4CA 5B1BC 1YLMA 1T6IA 3ZVRA 3CZ6A 4K0DA 4PFOA 2P1AA 1M56C 1QQ3A 1R5ID 2LFFA 1NG1A 4MNDA 5FCLA 2QY9A 4ZLDA 5L0JA 4YT4A 5EHHA 3FAPB 4XTKA 3O55A 3DE9A 1Q0MA 1D0XA 1YVIA 1RKEB 1M2VA 2MYSA 3Q7LA 4MTOA 4Q7CA 3DMDA 4XEVA 4PJLA 4U9EA 1QPUA 1RJ9B 1ZW2A 2ZD9A 2HMZA 4U5HA 3LNRA 3AG2C 2Q7RA 4DVYP 3Q6MA 1H9TA 1OXBA 5A6AA 2NPUA 1D1BA 4YJWA 1YYXA 2Y69C 4LERA 4E0IA 5DS6A 1VYIA 2D4UA 1YAUO 3LLIA 3N2ZB 1NFOA 2Q3TA 3EH2A 3L0IA 2OKUA 5CIVA 2QNLA 3HNLA 5KYXA 2H7OA 2R7XA 1TWCA 3GEEA 3NYJA 3ASOC 2CDQA 2HV6A 1A41A 1I4YA 5KYUB 2JD3A 2Y3GA 2Q9CA 3O6XA 1I5NA 3EG9A 3AG3C 4G78A 3LJBA 3VRCA 1PV3A 1G4US 1S7ZA 1ST6A 2GFHA 3FAJA 5JLIA 3B0VC 1I4ZA 1OCCC 2J9VA 1ZU4A 3GEIA 3FXHA 1EI7A 4EBKA 1BDJB 1ZHWA 3X1OA 3ABLC 3C8GD 3TD7A 4O6YA 1VTMP 2EIJC 4I1MA 3SXKA 3KYIA 2AWCA 4EWCA 5B1AC 3UGOA 2CW0F 3NRHA 1OKKD 2D5RB 3RH3A 5T1DB 4IARA 5EGYA 2GAQA 5BQIA 4LDKA 3QVZA 3ZDLA 4B6IA 2ZPAA 1TR2A 3EFOB 3H65A 2R7WA 1Z3IX 2CNWA 4IB4A 4J7YA 3U3BA 2L6GA 1R4TA 4D4XA 4BEJA 2LD6A 3NKEA 4E0HA 4JJGA 1LM3B 1Z5ZA 2R7VA 3G4XA 5KYNA 3NG1A 2V3CC 3RFYA 3ZSUA 3ZWIA 3KL4A 2LIGA 4AL0A 3E9VA 1SMYF 4JC7A 3T6GB 2H8AA 4BEMJ 4IRUA 1YZCA 1TFOB 1Y4CA 4EHPA 2CYDA 1ZYRF 4NQFA 2GDCA 2R02A 2XLDA 1TFKB 1T5OA 1G8XA 3W2WA 2KC3A 1CPQA 2HV7A 2OU6A 2J7PA 4H4KC 5AC5A 1RKEA 3C63A 4NTFA 2ZXPA 2HKVA 1FMWA 3ZTZA 2PNOA 1ORYA 4AE4A 4BJ1A 3EHNA 3K6BA 1V74B 1GS9A 1RJ9A 3K33A 3SXZA 2PF4E 3U8PA 2XXAB 1ORSC 2QTVA 4JEAA 4IAOA 4C3EA 2B0HA 3ZC4A 4NTBA 3IPMO 4NC3A 2HSBA 2EPNA 1EQ1A 2J46A 4JRZA 4CS8A 4YL0A 1VLTA 3UR3C 1VMAA 4YWQA 4JE9A 2WVNA 4JJFA 5L0CA 1D0YA 4EIYA 2P6VA 2XLOA 3UNGC 3X2QC 2XLMA 4DBQA 4I1OB 2YLIA 5JVEA 2X0CA 1IW7F 1WN0A 2YL3A 3NMIA 3EPVA 4NCQA 3JCUQ 1SZIA 4Q5SF 4YT2A 1ZZPA 2PP4A 3R2PA 2R7RA 4ANJA 3U3FA 2DGJA 1FTSA 2EPMX 2IYLD 2R7QA 3TJ5A 4PJJA 4CS9A 4U5DE 1D0ZA 2WVQA 5E3CA 4H54A 5JT4A 1HMOA 1SYQA 4EUKB 2MHRA 4N4WA 3S9OA 5L0HA 1RCPA 2QLAA 1QVXA 2DYSC
chains in the Genus database with same CATH topology
4NCQA 1Q0MA 1Q0GA 1T6IA 3G50A 1Q0KA 1Q0DA 1T6UA 3G4XA 3G4ZA 1Q0FA 1T6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCQ A;  1Q0M A;  1Q0G A;  1T6I A;  3G50 A;  1Q0K A;  1Q0D A;  1T6U A;  3G4X A;  3G4Z A;  1Q0F A;  1T6Q A; 
#chains in the Genus database with same CATH topology
 3W4Y A;  2EPK X;  2A6H F;  5KYY B;  4FX5 A;  4Z9I A;  3T9O A;  3RQE A;  1OCZ C;  2BE5 F;  2XS1 A;  3DKA A;  3OA1 A;  1FFH A;  4XPX A;  1A7D A;  3EQL F;  1BBH A;  3DJN B;  3NDB B;  1G4W R;  3B0U X;  1DOV A;  3I5Q A;  1VYK A;  4MVZ A;  4C3B A;  1E2X A;  3LS0 A;  3SEO A;  3V5Z A;  3S84 A;  2J45 A;  3EFO A;  4IJJ A;  2EPO A;  1TWA A;  4G7H F;  3L34 A;  4O6N A;  3TQO A;  2J9B A;  2XLV A;  4WAB A;  1FNT c;  1C03 A;  1WOL A;  4W8K A;  3VM6 A;  3T6B A;  2EIK C;  3QVY A;  1V54 C;  1WAT A;  3WAQ A;  3UGP A;  1A7E A;  3CEX A;  4EBB A;  1T9K A;  2QUP A;  5JP7 A;  1KTM A;  3KMI A;  3M4B A;  2PBE A;  1YDI A;  1D1A A;  1LS1 A;  3JYH A;  5JRA A;  3ASN C;  4RBN A;  1ZW3 A;  3H2V A;  3WG7 C;  1FMV A;  1MMA A;  1FFT C;  4OD5 A;  3V7O A;  2YL0 A;  3WHN A;  3MFN A;  1ZHZ A;  3GOR A;  2KSF A;  3IQ5 A;  2A0U A;  5CI9 A;  1AUE A;  4AE4 B;  1MMG A;  1OW6 A;  1OR2 A;  4LAC B;  3LS1 A;  1YYJ A;  3CSK A;  2WZG A;  3BRJ A;  4CS8 C;  1E85 A;  2VAS A;  2XXA A;  1NSG B;  3B71 A;  3JRT A;  1UFB A;  1M57 C;  2KGO A;  3JRM O;  4ONS A;  4PK4 A;  3TJ6 A;  5L0D A;  1LPE A;  4DRI B;  4K1O A;  2L7A A;  4JKV A;  4JVS A;  1M2O A;  1FR0 A;  1V4A A;  1Z63 A;  3W8I A;  4W8P A;  5D92 A;  4JIO A;  1BZ4 A;  2A69 F;  1U6H A;  2IXP A;  5B3S C;  1D1C A;  2WZF A;  3R7C A;  2J9W A;  3C62 A;  2CNW D;  4BJ6 A;  1T01 A;  2KYH A;  1LE4 A;  3RQG A;  4CS9 C;  5AC4 A;  3AOU A;  3EZI A;  2M64 A;  3C8G B;  1MMD A;  3L8I A;  4QI0 A;  5B3I A;  4MW3 A;  3ZTM A;  2HMQ A;  1W2W A;  3B0P A;  3SP1 A;  3AQB A;  3AG1 C;  1ORJ A;  3MBG A;  3C8Z A;  2VCB A;  3MYF A;  1YZA A;  4MQ9 F;  3IQT A;  3L1M A;  2IXO A;  4XPY A;  3HNK A;  1JOG A;  1BR1 A;  3AJM A;  1XZQ A;  3OEO A;  2IOQ A;  2Q00 A;  5D91 A;  3HJC A;  4D4N A;  3EGD B;  3ZIB A;  4CDV A;  5IY5 C;  4KNV A;  3S27 A;  3SNH A;  2NUP A;  4FES A;  5F5F A;  1IZM A;  2FAP B;  1K40 A;  5KYY A;  3KH2 A;  3AGU A;  2LFD A;  4A4A A;  3NMJ A;  1U0B B;  1OW8 A;  1SR2 A;  3LEV A;  4YL1 A;  4BJ5 A;  3QMK A;  2OQM A;  2BC5 A;  2CGE A;  1HW1 A;  4O6M A;  4XEK A;  3AGT A;  3PDM P;  3RW0 A;  1Z6A A;  5BUO A;  1G5Z A;  2YLD A;  3DI5 A;  5HV9 A;  1NZE A;  2HJM A;  1E83 A;  5DS5 A;  2HS5 A;  3DD7 A;  5KYW B;  2TMV P;  1K04 A;  1OCR C;  1E86 A;  4LDQ A;  2RSE B;  2ASR A;  3EZH A;  4PAC A;  4X0R A;  1F1M A;  3I4U A;  3Q7G A;  2E87 A;  1HY5 A;  4DBR A;  1KNY A;  1WWP A;  3A11 A;  2LSE A;  2Y3H A;  3RQF A;  3UMH A;  1HE1 A;  4CS7 A;  4I44 A;  2JPU A;  2XL8 A;  4O79 A;  4QDL A;  4ULV A;  3VYW A;  4DVZ A;  1JPJ A;  3K1I A;  3VF0 A;  2AU5 A;  1Q0D A;  2R25 A;  2IXM A;  2F22 A;  1J8Y F;  4L6R A;  4N6H A;  4CDY A;  1JPN A;  1ZHX A;  1OCO C;  2G3K A;  4DRH B;  5A6B A;  4LDR A;  3V5Y A;  1BR2 A;  3L8J A;  2WVO A;  1MNE A;  2LQG A;  2HFI A;  1EA8 A;  1WAS A;  3RKO F;  2XM4 A;  2YL1 A;  2W9Y A;  4WGZ A;  5L0G A;  1VK5 A;  3JT1 A;  4ULW A;  2Q9A A;  4AL1 A;  2WB7 A;  5AGF A;  2XLW A;  4BJ6 C;  2OJE D;  4MVO A;  2YL7 A;  4Q4Z F;  1LE2 A;  3POV A;  1O87 A;  4GYT A;  1NBB A;  4K7B A;  3TOL A;  3EHM A;  3LUT B;  3UMK A;  4E18 A;  2ZXR A;  2HZ8 A;  2J0W A;  3O39 A;  3ZQY A;  1QLE C;  4O7G A;  4QI2 A;  3E70 C;  5KYU A;  3I5P A;  4BJT A;  4Z9J A;  1OR3 A;  1HMD A;  3C8G A;  3CQZ A;  2XL6 A;  3LES A;  2AP3 A;  2OEV A;  5A6J A;  2XLH A;  5DVW A;  5A69 A;  5TJ5 E;  2DYR C;  4MVM A;  3C7J A;  2YHS A;  2B0J A;  3NYM A;  4DRJ B;  3EJN A;  5DS4 A;  3HLZ A;  3QTH A;  1OKK A;  3NYL A;  3JYY A;  3IQ6 A;  2R05 A;  1Y6D A;  4LLE A;  4MTF A;  3DAG A;  2YQY A;  1H9G A;  2A1D D;  4JCH A;  2X51 A;  4J32 B;  4BJ5 C;  1T6Q A;  3EGD A;  1H7I A;  2PFD A;  1NLX A;  1VOM A;  4PJN A;  5A6K A;  2NUP B;  3LNM B;  1OQC A;  3HTK C;  4J30 B;  1JAF A;  1Q0K A;  3V5X A;  3OWT A;  4F4B A;  1O5H A;  5L0F A;  1TWG A;  4U5C E;  2EIM C;  1E84 A;  1L7C A;  2Y39 A;  3HKK A;  1L3P A;  3EGX B;  1SF8 A;  3NMK A;  2A68 F;  3U8V A;  3ECS A;  2KJG A;  3ZQV A;  1TWH A;  4YT5 A;  2XS8 A;  3BEH A;  3M79 A;  4CIH A;  3ATP A;  4U5E E;  5T3W A;  1HW2 A;  3LLK A;  5KYW A;  3GM2 A;  2P61 A;  1PD0 A;  3QW0 A;  4DJ9 A;  3S0X A;  3SXM A;  2OCC C;  2W4M A;  2R7O A;  2VCC A;  2YEV A;  3U9J A;  3S29 A;  4YL3 A;  2LCH A;  4E7S A;  3MYI A;  4HEA J;  1VLS A;  3K1I C;  4ER9 A;  3FMS A;  4AX2 A;  3GOD A;  4CJG A;  2V26 A;  4IGG A;  2VC9 A;  3H2U A;  4OIQ F;  1ZHT A;  4JTA B;  3FVY A;  5BQG A;  2I15 A;  5EK0 A;  1LI7 A;  2IM8 A;  1YAR O;  2HJ3 A;  2Q9B A;  4XLP F;  1LVK A;  5E33 A;  5DLJ A;  1APC A;  1WGW A;  1YJG A;  3W8H A;  5F5H A;  2AVK A;  3DE8 A;  3M1C B;  4YT8 A;  2R7U A;  3FOO A;  4P9T A;  3U5S A;  4C7O B;  2IBF A;  3FHD A;  4U5F E;  2RD9 A;  1LI5 A;  1O3U A;  2YRF A;  3K7D A;  3U2M A;  3ABK C;  2OG2 A;  2GWW A;  4NTA A;  5BQH A;  2DB4 A;  1EKY A;  4JW1 A;  2W4B A;  5JSL A;  4CX9 A;  1DOW A;  3SYN A;  1A7V A;  4RDA A;  4OD4 A;  1QKR A;  5HSW A;  2NUT B;  2XL4 A;  2H7V C;  4N06 A;  1LKX A;  1QZX A;  3AQC A;  3T6J A;  1LIH A;  4YN0 B;  2J8W A;  4WJ0 A;  1AEP A;  4P6I C;  4IWB A;  2M4E A;  4C3D A;  1T6U A;  2FFH A;  3HNJ A;  3JTL O;  3KKB A;  1GM5 A;  3Q6N A;  4DOZ A;  1A0B A;  1CGO A;  1Q0G A;  1VB5 A;  1AVO B;  4XPW A;  3RYL A;  4A2N B;  3KPH A;  4PJM A;  2CCY A;  1OW7 A;  1FAP B;  2NSF A;  2BL2 A;  1TKN A;  4XWJ A;  1Z7Q c;  1NFN A;  2KK1 A;  4ZLC A;  3U0C A;  3IEE A;  2NSG A;  3MLG A;  4MS2 A;  4MVQ A;  5DQT A;  1V55 C;  4FWV A;  3DM5 A;  3HNI A;  3RIP A;  4BG0 A;  2EPL X;  2WZL A;  2HSQ A;  2J7P D;  4JTC B;  2VCA A;  4G0H A;  1UG7 A;  3ZG1 A;  5A6B D;  2IXN A;  4JEB A;  2AWY A;  4CIP A;  4KI2 A;  2L9J A;  3ABM C;  4RD9 A;  3T4R A;  4C7O A;  3JZ0 A;  2A6E F;  3PMR A;  3EGX A;  4XEF A;  2Y3D A;  5COG A;  5GPG B;  5L3V A;  4U5B E;  2YWA A;  2YKZ A;  4OIP F;  4XQ1 A;  3DZA A;  2C04 A;  3W2V A;  1LS4 A;  2L6H A;  5COF A;  1JR8 A;  4GQH A;  2ICW G;  2XLE A;  3S90 A;  1B68 A;  3SXY A;  4CJO A;  1ZHY A;  3F47 A;  1GQA A;  4MVU A;  1MQV A;  3DAF A;  5DQZ A;  2Y3B A;  2HUJ A;  2Z15 A;  1Z23 A;  5L0I A;  4MVS A;  3KYJ A;  3ITF A;  4N6C A;  4HFF B;  2G62 A;  1ZU5 A;  2G3V A;  3U2L A;  2JX0 A;  2J9U A;  3FOP A;  2FGY A;  1CPR A;  2UUH A;  3VAY A;  1N1C A;  4WGY A;  4JCZ A;  2WL8 A;  3RF3 A;  4LLC A;  4Z9H A;  2L6F A;  2MWQ A;  3LAY A;  2P0N A;  3GM3 A;  3RVZ A;  3DM9 B;  2KW3 C;  1YA7 O;  2L81 A;  3B29 A;  2QE9 A;  4KNW A;  1PD1 A;  1J8M F;  4CSA A;  2NG1 A;  3U9M A;  3DXJ F;  3GAN A;  3PHF 2;  5K0I A;  1C17 M;  2R7S A;  3NKD A;  1XWJ A;  2VH3 A;  3G50 A;  3WOD F;  3M15 A;  2OEX A;  2NUT A;  4DXW A;  1RKC A;  2YZS A;  3DWW A;  4OIR F;  1MMN A;  1K05 A;  2KNH A;  2XSE A;  2XM0 A;  2PX0 A;  4MVR A;  3SZR A;  4KC9 A;  4P9F A;  4CBE A;  3MX3 A;  4U5G A;  4OIO F;  1M2V B;  4IAQ A;  1U89 A;  1HE9 A;  4BPM A;  1WTY A;  2R03 A;  4JZA A;  1XZP A;  4I3M A;  1M6T A;  4EKW A;  4GEH A;  5E3A A;  3QW1 A;  4AK9 A;  3DJU B;  1RMV A;  2ZXO A;  3JSZ A;  3LEO A;  4KBL A;  1YA9 A;  3F46 A;  1H6G A;  3G4Z A;  2H7B A;  3IQC A;  1Q0F A;  2DI3 A;  1BR4 A;  2EIL C;  2ETS A;  3A9C A;  1CGM E;  2YVK A;  1CGN A;  1KU2 A;  1NU9 C;  1TQG A;  4PR9 A;  2I8B A;  3JSE O;  4XLN F;  3UMI A;  2UUI A;  4E17 A;  4FAP B;  1S05 A;  2R7T A;  1OXK A;  4G7O F;  5COM A;  2W45 A;  4U9D A;  3TOM A;  5KYX B;  1C02 A;  5JS5 A;  3GWN A;  3AG4 C;  4OIN F;  5FZT A;  5JUA A;  2EIN C;  1PCX A;  5E2Q A;  3K66 A;  3S28 A;  1ZVZ A;  2PX3 A;  2XRH A;  3PCV A;  3US6 A;  5F28 E;  3GM1 A;  4EBJ A;  4HFK B;  3RVY A;  1JMW A;  4MTG A;  3EG9 B;  4YK5 A;  5T3T A;  2KQ9 A;  5L3Q A;  2LP4 A;  4M63 A;  3O10 A;  3QZC A;  4MW8 A;  3C18 A;  3N24 A;  4JTD B;  4UDV A;  3K1H A;  4NY3 A;  1QSP A;  4E7Z A;  2Q4F A;  2VB6 A;  3CAX A;  3TK0 A;  1MND A;  2GA0 A;  2YLG A;  4PFP A;  4G7Z F;  2OOC A;  4JUR I;  4J7T A;  1NU7 D;  4CSA C;  1JRA A;  256B A;  2P7V A;  2J0X A;  2LK4 A;  3J06 A;  1GGQ A;  2C03 A;  5CI8 A;  2O9X A;  4HE8 D;  4R32 A;  1RXQ A;  2A0B A;  3GWL A;  4CDA A;  3GEH A;  2R9R B;  3N0T A;  3TUL A;  3FDQ A;  3B9Q A;  3EH1 A;  3IHU A;  2OJQ A;  2ZXW C;  3M4C A;  5B1B C;  1YLM A;  1T6I A;  3ZVR A;  3CZ6 A;  4K0D A;  4PFO A;  2P1A A;  1M56 C;  1QQ3 A;  1R5I D;  2LFF A;  1NG1 A;  4MND A;  5FCL A;  2QY9 A;  4ZLD A;  5L0J A;  4YT4 A;  5EHH A;  3FAP B;  4XTK A;  3O55 A;  3DE9 A;  1Q0M A;  1D0X A;  1YVI A;  1RKE B;  1M2V A;  2MYS A;  3Q7L A;  4MTO A;  4Q7C A;  3DMD A;  4XEV A;  4PJL A;  4U9E A;  1QPU A;  1RJ9 B;  1ZW2 A;  2ZD9 A;  2HMZ A;  4U5H A;  3LNR A;  3AG2 C;  2Q7R A;  4DVY P;  3Q6M A;  1H9T A;  1OXB A;  5A6A A;  2NPU A;  1D1B A;  4YJW A;  1YYX A;  2Y69 C;  4LER A;  4E0I A;  5DS6 A;  1VYI A;  2D4U A;  1YAU O;  3LLI A;  3N2Z B;  1NFO A;  2Q3T A;  3EH2 A;  3L0I A;  2OKU A;  5CIV A;  2QNL A;  3HNL A;  5KYX A;  2H7O A;  2R7X A;  1TWC A;  3GEE A;  3NYJ A;  3ASO C;  2CDQ A;  2HV6 A;  1A41 A;  1I4Y A;  5KYU B;  2JD3 A;  2Y3G A;  2Q9C A;  3O6X A;  1I5N A;  3EG9 A;  3AG3 C;  4G78 A;  3LJB A;  3VRC A;  1PV3 A;  1G4U S;  1S7Z A;  1ST6 A;  2GFH A;  3FAJ A;  5JLI A;  3B0V C;  1I4Z A;  1OCC C;  2J9V A;  1ZU4 A;  3GEI A;  3FXH A;  1EI7 A;  4EBK A;  1BDJ B;  1ZHW A;  3X1O A;  3ABL C;  3C8G D;  3TD7 A;  4O6Y A;  1VTM P;  2EIJ C;  4I1M A;  3SXK A;  3KYI A;  2AWC A;  4EWC A;  5B1A C;  3UGO A;  2CW0 F;  3NRH A;  1OKK D;  2D5R B;  3RH3 A;  5T1D B;  4IAR A;  5EGY A;  2GAQ A;  5BQI A;  4LDK A;  3QVZ A;  3ZDL A;  4B6I A;  2ZPA A;  1TR2 A;  3EFO B;  3H65 A;  2R7W A;  1Z3I X;  2CNW A;  4IB4 A;  4J7Y A;  3U3B A;  2L6G A;  1R4T A;  4D4X A;  4BEJ A;  2LD6 A;  3NKE A;  4E0H A;  4JJG A;  1LM3 B;  1Z5Z A;  2R7V A;  3G4X A;  5KYN A;  3NG1 A;  2V3C C;  3RFY A;  3ZSU A;  3ZWI A;  3KL4 A;  2LIG A;  4AL0 A;  3E9V A;  1SMY F;  4JC7 A;  3T6G B;  2H8A A;  4BEM J;  4IRU A;  1YZC A;  1TFO B;  1Y4C A;  4EHP A;  2CYD A;  1ZYR F;  4NQF A;  2GDC A;  2R02 A;  2XLD A;  1TFK B;  1T5O A;  1G8X A;  3W2W A;  2KC3 A;  1CPQ A;  2HV7 A;  2OU6 A;  2J7P A;  4H4K C;  5AC5 A;  1RKE A;  3C63 A;  4NTF A;  2ZXP A;  2HKV A;  1FMW A;  3ZTZ A;  2PNO A;  1ORY A;  4AE4 A;  4BJ1 A;  3EHN A;  3K6B A;  1V74 B;  1GS9 A;  1RJ9 A;  3K33 A;  3SXZ A;  2PF4 E;  3U8P A;  2XXA B;  1ORS C;  2QTV A;  4JEA A;  4IAO A;  4C3E A;  2B0H A;  3ZC4 A;  4NTB A;  3IPM O;  4NC3 A;  2HSB A;  2EPN A;  1EQ1 A;  2J46 A;  4JRZ A;  4CS8 A;  4YL0 A;  1VLT A;  3UR3 C;  1VMA A;  4YWQ A;  4JE9 A;  2WVN A;  4JJF A;  5L0C A;  1D0Y A;  4EIY A;  2P6V A;  2XLO A;  3UNG C;  3X2Q C;  2XLM A;  4DBQ A;  4I1O B;  2YLI A;  5JVE A;  2X0C A;  1IW7 F;  1WN0 A;  2YL3 A;  3NMI A;  3EPV A;  4NCQ A;  3JCU Q;  1SZI A;  4Q5S F;  4YT2 A;  1ZZP A;  2PP4 A;  3R2P A;  2R7R A;  4ANJ A;  3U3F A;  2DGJ A;  1FTS A;  2EPM X;  2IYL D;  2R7Q A;  3TJ5 A;  4PJJ A;  4CS9 A;  4U5D E;  1D0Z A;  2WVQ A;  5E3C A;  4H54 A;  5JT4 A;  1HMO A;  1SYQ A;  4EUK B;  2MHR A;  4N4W A;  3S9O A;  5L0H A;  1RCP A;  2QLA A;  1QVX A;  2DYS C; 
#chains in the Genus database with same CATH homology
 4NCQ A;  1Q0M A;  1Q0G A;  1T6I A;  3G50 A;  1Q0K A;  1Q0D A;  1T6U A;  3G4X A;  3G4Z A;  1Q0F A;  1T6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...