2XLDA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124q variant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 47
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xldA00
4NC3A 2YL3A 3QVYA 3QVZA 4CX9A 2XLWA 3ZTMA 4CDYA 3QW1A 4IAQA 5JRAA 3ZQVA 2XLDA 4CDAA 4IARA 2YKZA 1M6TA 2CCYA 3M4BA 3QW0A 3M4CA 4ULVA 4WGYA 3NMJA 3HNIA 2J8WA 5AGFA 1E86A 4CIPA 1CGNA 4D4XA 5JP7A 4IB4A 2XLMA 5JVEA 3IQ5A 1E84A 1GQAA 4JEAA 2XM4A 4WGZA 4U9DA 1E85A 1A7VA 4CJGA 1EKYA 2XLOA 5JSLA 3NMKA 3M15A 3HNLA 5B3IA 3FOOA 1RCPA 1YYXA 2YLGA 3ZWIA 1CGOA 4CDVA 1YZCA 4CJOA 1YZAA 3HNKA 2XL8A 1LM3B 4JE9A 1CPQA 3TOMA 4D4NA 1MQVA 3IQ6A 3NMIA 1JAFA 2J9BA 2XLEA 4U9EA 1NBBA 1E83A 2XLVA 2XM0A 1YYJA 4JEBA 2YL7A 2BC5A 1BBHA 256BA 2XL6A 3C62A 4N4WA 3L1MA 4N6HA 2YLDA 2XLHA 3ZTZA 5JUAA 1CPRA 1APCA 2YL0A 3M79A 4JKVA 4EIYA 3HNJA 5JT4A 1S05A 4ER9A 3TOLA 3DE8A 3U8PA 3DE9A 5JLIA 1QQ3A 3FOPA 4L6RA 2QLAA 3C63A 5JS5A 3ZQYA 2YL1A 1QPUA 3VRCA 2YLIA
chains in the Genus database with same CATH superfamily
3I5QA 4DRIB 4NC3A 2QNLA 4DVZA 1EA8A 2NUTB 3EG9A 4JTCB 3S84A 3PMRA 3GEIA 1H9GA 1MMGA 2JD3A 3DJUB 4MTOA 1Z7Qc 1I4YA 4JURI 4PK4A 4U5DE 1FNTc 4C3BA 2LFDA 1K04A 1A7EA 1JR8A 3ZTMA 4F4BA 3TQOA 4CDYA 1FTSA 3MFNA 2OEXA 4IAQA 1TWGA 1NSGB 3GORA 1J8YF 3JT1A 4HFKB 2HV6A 3PHF2 1OXBA 4BEMJ 2AP3A 4CBEA 3UMIA 2ZXRA 2VB6A 1G4US 1M6TA 2CCYA 4PJNA 1WWPA 3U5SA 5HV9A 2EPOA 1D1AA 1I5NA 1HE9A 1ZW2A 3FAPB 3CSKA 3NKEA 4ULVA 5F5FA 3JCUQ 2ICWG 4FWVA 1MMAA 1PD1A 2ETSA 4XPXA 4FESA 5T1DB 4MS2A 1TFKB 2J8WA 3EPVA 1NU7D 1VYKA 4MNDA 4N06A 1H9TA 2L81A 2HZ8A 1SF8A 3NKDA 3U2MA 4C3EA 3A11A 1ZU5A 1RXQA 5BUOA 5KYWA 3RIPA 3DXJF 2W9YA 2P61A 4IRUA 5B3SC 2Q9BA 1B68A 5JVEA 2KW3C 1LPEA 4PJJA 4B6IA 4MVOA 3FHDA 3S28A 2GAQA 1E85A 1ZU4A 1EKYA 3ABKC 2J9WA 4YL1A 5JSLA 3WHNA 4YJWA 5DS6A 3U8VA 3G4ZA 3HNLA 4HE8D 4CS8A 3VAYA 3T6GB 1M2VB 2TMVP 1TKNA 2GDCA 1O5HA 2A0BA 2EIKC 3NRHA 1YZAA 4CJOA 2A6EF 2VASA 4CS9C 3SYNA 2YRFA 4LDRA 4KBLA 4YK5A 3VF0A 2HSQA 5A6BA 1LS1A 2Q9CA 4IAOA 5E3AA 1MMNA 3KYIA 2Y69C 4DRHB 3LUTB 1QSPA 4AE4A 2R7WA 3EGXB 3MLGA 1WGWA 4EWCA 4O6YA 3BRJA 4Z9IA 1T6IA 1TWCA 1J8MF 2HUJA 3EH2A 4U5BE 5COMA 4JE9A 4RD9A 1U0BB 3HTKC 5EK0A 4HEAJ 1ST6A 3L8JA 2Y3BA 3CZ6A 5AC4A 1T6UA 2A1DD 1ORJA 2KNHA 1A7DA 1XWJA 4E18A 2ZXOA 1E83A 3L0IA 3GANA 3N2ZB 2KGOA 3ZDLA 3FDQA 4KI2A 1ZHZA 2QE9A 1WASA 1Z3IX 5L0CA 4MQ9F 4G78A 4YN0B 2OEVA 2R7OA 3UGPA 4C7OB 2HS5A 1T6QA 3AJMA 1BBHA 2Q00A 2XL6A 3C62A 2J7PD 3R2PA 1OR2A 4PFPA 5EHHA 4UDVA 1OW7A 4N6HA 2P0NA 4EBBA 2YLDA 1BZ4A 5L3VA 3V7OA 2NUPB 1QLEC 4G7ZF 3NDBB 3ZTZA 1ORSC 3G4XA 1HW2A 3DM9B 3E9VA 3KPHA 3U2LA 3DKAA 4Q4ZF 2PFDA 2G3KA 3DI5A 3EGDA 1CPRA 1APCA 1E2XA 4JKVA 3I5PA 3GM2A 1U6HA 2I15A 3NYJA 3RF3A 1T5OA 3L34A 5JT4A 3IEEA 1BDJB 3C8GA 2L6GA 3S9OA 3DE8A 3EHMA 5KYNA 4AL0A 1SYQA 3T6JA 3DE9A 3JRTA 3N0TA 3W8IA 3RYLA 2R03A 5K0IA 2AVKA 2KQ9A 1WN0A 4JTAB 3CQZA 1VLTA 1YJGA 3UNGC 5DS4A 3J06A 2YL1A 2H7BA 3MYFA 2P7VA 3AG1C 1M2OA 5CIVA 5KYXB 2OKUA 2HKVA 3H2UA 3ZG1A 1RJ9A 2YEVA 4XTKA 3SXZA 4J32B 4CS7A 1R4TA 3EHNA 3X2QC 3DM5A 4XEKA 3SXYA 3KMIA 1FFTC 3B71A 1YA7O 2CYDA 5COGA 3S90A 2ZPAA 1LS4A 1HMDA 4DJ9A 4XEVA 1Y6DA 3LNMB 1LIHA 3QW1A 1VYIA 5L0GA 5T3TA 3AOUA 2BL2A 1IZMA 2OG2A 4I1MA 3ZQVA 1L3PA 3LS1A 2XLDA 4JVSA 1V54C 4U5GA 1Z5ZA 1Z23A 3FMSA 4CDAA 4DXWA 4ZLDA 1TWHA 3LNRA 4MVMA 4IGGA 3QW0A 5B1BC 2JPUA 3M4CA 1BR4A 1NFOA 1CGME 4G7HF 3LEOA 4X0RA 3KKBA 2L9JA 2R05A 2XL4A 4GEHA 2A69F 5AGFA 3EG9B 2VCAA 2GFHA 2J7PA 2Y3GA 3HJCA 1MMDA 2W4BA 3EFOA 4YL0A 4CIPA 1CGNA 2AU5A 2NPUA 3FXHA 2Z15A 4LACB 4O6MA 2LD6A 4MVRA 3U0CA 2L7AA 3ASOC 2YQYA 2WVQA 2W4MA 5AC5A 2VH3A 5HSWA 3IQ5A 4EHPA 5L3QA 1GQAA 4E0IA 4EUKB 4LERA 1JRAA 4WABA 3IHUA 4W8PA 4XPWA 3SEOA 5L0JA 2WL8A 4PJLA 1RCPA 4EBKA 1D0ZA 3SXKA 5E3CA 1YZCA 4CDVA 4CSAC 5TJ5E 4QI0A 1ZHTA 2J46A 2CGEA 3TJ5A 1KU2A 4I44A 4JJGA 4JCHA 1OCOC 3KYJA 4MW3A 3EZIA 5COFA 3GM3A 1E86A 1KTMA 3WAQA 5A6AA 1V55C 4ANJA 1CPQA 1ZHWA 1XZPA 3PDMP 4WJ0A 3K1IA 3KH2A 4D4NA 4OD5A 2OU6A 4H4KC 2Y3DA 1HW1A 1ZZPA 3K33A 2P6VA 2BE5F 4J7YA 5D92A 1C03A 4DBRA 2HSBA 3C8GD 2XLEA 3SXMA 1NBBA 1Q0GA 3K1HA 2XLVA 2KJGA 4NY3A 1RMVA 1H7IA 1YYJA 1OXKA 2C03A 4NCQA 2BC5A 4OIRF 3OA1A 2H8AA 1SZIA 4DVYP 1DOVA 3DMDA 4AE4B 2KC3A 3T4RA 1EQ1A 5A6BD 3C8ZA 5KYYA 4U5CE 4BEJA 2J9VA 2XXAA 1MNDA 3W2VA 2PNOA 4KC9A 4K0DA 5L0HA 3CAXA 1JPNA 2MYSA 4BG0A 1O87A 4E17A 2D4UA 3M79A 1LE4A 4EIYA 3HNJA 2L6FA 3MYIA 2KSFA 4NTAA 1DOWA 4ER9A 5L0FA 3U8PA 1U89A 4JW1A 4Q7CA 4MVQA 3FOPA 2DYRC 3DZAA 4L6RA 3V5YA 1T9KA 2XS8A 4AK9A 2B0HA 3U3BA 3U9JA 4R32A 2ASRA 3ZQYA 4O6NA 1Z6AA 3S27A 1QPUA 1YDIA 4CS8C 2Y39A 4PJMA 3T6BA 1KNYA 2YLIA 3PCVA 1LVKA 3O10A 3VM6A 2YL3A 4MTFA 5FZTA 1VB5A 2IBFA 3QVYA 4P9FA 3TK0A 3W2WA 5BQIA 4E7SA 2GWWA 2WVNA 3EQLF 2QUPA 3RQEA 4XPYA 3U9MA 2IYLD 3AGTA 3C8GB 1QKRA 5DQZA 4BJ6A 3HLZA 3H2VA 3C18A 2UUIA 1Q0FA 3LEVA 5JRAA 1D0XA 2J0XA 4U5HA 1XZQA 4AL1A 2IM8A 2LP4A 1C17M 1G5ZA 4IARA 3IQCA 3ITFA 3TULA 1RKEB 3UMHA 1LI5A 1W2WA 1OW8A 4PFOA 1OCCC 3FAJA 2R7XA 3EZHA 2B0JA 4WGYA 3JYHA 4M63A 4OIQF 1NU9C 3ZC4A 4FX5A 1RJ9B 3HNIA 1G4WR 4GYTA 4BJ5A 1N1CA 1YAUO 5A69A 3NYMA 2XS1A 1A0BA 4XWJA 4CIHA 1GS9A 1VLSA 4E0HA 3S0XA 3GM1A 5F28E 3RVZA 5GPGB 2MWQA 3UMKA 5CI9A 1ZHYA 4KNWA 5JP7A 1HY5A 3ZIBA 1NLXA 3K7DA 2DB4A 2XLMA 5BQGA 3TJ6A 4G0HA 3S29A 2WZLA 3JZ0A 2H7VC 4JEAA 3T9OA 4W8KA 4U9DA 2J9UA 4CJGA 3OEOA 2E87A 2EIMC 3G50A 2OQMA 1F1MA 2DGJA 4RDAA 3IQTA 4RBNA 3FOOA 1YYXA 1S7ZA 1K05A 2HFIA 4DOZA 1CGOA 2WZGA 3AQBA 3V5ZA 3JSZA 4ZLCA 2KK1A 3LESA 3SZRA 3KL4A 3UR3C 2X51A 2G62A 1OQCA 3ASNC 3FVYA 5KYXA 1VTMP 2XL8A 3B0UX 2EPLX 1UG7A 1LM3B 3ATPA 5KYUA 4IWBA 3MBGA 2A0UA 2DI3A 3O55A 3Q7LA 4NTBA 1YARO 5DLJA 3C7JA 4BJTA 1Z63A 3O39A 4JJFA 3NYLA 4YT2A 1OKKA 2ZXWC 1AEPA 3AQCA 2R7TA 1MQVA 2LSEA 3EH1A 3NMIA 1K40A 1JAFA 4LLEA 1OW6A 3K66A 1A41A 3W8HA 4LDQA 4MW8A 2CW0F 4J30B 2A68F 2KYHA 4NQFA 3E70C 4ONSA 2G3VA 4U9EA 4JZAA 3R7CA 5A6KA 2M64A 3GODA 3LLIA 4OD4A 3RQGA 2XM0A 1O3UA 3RFYA 3L8IA 3SP1A 4U5EE 2YL7A 1QZXA 2R7UA 2FGYA 4JTDB 4N4WA 2YWAA 1TQGA 1RKCA 1NFNA 3GEEA 3QZCA 3ZSUA 5KYWB 2R02A 5CI8A 4XLNF 3U3FA 2NUTA 3RH3A 5EGYA 2LQGA 1FMVA 3M1CB 1SR2A 5B1AC 1OCRC 2YL0A 5T3WA 2NSFA 2FFHA 2EINC 1HMOA 1LI7A 1S05A 1WATA 2I8BA 2HV7A 2J45A 2OJQA 5E33A 3V5XA 4CS9A 1SMYF 4MTGA 3LLKA 2A6HF 5JLIA 4H54A 4PACA 1QQ3A 2R7SA 1YA9A 2QLAA 2D5RB 2QTVA 3AG3C 3GEHA 4C3DA 4DRJB 4YT4A 1PV3A 3ECSA 1PD0A 1LKXA 1IW7F 3C63A 3LAYA 5DVWA 5JS5A 4OIOF 1OCZC 3DAFA 3IPMO 3ZVRA 5KYYB 2EPKX 4U5FE 3UGOA 2EIJC 3AGUA 2XXAB 3W4YA 2CNWA 2R9RB 2HMQA 1JOGA 2IOQA 2XSEA 3QVZA 2RSEB 4CX9A 1VOMA 4J7TA 1TWAA 4NTFA 5DQTA 3DJNB 2XLWA 1H6GA 2M4EA 1JPJA 2WZFA 1ORYA 4IJJA 3GWNA 2QY9A 3AG4C 1G8XA 3N24A 5F5HA 2PX3A 1ZVZA 2YKZA 3K1IC 2AWYA 4MVZA 4P9TA 4QI2A 3K6BA 2HMZA 4AX2A 5BQHA 3M4BA 2EPNA 3Q6NA 5DS5A 4O7GA 4FAPB 2VC9A 5L0DA 1M2VA 1Q0KA 1VK5A 2WB7A 3JRMO 3X1OA 1D0YA 2EPMX 3NMJA 5D91A 3A9CA 3WODF 4YT8A 4ULWA 3HKKA 1AVOB 1TFOB 2PBEA 2R25A 2YZSA 2Q7RA 4QDLA 4YL3A 5L0IA 2Q4FA 1FMWA 3JTLO 2IXPA 4D4XA 4XLPF 4KNVA 4I1OB 3EGXA 2CDQA 4G7OF 2YHSA 1PCXA 3EGDB 4IB4A 2LCHA 3EJNA 3F46A 3VYWA 1E84A 1OKKD 2LIGA 1GGQA 2XM4A 4WGZA 4YWQA 2JX0A 1A7VA 3B0VC 3POVA 1GM5A 2XLOA 1V4AA 2OOCA 3NMKA 4EBJA 4JCZA 3M15A 3US6A 5B3IA 1D1BA 1Q0DA 5FCLA 3ABMC 1FAPB 2LFFA 3O6XA 1M57C 2YLGA 3AG2C 3OWTA 3ZWIA 4MVUA 1YVIA 4A4AA 1NZEA 2L6HA 5IY5C 1ZHXA 3HNKA 1AUEA 2MHRA 3F47A 2NSGA 3BEHA 3LJBA 2R7RA 4C7OA 2PF4E 2YVKA 2HJ3A 3B0PA 3B9QA 3NG1A 3WG7C 2UUHA 3RQFA 2WVOA 3TD7A 1BR2A 1NG1A 4MVSA 2IXNA 3JSEO 1V74B 4BPMA 1Y4CA 4Z9HA 2NUPA 4Z9JA 4OIPF 4HFFB 3TOMA 1BR1A 1UFBA 2RD9A 5A6JA 1QVXA 2LK4A 3RVYA 1JMWA 3IQ6A 2XRHA 2H7OA 3DD7A 1HE1A 1D1CA 4I3MA 2J9BA 4LDKA 4A2NB 2OJED 3ABLC 2J0WA 2IXOA 4JRZA 4BJ1A 1MNEA 3RKOF 2R7VA 4BJ6C 1RKEA 3LS0A 2Y3HA 4P6IC 3H65A 4JEBA 4GQHA 2PX0A 1L7CA 1VMAA 256BA 1M56C 1OR3A 1WOLA 2EILC 3CEXA 3EFOB 3L1MA 4N6CA 4JIOA 5KYUB 2P1AA 3I4UA 4O79A 1C02A 1WTYA 2XLHA 4Q5SF 2ZD9A 2Q9AA 2C04A 2CNWD 2DYSC 2PP4A 1YLMA 4K7BA 4LLCA 2GA0A 4XQ1A 3B29A 3RW0A 3Q6MA 4DBQA 3QMKA 5JUAA 2IXMA 4YT5A 4BJ5C 3MX3A 4EKWA 2W45A 2O9XA 2OCCC 1T01A 2VCCA 3Q7GA 1TR2A 3QTHA 1Q0MA 4OINF 2X0CA 3DWWA 3GWLA 1FR0A 1R5ID 4PR9A 4CSAA 2NG1A 3TOLA 2AWCA 4XEFA 3DAGA 5E2QA 3SNHA 2V26A 2V3CC 2HJMA 4JC7A 3JYYA 1FFHA 2F22A 1EI7A 1ZYRF 1LE2A 2FAPB 2Q3TA 3VRCA 1ZW3A 4K1OA 4E7ZA 2R7QA 1I4ZA 2ZXPA 2VCBA
chains in the Genus database with same CATH topology
4NC3A 2YL3A 3QVYA 3QVZA 4CX9A 2XLWA 3ZTMA 4CDYA 3QW1A 4IAQA 5JRAA 3ZQVA 2XLDA 4CDAA 4IARA 2YKZA 1M6TA 2CCYA 3M4BA 3QW0A 3M4CA 4ULVA 4WGYA 3NMJA 3HNIA 2J8WA 5AGFA 1E86A 4CIPA 1CGNA 4D4XA 5JP7A 4IB4A 2XLMA 5JVEA 3IQ5A 1E84A 1GQAA 4JEAA 2XM4A 4WGZA 4U9DA 1E85A 1A7VA 4CJGA 1EKYA 2XLOA 5JSLA 3NMKA 3M15A 3HNLA 5B3IA 3FOOA 1RCPA 1YYXA 2YLGA 3ZWIA 1CGOA 4CDVA 1YZCA 4CJOA 1YZAA 3HNKA 2XL8A 1LM3B 4JE9A 1CPQA 3TOMA 4D4NA 1MQVA 3IQ6A 3NMIA 1JAFA 2J9BA 2XLEA 4U9EA 1NBBA 1E83A 2XLVA 2XM0A 1YYJA 4JEBA 2YL7A 2BC5A 1BBHA 256BA 2XL6A 3C62A 4N4WA 3L1MA 4N6HA 2YLDA 2XLHA 3ZTZA 5JUAA 1CPRA 1APCA 2YL0A 3M79A 4JKVA 4EIYA 3HNJA 5JT4A 1S05A 4ER9A 3TOLA 3DE8A 3U8PA 3DE9A 5JLIA 1QQ3A 3FOPA 4L6RA 2QLAA 3C63A 5JS5A 3ZQYA 2YL1A 1QPUA 3VRCA 2YLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC3 A;  2YL3 A;  3QVY A;  3QVZ A;  4CX9 A;  2XLW A;  3ZTM A;  4CDY A;  3QW1 A;  4IAQ A;  5JRA A;  3ZQV A;  2XLD A;  4CDA A;  4IAR A;  2YKZ A;  1M6T A;  2CCY A;  3M4B A;  3QW0 A;  3M4C A;  4ULV A;  4WGY A;  3NMJ A;  3HNI A;  2J8W A;  5AGF A;  1E86 A;  4CIP A;  1CGN A;  4D4X A;  5JP7 A;  4IB4 A;  2XLM A;  5JVE A;  3IQ5 A;  1E84 A;  1GQA A;  4JEA A;  2XM4 A;  4WGZ A;  4U9D A;  1E85 A;  1A7V A;  4CJG A;  1EKY A;  2XLO A;  5JSL A;  3NMK A;  3M15 A;  3HNL A;  5B3I A;  3FOO A;  1RCP A;  1YYX A;  2YLG A;  3ZWI A;  1CGO A;  4CDV A;  1YZC A;  4CJO A;  1YZA A;  3HNK A;  2XL8 A;  1LM3 B;  4JE9 A;  1CPQ A;  3TOM A;  4D4N A;  1MQV A;  3IQ6 A;  3NMI A;  1JAF A;  2J9B A;  2XLE A;  4U9E A;  1NBB A;  1E83 A;  2XLV A;  2XM0 A;  1YYJ A;  4JEB A;  2YL7 A;  2BC5 A;  1BBH A;  256B A;  2XL6 A;  3C62 A;  4N4W A;  3L1M A;  4N6H A;  2YLD A;  2XLH A;  3ZTZ A;  5JUA A;  1CPR A;  1APC A;  2YL0 A;  3M79 A;  4JKV A;  4EIY A;  3HNJ A;  5JT4 A;  1S05 A;  4ER9 A;  3TOL A;  3DE8 A;  3U8P A;  3DE9 A;  5JLI A;  1QQ3 A;  3FOP A;  4L6R A;  2QLA A;  3C63 A;  5JS5 A;  3ZQY A;  2YL1 A;  1QPU A;  3VRC A;  2YLI A; 
#chains in the Genus database with same CATH topology
 3I5Q A;  4DRI B;  4NC3 A;  2QNL A;  4DVZ A;  1EA8 A;  2NUT B;  3EG9 A;  4JTC B;  3S84 A;  3PMR A;  3GEI A;  1H9G A;  1MMG A;  2JD3 A;  3DJU B;  4MTO A;  1Z7Q c;  1I4Y A;  4JUR I;  4PK4 A;  4U5D E;  1FNT c;  4C3B A;  2LFD A;  1K04 A;  1A7E A;  1JR8 A;  3ZTM A;  4F4B A;  3TQO A;  4CDY A;  1FTS A;  3MFN A;  2OEX A;  4IAQ A;  1TWG A;  1NSG B;  3GOR A;  1J8Y F;  3JT1 A;  4HFK B;  2HV6 A;  3PHF 2;  1OXB A;  4BEM J;  2AP3 A;  4CBE A;  3UMI A;  2ZXR A;  2VB6 A;  1G4U S;  1M6T A;  2CCY A;  4PJN A;  1WWP A;  3U5S A;  5HV9 A;  2EPO A;  1D1A A;  1I5N A;  1HE9 A;  1ZW2 A;  3FAP B;  3CSK A;  3NKE A;  4ULV A;  5F5F A;  3JCU Q;  2ICW G;  4FWV A;  1MMA A;  1PD1 A;  2ETS A;  4XPX A;  4FES A;  5T1D B;  4MS2 A;  1TFK B;  2J8W A;  3EPV A;  1NU7 D;  1VYK A;  4MND A;  4N06 A;  1H9T A;  2L81 A;  2HZ8 A;  1SF8 A;  3NKD A;  3U2M A;  4C3E A;  3A11 A;  1ZU5 A;  1RXQ A;  5BUO A;  5KYW A;  3RIP A;  3DXJ F;  2W9Y A;  2P61 A;  4IRU A;  5B3S C;  2Q9B A;  1B68 A;  5JVE A;  2KW3 C;  1LPE A;  4PJJ A;  4B6I A;  4MVO A;  3FHD A;  3S28 A;  2GAQ A;  1E85 A;  1ZU4 A;  1EKY A;  3ABK C;  2J9W A;  4YL1 A;  5JSL A;  3WHN A;  4YJW A;  5DS6 A;  3U8V A;  3G4Z A;  3HNL A;  4HE8 D;  4CS8 A;  3VAY A;  3T6G B;  1M2V B;  2TMV P;  1TKN A;  2GDC A;  1O5H A;  2A0B A;  2EIK C;  3NRH A;  1YZA A;  4CJO A;  2A6E F;  2VAS A;  4CS9 C;  3SYN A;  2YRF A;  4LDR A;  4KBL A;  4YK5 A;  3VF0 A;  2HSQ A;  5A6B A;  1LS1 A;  2Q9C A;  4IAO A;  5E3A A;  1MMN A;  3KYI A;  2Y69 C;  4DRH B;  3LUT B;  1QSP A;  4AE4 A;  2R7W A;  3EGX B;  3MLG A;  1WGW A;  4EWC A;  4O6Y A;  3BRJ A;  4Z9I A;  1T6I A;  1TWC A;  1J8M F;  2HUJ A;  3EH2 A;  4U5B E;  5COM A;  4JE9 A;  4RD9 A;  1U0B B;  3HTK C;  5EK0 A;  4HEA J;  1ST6 A;  3L8J A;  2Y3B A;  3CZ6 A;  5AC4 A;  1T6U A;  2A1D D;  1ORJ A;  2KNH A;  1A7D A;  1XWJ A;  4E18 A;  2ZXO A;  1E83 A;  3L0I A;  3GAN A;  3N2Z B;  2KGO A;  3ZDL A;  3FDQ A;  4KI2 A;  1ZHZ A;  2QE9 A;  1WAS A;  1Z3I X;  5L0C A;  4MQ9 F;  4G78 A;  4YN0 B;  2OEV A;  2R7O A;  3UGP A;  4C7O B;  2HS5 A;  1T6Q A;  3AJM A;  1BBH A;  2Q00 A;  2XL6 A;  3C62 A;  2J7P D;  3R2P A;  1OR2 A;  4PFP A;  5EHH A;  4UDV A;  1OW7 A;  4N6H A;  2P0N A;  4EBB A;  2YLD A;  1BZ4 A;  5L3V A;  3V7O A;  2NUP B;  1QLE C;  4G7Z F;  3NDB B;  3ZTZ A;  1ORS C;  3G4X A;  1HW2 A;  3DM9 B;  3E9V A;  3KPH A;  3U2L A;  3DKA A;  4Q4Z F;  2PFD A;  2G3K A;  3DI5 A;  3EGD A;  1CPR A;  1APC A;  1E2X A;  4JKV A;  3I5P A;  3GM2 A;  1U6H A;  2I15 A;  3NYJ A;  3RF3 A;  1T5O A;  3L34 A;  5JT4 A;  3IEE A;  1BDJ B;  3C8G A;  2L6G A;  3S9O A;  3DE8 A;  3EHM A;  5KYN A;  4AL0 A;  1SYQ A;  3T6J A;  3DE9 A;  3JRT A;  3N0T A;  3W8I A;  3RYL A;  2R03 A;  5K0I A;  2AVK A;  2KQ9 A;  1WN0 A;  4JTA B;  3CQZ A;  1VLT A;  1YJG A;  3UNG C;  5DS4 A;  3J06 A;  2YL1 A;  2H7B A;  3MYF A;  2P7V A;  3AG1 C;  1M2O A;  5CIV A;  5KYX B;  2OKU A;  2HKV A;  3H2U A;  3ZG1 A;  1RJ9 A;  2YEV A;  4XTK A;  3SXZ A;  4J32 B;  4CS7 A;  1R4T A;  3EHN A;  3X2Q C;  3DM5 A;  4XEK A;  3SXY A;  3KMI A;  1FFT C;  3B71 A;  1YA7 O;  2CYD A;  5COG A;  3S90 A;  2ZPA A;  1LS4 A;  1HMD A;  4DJ9 A;  4XEV A;  1Y6D A;  3LNM B;  1LIH A;  3QW1 A;  1VYI A;  5L0G A;  5T3T A;  3AOU A;  2BL2 A;  1IZM A;  2OG2 A;  4I1M A;  3ZQV A;  1L3P A;  3LS1 A;  2XLD A;  4JVS A;  1V54 C;  4U5G A;  1Z5Z A;  1Z23 A;  3FMS A;  4CDA A;  4DXW A;  4ZLD A;  1TWH A;  3LNR A;  4MVM A;  4IGG A;  3QW0 A;  5B1B C;  2JPU A;  3M4C A;  1BR4 A;  1NFO A;  1CGM E;  4G7H F;  3LEO A;  4X0R A;  3KKB A;  2L9J A;  2R05 A;  2XL4 A;  4GEH A;  2A69 F;  5AGF A;  3EG9 B;  2VCA A;  2GFH A;  2J7P A;  2Y3G A;  3HJC A;  1MMD A;  2W4B A;  3EFO A;  4YL0 A;  4CIP A;  1CGN A;  2AU5 A;  2NPU A;  3FXH A;  2Z15 A;  4LAC B;  4O6M A;  2LD6 A;  4MVR A;  3U0C A;  2L7A A;  3ASO C;  2YQY A;  2WVQ A;  2W4M A;  5AC5 A;  2VH3 A;  5HSW A;  3IQ5 A;  4EHP A;  5L3Q A;  1GQA A;  4E0I A;  4EUK B;  4LER A;  1JRA A;  4WAB A;  3IHU A;  4W8P A;  4XPW A;  3SEO A;  5L0J A;  2WL8 A;  4PJL A;  1RCP A;  4EBK A;  1D0Z A;  3SXK A;  5E3C A;  1YZC A;  4CDV A;  4CSA C;  5TJ5 E;  4QI0 A;  1ZHT A;  2J46 A;  2CGE A;  3TJ5 A;  1KU2 A;  4I44 A;  4JJG A;  4JCH A;  1OCO C;  3KYJ A;  4MW3 A;  3EZI A;  5COF A;  3GM3 A;  1E86 A;  1KTM A;  3WAQ A;  5A6A A;  1V55 C;  4ANJ A;  1CPQ A;  1ZHW A;  1XZP A;  3PDM P;  4WJ0 A;  3K1I A;  3KH2 A;  4D4N A;  4OD5 A;  2OU6 A;  4H4K C;  2Y3D A;  1HW1 A;  1ZZP A;  3K33 A;  2P6V A;  2BE5 F;  4J7Y A;  5D92 A;  1C03 A;  4DBR A;  2HSB A;  3C8G D;  2XLE A;  3SXM A;  1NBB A;  1Q0G A;  3K1H A;  2XLV A;  2KJG A;  4NY3 A;  1RMV A;  1H7I A;  1YYJ A;  1OXK A;  2C03 A;  4NCQ A;  2BC5 A;  4OIR F;  3OA1 A;  2H8A A;  1SZI A;  4DVY P;  1DOV A;  3DMD A;  4AE4 B;  2KC3 A;  3T4R A;  1EQ1 A;  5A6B D;  3C8Z A;  5KYY A;  4U5C E;  4BEJ A;  2J9V A;  2XXA A;  1MND A;  3W2V A;  2PNO A;  4KC9 A;  4K0D A;  5L0H A;  3CAX A;  1JPN A;  2MYS A;  4BG0 A;  1O87 A;  4E17 A;  2D4U A;  3M79 A;  1LE4 A;  4EIY A;  3HNJ A;  2L6F A;  3MYI A;  2KSF A;  4NTA A;  1DOW A;  4ER9 A;  5L0F A;  3U8P A;  1U89 A;  4JW1 A;  4Q7C A;  4MVQ A;  3FOP A;  2DYR C;  3DZA A;  4L6R A;  3V5Y A;  1T9K A;  2XS8 A;  4AK9 A;  2B0H A;  3U3B A;  3U9J A;  4R32 A;  2ASR A;  3ZQY A;  4O6N A;  1Z6A A;  3S27 A;  1QPU A;  1YDI A;  4CS8 C;  2Y39 A;  4PJM A;  3T6B A;  1KNY A;  2YLI A;  3PCV A;  1LVK A;  3O10 A;  3VM6 A;  2YL3 A;  4MTF A;  5FZT A;  1VB5 A;  2IBF A;  3QVY A;  4P9F A;  3TK0 A;  3W2W A;  5BQI A;  4E7S A;  2GWW A;  2WVN A;  3EQL F;  2QUP A;  3RQE A;  4XPY A;  3U9M A;  2IYL D;  3AGT A;  3C8G B;  1QKR A;  5DQZ A;  4BJ6 A;  3HLZ A;  3H2V A;  3C18 A;  2UUI A;  1Q0F A;  3LEV A;  5JRA A;  1D0X A;  2J0X A;  4U5H A;  1XZQ A;  4AL1 A;  2IM8 A;  2LP4 A;  1C17 M;  1G5Z A;  4IAR A;  3IQC A;  3ITF A;  3TUL A;  1RKE B;  3UMH A;  1LI5 A;  1W2W A;  1OW8 A;  4PFO A;  1OCC C;  3FAJ A;  2R7X A;  3EZH A;  2B0J A;  4WGY A;  3JYH A;  4M63 A;  4OIQ F;  1NU9 C;  3ZC4 A;  4FX5 A;  1RJ9 B;  3HNI A;  1G4W R;  4GYT A;  4BJ5 A;  1N1C A;  1YAU O;  5A69 A;  3NYM A;  2XS1 A;  1A0B A;  4XWJ A;  4CIH A;  1GS9 A;  1VLS A;  4E0H A;  3S0X A;  3GM1 A;  5F28 E;  3RVZ A;  5GPG B;  2MWQ A;  3UMK A;  5CI9 A;  1ZHY A;  4KNW A;  5JP7 A;  1HY5 A;  3ZIB A;  1NLX A;  3K7D A;  2DB4 A;  2XLM A;  5BQG A;  3TJ6 A;  4G0H A;  3S29 A;  2WZL A;  3JZ0 A;  2H7V C;  4JEA A;  3T9O A;  4W8K A;  4U9D A;  2J9U A;  4CJG A;  3OEO A;  2E87 A;  2EIM C;  3G50 A;  2OQM A;  1F1M A;  2DGJ A;  4RDA A;  3IQT A;  4RBN A;  3FOO A;  1YYX A;  1S7Z A;  1K05 A;  2HFI A;  4DOZ A;  1CGO A;  2WZG A;  3AQB A;  3V5Z A;  3JSZ A;  4ZLC A;  2KK1 A;  3LES A;  3SZR A;  3KL4 A;  3UR3 C;  2X51 A;  2G62 A;  1OQC A;  3ASN C;  3FVY A;  5KYX A;  1VTM P;  2XL8 A;  3B0U X;  2EPL X;  1UG7 A;  1LM3 B;  3ATP A;  5KYU A;  4IWB A;  3MBG A;  2A0U A;  2DI3 A;  3O55 A;  3Q7L A;  4NTB A;  1YAR O;  5DLJ A;  3C7J A;  4BJT A;  1Z63 A;  3O39 A;  4JJF A;  3NYL A;  4YT2 A;  1OKK A;  2ZXW C;  1AEP A;  3AQC A;  2R7T A;  1MQV A;  2LSE A;  3EH1 A;  3NMI A;  1K40 A;  1JAF A;  4LLE A;  1OW6 A;  3K66 A;  1A41 A;  3W8H A;  4LDQ A;  4MW8 A;  2CW0 F;  4J30 B;  2A68 F;  2KYH A;  4NQF A;  3E70 C;  4ONS A;  2G3V A;  4U9E A;  4JZA A;  3R7C A;  5A6K A;  2M64 A;  3GOD A;  3LLI A;  4OD4 A;  3RQG A;  2XM0 A;  1O3U A;  3RFY A;  3L8I A;  3SP1 A;  4U5E E;  2YL7 A;  1QZX A;  2R7U A;  2FGY A;  4JTD B;  4N4W A;  2YWA A;  1TQG A;  1RKC A;  1NFN A;  3GEE A;  3QZC A;  3ZSU A;  5KYW B;  2R02 A;  5CI8 A;  4XLN F;  3U3F A;  2NUT A;  3RH3 A;  5EGY A;  2LQG A;  1FMV A;  3M1C B;  1SR2 A;  5B1A C;  1OCR C;  2YL0 A;  5T3W A;  2NSF A;  2FFH A;  2EIN C;  1HMO A;  1LI7 A;  1S05 A;  1WAT A;  2I8B A;  2HV7 A;  2J45 A;  2OJQ A;  5E33 A;  3V5X A;  4CS9 A;  1SMY F;  4MTG A;  3LLK A;  2A6H F;  5JLI A;  4H54 A;  4PAC A;  1QQ3 A;  2R7S A;  1YA9 A;  2QLA A;  2D5R B;  2QTV A;  3AG3 C;  3GEH A;  4C3D A;  4DRJ B;  4YT4 A;  1PV3 A;  3ECS A;  1PD0 A;  1LKX A;  1IW7 F;  3C63 A;  3LAY A;  5DVW A;  5JS5 A;  4OIO F;  1OCZ C;  3DAF A;  3IPM O;  3ZVR A;  5KYY B;  2EPK X;  4U5F E;  3UGO A;  2EIJ C;  3AGU A;  2XXA B;  3W4Y A;  2CNW A;  2R9R B;  2HMQ A;  1JOG A;  2IOQ A;  2XSE A;  3QVZ A;  2RSE B;  4CX9 A;  1VOM A;  4J7T A;  1TWA A;  4NTF A;  5DQT A;  3DJN B;  2XLW A;  1H6G A;  2M4E A;  1JPJ A;  2WZF A;  1ORY A;  4IJJ A;  3GWN A;  2QY9 A;  3AG4 C;  1G8X A;  3N24 A;  5F5H A;  2PX3 A;  1ZVZ A;  2YKZ A;  3K1I C;  2AWY A;  4MVZ A;  4P9T A;  4QI2 A;  3K6B A;  2HMZ A;  4AX2 A;  5BQH A;  3M4B A;  2EPN A;  3Q6N A;  5DS5 A;  4O7G A;  4FAP B;  2VC9 A;  5L0D A;  1M2V A;  1Q0K A;  1VK5 A;  2WB7 A;  3JRM O;  3X1O A;  1D0Y A;  2EPM X;  3NMJ A;  5D91 A;  3A9C A;  3WOD F;  4YT8 A;  4ULW A;  3HKK A;  1AVO B;  1TFO B;  2PBE A;  2R25 A;  2YZS A;  2Q7R A;  4QDL A;  4YL3 A;  5L0I A;  2Q4F A;  1FMW A;  3JTL O;  2IXP A;  4D4X A;  4XLP F;  4KNV A;  4I1O B;  3EGX A;  2CDQ A;  4G7O F;  2YHS A;  1PCX A;  3EGD B;  4IB4 A;  2LCH A;  3EJN A;  3F46 A;  3VYW A;  1E84 A;  1OKK D;  2LIG A;  1GGQ A;  2XM4 A;  4WGZ A;  4YWQ A;  2JX0 A;  1A7V A;  3B0V C;  3POV A;  1GM5 A;  2XLO A;  1V4A A;  2OOC A;  3NMK A;  4EBJ A;  4JCZ A;  3M15 A;  3US6 A;  5B3I A;  1D1B A;  1Q0D A;  5FCL A;  3ABM C;  1FAP B;  2LFF A;  3O6X A;  1M57 C;  2YLG A;  3AG2 C;  3OWT A;  3ZWI A;  4MVU A;  1YVI A;  4A4A A;  1NZE A;  2L6H A;  5IY5 C;  1ZHX A;  3HNK A;  1AUE A;  2MHR A;  3F47 A;  2NSG A;  3BEH A;  3LJB A;  2R7R A;  4C7O A;  2PF4 E;  2YVK A;  2HJ3 A;  3B0P A;  3B9Q A;  3NG1 A;  3WG7 C;  2UUH A;  3RQF A;  2WVO A;  3TD7 A;  1BR2 A;  1NG1 A;  4MVS A;  2IXN A;  3JSE O;  1V74 B;  4BPM A;  1Y4C A;  4Z9H A;  2NUP A;  4Z9J A;  4OIP F;  4HFF B;  3TOM A;  1BR1 A;  1UFB A;  2RD9 A;  5A6J A;  1QVX A;  2LK4 A;  3RVY A;  1JMW A;  3IQ6 A;  2XRH A;  2H7O A;  3DD7 A;  1HE1 A;  1D1C A;  4I3M A;  2J9B A;  4LDK A;  4A2N B;  2OJE D;  3ABL C;  2J0W A;  2IXO A;  4JRZ A;  4BJ1 A;  1MNE A;  3RKO F;  2R7V A;  4BJ6 C;  1RKE A;  3LS0 A;  2Y3H A;  4P6I C;  3H65 A;  4JEB A;  4GQH A;  2PX0 A;  1L7C A;  1VMA A;  256B A;  1M56 C;  1OR3 A;  1WOL A;  2EIL C;  3CEX A;  3EFO B;  3L1M A;  4N6C A;  4JIO A;  5KYU B;  2P1A A;  3I4U A;  4O79 A;  1C02 A;  1WTY A;  2XLH A;  4Q5S F;  2ZD9 A;  2Q9A A;  2C04 A;  2CNW D;  2DYS C;  2PP4 A;  1YLM A;  4K7B A;  4LLC A;  2GA0 A;  4XQ1 A;  3B29 A;  3RW0 A;  3Q6M A;  4DBQ A;  3QMK A;  5JUA A;  2IXM A;  4YT5 A;  4BJ5 C;  3MX3 A;  4EKW A;  2W45 A;  2O9X A;  2OCC C;  1T01 A;  2VCC A;  3Q7G A;  1TR2 A;  3QTH A;  1Q0M A;  4OIN F;  2X0C A;  3DWW A;  3GWL A;  1FR0 A;  1R5I D;  4PR9 A;  4CSA A;  2NG1 A;  3TOL A;  2AWC A;  4XEF A;  3DAG A;  5E2Q A;  3SNH A;  2V26 A;  2V3C C;  2HJM A;  4JC7 A;  3JYY A;  1FFH A;  2F22 A;  1EI7 A;  1ZYR F;  1LE2 A;  2FAP B;  2Q3T A;  3VRC A;  1ZW3 A;  4K1O A;  4E7Z A;  2R7Q A;  1I4Z A;  2ZXP A;  2VCB A; 
#chains in the Genus database with same CATH homology
 4NC3 A;  2YL3 A;  3QVY A;  3QVZ A;  4CX9 A;  2XLW A;  3ZTM A;  4CDY A;  3QW1 A;  4IAQ A;  5JRA A;  3ZQV A;  2XLD A;  4CDA A;  4IAR A;  2YKZ A;  1M6T A;  2CCY A;  3M4B A;  3QW0 A;  3M4C A;  4ULV A;  4WGY A;  3NMJ A;  3HNI A;  2J8W A;  5AGF A;  1E86 A;  4CIP A;  1CGN A;  4D4X A;  5JP7 A;  4IB4 A;  2XLM A;  5JVE A;  3IQ5 A;  1E84 A;  1GQA A;  4JEA A;  2XM4 A;  4WGZ A;  4U9D A;  1E85 A;  1A7V A;  4CJG A;  1EKY A;  2XLO A;  5JSL A;  3NMK A;  3M15 A;  3HNL A;  5B3I A;  3FOO A;  1RCP A;  1YYX A;  2YLG A;  3ZWI A;  1CGO A;  4CDV A;  1YZC A;  4CJO A;  1YZA A;  3HNK A;  2XL8 A;  1LM3 B;  4JE9 A;  1CPQ A;  3TOM A;  4D4N A;  1MQV A;  3IQ6 A;  3NMI A;  1JAF A;  2J9B A;  2XLE A;  4U9E A;  1NBB A;  1E83 A;  2XLV A;  2XM0 A;  1YYJ A;  4JEB A;  2YL7 A;  2BC5 A;  1BBH A;  256B A;  2XL6 A;  3C62 A;  4N4W A;  3L1M A;  4N6H A;  2YLD A;  2XLH A;  3ZTZ A;  5JUA A;  1CPR A;  1APC A;  2YL0 A;  3M79 A;  4JKV A;  4EIY A;  3HNJ A;  5JT4 A;  1S05 A;  4ER9 A;  3TOL A;  3DE8 A;  3U8P A;  3DE9 A;  5JLI A;  1QQ3 A;  3FOP A;  4L6R A;  2QLA A;  3C63 A;  5JS5 A;  3ZQY A;  2YL1 A;  1QPU A;  3VRC A;  2YLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...