2XLDA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124q variant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 47
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xldA00
4CJOA 3M15A 3FOOA 2XL6A 4CX9A 4CDYA 3IQ6A 2XLVA 4WGYA 4CJGA 2YL7A 4D4NA 5JS5A 2YLDA 4ULVA 2QLAA 2CCYA 4CDVA 2YKZA 2J8WA 3VRCA 4U9DA 3ZTMA 3HNJA 1MQVA 1E86A 3QW1A 1YZAA 1CGOA 3C62A 4U9EA 2YLIA 2XLEA 3M4BA 3ZTZA 2XM4A 1E84A 1GQAA 3QW0A 3ZQYA 5JRAA 1QQ3A 3ZQVA 3NMJA 1CPQA 1YYJA 5JP7A 2BC5A 4CIPA 1A7VA 256BA 1CPRA 3M79A 3HNLA 4IAQA 3HNKA 1QPUA 3L1MA 1YZCA 3TOLA 5JUAA 3DE8A 2J9BA 3QVZA 1M6TA 1CGNA 2XLHA 4WGZA 3HNIA 3IQ5A 2XLOA 1E83A 2YLGA 5JLIA 2XM0A 3C63A 5JVEA 4N4WA 5B3IA 3QVYA 3NMIA 3ZWIA 4JEBA 4D4XA 4JE9A 2YL0A 1NBBA 1S05A 3NMKA 2XLMA 4JEAA 3TOMA 5JT4A 4JKVA 4EIYA 5AGFA 1EKYA 4L6RA 2XLDA 1BBHA 1YYXA 4CDAA 1E85A 3U8PA 1LM3B 4IB4A 2YL3A 2XLWA 3FOPA 4IARA 4ER9A 2YL1A 1RCPA 4N6HA 4NC3A 3M4CA 5JSLA 3DE9A 1JAFA 1APCA 2XL8A
chains in the Genus database with same CATH superfamily
4Z9JA 3SXKA 3WAQA 1ZHZA 4PJJA 4J7TA 2L6GA 4LLCA 2VC9A 1YLMA 2J9VA 4BEMJ 1OKKA 4YT2A 4FAPB 5KYYB 2KJGA 3BRJA 4JCZA 3B0VC 4EBKA 1LPEA 2W9YA 4WGYA 3DMDA 2VASA 2OEVA 2AP3A 3V7OA 4DRHB 3UGOA 3HJCA 2YLDA 4ULVA 1FMWA 1OW6A 2J45A 3AGTA 1RJ9B 3B71A 4PJLA 5E2QA 3C7JA 3U3BA 2J8WA 2I15A 3K1IA 2YEVA 4U9DA 2NG1A 3KKBA 3GEEA 3VRCA 3W4YA 1G8XA 2OKUA 4W8PA 1N1CA 4YT8A 1FAPB 1JPNA 1YZAA 4I1OB 4P9FA 1VMAA 2PP4A 4RBNA 3W8HA 3ZVRA 5KYUA 4XWJA 4DBRA 4OIQF 2A0BA 3C62A 4N06A 4HE8D 2YLIA 1Q0DA 1AEPA 1IW7F 3LLKA 4CBEA 4D4NA 5KYWB 3DAFA 1DOWA 2IOQA 2XM4A 1Q0MA 1LI5A 1OQCA 1VOMA 1SMYF 5K0IA 3T6GB 4U5EE 1A0BA 2OQMA 2FGYA 1M56C 1Z3IX 3CSKA 3FVYA 3LJBA 1MMDA 4J30B 3NMJA 4XQ1A 5BQHA 1V54C 3FAPB 1FNTc 3KH2A 4XPWA 3T6BA 4JJGA 2CNWD 1M2OA 2KC3A 3V5YA 2ZPAA 1NU7D 4EBBA 1FMVA 4CS9A 1LIHA 2H7OA 1OR3A 2FFHA 256BA 1V74B 2J46A 4GEHA 4JZAA 3U9JA 2OU6A 5A6JA 1IZMA 2ETSA 3IPMO 1OXKA 1YJGA 3JT1A 3LEOA 2LSEA 2HV7A 4H54A 3T9OA 1B68A 4PACA 4G0HA 2LIGA 4QI2A 4YK5A 4HFFB 4HEAJ 3Q7GA 4EKWA 2D4UA 2Q3TA 4AE4B 4PJNA 3CAXA 5DS4A 1ZHXA 2LP4A 3T4RA 2FAPB 3RF3A 1RKEA 4OD5A 4OIPF 5BQIA 3G4XA 1M6TA 2KYHA 3EGXB 5EGYA 2XLHA 4JVSA 2HFIA 4EWCA 3HNIA 4I1MA 4BPMA 1JR8A 1Z23A 4IAOA 5B1BC 3TJ5A 4O6YA 5L0JA 1ZHTA 2XM0A 1WASA 2UUIA 1VLSA 4N4WA 3FHDA 3QVYA 4WJ0A 1TFOB 1UFBA 2A6HF 3NMIA 3OA1A 1D1BA 2A0UA 2AWYA 4KNVA 2A68F 2OEXA 2RSEB 2QNLA 2YL0A 3IHUA 2I8BA 1YAUO 2H8AA 3K6BA 4FWVA 1NBBA 3NMKA 2L6FA 3O10A 3GEIA 2YQYA 3FAJA 1XZQA 1YA9A 2BE5F 4KI2A 2CGEA 3NKDA 3ASOC 2MWQA 4MTFA 1WWPA 5B3SC 1EKYA 3WG7C 3U2MA 2XLDA 3RFYA 4EBJA 3SXYA 4PJMA 3U8VA 4UDVA 2R7UA 1V55C 2AWCA 3FDQA 2LK4A 4RDAA 4PK4A 4XEFA 1LM3B 4GYTA 1ZVZA 1FFTC 3ZSUA 1HW1A 4DVYP 4XEKA 3FOPA 4JW1A 2L81A 4E17A 5B1AC 4I3MA 2WB7A 3U0CA 1QSPA 1NFOA 1V4AA 2ICWG 2IYLD 1ZU5A 4U5CE 3NG1A 1LI7A 3DE9A 4C3BA 3C18A 1TQGA 3B29A 2R03A 1BZ4A 4N6CA 4BJ1A 3I5PA 3DJUB 1K40A 4NTBA 3RVYA 4DXWA 1OCCC 3V5XA 3C8GA 2J0XA 4U5HA 2HZ8A 1LKXA 3VYWA 1YARO 5E33A 1CGME 2PBEA 3JTLO 4CJGA 1RKEB 5CI8A 3E9VA 1HW2A 3NDBB 2P6VA 3UMIA 2WZFA 1PV3A 4U5DE 4CDVA 2W4MA 2YKZA 5L0IA 4XLPF 2YWAA 3HNJA 4G7ZF 4XPYA 2J0WA 1MQVA 2G3KA 2IXNA 2Z15A 3QW1A 4Q7CA 1E86A 3L8IA 5L0CA 3DZAA 4BJ5A 3ZC4A 3SP1A 1U89A 4BJTA 3ASNC 1FTSA 2L9JA 2LD6A 5DVWA 2NUTA 2ZXPA 2NUPB 1E84A 2CW0F 1Q0KA 3Q6MA 1L3PA 5JRAA 5CIVA 2A69F 4K7BA 3EPVA 1TWGA 2R7WA 2UUHA 3S90A 1QQ3A 2OJQA 3ZQVA 4EHPA 3VF0A 1U0BB 1VK5A 1BR4A 1NG1A 4C7OA 1XWJA 2XXAA 1E2XA 2G3VA 2GDCA 3N24A 3NYLA 4CIPA 2BL2A 2B0HA 1CPRA 1JPJA 1W2WA 3IEEA 1GS9A 4IAQA 3A9CA 3HNKA 1O3UA 3X2QC 4CS7A 2Q00A 4I44A 5DQTA 3EZHA 1WATA 4AX2A 3LNMB 2NSGA 3LEVA 4K1OA 4J32B 3I4UA 4JURI 4YJWA 2F22A 2EPLX 3LS1A 4DRIB 1T5OA 2PX3A 3C8ZA 1QPUA 4XTKA 3TQOA 2GA0A 3TOLA 3GEHA 3DJNB 4MTGA 2DYRC 1ZYRF 4JCHA 1LS4A 4AL0A 2ZD9A 2G62A 3QVZA 1VTMP 4MVRA 3DXJF 4OD4A 2QUPA 1WN0A 3AG1C 1OR2A 3O6XA 3S0XA 3JRTA 2ZXRA 3JZ0A 4MTOA 1PD1A 2A6EF 2XLOA 2R7RA 1E83A 1ZW2A 3TD7A 3TK0A 1M2VA 5JVEA 3QZCA 5B3IA 1R4TA 1SYQA 1YA7O 2HS5A 2IXPA 2YRFA 4EUKB 3NKEA 2R7TA 3E70C 2J9WA 3AQBA 4LERA 4O6MA 3UMHA 3GORA 2DGJA 5KYYA 1SZIA 3ECSA 2O9XA 2EPKX 1OCRC 1S05A 1OKKD 2M4EA 2XLMA 1RJ9A 3AQCA 4LDQA 3DI5A 3TOMA 3NYMA 4JKVA 4YT5A 2X0CA 5L0GA 2ZXOA 2R7VA 2V26A 2EILC 4JTCB 5AGFA 1ST6A 1TWHA 2R7OA 4XPXA 3RIPA 3AG2C 5L0HA 1MMNA 1YYXA 2HJMA 4MVZA 2RD9A 3LLIA 3GANA 2EIKC 2WZGA 3CQZA 5L0FA 1JOGA 1MNDA 4E0HA 4E7ZA 2L6HA 2A1DD 4G7OF 2YZSA 3LESA 2XLWA 4MS2A 4E18A 2XSEA 2W45A 1HY5A 1U6HA 2YL1A 3KMIA 2R05A 3ABMC 3I5QA 3MX3A 1HE9A 3H65A 3NRHA 4N6HA 4HFKB 3U5SA 4A4AA 5JSLA 1ZU4A 1T6QA 5F5FA 1DOVA 4CSAC 4NCQA 5CI9A 3RQEA 4YWQA 1M2VB 2NSFA 3U2LA 1D0XA 3S28A 2XL6A 4DBQA 4CDYA 2R7XA 1MMAA 3MYFA 2ASRA 5HSWA 3EGDB 3BEHA 1GGQA 4MVMA 1Z5ZA 3M1CB 3MLGA 3S29A 3LAYA 2YL7A 2CNWA 2WVNA 4WABA 1D1CA 1BDJB 2L7AA 3C8GD 1HE1A 1OW8A 3KPHA 2H7BA 4R32A 3WHNA 3ABKC 1UG7A 3AG4C 4IJJA 4U5GA 2QLAA 4H4KC 4JTDB 4YL0A 3ZTMA 3CZ6A 2R02A 5COFA 1Z7Qc 1H6GA 4JRZA 5EK0A 3FMSA 2R7SA 3F47A 3N2ZB 2NPUA 5L3VA 2QTVA 3Q6NA 4NTFA 3Q7LA 4BJ6A 4KNWA 4LACB 4BG0A 2JX0A 1R5ID 1T01A 4QDLA 1QKRA 1K04A 3GODA 3J06A 2OG2A 1ZHWA 2WVQA 4MVQA 5DLJA 2J9UA 3TULA 3T6JA 5FZTA 4XLNF 3QTHA 3SEOA 1WGWA 2Y3GA 2C04A 3A11A 1SF8A 4YL1A 3DM9B 4MNDA 1T6IA 3VAYA 3EHMA 3HLZA 1YYJA 3UGPA 3EG9B 5DS5A 1C02A 1L7CA 1ORSC 1ZHYA 3IQCA 5A6KA 1EA8A 2HMQA 2VB6A 4Z9HA 4Q4ZF 2TMVP 3O39A 3TJ6A 5COMA 1ORJA 1NLXA 2X51A 2EINC 3HNLA 1HMOA 3K1IC 2HMZA 3L8JA 5COGA 5IY5C 3PDMP 1TWAA 4OIOF 3LUTB 5DQZA 1FFHA 2VCBA 2KQ9A 4ULWA 4CS8A 2GAQA 1J8MF 2WVOA 2XS1A 5KYUB 3R2PA 2DB4A 2Y3DA 3EFOA 1Z6AA 4C7OB 5L0DA 2PNOA 2Y3HA 2EIMC 1I5NA 3MYIA 2Q9BA 2YVKA 5EHHA 1TWCA 5KYXB 3H2VA 5JUAA 1EQ1A 1YVIA 2Y69C 1KTMA 3DAGA 2J9BA 4O7GA 2R25A 1H9GA 2YHSA 3NYJA 1HMDA 4WGZA 2QE9A 3RQFA 3IQ5A 4NY3A 5T3TA 2ZXWC 3KL4A 1RXQA 4JC7A 4Q5SF 2YLGA 5A6BA 2Q9CA 4PR9A 3RQGA 2XS8A 4AK9A 4QI0A 4CIHA 2H7VC 3ZWIA 1OW7A 1MNEA 4G78A 4MQ9F 3SNHA 3DKAA 2W4BA 1KU2A 2AVKA 3B0PA 4JE9A 4C3EA 3OWTA 2OOCA 5TJ5E 3KYJA 3S27A 1SR2A 1VYIA 2OJED 3IQTA 1GM5A 1O5HA 4PFPA 3N0TA 4J7YA 4BJ6C 4EIYA 3O55A 3EJNA 4M63A 1Q0FA 1JMWA 1A41A 3EGXA 4RD9A 2IXOA 3W2VA 4L6RA 3GWLA 1Y4CA 1BBHA 2P0NA 2P61A 3AGUA 1WOLA 4OINF 1FR0A 1AUEA 3JRMO 2D5RB 2HV6A 2QY9A 1RMVA 2KNHA 3WODF 5KYNA 4DRJB 3U8PA 1E85A 1D0ZA 1YDIA 2KK1A 2HUJA 2KSFA 2Q7RA 1S7ZA 2YL3A 3UR3C 1T9KA 2Y39A 4ER9A 4XEVA 3MFNA 4A2NB 4ANJA 1RCPA 2LFFA 5FCLA 1LS1A 4NC3A 5KYXA 4YT4A 2Q9AA 2MHRA 2OCCC 3OEOA 1T6UA 4DVZA 4ZLCA 3C8GB 1APCA 2XL8A 4DJ9A 1TFKB 2JPUA 1A7DA 3ZDLA 4CJOA 4O6NA 3B0UX 3M15A 3FOOA 4IWBA 4CX9A 4E7SA 5GPGB 1VLTA 2HSBA 1PD0A 3DM5A 3RKOF 3IQ6A 3RW0A 2IM8A 3H2UA 5F5HA 4LLEA 2XLVA 3W2WA 4YL3A 3EZIA 3ABLC 3U9MA 3UMKA 4W8KA 3HTKC 2R9RB 4AL1A 4G7HF 1G4US 3JYYA 4BJ5C 2IBFA 3K33A 3EH1A 5JS5A 2DI3A 2Q4FA 1PCXA 2CCYA 2EIJC 3DWWA 2V3CC 1I4YA 1D0YA 4FX5A 5A6AA 3AG3C 5E3AA 5L3QA 3GM1A 3ITFA 1MMGA 5F28E 1CGOA 4Z9IA 1TKNA 1Y6DA 2R7QA 3AJMA 3GWNA 3K1HA 3RH3A 2M64A 3EGDA 3K7DA 4K0DA 4U9EA 3US6A 3SXZA 3U3FA 5DS6A 1ZW3A 2XLEA 3GM2A 3M4BA 3ZTZA 3RVZA 3JSEO 3MBGA 2P7VA 3AOUA 1ZZPA 4JTAB 1F1MA 1GQAA 2IXMA 1K05A 3DD7A 3QW0A 4IGGA 5E3CA 3ZQYA 3LS0A 3JYHA 4MVSA 1G5ZA 2WZLA 5AC5A 2NUTB 1QLEC 3G50A 1RKCA 3KYIA 2VCCA 2LFDA 1CPQA 2C03A 1OCOC 2KW3C 2EPMX 1OXBA 3ATPA 3JCUQ 5JP7A 4CS8C 4B6IA 1LE4A 5HV9A 3K66A 5D92A 2BC5A 4ZLDA 3L0IA 3SYNA 3EG9A 1QZXA 2XRHA 1A7VA 3G4ZA 3PCVA 2B0JA 2Y3BA 3L34A 2E87A 3M79A 1M57C 5A6BD 1C17M 4YN0B 3S9OA 4C3DA 1I4ZA 2LQGA 4JIOA 2EPOA 3GM3A 4KBLA 5T1DB 1LVKA 2PX0A 4PFOA 2CDQA 3S84A 2MYSA 2HSQA 1NU9C 2PF4E 5BQGA 3L1MA 4NQFA 3POVA 1D1AA 3CEXA 1YZCA 2EPNA 2JD3A 3SZRA 1NZEA 1QVXA 1EI7A 1NFNA 3DE8A 3EHNA 3B9QA 3QMKA 1OCZC 4NTAA 1CGNA 2VCAA 2XL4A 3ZIBA 3LNRA 3SXMA 1H9TA 2AU5A 4OIRF 4KC9A 1J8YF 3EQLF 3EFOB 4DOZA 1XZPA 4MVOA 5JLIA 3PHF2 4MW8A 3X1OA 4LDKA 1Q0GA 3C63A 4AE4A 4FESA 2WL8A 4GQHA 2NUPA 5T3WA 4JEBA 2CYDA 4U5FE 4D4XA 4E0IA 3PMRA 2KGOA 5KYWA 2HKVA 1A7EA 1H7IA 1KNYA 1LE2A 2GFHA 4MW3A 4P6IC 4CS9C 4X0RA 1ORYA 3FXHA 4U5BE 3R7CA 1Z63A 2PFDA 2XXAB 1WTYA 3JSZA 4JEAA 1AVOB 1C03A 3HKKA 1JRAA 2GWWA 3F46A 4BEJA 2P1AA 5JT4A 2HJ3A 1O87A 2J7PD 1G4WR 1VYKA 3EH2A 4IRUA 2LCHA 4CSAA 2VH3A 1TR2A 1NSGB 4F4BA 4CDAA 4O79A 4ONSA 4LDRA 4JJFA 2J7PA 5BUOA 1BR1A 1BR2A 4IB4A 3ZG1A 3VM6A 4IARA 3V5ZA 4P9TA 3RYLA 2DYSC 5AC4A 3W8IA 3UNGC 5D91A 3M4CA 5A69A 1VB5A 1JAFA 4MVUA
chains in the Genus database with same CATH topology
4CJOA 3M15A 3FOOA 2XL6A 4CX9A 4CDYA 3IQ6A 2XLVA 4WGYA 4CJGA 2YL7A 4D4NA 5JS5A 2YLDA 4ULVA 2QLAA 2CCYA 4CDVA 2YKZA 2J8WA 3VRCA 4U9DA 3ZTMA 3HNJA 1MQVA 1E86A 3QW1A 1YZAA 1CGOA 3C62A 4U9EA 2YLIA 2XLEA 3M4BA 3ZTZA 2XM4A 1E84A 1GQAA 3QW0A 3ZQYA 5JRAA 1QQ3A 3ZQVA 3NMJA 1CPQA 1YYJA 5JP7A 2BC5A 4CIPA 1A7VA 256BA 1CPRA 3M79A 3HNLA 4IAQA 3HNKA 1QPUA 3L1MA 1YZCA 3TOLA 5JUAA 3DE8A 2J9BA 3QVZA 1M6TA 1CGNA 2XLHA 4WGZA 3HNIA 3IQ5A 2XLOA 1E83A 2YLGA 5JLIA 2XM0A 3C63A 5JVEA 4N4WA 5B3IA 3QVYA 3NMIA 3ZWIA 4JEBA 4D4XA 4JE9A 2YL0A 1NBBA 1S05A 3NMKA 2XLMA 4JEAA 3TOMA 5JT4A 4JKVA 4EIYA 5AGFA 1EKYA 4L6RA 2XLDA 1BBHA 1YYXA 4CDAA 1E85A 3U8PA 1LM3B 4IB4A 2YL3A 2XLWA 3FOPA 4IARA 4ER9A 2YL1A 1RCPA 4N6HA 4NC3A 3M4CA 5JSLA 3DE9A 1JAFA 1APCA 2XL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJO A;  3M15 A;  3FOO A;  2XL6 A;  4CX9 A;  4CDY A;  3IQ6 A;  2XLV A;  4WGY A;  4CJG A;  2YL7 A;  4D4N A;  5JS5 A;  2YLD A;  4ULV A;  2QLA A;  2CCY A;  4CDV A;  2YKZ A;  2J8W A;  3VRC A;  4U9D A;  3ZTM A;  3HNJ A;  1MQV A;  1E86 A;  3QW1 A;  1YZA A;  1CGO A;  3C62 A;  4U9E A;  2YLI A;  2XLE A;  3M4B A;  3ZTZ A;  2XM4 A;  1E84 A;  1GQA A;  3QW0 A;  3ZQY A;  5JRA A;  1QQ3 A;  3ZQV A;  3NMJ A;  1CPQ A;  1YYJ A;  5JP7 A;  2BC5 A;  4CIP A;  1A7V A;  256B A;  1CPR A;  3M79 A;  3HNL A;  4IAQ A;  3HNK A;  1QPU A;  3L1M A;  1YZC A;  3TOL A;  5JUA A;  3DE8 A;  2J9B A;  3QVZ A;  1M6T A;  1CGN A;  2XLH A;  4WGZ A;  3HNI A;  3IQ5 A;  2XLO A;  1E83 A;  2YLG A;  5JLI A;  2XM0 A;  3C63 A;  5JVE A;  4N4W A;  5B3I A;  3QVY A;  3NMI A;  3ZWI A;  4JEB A;  4D4X A;  4JE9 A;  2YL0 A;  1NBB A;  1S05 A;  3NMK A;  2XLM A;  4JEA A;  3TOM A;  5JT4 A;  4JKV A;  4EIY A;  5AGF A;  1EKY A;  4L6R A;  2XLD A;  1BBH A;  1YYX A;  4CDA A;  1E85 A;  3U8P A;  1LM3 B;  4IB4 A;  2YL3 A;  2XLW A;  3FOP A;  4IAR A;  4ER9 A;  2YL1 A;  1RCP A;  4N6H A;  4NC3 A;  3M4C A;  5JSL A;  3DE9 A;  1JAF A;  1APC A;  2XL8 A; 
#chains in the Genus database with same CATH topology
 4Z9J A;  3SXK A;  3WAQ A;  1ZHZ A;  4PJJ A;  4J7T A;  2L6G A;  4LLC A;  2VC9 A;  1YLM A;  2J9V A;  4BEM J;  1OKK A;  4YT2 A;  4FAP B;  5KYY B;  2KJG A;  3BRJ A;  4JCZ A;  3B0V C;  4EBK A;  1LPE A;  2W9Y A;  4WGY A;  3DMD A;  2VAS A;  2OEV A;  2AP3 A;  3V7O A;  4DRH B;  3UGO A;  3HJC A;  2YLD A;  4ULV A;  1FMW A;  1OW6 A;  2J45 A;  3AGT A;  1RJ9 B;  3B71 A;  4PJL A;  5E2Q A;  3C7J A;  3U3B A;  2J8W A;  2I15 A;  3K1I A;  2YEV A;  4U9D A;  2NG1 A;  3KKB A;  3GEE A;  3VRC A;  3W4Y A;  1G8X A;  2OKU A;  4W8P A;  1N1C A;  4YT8 A;  1FAP B;  1JPN A;  1YZA A;  4I1O B;  4P9F A;  1VMA A;  2PP4 A;  4RBN A;  3W8H A;  3ZVR A;  5KYU A;  4XWJ A;  4DBR A;  4OIQ F;  2A0B A;  3C62 A;  4N06 A;  4HE8 D;  2YLI A;  1Q0D A;  1AEP A;  1IW7 F;  3LLK A;  4CBE A;  4D4N A;  5KYW B;  3DAF A;  1DOW A;  2IOQ A;  2XM4 A;  1Q0M A;  1LI5 A;  1OQC A;  1VOM A;  1SMY F;  5K0I A;  3T6G B;  4U5E E;  1A0B A;  2OQM A;  2FGY A;  1M56 C;  1Z3I X;  3CSK A;  3FVY A;  3LJB A;  1MMD A;  4J30 B;  3NMJ A;  4XQ1 A;  5BQH A;  1V54 C;  3FAP B;  1FNT c;  3KH2 A;  4XPW A;  3T6B A;  4JJG A;  2CNW D;  1M2O A;  2KC3 A;  3V5Y A;  2ZPA A;  1NU7 D;  4EBB A;  1FMV A;  4CS9 A;  1LIH A;  2H7O A;  1OR3 A;  2FFH A;  256B A;  1V74 B;  2J46 A;  4GEH A;  4JZA A;  3U9J A;  2OU6 A;  5A6J A;  1IZM A;  2ETS A;  3IPM O;  1OXK A;  1YJG A;  3JT1 A;  3LEO A;  2LSE A;  2HV7 A;  4H54 A;  3T9O A;  1B68 A;  4PAC A;  4G0H A;  2LIG A;  4QI2 A;  4YK5 A;  4HFF B;  4HEA J;  3Q7G A;  4EKW A;  2D4U A;  2Q3T A;  4AE4 B;  4PJN A;  3CAX A;  5DS4 A;  1ZHX A;  2LP4 A;  3T4R A;  2FAP B;  3RF3 A;  1RKE A;  4OD5 A;  4OIP F;  5BQI A;  3G4X A;  1M6T A;  2KYH A;  3EGX B;  5EGY A;  2XLH A;  4JVS A;  2HFI A;  4EWC A;  3HNI A;  4I1M A;  4BPM A;  1JR8 A;  1Z23 A;  4IAO A;  5B1B C;  3TJ5 A;  4O6Y A;  5L0J A;  1ZHT A;  2XM0 A;  1WAS A;  2UUI A;  1VLS A;  4N4W A;  3FHD A;  3QVY A;  4WJ0 A;  1TFO B;  1UFB A;  2A6H F;  3NMI A;  3OA1 A;  1D1B A;  2A0U A;  2AWY A;  4KNV A;  2A68 F;  2OEX A;  2RSE B;  2QNL A;  2YL0 A;  3IHU A;  2I8B A;  1YAU O;  2H8A A;  3K6B A;  4FWV A;  1NBB A;  3NMK A;  2L6F A;  3O10 A;  3GEI A;  2YQY A;  3FAJ A;  1XZQ A;  1YA9 A;  2BE5 F;  4KI2 A;  2CGE A;  3NKD A;  3ASO C;  2MWQ A;  4MTF A;  1WWP A;  5B3S C;  1EKY A;  3WG7 C;  3U2M A;  2XLD A;  3RFY A;  4EBJ A;  3SXY A;  4PJM A;  3U8V A;  4UDV A;  2R7U A;  1V55 C;  2AWC A;  3FDQ A;  2LK4 A;  4RDA A;  4PK4 A;  4XEF A;  1LM3 B;  4GYT A;  1ZVZ A;  1FFT C;  3ZSU A;  1HW1 A;  4DVY P;  4XEK A;  3FOP A;  4JW1 A;  2L81 A;  4E17 A;  5B1A C;  4I3M A;  2WB7 A;  3U0C A;  1QSP A;  1NFO A;  1V4A A;  2ICW G;  2IYL D;  1ZU5 A;  4U5C E;  3NG1 A;  1LI7 A;  3DE9 A;  4C3B A;  3C18 A;  1TQG A;  3B29 A;  2R03 A;  1BZ4 A;  4N6C A;  4BJ1 A;  3I5P A;  3DJU B;  1K40 A;  4NTB A;  3RVY A;  4DXW A;  1OCC C;  3V5X A;  3C8G A;  2J0X A;  4U5H A;  2HZ8 A;  1LKX A;  3VYW A;  1YAR O;  5E33 A;  1CGM E;  2PBE A;  3JTL O;  4CJG A;  1RKE B;  5CI8 A;  3E9V A;  1HW2 A;  3NDB B;  2P6V A;  3UMI A;  2WZF A;  1PV3 A;  4U5D E;  4CDV A;  2W4M A;  2YKZ A;  5L0I A;  4XLP F;  2YWA A;  3HNJ A;  4G7Z F;  4XPY A;  2J0W A;  1MQV A;  2G3K A;  2IXN A;  2Z15 A;  3QW1 A;  4Q7C A;  1E86 A;  3L8I A;  5L0C A;  3DZA A;  4BJ5 A;  3ZC4 A;  3SP1 A;  1U89 A;  4BJT A;  3ASN C;  1FTS A;  2L9J A;  2LD6 A;  5DVW A;  2NUT A;  2ZXP A;  2NUP B;  1E84 A;  2CW0 F;  1Q0K A;  3Q6M A;  1L3P A;  5JRA A;  5CIV A;  2A69 F;  4K7B A;  3EPV A;  1TWG A;  2R7W A;  2UUH A;  3S90 A;  1QQ3 A;  2OJQ A;  3ZQV A;  4EHP A;  3VF0 A;  1U0B B;  1VK5 A;  1BR4 A;  1NG1 A;  4C7O A;  1XWJ A;  2XXA A;  1E2X A;  2G3V A;  2GDC A;  3N24 A;  3NYL A;  4CIP A;  2BL2 A;  2B0H A;  1CPR A;  1JPJ A;  1W2W A;  3IEE A;  1GS9 A;  4IAQ A;  3A9C A;  3HNK A;  1O3U A;  3X2Q C;  4CS7 A;  2Q00 A;  4I44 A;  5DQT A;  3EZH A;  1WAT A;  4AX2 A;  3LNM B;  2NSG A;  3LEV A;  4K1O A;  4J32 B;  3I4U A;  4JUR I;  4YJW A;  2F22 A;  2EPL X;  3LS1 A;  4DRI B;  1T5O A;  2PX3 A;  3C8Z A;  1QPU A;  4XTK A;  3TQO A;  2GA0 A;  3TOL A;  3GEH A;  3DJN B;  4MTG A;  2DYR C;  1ZYR F;  4JCH A;  1LS4 A;  4AL0 A;  2ZD9 A;  2G62 A;  3QVZ A;  1VTM P;  4MVR A;  3DXJ F;  4OD4 A;  2QUP A;  1WN0 A;  3AG1 C;  1OR2 A;  3O6X A;  3S0X A;  3JRT A;  2ZXR A;  3JZ0 A;  4MTO A;  1PD1 A;  2A6E F;  2XLO A;  2R7R A;  1E83 A;  1ZW2 A;  3TD7 A;  3TK0 A;  1M2V A;  5JVE A;  3QZC A;  5B3I A;  1R4T A;  1SYQ A;  1YA7 O;  2HS5 A;  2IXP A;  2YRF A;  4EUK B;  3NKE A;  2R7T A;  3E70 C;  2J9W A;  3AQB A;  4LER A;  4O6M A;  3UMH A;  3GOR A;  2DGJ A;  5KYY A;  1SZI A;  3ECS A;  2O9X A;  2EPK X;  1OCR C;  1S05 A;  1OKK D;  2M4E A;  2XLM A;  1RJ9 A;  3AQC A;  4LDQ A;  3DI5 A;  3TOM A;  3NYM A;  4JKV A;  4YT5 A;  2X0C A;  5L0G A;  2ZXO A;  2R7V A;  2V26 A;  2EIL C;  4JTC B;  5AGF A;  1ST6 A;  1TWH A;  2R7O A;  4XPX A;  3RIP A;  3AG2 C;  5L0H A;  1MMN A;  1YYX A;  2HJM A;  4MVZ A;  2RD9 A;  3LLI A;  3GAN A;  2EIK C;  2WZG A;  3CQZ A;  5L0F A;  1JOG A;  1MND A;  4E0H A;  4E7Z A;  2L6H A;  2A1D D;  4G7O F;  2YZS A;  3LES A;  2XLW A;  4MS2 A;  4E18 A;  2XSE A;  2W45 A;  1HY5 A;  1U6H A;  2YL1 A;  3KMI A;  2R05 A;  3ABM C;  3I5Q A;  3MX3 A;  1HE9 A;  3H65 A;  3NRH A;  4N6H A;  4HFK B;  3U5S A;  4A4A A;  5JSL A;  1ZU4 A;  1T6Q A;  5F5F A;  1DOV A;  4CSA C;  4NCQ A;  5CI9 A;  3RQE A;  4YWQ A;  1M2V B;  2NSF A;  3U2L A;  1D0X A;  3S28 A;  2XL6 A;  4DBQ A;  4CDY A;  2R7X A;  1MMA A;  3MYF A;  2ASR A;  5HSW A;  3EGD B;  3BEH A;  1GGQ A;  4MVM A;  1Z5Z A;  3M1C B;  3MLG A;  3S29 A;  3LAY A;  2YL7 A;  2CNW A;  2WVN A;  4WAB A;  1D1C A;  1BDJ B;  2L7A A;  3C8G D;  1HE1 A;  1OW8 A;  3KPH A;  2H7B A;  4R32 A;  3WHN A;  3ABK C;  1UG7 A;  3AG4 C;  4IJJ A;  4U5G A;  2QLA A;  4H4K C;  4JTD B;  4YL0 A;  3ZTM A;  3CZ6 A;  2R02 A;  5COF A;  1Z7Q c;  1H6G A;  4JRZ A;  5EK0 A;  3FMS A;  2R7S A;  3F47 A;  3N2Z B;  2NPU A;  5L3V A;  2QTV A;  3Q6N A;  4NTF A;  3Q7L A;  4BJ6 A;  4KNW A;  4LAC B;  4BG0 A;  2JX0 A;  1R5I D;  1T01 A;  4QDL A;  1QKR A;  1K04 A;  3GOD A;  3J06 A;  2OG2 A;  1ZHW A;  2WVQ A;  4MVQ A;  5DLJ A;  2J9U A;  3TUL A;  3T6J A;  5FZT A;  4XLN F;  3QTH A;  3SEO A;  1WGW A;  2Y3G A;  2C04 A;  3A11 A;  1SF8 A;  4YL1 A;  3DM9 B;  4MND A;  1T6I A;  3VAY A;  3EHM A;  3HLZ A;  1YYJ A;  3UGP A;  3EG9 B;  5DS5 A;  1C02 A;  1L7C A;  1ORS C;  1ZHY A;  3IQC A;  5A6K A;  1EA8 A;  2HMQ A;  2VB6 A;  4Z9H A;  4Q4Z F;  2TMV P;  3O39 A;  3TJ6 A;  5COM A;  1ORJ A;  1NLX A;  2X51 A;  2EIN C;  3HNL A;  1HMO A;  3K1I C;  2HMZ A;  3L8J A;  5COG A;  5IY5 C;  3PDM P;  1TWA A;  4OIO F;  3LUT B;  5DQZ A;  1FFH A;  2VCB A;  2KQ9 A;  4ULW A;  4CS8 A;  2GAQ A;  1J8M F;  2WVO A;  2XS1 A;  5KYU B;  3R2P A;  2DB4 A;  2Y3D A;  3EFO A;  1Z6A A;  4C7O B;  5L0D A;  2PNO A;  2Y3H A;  2EIM C;  1I5N A;  3MYI A;  2Q9B A;  2YVK A;  5EHH A;  1TWC A;  5KYX B;  3H2V A;  5JUA A;  1EQ1 A;  1YVI A;  2Y69 C;  1KTM A;  3DAG A;  2J9B A;  4O7G A;  2R25 A;  1H9G A;  2YHS A;  3NYJ A;  1HMD A;  4WGZ A;  2QE9 A;  3RQF A;  3IQ5 A;  4NY3 A;  5T3T A;  2ZXW C;  3KL4 A;  1RXQ A;  4JC7 A;  4Q5S F;  2YLG A;  5A6B A;  2Q9C A;  4PR9 A;  3RQG A;  2XS8 A;  4AK9 A;  4QI0 A;  4CIH A;  2H7V C;  3ZWI A;  1OW7 A;  1MNE A;  4G78 A;  4MQ9 F;  3SNH A;  3DKA A;  2W4B A;  1KU2 A;  2AVK A;  3B0P A;  4JE9 A;  4C3E A;  3OWT A;  2OOC A;  5TJ5 E;  3KYJ A;  3S27 A;  1SR2 A;  1VYI A;  2OJE D;  3IQT A;  1GM5 A;  1O5H A;  4PFP A;  3N0T A;  4J7Y A;  4BJ6 C;  4EIY A;  3O55 A;  3EJN A;  4M63 A;  1Q0F A;  1JMW A;  1A41 A;  3EGX A;  4RD9 A;  2IXO A;  3W2V A;  4L6R A;  3GWL A;  1Y4C A;  1BBH A;  2P0N A;  2P61 A;  3AGU A;  1WOL A;  4OIN F;  1FR0 A;  1AUE A;  3JRM O;  2D5R B;  2HV6 A;  2QY9 A;  1RMV A;  2KNH A;  3WOD F;  5KYN A;  4DRJ B;  3U8P A;  1E85 A;  1D0Z A;  1YDI A;  2KK1 A;  2HUJ A;  2KSF A;  2Q7R A;  1S7Z A;  2YL3 A;  3UR3 C;  1T9K A;  2Y39 A;  4ER9 A;  4XEV A;  3MFN A;  4A2N B;  4ANJ A;  1RCP A;  2LFF A;  5FCL A;  1LS1 A;  4NC3 A;  5KYX A;  4YT4 A;  2Q9A A;  2MHR A;  2OCC C;  3OEO A;  1T6U A;  4DVZ A;  4ZLC A;  3C8G B;  1APC A;  2XL8 A;  4DJ9 A;  1TFK B;  2JPU A;  1A7D A;  3ZDL A;  4CJO A;  4O6N A;  3B0U X;  3M15 A;  3FOO A;  4IWB A;  4CX9 A;  4E7S A;  5GPG B;  1VLT A;  2HSB A;  1PD0 A;  3DM5 A;  3RKO F;  3IQ6 A;  3RW0 A;  2IM8 A;  3H2U A;  5F5H A;  4LLE A;  2XLV A;  3W2W A;  4YL3 A;  3EZI A;  3ABL C;  3U9M A;  3UMK A;  4W8K A;  3HTK C;  2R9R B;  4AL1 A;  4G7H F;  1G4U S;  3JYY A;  4BJ5 C;  2IBF A;  3K33 A;  3EH1 A;  5JS5 A;  2DI3 A;  2Q4F A;  1PCX A;  2CCY A;  2EIJ C;  3DWW A;  2V3C C;  1I4Y A;  1D0Y A;  4FX5 A;  5A6A A;  3AG3 C;  5E3A A;  5L3Q A;  3GM1 A;  3ITF A;  1MMG A;  5F28 E;  1CGO A;  4Z9I A;  1TKN A;  1Y6D A;  2R7Q A;  3AJM A;  3GWN A;  3K1H A;  3RH3 A;  2M64 A;  3EGD A;  3K7D A;  4K0D A;  4U9E A;  3US6 A;  3SXZ A;  3U3F A;  5DS6 A;  1ZW3 A;  2XLE A;  3GM2 A;  3M4B A;  3ZTZ A;  3RVZ A;  3JSE O;  3MBG A;  2P7V A;  3AOU A;  1ZZP A;  4JTA B;  1F1M A;  1GQA A;  2IXM A;  1K05 A;  3DD7 A;  3QW0 A;  4IGG A;  5E3C A;  3ZQY A;  3LS0 A;  3JYH A;  4MVS A;  1G5Z A;  2WZL A;  5AC5 A;  2NUT B;  1QLE C;  3G50 A;  1RKC A;  3KYI A;  2VCC A;  2LFD A;  1CPQ A;  2C03 A;  1OCO C;  2KW3 C;  2EPM X;  1OXB A;  3ATP A;  3JCU Q;  5JP7 A;  4CS8 C;  4B6I A;  1LE4 A;  5HV9 A;  3K66 A;  5D92 A;  2BC5 A;  4ZLD A;  3L0I A;  3SYN A;  3EG9 A;  1QZX A;  2XRH A;  1A7V A;  3G4Z A;  3PCV A;  2B0J A;  2Y3B A;  3L34 A;  2E87 A;  3M79 A;  1M57 C;  5A6B D;  1C17 M;  4YN0 B;  3S9O A;  4C3D A;  1I4Z A;  2LQG A;  4JIO A;  2EPO A;  3GM3 A;  4KBL A;  5T1D B;  1LVK A;  2PX0 A;  4PFO A;  2CDQ A;  3S84 A;  2MYS A;  2HSQ A;  1NU9 C;  2PF4 E;  5BQG A;  3L1M A;  4NQF A;  3POV A;  1D1A A;  3CEX A;  1YZC A;  2EPN A;  2JD3 A;  3SZR A;  1NZE A;  1QVX A;  1EI7 A;  1NFN A;  3DE8 A;  3EHN A;  3B9Q A;  3QMK A;  1OCZ C;  4NTA A;  1CGN A;  2VCA A;  2XL4 A;  3ZIB A;  3LNR A;  3SXM A;  1H9T A;  2AU5 A;  4OIR F;  4KC9 A;  1J8Y F;  3EQL F;  3EFO B;  4DOZ A;  1XZP A;  4MVO A;  5JLI A;  3PHF 2;  4MW8 A;  3X1O A;  4LDK A;  1Q0G A;  3C63 A;  4AE4 A;  4FES A;  2WL8 A;  4GQH A;  2NUP A;  5T3W A;  4JEB A;  2CYD A;  4U5F E;  4D4X A;  4E0I A;  3PMR A;  2KGO A;  5KYW A;  2HKV A;  1A7E A;  1H7I A;  1KNY A;  1LE2 A;  2GFH A;  4MW3 A;  4P6I C;  4CS9 C;  4X0R A;  1ORY A;  3FXH A;  4U5B E;  3R7C A;  1Z63 A;  2PFD A;  2XXA B;  1WTY A;  3JSZ A;  4JEA A;  1AVO B;  1C03 A;  3HKK A;  1JRA A;  2GWW A;  3F46 A;  4BEJ A;  2P1A A;  5JT4 A;  2HJ3 A;  1O87 A;  2J7P D;  1G4W R;  1VYK A;  3EH2 A;  4IRU A;  2LCH A;  4CSA A;  2VH3 A;  1TR2 A;  1NSG B;  4F4B A;  4CDA A;  4O79 A;  4ONS A;  4LDR A;  4JJF A;  2J7P A;  5BUO A;  1BR1 A;  1BR2 A;  4IB4 A;  3ZG1 A;  3VM6 A;  4IAR A;  3V5Z A;  4P9T A;  3RYL A;  2DYS C;  5AC4 A;  3W8I A;  3UNG C;  5D91 A;  3M4C A;  5A69 A;  1VB5 A;  1JAF A;  4MVU A; 
#chains in the Genus database with same CATH homology
 4CJO A;  3M15 A;  3FOO A;  2XL6 A;  4CX9 A;  4CDY A;  3IQ6 A;  2XLV A;  4WGY A;  4CJG A;  2YL7 A;  4D4N A;  5JS5 A;  2YLD A;  4ULV A;  2QLA A;  2CCY A;  4CDV A;  2YKZ A;  2J8W A;  3VRC A;  4U9D A;  3ZTM A;  3HNJ A;  1MQV A;  1E86 A;  3QW1 A;  1YZA A;  1CGO A;  3C62 A;  4U9E A;  2YLI A;  2XLE A;  3M4B A;  3ZTZ A;  2XM4 A;  1E84 A;  1GQA A;  3QW0 A;  3ZQY A;  5JRA A;  1QQ3 A;  3ZQV A;  3NMJ A;  1CPQ A;  1YYJ A;  5JP7 A;  2BC5 A;  4CIP A;  1A7V A;  256B A;  1CPR A;  3M79 A;  3HNL A;  4IAQ A;  3HNK A;  1QPU A;  3L1M A;  1YZC A;  3TOL A;  5JUA A;  3DE8 A;  2J9B A;  3QVZ A;  1M6T A;  1CGN A;  2XLH A;  4WGZ A;  3HNI A;  3IQ5 A;  2XLO A;  1E83 A;  2YLG A;  5JLI A;  2XM0 A;  3C63 A;  5JVE A;  4N4W A;  5B3I A;  3QVY A;  3NMI A;  3ZWI A;  4JEB A;  4D4X A;  4JE9 A;  2YL0 A;  1NBB A;  1S05 A;  3NMK A;  2XLM A;  4JEA A;  3TOM A;  5JT4 A;  4JKV A;  4EIY A;  5AGF A;  1EKY A;  4L6R A;  2XLD A;  1BBH A;  1YYX A;  4CDA A;  1E85 A;  3U8P A;  1LM3 B;  4IB4 A;  2YL3 A;  2XLW A;  3FOP A;  4IAR A;  4ER9 A;  2YL1 A;  1RCP A;  4N6H A;  4NC3 A;  3M4C A;  5JSL A;  3DE9 A;  1JAF A;  1APC A;  2XL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...