2XLDA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124q variant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 47
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xldA00
1MQVA 4CX9A 1E84A 4N6HA 4JE9A 1JAFA 2XM4A 1QQ3A 1E86A 256BA 5JVEA 3ZQVA 1YYJA 1QPUA 3NMKA 4WGYA 2XLEA 1EKYA 2XL8A 4CDVA 2XM0A 2YKZA 3HNIA 2XLWA 1A7VA 2YL1A 4WGZA 2XLHA 3QW1A 1CPQA 1BBHA 1APCA 1E83A 4CIPA 1E85A 3FOOA 5JT4A 2YL7A 4N4WA 5JRAA 1LM3B 3ZTZA 3HNJA 2YL0A 5JP7A 4CJGA 4NC3A 1YZAA 3FOPA 5JUAA 3ZWIA 4JEAA 3M4BA 3M79A 5JS5A 4IB4A 3IQ6A 3NMJA 2J8WA 3L1MA 2QLAA 4L6RA 4ER9A 4JKVA 2XL6A 4D4XA 3TOMA 3M4CA 3DE8A 2XLDA 2J9BA 2XLOA 4U9DA 5JSLA 1NBBA 5AGFA 3TOLA 3ZQYA 3C62A 1CGNA 4IAQA 5JLIA 2YLDA 2BC5A 3HNLA 3U8PA 3DE9A 1M6TA 4CDAA 3QW0A 1CGOA 3C63A 4CDYA 4ULVA 2YLGA 1CPRA 3QVZA 1YYXA 2YL3A 2YLIA 1S05A 2XLMA 5B3IA 4JEBA 1RCPA 4D4NA 3VRCA 3NMIA 4CJOA 3M15A 4EIYA 3HNKA 3IQ5A 2CCYA 3QVYA 4U9EA 1GQAA 2XLVA 3ZTMA 4IARA 1YZCA
chains in the Genus database with same CATH superfamily
4A4AA 2E87A 1YAUO 4XTKA 1OCZC 3KYIA 4NTAA 1QSPA 3EHNA 3B9QA 5FZTA 3ZIBA 2EIKC 1R4TA 3QMKA 4JE9A 4Z9JA 1YDIA 1ZHWA 1ZW2A 2Y3GA 1W2WA 2CDQA 3AG4C 4PJNA 2HZ8A 2OKUA 4O6NA 2EIMC 4WABA 5IY5C 4N6CA 1M2OA 5JVEA 2XSEA 3S0XA 1YYJA 1WATA 1QPUA 1BR2A 3AG2C 4JCZA 2R02A 2YQYA 5E3AA 3O39A 3JYHA 2KGOA 4CSAA 3V5XA 2XS8A 3AG1C 1EKYA 4MNDA 1BZ4A 4EBKA 3RQGA 3CEXA 4J30B 1LVKA 1F1MA 2L6GA 3V7OA 2YL1A 3K1IA 1YARO 2CNWD 3C8ZA 4C7OB 1FR0A 3B0PA 2R7WA 2ZPAA 2Q7RA 4OINF 2GA0A 1S7ZA 1O3UA 4C3BA 2Y69C 1MNDA 1LIHA 2J7PD 2HJ3A 2EILC 2WVNA 5DS6A 3SXYA 1E83A 1U6HA 5CIVA 3C8GA 4EUKB 1E85A 3FXHA 3R7CA 4YT2A 2NUPA 2YL7A 1N1CA 3KPHA 3LEVA 2YEVA 4DOZA 3MYFA 3JRTA 4N4WA 5AC4A 1C17M 4XLNF 4OIOF 1ZHXA 3ZTZA 2DI3A 4D4NA 4AE4A 3LLIA 3NYJA 2G3KA 2J45A 4G7HF 1EQ1A 1NFNA 4NC3A 2A68F 1H7IA 2Q00A 2WVOA 5DS5A 2OG2A 2Y3HA 1VMAA 1Y4CA 3T6JA 1VTMP 2HV6A 2Q9CA 4EBJA 1AVOB 2CW0F 2HUJA 4GEHA 2LFDA 4W8PA 4ANJA 3ECSA 1HY5A 5BQIA 5L0CA 2L7AA 5L3VA 4U5HA 3U2LA 3S27A 1VYIA 4MVRA 2R7OA 3L8IA 1XZPA 4PJLA 3IQ6A 4FAPB 4PJJA 3S28A 3TK0A 4H4KC 3L1MA 3S9OA 1I5NA 3K1HA 4NQFA 3ZC4A 3A11A 2ZXOA 1OW6A 3FHDA 4JKVA 4MW3A 2VCAA 4ER9A 2L6FA 3NDBB 5B3SC 1TWAA 3TOMA 3LNRA 3KYJA 3QTHA 2BL2A 2WB7A 1K04A 3DE8A 3NKDA 3ZDLA 1KNYA 2KC3A 4QI2A 3EJNA 5D91A 3X2QC 2G62A 1Q0KA 4CS9A 2P7VA 1ZU4A 3ZQYA 3C62A 2LQGA 3KH2A 1CGNA 5T3TA 1H6GA 4BJ1A 2PX0A 4LERA 1Z3IX 4MVMA 2R7TA 2AWCA 1EI7A 2Z15A 1ZHZA 3QW0A 2CNWA 3GEEA 1CGOA 4CDAA 1SF8A 2LSEA 4ULVA 3VM6A 1O5HA 2J9UA 4I1OB 3V5ZA 1CPRA 2PF4E 2J7PA 1C02A 4K1OA 3SYNA 2YL3A 4JTDB 4JW1A 4DBRA 4JJFA 4BG0A 2Y3DA 2NUPB 1NU7D 2R9RB 1WGWA 2PNOA 2HMQA 2OEXA 2PBEA 4MQ9F 4Q7CA 4PJMA 5E3CA 3SZRA 1M56C 1TWGA 1T6UA 1H9TA 2QTVA 1M2VA 3M15A 1ZHTA 2EINC 1YA9A 4AE4B 1HMDA 2QNLA 3HTKC 4KBLA 3GEIA 4F4BA 4IGGA 2ICWG 4O7GA 1I4YA 4LACB 1OCRC 2W9YA 4BPMA 1V54C 3LUTB 1OW8A 2Q4FA 4XPYA 1GQAA 2EPKX 3ITFA 5L3QA 3J06A 1Q0FA 2B0JA 2XLVA 4U5FE 4MTOA 4NCQA 3S90A 1MQVA 3DI5A 3GWNA 3DAGA 4JURI 2XRHA 3NRHA 1RMVA 2Y3BA 3IEEA 2F22A 4N6HA 3R2PA 3RW0A 4E17A 5DVWA 3MLGA 1JAFA 3VYWA 4MVOA 2XM4A 4C3EA 1OCCC 1D0YA 1OXKA 1E86A 256BA 3F46A 2OEVA 5D92A 3UNGC 2R7UA 4G7OF 3WODF 1Y6DA 1FMWA 2EIJC 3NMKA 1TFOB 3K1IC 1YVIA 1ST6A 4I1MA 2XLEA 1OKKD 2J0WA 2IXNA 4NTBA 1KTMA 3G4XA 4B6IA 1VK5A 2XM0A 2YKZA 2Q3TA 4I44A 1PV3A 2WVQA 1YJGA 2P0NA 4WGZA 4JVSA 3FVYA 5A6BD 4XLPF 2BE5F 5BQGA 5JUAA 2RD9A 2A6HF 1Q0MA 5COMA 1BBHA 1MNEA 1VYKA 4N06A 4A2NB 2NSFA 2A69F 1APCA 2R03A 3KKBA 1U89A 4KNVA 2OOCA 2C03A 3LJBA 4CIPA 4IRUA 3DJUB 5JT4A 2CGEA 4GYTA 1TR2A 2C04A 4FX5A 5JRAA 4MVSA 2PP4A 3FMSA 3RH3A 4U5GA 4CJGA 1SYQA 3RKOF 3RFYA 1NG1A 2KYHA 2PX3A 2YHSA 3ABLC 3CSKA 4MVZA 1M2VB 1IZMA 4G7ZF 1EA8A 3K33A 4IJJA 1OW7A 4DRJB 4R32A 1ZW3A 3GM1A 4FWVA 3GWLA 3DJNB 3IHUA 3MX3A 4LLEA 2LK4A 2VB6A 2KQ9A 3F47A 4NTFA 4U5CE 4QI0A 2LP4A 1GGQA 3LNMB 1LS4A 5T3WA 3SP1A 2RSEB 4AL1A 5F5FA 3U8VA 5GPGB 1HW2A 3GM2A 4XWJA 4K0DA 2H7OA 1Q0DA 2MWQA 3K66A 1ORSC 3NMJA 4DRIB 3HKKA 1A41A 4L6RA 3ZVRA 4OIPF 4J7YA 3Q6NA 3HLZA 4CS9C 3M1CB 1A0BA 2ZXPA 4D4XA 4QDLA 1V55C 3LAYA 4MS2A 3G50A 3W8HA 1FTSA 4YT8A 2OU6A 4U9DA 1QZXA 1RXQA 2HV7A 3BRJA 3JSZA 4NY3A 5JSLA 3RIPA 4DRHB 1AUEA 1NBBA 2JPUA 4G78A 3UMKA 1OKKA 1ZHYA 1U0BB 1HE9A 2HJMA 3EFOA 1BR4A 2YLDA 2BC5A 3HNLA 4HE8D 3DE9A 3UMIA 3EPVA 1Z5ZA 5AC5A 1M6TA 3EQLF 3EHMA 3U9MA 4J7TA 3Q6MA 3C63A 4CDYA 5A6BA 5L0JA 2JD3A 3AGUA 2X51A 4PFOA 2VCCA 5B1AC 1J8MF 1O87A 2YLGA 3QVZA 3PCVA 2HMZA 1YYXA 2OCCC 1YLMA 1TQGA 2NUTA 3TJ6A 2D5RB 4LDQA 3L34A 4MTFA 3L0IA 4KC9A 1T6IA 4P9FA 4JRZA 3C7JA 1A7EA 3JSEO 1RCPA 3FDQA 3Q7GA 4I3MA 3I4UA 4ONSA 4PR9A 3NMIA 1OR2A 1MMNA 4CJOA 2CCYA 5KYWA 1TKNA 1G4WR 2A1DD 2Q9BA 3LS0A 4E7SA 2R7SA 4CBEA 3ASNC 3KL4A 1LI7A 3AJMA 3T4RA 1D0ZA 2YRFA 1ORYA 5DS4A 4IARA 2M64A 1Z6AA 2GAQA 3CQZA 4CX9A 4E0IA 1Q0GA 1UG7A 2AU5A 3H65A 4WJ0A 3O55A 4YJWA 4YWQA 5EHHA 1RJ9A 4KNWA 2A6EF 1LKXA 4X0RA 1QQ3A 2DGJA 1PD0A 3IQCA 3K6BA 3NYLA 3ZQVA 3EG9A 3LESA 2H7VC 3WHNA 4ZLDA 1LI5A 5L0FA 3U2MA 2LFFA 2W4MA 5DQTA 4E7ZA 2KW3C 1QVXA 4E18A 4RBNA 2XL8A 4EHPA 4JIOA 4CDVA 2L9JA 3T9OA 2W45A 1BDJB 2XLWA 3HNIA 3NYMA 3X1OA 1A7VA 4XEKA 2XLHA 3TD7A 3DM9B 3KMIA 4OD4A 2L6HA 3S84A 4YT4A 3EFOB 1CPQA 3DMDA 4DXWA 5EK0A 2FAPB 4U5DE 3W8IA 5A6AA 5COGA 2ZD9A 5L0DA 3RVYA 2G3VA 3UR3C 1TFKB 1LPEA 1NSGB 3CZ6A 1L3PA 3DM5A 4OIRF 4AX2A 4EBBA 3ZG1A 2NUTB 3SNHA 3DKAA 2IXOA 4XQ1A 1LM3B 2QY9A 3GM3A 1I4ZA 3HNJA 2IM8A 2YL0A 3SXZA 4G0HA 1FFHA 1B68A 5JP7A 2HKVA 5DQZA 4YL3A 3W2WA 3PDMP 2DB4A 3FAPB 2Y39A 4YK5A 4YL0A 5A6JA 4UDVA 5A69A 2A0UA 5KYWB 2R7RA 3RQEA 2AP3A 3JT1A 2ETSA 2XS1A 4MTGA 2XXAA 1LE4A 4W8KA 3PMRA 1DOVA 1QLEC 2NSGA 3B29A 3JZ0A 3IPMO 3M4BA 3M79A 5L0GA 1JOGA 2XL4A 3EZHA 5TJ5E 5KYXA 3T6GB 1CGME 2FFHA 1WOLA 2IXPA 3VF0A 1RKCA 1VOMA 4YL1A 2J8WA 3VAYA 2MYSA 2QLAA 3WG7C 2O9XA 1RJ9B 1GS9A 2WL8A 3RF3A 2OJED 2XL6A 4CS8A 2P6VA 1HMOA 3EGXB 2VC9A 4MVUA 3M4CA 2HFIA 1FFTC 2KNHA 1NLXA 2XLDA 2J9BA 3EG9B 3JCUQ 3JRMO 4PFPA 3QZCA 5CI8A 3U3BA 4CIHA 4O6MA 1FNTc 4Q5SF 5AGFA 3TOLA 5HV9A 4IAQA 3EH1A 5JLIA 1T01A 1PD1A 2EPLX 3LS1A 3GODA 2WZFA 1LE2A 4GQHA 2L81A 1D1AA 4BJTA 1XWJA 5KYNA 4P6IC 2EPOA 5F28E 1L7CA 2LCHA 2AVKA 2LIGA 3ATPA 3C18A 3K7DA 3S29A 5E33A 3O6XA 3EGDA 1WN0A 2J46A 3A9CA 1T9KA 3CAXA 5EGYA 3ZSUA 5B3IA 5FCLA 3RYLA 1MMAA 1WASA 2PFDA 5KYUA 5K0IA 3EZIA 2NPUA 4JC7A 3VRCA 1SZIA 3NKEA 3RQFA 4IWBA 3IQ5A 4RD9A 1ZYRF 1JPNA 3N2ZB 2TMVP 3SXMA 1QKRA 1D1BA 4JCHA 4U9EA 3IQTA 2ZXWC 4LLCA 1VLTA 1WWPA 2R7XA 5L0HA 2V3CC 1YZCA 3H2VA 4J32B 2XXAB 4RDAA 1JRAA 1E84A 1SR2A 2W4BA 3MYIA 5T1DB 4O79A 1H9GA 4YN0B 2VCBA 4BEJA 1DOWA 1HE1A 2ASRA 1RKEA 4ULWA 4Z9IA 3B0VC 5KYXB 1OR3A 3JYYA 3N24A 2QUPA 2H8AA 3LEOA 4DVYP 1XZQA 4U5BE 1J8YF 1KU2A 2IYLD 2OJQA 2R7QA 2WZGA 4DBQA 3RVZA 2HSQA 4WGYA 4BJ6C 4LDKA 3PHF2 4H54A 3UGOA 2GFHA 2R25A 3US6A 3JTLO 2OQMA 2YVKA 3BEHA 1T5OA 2V26A 4HEAJ 5L0IA 3E70C 3DWWA 3TJ5A 1ZVZA 2M4EA 3WAQA 2AWYA 1TWHA 3T6BA 1FAPB 2FGYA 2I8BA 3AOUA 3QW1A 2J9VA 5BUOA 4CSAC 1LS1A 2VH3A 3AQBA 2UUIA 4MW8A 4XEVA 4C3DA 1NZEA 4Q4ZF 1D1CA 3U0CA 1VLSA 1IW7F 3FOOA 4M63A 4FESA 1JPJA 4KI2A 4HFFB 3EH2A 3EGDB 1V4AA 3Q7LA 5HSWA 1WTYA 1SMYF 1OQCA 3EGXA 3H2UA 2I15A 2JX0A 3L8JA 2DYRC 3UMHA 3W2VA 1E2XA 2R05A 5KYUB 1YZAA 3B0UX 3OWTA 1Z23A 2LD6A 4K7BA 3FOPA 2CYDA 5KYYA 4IAOA 3POVA 3U5SA 3DZAA 3ABKC 4YT5A 3GANA 3ZWIA 3ASOC 4BJ6A 4JEAA 2KSFA 1Z63A 4BJ5C 3B71A 4JZAA 2Q9AA 5B1BC 5DLJA 3TULA 5JS5A 2H7BA 4IB4A 1G8XA 2IXMA 1ZU5A 4CS8C 4PK4A 4P9TA 4EWCA 2GWWA 1NU9C 1OCOC 1ORJA 3C8GB 1RKEB 2GDCA 3AQCA 3E9VA 1K05A 1R5ID 3MFNA 3GORA 5BQHA 3W4YA 1TWCA 1UFBA 1JR8A 2XLOA 2IBFA 3OA1A 4BEMJ 1MMDA 2WZLA 4LDRA 1G5ZA 1G4US 1FMVA 4MVQA 4DJ9A 3DD7A 1ZZPA 1M57C 3U3FA 3I5PA 4C7OA 1C03A 3UGPA 1T6QA 2QE9A 3DXJF 3SXKA 3U8PA 1V74B 2HSBA 2YZSA 1OXBA 4JTCB 5A6KA 1GM5A 2B0HA 2YWAA 4HFKB 3C8GD 2J9WA 5CI9A 3TQOA 2EPMX 1D0XA 3DAFA 4XPWA 4OD5A 2A0BA 2KK1A 3LLKA 4EKWA 2EPNA 5COFA 2ZXRA 4U5EE 4OIQF 3OEOA 1PCXA 1NFOA 4O6YA 1Z7Qc 1BR1A 2DYSC 2IOQA 3I5QA 5F5HA 2X0CA 2YLIA 1S05A 2KJGA 4AL0A 4BJ5A 3GEHA 2XLMA 4JEBA 2NG1A 4E0HA 2UUHA 4JTAB 3O10A 1HW1A 5E2QA 4AK9A 4XEFA 2J0XA 4XPXA 3FAJA 3HJCA 4PACA 4EIYA 3HNKA 4Z9HA 1MMGA 3V5YA 1AEPA 3SEOA 3NG1A 3QVYA 1JMWA 2MHRA 3N0TA 2R7VA 4CS7A 1K40A 2HS5A 1YA7O 4ZLCA 3AG3C 3U9JA 2P1AA 2P61A 4JJGA 5KYYB 1VB5A 3ABMC 2VASA 3ZTMA 3G4ZA 4DVZA 3MBGA 1A7DA 2D4UA 3AGTA
chains in the Genus database with same CATH topology
1MQVA 4CX9A 1E84A 4N6HA 4JE9A 1JAFA 2XM4A 1QQ3A 1E86A 256BA 5JVEA 3ZQVA 1YYJA 1QPUA 3NMKA 4WGYA 2XLEA 1EKYA 2XL8A 4CDVA 2XM0A 2YKZA 3HNIA 2XLWA 1A7VA 2YL1A 4WGZA 2XLHA 3QW1A 1CPQA 1BBHA 1APCA 1E83A 4CIPA 1E85A 3FOOA 5JT4A 2YL7A 4N4WA 5JRAA 1LM3B 3ZTZA 3HNJA 2YL0A 5JP7A 4CJGA 4NC3A 1YZAA 3FOPA 5JUAA 3ZWIA 4JEAA 3M4BA 3M79A 5JS5A 4IB4A 3IQ6A 3NMJA 2J8WA 3L1MA 2QLAA 4L6RA 4ER9A 4JKVA 2XL6A 4D4XA 3TOMA 3M4CA 3DE8A 2XLDA 2J9BA 2XLOA 4U9DA 5JSLA 1NBBA 5AGFA 3TOLA 3ZQYA 3C62A 1CGNA 4IAQA 5JLIA 2YLDA 2BC5A 3HNLA 3U8PA 3DE9A 1M6TA 4CDAA 3QW0A 1CGOA 3C63A 4CDYA 4ULVA 2YLGA 1CPRA 3QVZA 1YYXA 2YL3A 2YLIA 1S05A 2XLMA 5B3IA 4JEBA 1RCPA 4D4NA 3VRCA 3NMIA 4CJOA 3M15A 4EIYA 3HNKA 3IQ5A 2CCYA 3QVYA 4U9EA 1GQAA 2XLVA 3ZTMA 4IARA 1YZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQV A;  4CX9 A;  1E84 A;  4N6H A;  4JE9 A;  1JAF A;  2XM4 A;  1QQ3 A;  1E86 A;  256B A;  5JVE A;  3ZQV A;  1YYJ A;  1QPU A;  3NMK A;  4WGY A;  2XLE A;  1EKY A;  2XL8 A;  4CDV A;  2XM0 A;  2YKZ A;  3HNI A;  2XLW A;  1A7V A;  2YL1 A;  4WGZ A;  2XLH A;  3QW1 A;  1CPQ A;  1BBH A;  1APC A;  1E83 A;  4CIP A;  1E85 A;  3FOO A;  5JT4 A;  2YL7 A;  4N4W A;  5JRA A;  1LM3 B;  3ZTZ A;  3HNJ A;  2YL0 A;  5JP7 A;  4CJG A;  4NC3 A;  1YZA A;  3FOP A;  5JUA A;  3ZWI A;  4JEA A;  3M4B A;  3M79 A;  5JS5 A;  4IB4 A;  3IQ6 A;  3NMJ A;  2J8W A;  3L1M A;  2QLA A;  4L6R A;  4ER9 A;  4JKV A;  2XL6 A;  4D4X A;  3TOM A;  3M4C A;  3DE8 A;  2XLD A;  2J9B A;  2XLO A;  4U9D A;  5JSL A;  1NBB A;  5AGF A;  3TOL A;  3ZQY A;  3C62 A;  1CGN A;  4IAQ A;  5JLI A;  2YLD A;  2BC5 A;  3HNL A;  3U8P A;  3DE9 A;  1M6T A;  4CDA A;  3QW0 A;  1CGO A;  3C63 A;  4CDY A;  4ULV A;  2YLG A;  1CPR A;  3QVZ A;  1YYX A;  2YL3 A;  2YLI A;  1S05 A;  2XLM A;  5B3I A;  4JEB A;  1RCP A;  4D4N A;  3VRC A;  3NMI A;  4CJO A;  3M15 A;  4EIY A;  3HNK A;  3IQ5 A;  2CCY A;  3QVY A;  4U9E A;  1GQA A;  2XLV A;  3ZTM A;  4IAR A;  1YZC A; 
#chains in the Genus database with same CATH topology
 4A4A A;  2E87 A;  1YAU O;  4XTK A;  1OCZ C;  3KYI A;  4NTA A;  1QSP A;  3EHN A;  3B9Q A;  5FZT A;  3ZIB A;  2EIK C;  1R4T A;  3QMK A;  4JE9 A;  4Z9J A;  1YDI A;  1ZHW A;  1ZW2 A;  2Y3G A;  1W2W A;  2CDQ A;  3AG4 C;  4PJN A;  2HZ8 A;  2OKU A;  4O6N A;  2EIM C;  4WAB A;  5IY5 C;  4N6C A;  1M2O A;  5JVE A;  2XSE A;  3S0X A;  1YYJ A;  1WAT A;  1QPU A;  1BR2 A;  3AG2 C;  4JCZ A;  2R02 A;  2YQY A;  5E3A A;  3O39 A;  3JYH A;  2KGO A;  4CSA A;  3V5X A;  2XS8 A;  3AG1 C;  1EKY A;  4MND A;  1BZ4 A;  4EBK A;  3RQG A;  3CEX A;  4J30 B;  1LVK A;  1F1M A;  2L6G A;  3V7O A;  2YL1 A;  3K1I A;  1YAR O;  2CNW D;  3C8Z A;  4C7O B;  1FR0 A;  3B0P A;  2R7W A;  2ZPA A;  2Q7R A;  4OIN F;  2GA0 A;  1S7Z A;  1O3U A;  4C3B A;  2Y69 C;  1MND A;  1LIH A;  2J7P D;  2HJ3 A;  2EIL C;  2WVN A;  5DS6 A;  3SXY A;  1E83 A;  1U6H A;  5CIV A;  3C8G A;  4EUK B;  1E85 A;  3FXH A;  3R7C A;  4YT2 A;  2NUP A;  2YL7 A;  1N1C A;  3KPH A;  3LEV A;  2YEV A;  4DOZ A;  3MYF A;  3JRT A;  4N4W A;  5AC4 A;  1C17 M;  4XLN F;  4OIO F;  1ZHX A;  3ZTZ A;  2DI3 A;  4D4N A;  4AE4 A;  3LLI A;  3NYJ A;  2G3K A;  2J45 A;  4G7H F;  1EQ1 A;  1NFN A;  4NC3 A;  2A68 F;  1H7I A;  2Q00 A;  2WVO A;  5DS5 A;  2OG2 A;  2Y3H A;  1VMA A;  1Y4C A;  3T6J A;  1VTM P;  2HV6 A;  2Q9C A;  4EBJ A;  1AVO B;  2CW0 F;  2HUJ A;  4GEH A;  2LFD A;  4W8P A;  4ANJ A;  3ECS A;  1HY5 A;  5BQI A;  5L0C A;  2L7A A;  5L3V A;  4U5H A;  3U2L A;  3S27 A;  1VYI A;  4MVR A;  2R7O A;  3L8I A;  1XZP A;  4PJL A;  3IQ6 A;  4FAP B;  4PJJ A;  3S28 A;  3TK0 A;  4H4K C;  3L1M A;  3S9O A;  1I5N A;  3K1H A;  4NQF A;  3ZC4 A;  3A11 A;  2ZXO A;  1OW6 A;  3FHD A;  4JKV A;  4MW3 A;  2VCA A;  4ER9 A;  2L6F A;  3NDB B;  5B3S C;  1TWA A;  3TOM A;  3LNR A;  3KYJ A;  3QTH A;  2BL2 A;  2WB7 A;  1K04 A;  3DE8 A;  3NKD A;  3ZDL A;  1KNY A;  2KC3 A;  4QI2 A;  3EJN A;  5D91 A;  3X2Q C;  2G62 A;  1Q0K A;  4CS9 A;  2P7V A;  1ZU4 A;  3ZQY A;  3C62 A;  2LQG A;  3KH2 A;  1CGN A;  5T3T A;  1H6G A;  4BJ1 A;  2PX0 A;  4LER A;  1Z3I X;  4MVM A;  2R7T A;  2AWC A;  1EI7 A;  2Z15 A;  1ZHZ A;  3QW0 A;  2CNW A;  3GEE A;  1CGO A;  4CDA A;  1SF8 A;  2LSE A;  4ULV A;  3VM6 A;  1O5H A;  2J9U A;  4I1O B;  3V5Z A;  1CPR A;  2PF4 E;  2J7P A;  1C02 A;  4K1O A;  3SYN A;  2YL3 A;  4JTD B;  4JW1 A;  4DBR A;  4JJF A;  4BG0 A;  2Y3D A;  2NUP B;  1NU7 D;  2R9R B;  1WGW A;  2PNO A;  2HMQ A;  2OEX A;  2PBE A;  4MQ9 F;  4Q7C A;  4PJM A;  5E3C A;  3SZR A;  1M56 C;  1TWG A;  1T6U A;  1H9T A;  2QTV A;  1M2V A;  3M15 A;  1ZHT A;  2EIN C;  1YA9 A;  4AE4 B;  1HMD A;  2QNL A;  3HTK C;  4KBL A;  3GEI A;  4F4B A;  4IGG A;  2ICW G;  4O7G A;  1I4Y A;  4LAC B;  1OCR C;  2W9Y A;  4BPM A;  1V54 C;  3LUT B;  1OW8 A;  2Q4F A;  4XPY A;  1GQA A;  2EPK X;  3ITF A;  5L3Q A;  3J06 A;  1Q0F A;  2B0J A;  2XLV A;  4U5F E;  4MTO A;  4NCQ A;  3S90 A;  1MQV A;  3DI5 A;  3GWN A;  3DAG A;  4JUR I;  2XRH A;  3NRH A;  1RMV A;  2Y3B A;  3IEE A;  2F22 A;  4N6H A;  3R2P A;  3RW0 A;  4E17 A;  5DVW A;  3MLG A;  1JAF A;  3VYW A;  4MVO A;  2XM4 A;  4C3E A;  1OCC C;  1D0Y A;  1OXK A;  1E86 A;  256B A;  3F46 A;  2OEV A;  5D92 A;  3UNG C;  2R7U A;  4G7O F;  3WOD F;  1Y6D A;  1FMW A;  2EIJ C;  3NMK A;  1TFO B;  3K1I C;  1YVI A;  1ST6 A;  4I1M A;  2XLE A;  1OKK D;  2J0W A;  2IXN A;  4NTB A;  1KTM A;  3G4X A;  4B6I A;  1VK5 A;  2XM0 A;  2YKZ A;  2Q3T A;  4I44 A;  1PV3 A;  2WVQ A;  1YJG A;  2P0N A;  4WGZ A;  4JVS A;  3FVY A;  5A6B D;  4XLP F;  2BE5 F;  5BQG A;  5JUA A;  2RD9 A;  2A6H F;  1Q0M A;  5COM A;  1BBH A;  1MNE A;  1VYK A;  4N06 A;  4A2N B;  2NSF A;  2A69 F;  1APC A;  2R03 A;  3KKB A;  1U89 A;  4KNV A;  2OOC A;  2C03 A;  3LJB A;  4CIP A;  4IRU A;  3DJU B;  5JT4 A;  2CGE A;  4GYT A;  1TR2 A;  2C04 A;  4FX5 A;  5JRA A;  4MVS A;  2PP4 A;  3FMS A;  3RH3 A;  4U5G A;  4CJG A;  1SYQ A;  3RKO F;  3RFY A;  1NG1 A;  2KYH A;  2PX3 A;  2YHS A;  3ABL C;  3CSK A;  4MVZ A;  1M2V B;  1IZM A;  4G7Z F;  1EA8 A;  3K33 A;  4IJJ A;  1OW7 A;  4DRJ B;  4R32 A;  1ZW3 A;  3GM1 A;  4FWV A;  3GWL A;  3DJN B;  3IHU A;  3MX3 A;  4LLE A;  2LK4 A;  2VB6 A;  2KQ9 A;  3F47 A;  4NTF A;  4U5C E;  4QI0 A;  2LP4 A;  1GGQ A;  3LNM B;  1LS4 A;  5T3W A;  3SP1 A;  2RSE B;  4AL1 A;  5F5F A;  3U8V A;  5GPG B;  1HW2 A;  3GM2 A;  4XWJ A;  4K0D A;  2H7O A;  1Q0D A;  2MWQ A;  3K66 A;  1ORS C;  3NMJ A;  4DRI B;  3HKK A;  1A41 A;  4L6R A;  3ZVR A;  4OIP F;  4J7Y A;  3Q6N A;  3HLZ A;  4CS9 C;  3M1C B;  1A0B A;  2ZXP A;  4D4X A;  4QDL A;  1V55 C;  3LAY A;  4MS2 A;  3G50 A;  3W8H A;  1FTS A;  4YT8 A;  2OU6 A;  4U9D A;  1QZX A;  1RXQ A;  2HV7 A;  3BRJ A;  3JSZ A;  4NY3 A;  5JSL A;  3RIP A;  4DRH B;  1AUE A;  1NBB A;  2JPU A;  4G78 A;  3UMK A;  1OKK A;  1ZHY A;  1U0B B;  1HE9 A;  2HJM A;  3EFO A;  1BR4 A;  2YLD A;  2BC5 A;  3HNL A;  4HE8 D;  3DE9 A;  3UMI A;  3EPV A;  1Z5Z A;  5AC5 A;  1M6T A;  3EQL F;  3EHM A;  3U9M A;  4J7T A;  3Q6M A;  3C63 A;  4CDY A;  5A6B A;  5L0J A;  2JD3 A;  3AGU A;  2X51 A;  4PFO A;  2VCC A;  5B1A C;  1J8M F;  1O87 A;  2YLG A;  3QVZ A;  3PCV A;  2HMZ A;  1YYX A;  2OCC C;  1YLM A;  1TQG A;  2NUT A;  3TJ6 A;  2D5R B;  4LDQ A;  3L34 A;  4MTF A;  3L0I A;  4KC9 A;  1T6I A;  4P9F A;  4JRZ A;  3C7J A;  1A7E A;  3JSE O;  1RCP A;  3FDQ A;  3Q7G A;  4I3M A;  3I4U A;  4ONS A;  4PR9 A;  3NMI A;  1OR2 A;  1MMN A;  4CJO A;  2CCY A;  5KYW A;  1TKN A;  1G4W R;  2A1D D;  2Q9B A;  3LS0 A;  4E7S A;  2R7S A;  4CBE A;  3ASN C;  3KL4 A;  1LI7 A;  3AJM A;  3T4R A;  1D0Z A;  2YRF A;  1ORY A;  5DS4 A;  4IAR A;  2M64 A;  1Z6A A;  2GAQ A;  3CQZ A;  4CX9 A;  4E0I A;  1Q0G A;  1UG7 A;  2AU5 A;  3H65 A;  4WJ0 A;  3O55 A;  4YJW A;  4YWQ A;  5EHH A;  1RJ9 A;  4KNW A;  2A6E F;  1LKX A;  4X0R A;  1QQ3 A;  2DGJ A;  1PD0 A;  3IQC A;  3K6B A;  3NYL A;  3ZQV A;  3EG9 A;  3LES A;  2H7V C;  3WHN A;  4ZLD A;  1LI5 A;  5L0F A;  3U2M A;  2LFF A;  2W4M A;  5DQT A;  4E7Z A;  2KW3 C;  1QVX A;  4E18 A;  4RBN A;  2XL8 A;  4EHP A;  4JIO A;  4CDV A;  2L9J A;  3T9O A;  2W45 A;  1BDJ B;  2XLW A;  3HNI A;  3NYM A;  3X1O A;  1A7V A;  4XEK A;  2XLH A;  3TD7 A;  3DM9 B;  3KMI A;  4OD4 A;  2L6H A;  3S84 A;  4YT4 A;  3EFO B;  1CPQ A;  3DMD A;  4DXW A;  5EK0 A;  2FAP B;  4U5D E;  3W8I A;  5A6A A;  5COG A;  2ZD9 A;  5L0D A;  3RVY A;  2G3V A;  3UR3 C;  1TFK B;  1LPE A;  1NSG B;  3CZ6 A;  1L3P A;  3DM5 A;  4OIR F;  4AX2 A;  4EBB A;  3ZG1 A;  2NUT B;  3SNH A;  3DKA A;  2IXO A;  4XQ1 A;  1LM3 B;  2QY9 A;  3GM3 A;  1I4Z A;  3HNJ A;  2IM8 A;  2YL0 A;  3SXZ A;  4G0H A;  1FFH A;  1B68 A;  5JP7 A;  2HKV A;  5DQZ A;  4YL3 A;  3W2W A;  3PDM P;  2DB4 A;  3FAP B;  2Y39 A;  4YK5 A;  4YL0 A;  5A6J A;  4UDV A;  5A69 A;  2A0U A;  5KYW B;  2R7R A;  3RQE A;  2AP3 A;  3JT1 A;  2ETS A;  2XS1 A;  4MTG A;  2XXA A;  1LE4 A;  4W8K A;  3PMR A;  1DOV A;  1QLE C;  2NSG A;  3B29 A;  3JZ0 A;  3IPM O;  3M4B A;  3M79 A;  5L0G A;  1JOG A;  2XL4 A;  3EZH A;  5TJ5 E;  5KYX A;  3T6G B;  1CGM E;  2FFH A;  1WOL A;  2IXP A;  3VF0 A;  1RKC A;  1VOM A;  4YL1 A;  2J8W A;  3VAY A;  2MYS A;  2QLA A;  3WG7 C;  2O9X A;  1RJ9 B;  1GS9 A;  2WL8 A;  3RF3 A;  2OJE D;  2XL6 A;  4CS8 A;  2P6V A;  1HMO A;  3EGX B;  2VC9 A;  4MVU A;  3M4C A;  2HFI A;  1FFT C;  2KNH A;  1NLX A;  2XLD A;  2J9B A;  3EG9 B;  3JCU Q;  3JRM O;  4PFP A;  3QZC A;  5CI8 A;  3U3B A;  4CIH A;  4O6M A;  1FNT c;  4Q5S F;  5AGF A;  3TOL A;  5HV9 A;  4IAQ A;  3EH1 A;  5JLI A;  1T01 A;  1PD1 A;  2EPL X;  3LS1 A;  3GOD A;  2WZF A;  1LE2 A;  4GQH A;  2L81 A;  1D1A A;  4BJT A;  1XWJ A;  5KYN A;  4P6I C;  2EPO A;  5F28 E;  1L7C A;  2LCH A;  2AVK A;  2LIG A;  3ATP A;  3C18 A;  3K7D A;  3S29 A;  5E33 A;  3O6X A;  3EGD A;  1WN0 A;  2J46 A;  3A9C A;  1T9K A;  3CAX A;  5EGY A;  3ZSU A;  5B3I A;  5FCL A;  3RYL A;  1MMA A;  1WAS A;  2PFD A;  5KYU A;  5K0I A;  3EZI A;  2NPU A;  4JC7 A;  3VRC A;  1SZI A;  3NKE A;  3RQF A;  4IWB A;  3IQ5 A;  4RD9 A;  1ZYR F;  1JPN A;  3N2Z B;  2TMV P;  3SXM A;  1QKR A;  1D1B A;  4JCH A;  4U9E A;  3IQT A;  2ZXW C;  4LLC A;  1VLT A;  1WWP A;  2R7X A;  5L0H A;  2V3C C;  1YZC A;  3H2V A;  4J32 B;  2XXA B;  4RDA A;  1JRA A;  1E84 A;  1SR2 A;  2W4B A;  3MYI A;  5T1D B;  4O79 A;  1H9G A;  4YN0 B;  2VCB A;  4BEJ A;  1DOW A;  1HE1 A;  2ASR A;  1RKE A;  4ULW A;  4Z9I A;  3B0V C;  5KYX B;  1OR3 A;  3JYY A;  3N24 A;  2QUP A;  2H8A A;  3LEO A;  4DVY P;  1XZQ A;  4U5B E;  1J8Y F;  1KU2 A;  2IYL D;  2OJQ A;  2R7Q A;  2WZG A;  4DBQ A;  3RVZ A;  2HSQ A;  4WGY A;  4BJ6 C;  4LDK A;  3PHF 2;  4H54 A;  3UGO A;  2GFH A;  2R25 A;  3US6 A;  3JTL O;  2OQM A;  2YVK A;  3BEH A;  1T5O A;  2V26 A;  4HEA J;  5L0I A;  3E70 C;  3DWW A;  3TJ5 A;  1ZVZ A;  2M4E A;  3WAQ A;  2AWY A;  1TWH A;  3T6B A;  1FAP B;  2FGY A;  2I8B A;  3AOU A;  3QW1 A;  2J9V A;  5BUO A;  4CSA C;  1LS1 A;  2VH3 A;  3AQB A;  2UUI A;  4MW8 A;  4XEV A;  4C3D A;  1NZE A;  4Q4Z F;  1D1C A;  3U0C A;  1VLS A;  1IW7 F;  3FOO A;  4M63 A;  4FES A;  1JPJ A;  4KI2 A;  4HFF B;  3EH2 A;  3EGD B;  1V4A A;  3Q7L A;  5HSW A;  1WTY A;  1SMY F;  1OQC A;  3EGX A;  3H2U A;  2I15 A;  2JX0 A;  3L8J A;  2DYR C;  3UMH A;  3W2V A;  1E2X A;  2R05 A;  5KYU B;  1YZA A;  3B0U X;  3OWT A;  1Z23 A;  2LD6 A;  4K7B A;  3FOP A;  2CYD A;  5KYY A;  4IAO A;  3POV A;  3U5S A;  3DZA A;  3ABK C;  4YT5 A;  3GAN A;  3ZWI A;  3ASO C;  4BJ6 A;  4JEA A;  2KSF A;  1Z63 A;  4BJ5 C;  3B71 A;  4JZA A;  2Q9A A;  5B1B C;  5DLJ A;  3TUL A;  5JS5 A;  2H7B A;  4IB4 A;  1G8X A;  2IXM A;  1ZU5 A;  4CS8 C;  4PK4 A;  4P9T A;  4EWC A;  2GWW A;  1NU9 C;  1OCO C;  1ORJ A;  3C8G B;  1RKE B;  2GDC A;  3AQC A;  3E9V A;  1K05 A;  1R5I D;  3MFN A;  3GOR A;  5BQH A;  3W4Y A;  1TWC A;  1UFB A;  1JR8 A;  2XLO A;  2IBF A;  3OA1 A;  4BEM J;  1MMD A;  2WZL A;  4LDR A;  1G5Z A;  1G4U S;  1FMV A;  4MVQ A;  4DJ9 A;  3DD7 A;  1ZZP A;  1M57 C;  3U3F A;  3I5P A;  4C7O A;  1C03 A;  3UGP A;  1T6Q A;  2QE9 A;  3DXJ F;  3SXK A;  3U8P A;  1V74 B;  2HSB A;  2YZS A;  1OXB A;  4JTC B;  5A6K A;  1GM5 A;  2B0H A;  2YWA A;  4HFK B;  3C8G D;  2J9W A;  5CI9 A;  3TQO A;  2EPM X;  1D0X A;  3DAF A;  4XPW A;  4OD5 A;  2A0B A;  2KK1 A;  3LLK A;  4EKW A;  2EPN A;  5COF A;  2ZXR A;  4U5E E;  4OIQ F;  3OEO A;  1PCX A;  1NFO A;  4O6Y A;  1Z7Q c;  1BR1 A;  2DYS C;  2IOQ A;  3I5Q A;  5F5H A;  2X0C A;  2YLI A;  1S05 A;  2KJG A;  4AL0 A;  4BJ5 A;  3GEH A;  2XLM A;  4JEB A;  2NG1 A;  4E0H A;  2UUH A;  4JTA B;  3O10 A;  1HW1 A;  5E2Q A;  4AK9 A;  4XEF A;  2J0X A;  4XPX A;  3FAJ A;  3HJC A;  4PAC A;  4EIY A;  3HNK A;  4Z9H A;  1MMG A;  3V5Y A;  1AEP A;  3SEO A;  3NG1 A;  3QVY A;  1JMW A;  2MHR A;  3N0T A;  2R7V A;  4CS7 A;  1K40 A;  2HS5 A;  1YA7 O;  4ZLC A;  3AG3 C;  3U9J A;  2P1A A;  2P61 A;  4JJG A;  5KYY B;  1VB5 A;  3ABM C;  2VAS A;  3ZTM A;  3G4Z A;  4DVZ A;  3MBG A;  1A7D A;  2D4U A;  3AGT A; 
#chains in the Genus database with same CATH homology
 1MQV A;  4CX9 A;  1E84 A;  4N6H A;  4JE9 A;  1JAF A;  2XM4 A;  1QQ3 A;  1E86 A;  256B A;  5JVE A;  3ZQV A;  1YYJ A;  1QPU A;  3NMK A;  4WGY A;  2XLE A;  1EKY A;  2XL8 A;  4CDV A;  2XM0 A;  2YKZ A;  3HNI A;  2XLW A;  1A7V A;  2YL1 A;  4WGZ A;  2XLH A;  3QW1 A;  1CPQ A;  1BBH A;  1APC A;  1E83 A;  4CIP A;  1E85 A;  3FOO A;  5JT4 A;  2YL7 A;  4N4W A;  5JRA A;  1LM3 B;  3ZTZ A;  3HNJ A;  2YL0 A;  5JP7 A;  4CJG A;  4NC3 A;  1YZA A;  3FOP A;  5JUA A;  3ZWI A;  4JEA A;  3M4B A;  3M79 A;  5JS5 A;  4IB4 A;  3IQ6 A;  3NMJ A;  2J8W A;  3L1M A;  2QLA A;  4L6R A;  4ER9 A;  4JKV A;  2XL6 A;  4D4X A;  3TOM A;  3M4C A;  3DE8 A;  2XLD A;  2J9B A;  2XLO A;  4U9D A;  5JSL A;  1NBB A;  5AGF A;  3TOL A;  3ZQY A;  3C62 A;  1CGN A;  4IAQ A;  5JLI A;  2YLD A;  2BC5 A;  3HNL A;  3U8P A;  3DE9 A;  1M6T A;  4CDA A;  3QW0 A;  1CGO A;  3C63 A;  4CDY A;  4ULV A;  2YLG A;  1CPR A;  3QVZ A;  1YYX A;  2YL3 A;  2YLI A;  1S05 A;  2XLM A;  5B3I A;  4JEB A;  1RCP A;  4D4N A;  3VRC A;  3NMI A;  4CJO A;  3M15 A;  4EIY A;  3HNK A;  3IQ5 A;  2CCY A;  3QVY A;  4U9E A;  1GQA A;  2XLV A;  3ZTM A;  4IAR A;  1YZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...