1LS4A

Nmr structure of apolipophorin-iii from locusta migratoria
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
164
structure length
164
Chain Sequence
b'RPDAAGHVNIAEAVQQLNHTIVNAAHELHETLGLPTPDEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNAFARNLNNSIHDAATSLNLQDQLNSLQSALTNVGHQWQDIATKTQASAQEAWAPVQSALQEAAEKTKEAAANLQNSIQSAVQKPAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipophorin-III
publication title NMR solution structure and dynamics of an exchangeable apolipoprotein,locusta migratoria apolipophorin III.
pubmed doi rcsb
source organism Locusta migratoria
molecule tags Lipid transport
total genus 52
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2002-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ls4A00
1LS4A 3R2PA 3S84A 1EQ1A 1NFOA 1LE4A 1GS9A 1AEPA 1EA8A 1LPEA 1BZ4A 1OR2A 1OR3A 1H7IA 1YA9A 1B68A 1LE2A 2KC3A 1NFNA
chains in the Genus database with same CATH superfamily
4PR9A 1AVOB 1FMWA 4CDAA 1E86A 3M4CA 3FAJA 1G5ZA 1O87A 3C8GB 1E85A 1LE4A 2KNHA 2VCBA 2WZLA 3Q7LA 2IYLD 1I5NA 4YT4A 2RD9A 3LLKA 3V5YA 1MNDA 2JPUA 4BEMJ 3AG1C 1D0YA 3FMSA 3FOPA 1FAPB 1FFTC 3JZ0A 5DQTA 4EIYA 1OCZC 2Q9BA 4Z9JA 3SNHA 2HSQA 4H54A 4IJJA 3SXYA 2L6FA 3K1IA 2P1AA 3RQFA 2UUHA 4AL1A 2PNOA 1XZPA 1GGQA 1RCPA 2EIMC 3NKEA 2YLGA 4NTAA 3W8IA 2DYRC 1JPJA 3F47A 4MQ9F 4AE4B 3IPMO 5B1BC 1PCXA 1Q0DA 3FAPB 1VLSA 2J9VA 1ZHWA 2XLWA 4JJGA 1ZVZA 4YJWA 2HS5A 1MQVA 3UMIA 5KYWA 1M2OA 1YDIA 3KH2A 3ZG1A 4C3BA 4JIOA 5KYXA 3B0UX 2R7XA 1M56C 3GEEA 2XLHA 4O6YA 5KYUB 2F22A 3EH1A 2LD6A 4U5DE 1VYKA 4JCZA 3FOOA 2WB7A 4OD4A 4BJ6C 4P9FA 2YHSA 1FNTc 2Y3HA 1DOWA 1RKCA 3DJNB 3ABKC 5JT4A 5L3QA 4JEAA 5EGYA 3C62A 3EZHA 1KTMA 3EGDB 1XWJA 1JAFA 1VK5A 3Q7GA 1ZHYA 3W4YA 1QQ3A 5F5HA 2YRFA 4CS8C 3DE8A 3U3FA 1VMAA 1NG1A 3S27A 4BJ5C 4G0HA 3H65A 2D4UA 3HNLA 1HE1A 2E87A 3DKAA 5FCLA 2EPLX 2V26A 3HNKA 2CYDA 2HJMA 3MX3A 4Q7CA 4AL0A 2LP4A 4H4KC 1MNEA 2EIKC 1DOVA 3MBGA 4XPXA 1T6UA 5L3VA 3U9MA 2Q7RA 3RIPA 2A69F 3IQTA 4E0IA 1EKYA 2FAPB 2R25A 2OQMA 2XXAA 3RQEA 1SF8A 3K33A 3UMHA 2O9XA 1RXQA 2Y3GA 1AEPA 4DVYP 4MW8A 1Y6DA 5E3AA 1Z7Qc 3LNRA 1Z63A 2L6GA 4UDVA 3JT1A 4WGZA 1WASA 1D1CA 1D1AA 1Q0FA 1ZW2A 4YT5A 2CW0F 3DD7A 4XQ1A 1PV3A 4K1OA 3CAXA 1I4YA 4ER9A 2WVQA 4PK4A 3ZTZA 4B6IA 1YA7O 1IZMA 4MW3A 3AG3C 4KNVA 1TQGA 4CX9A 5F28E 4BG0A 2HMZA 2R02A 2R7OA 1LIHA 2NUTB 3AOUA 3GORA 3EG9B 5E3CA 3DAFA 4ANJA 1JMWA 2HSBA 2XS8A 4PJNA 3RW0A 2OG2A 3PMRA 2X51A 1EI7A 3JSZA 3T6GB 3NMIA 3C63A 4JTDB 5BUOA 2YVKA 3KKBA 2CNWA 2H7BA 5GPGB 4MVMA 4EBJA 2H8AA 2AWCA 2A6HF 2D5RB 2YL3A 4YT2A 2RSEB 3QVYA 4IRUA 4E7SA 2R05A 4RD9A 2XXAB 2KSFA 3AGTA 3C18A 3KPHA 1Q0GA 4DOZA 4LDKA 1JRAA 2W9YA 2XLDA 3DJUB 4BJTA 4N06A 1KU2A 2A1DD 4E18A 1YLMA 5B3IA 3GEHA 3DM5A 3C8GA 3JSEO 2OOCA 1LM3B 3L1MA 4YK5A 3GWLA 3TJ5A 4XEVA 4YL1A 4RBNA 4JEBA 1OW7A 3QW1A 3TULA 2XRHA 3LEOA 4PACA 1I4ZA 3RVYA 2L7AA 1CGOA 2QLAA 1BDJB 3SXKA 1U89A 1V74B 1QZXA 1ZHXA 2AP3A 2L81A 2ZXPA 2IBFA 3K1HA 4AE4A 5IY5C 2Z15A 5L0CA 3LJBA 4ONSA 1OCRC 4BJ1A 1T6IA 2YL7A 4O79A 1TFKB 2BL2A 3MFNA 1TFOB 2EIJC 3BEHA 3HNJA 1VTMP 5D91A 3DE9A 2Y3DA 4Z9HA 5KYYB 1UFBA 1YVIA 4ULWA 2A6EF 3ABMC 3EHMA 4MVZA 4JVSA 3UGOA 3LLIA 3AG2C 1J8YF 4OD5A 2LK4A 5K0IA 4CS9C 2NG1A 1B68A 3HJCA 3WAQA 4XWJA 2IXMA 2OEVA 3LNMB 4EUKB 1WN0A 3QMKA 2R7RA 1NFNA 3EGDA 3TOLA 4A4AA 4G7OF 3GEIA 4K7BA 3R2PA 3R7CA 3JRTA 2VCAA 3SZRA 1XZQA 2CGEA 2OEXA 3W2VA 2JD3A 3G50A 3X1OA 4FAPB 3JRMO 5EHHA 3O6XA 3IQCA 2Q9AA 3VM6A 2EINC 3LAYA 3M4BA 4LLCA 1TWGA 4U5CE 3O55A 2I8BA 3MYFA 3GM3A 3K66A 4PJJA 5AC4A 2GDCA 3J06A 2LIGA 2P6VA 1OW8A 1QPUA 3U9JA 2PF4E 5JSLA 5BQIA 2LFFA 2TMVP 1W2WA 2DB4A 2YWAA 3NYLA 4CS7A 5TJ5E 4OIOF 4J7YA 4NTFA 4AX2A 2EPKX 5A6BA 4N6CA 4E7ZA 2PP4A 2OKUA 2WL8A 2ZXOA 3K6BA 3HTKC 2YQYA 4ZLDA 2WVNA 2J9UA 2YZSA 2A68F 1OQCA 3HNIA 4XEKA 2IXPA 3RF3A 4NQFA 3DAGA 5COFA 1QLEC 1T9KA 3DMDA 2QE9A 3ECSA 2P0NA 3NYMA 4EBBA 3S84A 5HSWA 2CCYA 3EHNA 1EQ1A 2HZ8A 2CNWD 4EBKA 1CGNA 2XLEA 2V3CC 4JURI 5DS6A 3U8VA 5JRAA 4YT8A 4I3MA 3B9QA 1H9TA 2ZXWC 4W8PA 5A6KA 3LS1A 3LUTB 3C8GD 4XLNF 4U5FE 2NUTA 2XLVA 2DI3A 3EG9A 4PFPA 2YLDA 5CI9A 4OINF 4O7GA 3KYIA 3LESA 3QTHA 1M57C 4IGGA 4XPYA 3G4XA 3AG4C 2KGOA 3NMJA 1K04A 1NLXA 2Y3BA 1OKKD 4U9DA 3RQGA 1YYJA 1TR2A 2GA0A 4FESA 5FZTA 4PJLA 1J8MF 1LKXA 1YAUO 3FHDA 4PJMA 1E84A 4Q4ZF 3NYJA 2DYSC 4N6HA 1C02A 1LS4A 3S9OA 3V5XA 4HE8D 1MMNA 4I1OB 1E2XA 4JW1A 2J9BA 4Z9IA 3RVZA 4CJGA 1GS9A 3HLZA 4C3DA 2KK1A 1RJ9A 1MMDA 1ORYA 3KYJA 1R4TA 2HJ3A 2XM4A 1LVKA 1ZU4A 2OJED 3KMIA 4JTAB 3V5ZA 4KI2A 1QKRA 1K05A 2XM0A 2JX0A 1SZIA 4P9TA 5BQHA 3IQ6A 2G62A 2QY9A 1C03A 2J45A 2EPNA 5DVWA 1ZHTA 1GQAA 3I5QA 4EKWA 1VYIA 4KC9A 2HFIA 3NRHA 3OEOA 4QI0A 4DBRA 4OIQF 3K7DA 2FFHA 3U2MA 1BR2A 1H7IA 1U6HA 3ZTMA 2LQGA 3A9CA 2ZXRA 3Q6MA 1A0BA 3RYLA 4XTKA 2XSEA 2EPOA 3WG7C 2L9JA 2XS1A 2M4EA 1A7VA 3U2LA 3UMKA 4CSAC 1HY5A 4FWVA 4DXWA 1D0ZA 1ZHZA 4CJOA 1A7EA 1H6GA 2YEVA 3ASOC 3IQ5A 5DQZA 3QVZA 4R32A 3CZ6A 5KYYA 5T3TA 2PBEA 3MYIA 5HV9A 3VF0A 1G4WR 1V55C 4BJ6A 4WABA 1SYQA 2VH3A 3H2VA 4U5GA 4EHPA 4KBLA 4DBQA 1FMVA 3NMKA 4LERA 4BPMA 5A6BD 3RH3A 4C7OB 2R03A 2XLOA 3SXZA 1YZCA 4GEHA 1O3UA 2R7VA 3DM9B 5DLJA 1ST6A 5DS5A 1FR0A 5EK0A 4HEAJ 4CS8A 3PHF2 2VB6A 1RJ9B 3L8JA 4DRJB 5L0HA 4BJ5A 3M1CB 1O5HA 4IAOA 1Z6AA 3S90A 5JUAA 3EFOA 3GM2A 1T6QA 5COMA 1VB5A 4P6IC 4OIRF 4IWBA 3U8PA 4EWCA 1HMOA 4O6NA 3JYYA 5T1DB 1HE9A 1OKKA 1MMAA 2Q3TA 2WZFA 5E33A 3GWNA 4CDVA 4WGYA 3TQOA 1TKNA 1EA8A 2J7PA 2QUPA 3EZIA 1LPEA 1OW6A 2P61A 3ZQVA 1ZW3A 1C17M 4JZAA 3K1IC 1G8XA 3SYNA 1WWPA 1HW1A 2OCCC 3AGUA 4D4NA 4MVSA 3EGXA 5AC5A 4NY3A 1WTYA 3OWTA 2ZD9A 2A0BA 2GWWA 1Y4CA 4KNWA 4JE9A 3G4ZA 3B0VC 1RKEA 3US6A 2DGJA 4MVOA 4AK9A 1MMGA 1KNYA 4BEJA 4CIPA 3I5PA 4ULVA 5AGFA 2HV6A 2MYSA 1VOMA 2W4MA 2W4BA 4LDRA 3ZIBA 4A2NB 3O39A 4ZLCA 5L0DA 4O6MA 1Q0MA 4NC3A 1R5ID 1WATA 3JTLO 2NPUA 4L6RA 3IEEA 2NSGA 1BR4A 4MVUA 3TOMA 4YL3A 2B0JA 1OCCC 4LLEA 3EFOB 1UG7A 2X0CA 2QNLA 2C03A 2Q00A 3B0PA 1LS1A 2H7VC 2ICWG 3V7OA 1OXKA 4M63A 1ZYRF 2R7TA 3B71A 1Z23A 3AQCA 5A6JA 4XLPF 4C3EA 3ZC4A 1CPRA 1YA9A 4CBEA 4DRIB 1FFHA 4U5EE 2AU5A 4J30B 2YL1A 2BC5A 2AVKA 1YZAA 3EGXB 4W8KA 4DVZA 4IAQA 1L3PA 1IW7F 5T3WA 3ZQYA 3EJNA 2LCHA 2YLIA 3U5SA 1NFOA 3L8IA 4J7TA 3SXMA 3AJMA 3EH2A 3HKKA 4N4WA 1TWHA 1D1BA 4MVRA 4DJ9A 4E17A 5DS4A 1L7CA 1RKEB 3ASNC 2WZGA 3RFYA 4E0HA 3NDBB 2AWYA 3VAYA 3C7JA 3FDQA 1OR3A 3UGPA 1M2VA 5L0GA 2R7UA 2MHRA 4XEFA 1NBBA 5BQGA 2Y39A 5A6AA 1NZEA 3TJ6A 2KW3C 3S0XA 3S28A 5JLIA 1QSPA 2HMQA 4FX5A 4WJ0A 2IXNA 5KYNA 2GAQA 3OA1A 2W45A 4U5BE 3GODA 1WOLA 2HUJA 1T5OA 3IHUA 3DZAA 2OJQA 3U3BA 3ZVRA 4CS9A 1JPNA 2IXOA 1U0BB 1S05A 2J7PD 3PDMP 2QTVA 4X0RA 4C7OA 5CIVA 3DXJF 4MTGA 3ZSUA 2IM8A 4GQHA 2NSFA 2J9WA 2PX3A 1NU7D 2XL6A 4J32B 3FXHA 4JC7A 4MVQA 2PX0A 1HMDA 3EQLF 3TK0A 2KQ9A 3N2ZB 5JS5A 3W8HA 2MWQA 1BR1A 4QDLA 2IOQA 2ZPAA 1G4US 3E9VA 3QW0A 1LI5A 3UR3C 2B0HA 1H9GA 1V4AA 1SR2A 2WVOA 1Q0KA 1M2VB 2EILC 2KC3A 3F46A 3NKDA 3N24A 2KYHA 4MNDA 4K0DA 1RMVA 3JYHA 3M79A 3GANA 1SMYF 2XL4A 2FGYA 2P7VA 4IB4A 3ZWIA 2UUIA 4QI2A 2PFDA 5B3SC 5KYWB 3AQBA 1AUEA 3DI5A 2ETSA 5KYXB 2LSEA 1E83A 2G3VA 3ABLC 4LACB 1OR2A 2CDQA 3LS0A 4JTCB 1OXBA 4CDYA 1VLTA 1PD1A 1HW2A 4G7ZF 1Z3IX 1TWCA 2I15A 3H2UA 1WGWA 2G3KA 4XPWA 1YJGA 1TWAA 3UNGC 3T6BA 2R9RB 3MLGA 2VCCA 4JJFA 3VYWA 1FTSA 3EPVA 3KL4A 1K40A 1LE2A 3SP1A 2KJGA 3L34A 2R7QA 4MS2A 3X2QC 4CIHA 4G78A 5L0FA 2LFDA 4IARA 1D0XA 1QVXA 5B1AC 4Q5SF 4I1MA 3TD7A 3E70C 2J8WA 5A69A 256BA 2M64A 3SEOA 4YL0A 3BRJA 2NUPA 1NSGB 1M6TA 2J0WA 3T4RA 1BZ4A 1YARO 1ZZPA 2GFHA 2Q4FA 1JR8A 3WHNA 3POVA 3DWWA 3M15A 2Y69C 2J46A 3QZCA 2HKVA 1F1MA 2XLMA 1ORSC 5CI8A 4YWQA 4LDQA 3FVYA 1NU9C 4MTFA 4U5HA 3RKOF 4JRZA 2ASRA 3GM1A 3I4UA 4DRHB 2VC9A 1Z5ZA 3CEXA 3JCUQ 4MTOA 5E2QA 1CPQA 1LI7A 2H7OA 2OU6A 2YKZA 2A0UA 4YN0B 3T9OA 1PD0A 2EPMX 3A11A 5JP7A 2R7WA 3S29A 2BE5F 2Q9CA 3N0TA 4NCQA 1N1CA 2L6HA 4F4BA 3ITFA 5D92A 1BBHA 4CSAA 2YL0A 1CGME 1A41A 4D4XA 3ZDLA 1GM5A 1V54C 1APCA 3L0IA 3O10A 1YYXA 3W2WA 3CQZA 4U9EA 5F5FA 5COGA 1ORJA 4PFOA 4GYTA 2R7SA 1JOGA 2VASA 3ATPA 5JVEA 1T01A 1ZU5A 5KYUA 3T6JA 3WODF 1OCOC 4RDAA 4NTBA 1A7DA 3PCVA 3VRCA 4HFFB 3C8ZA 3B29A 5L0JA 4G7HF 2HV7A 2NUPB 4JCHA 4JKVA 5L0IA 2J0XA 3U0CA 3LEVA 3NG1A 4OIPF 3CSKA 3Q6NA 4HFKB 2C04A 4I44A 2XL8A 1S7ZA
chains in the Genus database with same CATH topology
1LS4A 3R2PA 3S84A 1EQ1A 1NFOA 1LE4A 1GS9A 1AEPA 1EA8A 1LPEA 1BZ4A 1OR2A 1OR3A 1H7IA 1YA9A 1B68A 1LE2A 2KC3A 1NFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS4 A;  3R2P A;  3S84 A;  1EQ1 A;  1NFO A;  1LE4 A;  1GS9 A;  1AEP A;  1EA8 A;  1LPE A;  1BZ4 A;  1OR2 A;  1OR3 A;  1H7I A;  1YA9 A;  1B68 A;  1LE2 A;  2KC3 A;  1NFN A; 
#chains in the Genus database with same CATH topology
 4PR9 A;  1AVO B;  1FMW A;  4CDA A;  1E86 A;  3M4C A;  3FAJ A;  1G5Z A;  1O87 A;  3C8G B;  1E85 A;  1LE4 A;  2KNH A;  2VCB A;  2WZL A;  3Q7L A;  2IYL D;  1I5N A;  4YT4 A;  2RD9 A;  3LLK A;  3V5Y A;  1MND A;  2JPU A;  4BEM J;  3AG1 C;  1D0Y A;  3FMS A;  3FOP A;  1FAP B;  1FFT C;  3JZ0 A;  5DQT A;  4EIY A;  1OCZ C;  2Q9B A;  4Z9J A;  3SNH A;  2HSQ A;  4H54 A;  4IJJ A;  3SXY A;  2L6F A;  3K1I A;  2P1A A;  3RQF A;  2UUH A;  4AL1 A;  2PNO A;  1XZP A;  1GGQ A;  1RCP A;  2EIM C;  3NKE A;  2YLG A;  4NTA A;  3W8I A;  2DYR C;  1JPJ A;  3F47 A;  4MQ9 F;  4AE4 B;  3IPM O;  5B1B C;  1PCX A;  1Q0D A;  3FAP B;  1VLS A;  2J9V A;  1ZHW A;  2XLW A;  4JJG A;  1ZVZ A;  4YJW A;  2HS5 A;  1MQV A;  3UMI A;  5KYW A;  1M2O A;  1YDI A;  3KH2 A;  3ZG1 A;  4C3B A;  4JIO A;  5KYX A;  3B0U X;  2R7X A;  1M56 C;  3GEE A;  2XLH A;  4O6Y A;  5KYU B;  2F22 A;  3EH1 A;  2LD6 A;  4U5D E;  1VYK A;  4JCZ A;  3FOO A;  2WB7 A;  4OD4 A;  4BJ6 C;  4P9F A;  2YHS A;  1FNT c;  2Y3H A;  1DOW A;  1RKC A;  3DJN B;  3ABK C;  5JT4 A;  5L3Q A;  4JEA A;  5EGY A;  3C62 A;  3EZH A;  1KTM A;  3EGD B;  1XWJ A;  1JAF A;  1VK5 A;  3Q7G A;  1ZHY A;  3W4Y A;  1QQ3 A;  5F5H A;  2YRF A;  4CS8 C;  3DE8 A;  3U3F A;  1VMA A;  1NG1 A;  3S27 A;  4BJ5 C;  4G0H A;  3H65 A;  2D4U A;  3HNL A;  1HE1 A;  2E87 A;  3DKA A;  5FCL A;  2EPL X;  2V26 A;  3HNK A;  2CYD A;  2HJM A;  3MX3 A;  4Q7C A;  4AL0 A;  2LP4 A;  4H4K C;  1MNE A;  2EIK C;  1DOV A;  3MBG A;  4XPX A;  1T6U A;  5L3V A;  3U9M A;  2Q7R A;  3RIP A;  2A69 F;  3IQT A;  4E0I A;  1EKY A;  2FAP B;  2R25 A;  2OQM A;  2XXA A;  3RQE A;  1SF8 A;  3K33 A;  3UMH A;  2O9X A;  1RXQ A;  2Y3G A;  1AEP A;  4DVY P;  4MW8 A;  1Y6D A;  5E3A A;  1Z7Q c;  3LNR A;  1Z63 A;  2L6G A;  4UDV A;  3JT1 A;  4WGZ A;  1WAS A;  1D1C A;  1D1A A;  1Q0F A;  1ZW2 A;  4YT5 A;  2CW0 F;  3DD7 A;  4XQ1 A;  1PV3 A;  4K1O A;  3CAX A;  1I4Y A;  4ER9 A;  2WVQ A;  4PK4 A;  3ZTZ A;  4B6I A;  1YA7 O;  1IZM A;  4MW3 A;  3AG3 C;  4KNV A;  1TQG A;  4CX9 A;  5F28 E;  4BG0 A;  2HMZ A;  2R02 A;  2R7O A;  1LIH A;  2NUT B;  3AOU A;  3GOR A;  3EG9 B;  5E3C A;  3DAF A;  4ANJ A;  1JMW A;  2HSB A;  2XS8 A;  4PJN A;  3RW0 A;  2OG2 A;  3PMR A;  2X51 A;  1EI7 A;  3JSZ A;  3T6G B;  3NMI A;  3C63 A;  4JTD B;  5BUO A;  2YVK A;  3KKB A;  2CNW A;  2H7B A;  5GPG B;  4MVM A;  4EBJ A;  2H8A A;  2AWC A;  2A6H F;  2D5R B;  2YL3 A;  4YT2 A;  2RSE B;  3QVY A;  4IRU A;  4E7S A;  2R05 A;  4RD9 A;  2XXA B;  2KSF A;  3AGT A;  3C18 A;  3KPH A;  1Q0G A;  4DOZ A;  4LDK A;  1JRA A;  2W9Y A;  2XLD A;  3DJU B;  4BJT A;  4N06 A;  1KU2 A;  2A1D D;  4E18 A;  1YLM A;  5B3I A;  3GEH A;  3DM5 A;  3C8G A;  3JSE O;  2OOC A;  1LM3 B;  3L1M A;  4YK5 A;  3GWL A;  3TJ5 A;  4XEV A;  4YL1 A;  4RBN A;  4JEB A;  1OW7 A;  3QW1 A;  3TUL A;  2XRH A;  3LEO A;  4PAC A;  1I4Z A;  3RVY A;  2L7A A;  1CGO A;  2QLA A;  1BDJ B;  3SXK A;  1U89 A;  1V74 B;  1QZX A;  1ZHX A;  2AP3 A;  2L81 A;  2ZXP A;  2IBF A;  3K1H A;  4AE4 A;  5IY5 C;  2Z15 A;  5L0C A;  3LJB A;  4ONS A;  1OCR C;  4BJ1 A;  1T6I A;  2YL7 A;  4O79 A;  1TFK B;  2BL2 A;  3MFN A;  1TFO B;  2EIJ C;  3BEH A;  3HNJ A;  1VTM P;  5D91 A;  3DE9 A;  2Y3D A;  4Z9H A;  5KYY B;  1UFB A;  1YVI A;  4ULW A;  2A6E F;  3ABM C;  3EHM A;  4MVZ A;  4JVS A;  3UGO A;  3LLI A;  3AG2 C;  1J8Y F;  4OD5 A;  2LK4 A;  5K0I A;  4CS9 C;  2NG1 A;  1B68 A;  3HJC A;  3WAQ A;  4XWJ A;  2IXM A;  2OEV A;  3LNM B;  4EUK B;  1WN0 A;  3QMK A;  2R7R A;  1NFN A;  3EGD A;  3TOL A;  4A4A A;  4G7O F;  3GEI A;  4K7B A;  3R2P A;  3R7C A;  3JRT A;  2VCA A;  3SZR A;  1XZQ A;  2CGE A;  2OEX A;  3W2V A;  2JD3 A;  3G50 A;  3X1O A;  4FAP B;  3JRM O;  5EHH A;  3O6X A;  3IQC A;  2Q9A A;  3VM6 A;  2EIN C;  3LAY A;  3M4B A;  4LLC A;  1TWG A;  4U5C E;  3O55 A;  2I8B A;  3MYF A;  3GM3 A;  3K66 A;  4PJJ A;  5AC4 A;  2GDC A;  3J06 A;  2LIG A;  2P6V A;  1OW8 A;  1QPU A;  3U9J A;  2PF4 E;  5JSL A;  5BQI A;  2LFF A;  2TMV P;  1W2W A;  2DB4 A;  2YWA A;  3NYL A;  4CS7 A;  5TJ5 E;  4OIO F;  4J7Y A;  4NTF A;  4AX2 A;  2EPK X;  5A6B A;  4N6C A;  4E7Z A;  2PP4 A;  2OKU A;  2WL8 A;  2ZXO A;  3K6B A;  3HTK C;  2YQY A;  4ZLD A;  2WVN A;  2J9U A;  2YZS A;  2A68 F;  1OQC A;  3HNI A;  4XEK A;  2IXP A;  3RF3 A;  4NQF A;  3DAG A;  5COF A;  1QLE C;  1T9K A;  3DMD A;  2QE9 A;  3ECS A;  2P0N A;  3NYM A;  4EBB A;  3S84 A;  5HSW A;  2CCY A;  3EHN A;  1EQ1 A;  2HZ8 A;  2CNW D;  4EBK A;  1CGN A;  2XLE A;  2V3C C;  4JUR I;  5DS6 A;  3U8V A;  5JRA A;  4YT8 A;  4I3M A;  3B9Q A;  1H9T A;  2ZXW C;  4W8P A;  5A6K A;  3LS1 A;  3LUT B;  3C8G D;  4XLN F;  4U5F E;  2NUT A;  2XLV A;  2DI3 A;  3EG9 A;  4PFP A;  2YLD A;  5CI9 A;  4OIN F;  4O7G A;  3KYI A;  3LES A;  3QTH A;  1M57 C;  4IGG A;  4XPY A;  3G4X A;  3AG4 C;  2KGO A;  3NMJ A;  1K04 A;  1NLX A;  2Y3B A;  1OKK D;  4U9D A;  3RQG A;  1YYJ A;  1TR2 A;  2GA0 A;  4FES A;  5FZT A;  4PJL A;  1J8M F;  1LKX A;  1YAU O;  3FHD A;  4PJM A;  1E84 A;  4Q4Z F;  3NYJ A;  2DYS C;  4N6H A;  1C02 A;  1LS4 A;  3S9O A;  3V5X A;  4HE8 D;  1MMN A;  4I1O B;  1E2X A;  4JW1 A;  2J9B A;  4Z9I A;  3RVZ A;  4CJG A;  1GS9 A;  3HLZ A;  4C3D A;  2KK1 A;  1RJ9 A;  1MMD A;  1ORY A;  3KYJ A;  1R4T A;  2HJ3 A;  2XM4 A;  1LVK A;  1ZU4 A;  2OJE D;  3KMI A;  4JTA B;  3V5Z A;  4KI2 A;  1QKR A;  1K05 A;  2XM0 A;  2JX0 A;  1SZI A;  4P9T A;  5BQH A;  3IQ6 A;  2G62 A;  2QY9 A;  1C03 A;  2J45 A;  2EPN A;  5DVW A;  1ZHT A;  1GQA A;  3I5Q A;  4EKW A;  1VYI A;  4KC9 A;  2HFI A;  3NRH A;  3OEO A;  4QI0 A;  4DBR A;  4OIQ F;  3K7D A;  2FFH A;  3U2M A;  1BR2 A;  1H7I A;  1U6H A;  3ZTM A;  2LQG A;  3A9C A;  2ZXR A;  3Q6M A;  1A0B A;  3RYL A;  4XTK A;  2XSE A;  2EPO A;  3WG7 C;  2L9J A;  2XS1 A;  2M4E A;  1A7V A;  3U2L A;  3UMK A;  4CSA C;  1HY5 A;  4FWV A;  4DXW A;  1D0Z A;  1ZHZ A;  4CJO A;  1A7E A;  1H6G A;  2YEV A;  3ASO C;  3IQ5 A;  5DQZ A;  3QVZ A;  4R32 A;  3CZ6 A;  5KYY A;  5T3T A;  2PBE A;  3MYI A;  5HV9 A;  3VF0 A;  1G4W R;  1V55 C;  4BJ6 A;  4WAB A;  1SYQ A;  2VH3 A;  3H2V A;  4U5G A;  4EHP A;  4KBL A;  4DBQ A;  1FMV A;  3NMK A;  4LER A;  4BPM A;  5A6B D;  3RH3 A;  4C7O B;  2R03 A;  2XLO A;  3SXZ A;  1YZC A;  4GEH A;  1O3U A;  2R7V A;  3DM9 B;  5DLJ A;  1ST6 A;  5DS5 A;  1FR0 A;  5EK0 A;  4HEA J;  4CS8 A;  3PHF 2;  2VB6 A;  1RJ9 B;  3L8J A;  4DRJ B;  5L0H A;  4BJ5 A;  3M1C B;  1O5H A;  4IAO A;  1Z6A A;  3S90 A;  5JUA A;  3EFO A;  3GM2 A;  1T6Q A;  5COM A;  1VB5 A;  4P6I C;  4OIR F;  4IWB A;  3U8P A;  4EWC A;  1HMO A;  4O6N A;  3JYY A;  5T1D B;  1HE9 A;  1OKK A;  1MMA A;  2Q3T A;  2WZF A;  5E33 A;  3GWN A;  4CDV A;  4WGY A;  3TQO A;  1TKN A;  1EA8 A;  2J7P A;  2QUP A;  3EZI A;  1LPE A;  1OW6 A;  2P61 A;  3ZQV A;  1ZW3 A;  1C17 M;  4JZA A;  3K1I C;  1G8X A;  3SYN A;  1WWP A;  1HW1 A;  2OCC C;  3AGU A;  4D4N A;  4MVS A;  3EGX A;  5AC5 A;  4NY3 A;  1WTY A;  3OWT A;  2ZD9 A;  2A0B A;  2GWW A;  1Y4C A;  4KNW A;  4JE9 A;  3G4Z A;  3B0V C;  1RKE A;  3US6 A;  2DGJ A;  4MVO A;  4AK9 A;  1MMG A;  1KNY A;  4BEJ A;  4CIP A;  3I5P A;  4ULV A;  5AGF A;  2HV6 A;  2MYS A;  1VOM A;  2W4M A;  2W4B A;  4LDR A;  3ZIB A;  4A2N B;  3O39 A;  4ZLC A;  5L0D A;  4O6M A;  1Q0M A;  4NC3 A;  1R5I D;  1WAT A;  3JTL O;  2NPU A;  4L6R A;  3IEE A;  2NSG A;  1BR4 A;  4MVU A;  3TOM A;  4YL3 A;  2B0J A;  1OCC C;  4LLE A;  3EFO B;  1UG7 A;  2X0C A;  2QNL A;  2C03 A;  2Q00 A;  3B0P A;  1LS1 A;  2H7V C;  2ICW G;  3V7O A;  1OXK A;  4M63 A;  1ZYR F;  2R7T A;  3B71 A;  1Z23 A;  3AQC A;  5A6J A;  4XLP F;  4C3E A;  3ZC4 A;  1CPR A;  1YA9 A;  4CBE A;  4DRI B;  1FFH A;  4U5E E;  2AU5 A;  4J30 B;  2YL1 A;  2BC5 A;  2AVK A;  1YZA A;  3EGX B;  4W8K A;  4DVZ A;  4IAQ A;  1L3P A;  1IW7 F;  5T3W A;  3ZQY A;  3EJN A;  2LCH A;  2YLI A;  3U5S A;  1NFO A;  3L8I A;  4J7T A;  3SXM A;  3AJM A;  3EH2 A;  3HKK A;  4N4W A;  1TWH A;  1D1B A;  4MVR A;  4DJ9 A;  4E17 A;  5DS4 A;  1L7C A;  1RKE B;  3ASN C;  2WZG A;  3RFY A;  4E0H A;  3NDB B;  2AWY A;  3VAY A;  3C7J A;  3FDQ A;  1OR3 A;  3UGP A;  1M2V A;  5L0G A;  2R7U A;  2MHR A;  4XEF A;  1NBB A;  5BQG A;  2Y39 A;  5A6A A;  1NZE A;  3TJ6 A;  2KW3 C;  3S0X A;  3S28 A;  5JLI A;  1QSP A;  2HMQ A;  4FX5 A;  4WJ0 A;  2IXN A;  5KYN A;  2GAQ A;  3OA1 A;  2W45 A;  4U5B E;  3GOD A;  1WOL A;  2HUJ A;  1T5O A;  3IHU A;  3DZA A;  2OJQ A;  3U3B A;  3ZVR A;  4CS9 A;  1JPN A;  2IXO A;  1U0B B;  1S05 A;  2J7P D;  3PDM P;  2QTV A;  4X0R A;  4C7O A;  5CIV A;  3DXJ F;  4MTG A;  3ZSU A;  2IM8 A;  4GQH A;  2NSF A;  2J9W A;  2PX3 A;  1NU7 D;  2XL6 A;  4J32 B;  3FXH A;  4JC7 A;  4MVQ A;  2PX0 A;  1HMD A;  3EQL F;  3TK0 A;  2KQ9 A;  3N2Z B;  5JS5 A;  3W8H A;  2MWQ A;  1BR1 A;  4QDL A;  2IOQ A;  2ZPA A;  1G4U S;  3E9V A;  3QW0 A;  1LI5 A;  3UR3 C;  2B0H A;  1H9G A;  1V4A A;  1SR2 A;  2WVO A;  1Q0K A;  1M2V B;  2EIL C;  2KC3 A;  3F46 A;  3NKD A;  3N24 A;  2KYH A;  4MND A;  4K0D A;  1RMV A;  3JYH A;  3M79 A;  3GAN A;  1SMY F;  2XL4 A;  2FGY A;  2P7V A;  4IB4 A;  3ZWI A;  2UUI A;  4QI2 A;  2PFD A;  5B3S C;  5KYW B;  3AQB A;  1AUE A;  3DI5 A;  2ETS A;  5KYX B;  2LSE A;  1E83 A;  2G3V A;  3ABL C;  4LAC B;  1OR2 A;  2CDQ A;  3LS0 A;  4JTC B;  1OXB A;  4CDY A;  1VLT A;  1PD1 A;  1HW2 A;  4G7Z F;  1Z3I X;  1TWC A;  2I15 A;  3H2U A;  1WGW A;  2G3K A;  4XPW A;  1YJG A;  1TWA A;  3UNG C;  3T6B A;  2R9R B;  3MLG A;  2VCC A;  4JJF A;  3VYW A;  1FTS A;  3EPV A;  3KL4 A;  1K40 A;  1LE2 A;  3SP1 A;  2KJG A;  3L34 A;  2R7Q A;  4MS2 A;  3X2Q C;  4CIH A;  4G78 A;  5L0F A;  2LFD A;  4IAR A;  1D0X A;  1QVX A;  5B1A C;  4Q5S F;  4I1M A;  3TD7 A;  3E70 C;  2J8W A;  5A69 A;  256B A;  2M64 A;  3SEO A;  4YL0 A;  3BRJ A;  2NUP A;  1NSG B;  1M6T A;  2J0W A;  3T4R A;  1BZ4 A;  1YAR O;  1ZZP A;  2GFH A;  2Q4F A;  1JR8 A;  3WHN A;  3POV A;  3DWW A;  3M15 A;  2Y69 C;  2J46 A;  3QZC A;  2HKV A;  1F1M A;  2XLM A;  1ORS C;  5CI8 A;  4YWQ A;  4LDQ A;  3FVY A;  1NU9 C;  4MTF A;  4U5H A;  3RKO F;  4JRZ A;  2ASR A;  3GM1 A;  3I4U A;  4DRH B;  2VC9 A;  1Z5Z A;  3CEX A;  3JCU Q;  4MTO A;  5E2Q A;  1CPQ A;  1LI7 A;  2H7O A;  2OU6 A;  2YKZ A;  2A0U A;  4YN0 B;  3T9O A;  1PD0 A;  2EPM X;  3A11 A;  5JP7 A;  2R7W A;  3S29 A;  2BE5 F;  2Q9C A;  3N0T A;  4NCQ A;  1N1C A;  2L6H A;  4F4B A;  3ITF A;  5D92 A;  1BBH A;  4CSA A;  2YL0 A;  1CGM E;  1A41 A;  4D4X A;  3ZDL A;  1GM5 A;  1V54 C;  1APC A;  3L0I A;  3O10 A;  1YYX A;  3W2W A;  3CQZ A;  4U9E A;  5F5F A;  5COG A;  1ORJ A;  4PFO A;  4GYT A;  2R7S A;  1JOG A;  2VAS A;  3ATP A;  5JVE A;  1T01 A;  1ZU5 A;  5KYU A;  3T6J A;  3WOD F;  1OCO C;  4RDA A;  4NTB A;  1A7D A;  3PCV A;  3VRC A;  4HFF B;  3C8Z A;  3B29 A;  5L0J A;  4G7H F;  2HV7 A;  2NUP B;  4JCH A;  4JKV A;  5L0I A;  2J0X A;  3U0C A;  3LEV A;  3NG1 A;  4OIP F;  3CSK A;  3Q6N A;  4HFK B;  2C04 A;  4I44 A;  2XL8 A;  1S7Z A; 
#chains in the Genus database with same CATH homology
 1LS4 A;  3R2P A;  3S84 A;  1EQ1 A;  1NFO A;  1LE4 A;  1GS9 A;  1AEP A;  1EA8 A;  1LPE A;  1BZ4 A;  1OR2 A;  1OR3 A;  1H7I A;  1YA9 A;  1B68 A;  1LE2 A;  2KC3 A;  1NFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...