1LS4A

Nmr structure of apolipophorin-iii from locusta migratoria
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
164
structure length
164
Chain Sequence
RPDAAGHVNIAEAVQQLNHTIVNAAHELHETLGLPTPDEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNAFARNLNNSIHDAATSLNLQDQLNSLQSALTNVGHQWQDIATKTQASAQEAWAPVQSALQEAAEKTKEAAANLQNSIQSAVQKPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Apolipophorin-III
publication title NMR solution structure and dynamics of an exchangeable apolipoprotein,locusta migratoria apolipophorin III.
pubmed doi rcsb
source organism Locusta migratoria
total genus 52
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2002-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ls4A00
1EA8A 1BZ4A 1NFNA 1GS9A 3S84A 1LPEA 1NFOA 1OR2A 1YA9A 1H7IA 3R2PA 1AEPA 1EQ1A 1LS4A 1OR3A 1B68A 1LE2A 1LE4A 2KC3A
chains in the Genus database with same CATH superfamily
3EG9A 1N1CA 2O9XA 2A1DD 2ZXWC 1E84A 1FAPB 3ZQYA 2J8WA 3JT1A 2R7SA 2WVQA 1TWAA 5F28E 4QDLA 1BDJB 1M57C 5A6BD 3F47A 4WABA 5AGFA 4BJ6A 4NY3A 4DBQA 3LNRA 3TJ5A 2A69F 2YL0A 5E3CA 1YDIA 5JUAA 3N0TA 3POVA 3T6JA 5A6BA 3C63A 2QNLA 3CZ6A 4N6CA 4P6IC 1MMGA 2E87A 5COMA 3M15A 5CI9A 5A69A 3LS0A 1XZQA 2EIJC 2JX0A 3HTKC 5EK0A 3EFOB 5TJ5E 3EPVA 4EBJA 2RSEB 1JRAA 3NMJA 4PR9A 1W2WA 4DVZA 2IXOA 1SZIA 3O6XA 2G3VA 2XLWA 4WJ0A 1OR3A 3DAFA 3ATPA 2A6EF 4O7GA 1WN0A 1M2OA 1WGWA 2P7VA 2Y69C 5EGYA 3ZWIA 2LD6A 4JTDB 1Z7Qc 5FZTA 1D1BA 4H54A 4L6RA 1SYQA 2NUPA 3EGDA 5E33A 3UGPA 1C02A 5A6KA 4LDRA 3CEXA 3GEIA 1YZCA 1RMVA 1NG1A 3DI5A 2J7PD 3LEVA 3AGTA 1OCRC 1AUEA 2QLAA 1SR2A 3HNIA 4Q5SF 5F5FA 2YZSA 4MW8A 4G7ZF 3VAYA 1I5NA 2J7PA 2XS8A 2R7OA 2DB4A 1NU7D 2W45A 3FVYA 2W9YA 3VYWA 1SF8A 4JEAA 2XL8A 2Q7RA 1YARO 2LK4A 3AG2C 2HUJA 3IQCA 1E85A 1PD1A 1ZW2A 2B0JA 3DMDA 4MVMA 4E7ZA 3VF0A 2OKUA 3SXKA 3HKKA 1E83A 3A11A 3ABMC 3DD7A 1YAUO 3GM1A 3KPHA 3L34A 3LJBA 4P9TA 3RIPA 3S90A 3B0UX 3TULA 4ZLDA 1OW7A 3DWWA 4OIOF 2UUHA 4HFFB 3WODF 4I44A 4FESA 3QW1A 2LFFA 2DI3A 2J9UA 2ASRA 3JZ0A 4MVSA 5JLIA 3MFNA 5JS5A 1CGME 1QQ3A 2ZPAA 4CS9C 3S9OA 2PBEA 1T9KA 2BL2A 3SZRA 4LLEA 3V5YA 4GYTA 2GDCA 5KYUB 1I4ZA 1K40A 4DRJB 4YL1A 2IXNA 3DZAA 3EGXA 2J9WA 3NKDA 3LEOA 3QZCA 5L3VA 2LP4A 3T6GB 3TQOA 2D5RB 3NMIA 4P9FA 3B29A 4DBRA 4KNWA 3LAYA 4IAOA 3TK0A 4CS9A 3I5PA 5B1BC 4EBBA 4A2NB 5KYYB 2ETSA 1ZU4A 5CI8A 3MYFA 1NFNA 4Q4ZF 3T6BA 3RF3A 3FHDA 1FMWA 2WVOA 2OEXA 1NSGB 3CSKA 3E70C 4D4NA 3KYIA 1HW1A 3Q7GA 4JRZA 1XWJA 2XLMA 3EFOA 4LACB 2HFIA 2XS1A 4XQ1A 2X0CA 1ZHZA 1M2VB 1MMDA 2D4UA 3U9JA 1T6UA 4YK5A 3ZDLA 3ZVRA 4E18A 2BE5F 2HZ8A 3S29A 3ZQVA 3C62A 3L0IA 3NYLA 5CIVA 5D92A 1YLMA 3NMKA 4MQ9F 1TWHA 2XLHA 5D91A 3RW0A 1MMNA 4YT4A 4ONSA 2EPKX 2GAQA 1OCZC 4CX9A 4JCZA 2FGYA 2G62A 2IXPA 3G50A 4PJMA 1RKEB 3PCVA 5B1AC 3T4RA 2F22A 1LI7A 4MVUA 1C03A 2PX0A 2V26A 4MTFA 3TJ6A 1UFBA 3IPMO 4G78A 4MTOA 1OCOC 3LUTB 5A6JA 1Q0KA 3IEEA 1U6HA 3M4CA 4G0HA 4EBKA 3GEHA 3VRCA 1H7IA 4EHPA 5BUOA 3SXMA 5B3IA 3AQBA 3R2PA 4GEHA 5L0IA 3HNLA 1M56C 3BEHA 3LESA 3SXZA 4YT2A 2Q4FA 3LS1A 1OQCA 2Y3HA 2LIGA 2R7QA 2LCHA 3C18A 1WWPA 5F5HA 4A4AA 3A9CA 3O39A 1HMDA 1V4AA 3MX3A 1J8MF 1BR1A 2AVKA 1VLSA 4PJLA 2HSBA 4CBEA 4NTBA 4MVQA 4YL3A 1C17M 1RKCA 3KL4A 3RVYA 1L3PA 4OIPF 3RYLA 2IOQA 2YVKA 3ASNC 5L0HA 5DLJA 4ZLCA 2A6HF 4BG0A 1ZU5A 3C7JA 5KYUA 1Q0DA 2KGOA 2Y3BA 3CAXA 1HE9A 1T5OA 3BRJA 2J45A 2PFDA 2HV7A 3EH2A 2JD3A 3QVYA 4IGGA 2HMZA 3H2VA 4OIQF 3FOOA 3O55A 3CQZA 2KK1A 3N2ZB 4AX2A 5KYYA 1RXQA 2KNHA 2WB7A 1M6TA 3DJUB 3MYIA 4U5GA 4BJ1A 4CDVA 2OJQA 2R7UA 1VK5A 3TOMA 4EUKB 1Q0MA 1ZW3A 4Z9HA 1G4WR 4YN0B 2DGJA 2I15A 1QZXA 3GM2A 5BQHA 2Q9CA 1OW6A 1FNTc 1ORYA 2P61A 1V74B 2J46A 2ZXPA 4XPXA 2XXAA 3WG7C 3DXJF 1IZMA 4C3DA 3TD7A 4E17A 4JE9A 4WGYA 2CW0F 3ABKC 1NU9C 1Q0GA 3NG1A 2WZFA 5T3WA 4DRHB 2NUTA 3ZIBA 2FAPB 2H7OA 1DOVA 4AE4B 4D4XA 1EKYA 3JRTA 3M79A 2ICWG 4B6IA 5BQGA 2YKZA 4JZAA 4FAPB 1MNEA 1Y6DA 1CPRA 1PCXA 1T6IA 2A0UA 1WOLA 2YHSA 1JMWA 3DKAA 2R7XA 2IBFA 3K1HA 4K7BA 4U9DA 4Z9IA 1LE4A 4HE8D 2ZD9A 4BPMA 2WZGA 3U2MA 2DYSC 3KH2A 4O6YA 3V5ZA 1HMOA 2CNWD 3AG1C 4PJJA 1V54C 3SEOA 3PDMP 1WATA 2R03A 4I3MA 1L7CA 2DYRC 4JIOA 1LS1A 3NDBB 1XZPA 2PX3A 2CNWA 5KYNA 5DS5A 2YLDA 3UMIA 1LIHA 4J30B 2MWQA 2KC3A 3X2QC 3DE8A 3EHMA 1VYKA 2J9BA 3UMKA 1EQ1A 5A6AA 1BR2A 3IQTA 4PK4A 2KQ9A 2M4EA 2W4BA 3RH3A 4LDKA 5KYXA 1GM5A 2W4MA 2XLDA 5AC4A 1H6GA 1ZYRF 2IYLD 4OINF 2GFHA 1NBBA 2L6FA 2Q9AA 2C03A 2Y39A 2Y3GA 3RKOF 4E0IA 1JR8A 1T01A 1RJ9B 2TMVP 1OW8A 1QVXA 4NCQA 4YJWA 1Z3IX 1QPUA 4XTKA 2HSQA 4MW3A 4W8PA 1A41A 1EA8A 2QUPA 3K7DA 1G8XA 2NPUA 3NYJA 4PJNA 3SP1A 4K0DA 4XLNF 1GS9A 2NSFA 5DS6A 3EG9B 3V7OA 2EINC 2I8BA 3Q7LA 4NTFA 2VH3A 1TFOB 3IHUA 5IY5C 4XEVA 2YQYA 1YA7O 1GGQA 2EPLX 1YJGA 2VB6A 3JRMO 1FFHA 3E9VA 1JAFA 1HE1A 3ABLC 3EHNA 3OWTA 1WASA 4OD4A 1K04A 3U5SA 4X0RA 1A7DA 1QSPA 3JCUQ 4JKVA 4PACA 2ZXRA 2VCAA 1HW2A 2XLEA 5COFA 1D0XA 4IAQA 4IB4A 1FR0A 2EIKC 3K1IC 1KTMA 4EWCA 4AK9A 4LLCA 1Y4CA 2CYDA 3JYYA 3ECSA 3G4XA 1YYJA 5L0FA 4AE4A 2NUPB 1TWGA 3RQEA 1QKRA 2Y3DA 1A7VA 1O3UA 1AEPA 3DM9B 4MNDA 4I1OB 2HV6A 3EJNA 4H4KC 2YRFA 3ZTMA 5L0JA 3L8JA 3I4UA 5HSWA 3C8GB 1CPQA 3K1IA 4IWBA 4U5FE 1Z5ZA 4JJGA 3PHF2 5DQTA 4G7OF 3RFYA 4U5HA 4BJTA 5L0DA 2YL3A 2MHRA 2EPMX 1D1AA 2QTVA 4CIPA 4C7OB 1V55C 5JP7A 3LNMB 3K33A 2R7VA 3ZTZA 3NYMA 1JPNA 5BQIA 2L6HA 4U5EE 3ITFA 1J8YF 3DM5A 3FMSA 1DOWA 1RCPA 4ER9A 3GODA 3U8VA 1EI7A 1CGOA 1FFTC 1YVIA 2YL7A 1Z63A 1G4US 2OJED 2QE9A 2HS5A 2WL8A 3Q6MA 4I1MA 2P6VA 2XL6A 4RDAA 3GWNA 1OCCC 3B0VC 3NKEA 2IM8A 3J06A 3O10A 3FXHA 4KBLA 2KW3C 4HEAJ 4OIRF 3L8IA 2VCCA 5L0GA 1RJ9A 2XLVA 2G3KA 3U2LA 2XLOA 1ZHTA 3G4ZA 1S05A 3JSZA 3PMRA 4KNVA 3ZG1A 4BJ6C 4WGZA 3W2WA 3L1MA 5AC5A 1TR2A 2OU6A 3FOPA 3H2UA 3U3FA 1LM3B 2A0BA 3FAJA 3HLZA 3RQGA 3UNGC 1S7ZA 3ZC4A 3WHNA 3T9OA 1B68A 3W8IA 3FDQA 1SMYF 2J9VA 1F1MA 3WAQA 2EILC 2H7VC 2QY9A 4CS8C 4EKWA 2PF4E 3IQ5A 4ANJA 5L0CA 4M63A 4E7SA 1I4YA 2Q3TA 2YLGA 4NTAA 3S28A 4O6MA 3UMHA 4JTAB 4IARA 5K0IA 2GWWA 2VASA 1M2VA 1KU2A 3Q6NA 4OD5A 4XEKA 2R7RA 3UR3C 3QW0A 2H7BA 3HJCA 4JW1A 4XLPF 1O87A 2OG2A 1ZVZA 4DOZA 1TWCA 1NLXA 4CDAA 2VCBA 1VTMP 1YZAA 2L7AA 4CDYA 4W8KA 4CS8A 1BR4A 3GEEA 3X1OA 1PV3A 4JVSA 1ORJA 2M64A 2X51A 5DVWA 3S0XA 3ASOC 4RBNA 3U3BA 1A7EA 1R4TA 5GPGB 3AJMA 1D0ZA 1VYIA 3LLKA 3VM6A 1RKEA 1JPJA 1VOMA 3EZIA 2OCCC 4AL1A 1VMAA 2R05A 2NSGA 4DJ9A 3AG4C 5T3TA 1LE2A 2A68F 2RD9A 1LI5A 5T1DB 5JVEA 3MLGA 3C8ZA 1ORSC 1JOGA 1H9GA 4N6HA 4O6NA 3AQCA 2P0NA 1OXBA 4JEBA 2XRHA 2P1AA 3C8GD 1LKXA 4C3EA 4FX5A 2B0HA 2YLIA 2Z15A 4Z9JA 3U9MA 1LPEA 3M4BA 1NZEA 3C8GA 1BBHA 2R02A 3HNKA 1OR2A 3QTHA 3W8HA 4BEJA 5L3QA 1OKKD 1TQGA 3QMKA 4J32B 4JTCB 4DVYP 2XL4A 1ZZPA 3HNJA 1Z23A 1ZHYA 2CDQA 3I5QA 3KYJA 4LDQA 2V3CC 4C7OA 1OKKA 5EHHA 3QVZA 4RD9A 4YWQA 3R7CA 2WVNA 2J0XA 3UGOA 3V5XA 1LS4A 5JRAA 5KYWB 2KYHA 2GA0A 3OA1A 1H9TA 2OQMA 3TOLA 4CSAC 4KI2A 3AG3C 1CGNA 4ULVA 3U0CA 2C04A 1ZHWA 4XWJA 2HJMA 1BZ4A 2WZLA 1TKNA 4BJ5C 3SYNA 4NC3A 3EZHA 2MYSA 3K6BA 1E86A 3GWLA 3JSEO 1OXKA 2LFDA 2YEVA 4PFPA 4U5BE 1IW7F 5JSLA 4K1OA 1VB5A 3S84A 2JPUA 4GQHA 4YL0A 2LQGA 4XPYA 4DRIB 1APCA 2AU5A 1YA9A 3KKBA 4CSAA 4G7HF 4U5CE 1WTYA 4CJOA 3DAGA 4IJJA 4Q7CA 4BJ5A 4MVRA 5COGA 2BC5A 1Q0FA 4HFKB 4N06A 1U89A 3RVZA 2AP3A 5DQZA 3H65A 5JT4A 3US6A 1GQAA 1TFKB 2LSEA 2FFHA 2L81A 5E3AA 2YL1A 2XM0A 3S27A 1MQVA 2L6GA 4LERA 4YT5A 2R7TA 3B0PA 1Z6AA 1LVKA 2R9RB 2OEVA 5HV9A 4MVZA 3SNHA 1YYXA 2CGEA 4ULWA 4O79A 4JURI 4MTGA 3B71A 2UUIA 4J7TA 4KC9A 4JJFA 4BEMJ 4PFOA 2R7WA 2Q00A 1HY5A 4UDVA 1O5HA 4U5DE 3GANA 1NFOA 2VC9A 3AGUA 3EGDB 4E0HA 3F46A 2XXAB 2PNOA 3DE9A 3KMIA 4N4WA 3NRHA 4AL0A 3DJNB 2OOCA 3K66A 4MS2A 3GORA 4CJGA 1G5ZA 4XEFA 2H8AA 2Q9BA 3JYHA 4JCHA 1UG7A 2NUTB 2PP4A 1ZHXA 3FAPB 1FTSA 4IRUA 1A0BA 3RQFA 3SXYA 4CS7A 5B3SC 3N24A 4NQFA 1MNDA 1D1CA 1PD0A 256BA 2R25A 4YT8A 2XM4A 4QI2A 2EPNA 1E2XA 2EPOA 4QI0A 3W4YA 4EIYA 5FCLA 1MMAA 2EIMC 2L9JA 1ST6A 3B9QA 2HJ3A 2HMQA 3IQ6A 4U9EA 1D0YA 4CIHA 3JTLO 3MBGA 3U8PA 2XSEA 1QLEC 4J7YA 2IXMA 3EQLF 1K05A 4C3BA 4JC7A 4MVOA 2YWAA 5E2QA 4XPWA 3ZSUA 3AOUA 5KYWA 1U0BB 1KNYA 3EH1A 2ZXOA 4R32A 3W2VA 4DXWA 5DS4A 4FWVA 2KJGA 1VLTA 2AWCA 1AVOB 2KSFA 2HKVA 1FMVA 4F4BA 5KYXB 3M1CB 1T6QA 2AWYA 2CCYA 3LLIA 2NG1A 3GM3A 2J0WA 3OEOA 3EGXB 1R5ID
chains in the Genus database with same CATH topology
1EA8A 1BZ4A 1NFNA 1GS9A 3S84A 1LPEA 1NFOA 1OR2A 1YA9A 1H7IA 3R2PA 1AEPA 1EQ1A 1LS4A 1OR3A 1B68A 1LE2A 1LE4A 2KC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA8 A;  1BZ4 A;  1NFN A;  1GS9 A;  3S84 A;  1LPE A;  1NFO A;  1OR2 A;  1YA9 A;  1H7I A;  3R2P A;  1AEP A;  1EQ1 A;  1LS4 A;  1OR3 A;  1B68 A;  1LE2 A;  1LE4 A;  2KC3 A; 
#chains in the Genus database with same CATH topology
 3EG9 A;  1N1C A;  2O9X A;  2A1D D;  2ZXW C;  1E84 A;  1FAP B;  3ZQY A;  2J8W A;  3JT1 A;  2R7S A;  2WVQ A;  1TWA A;  5F28 E;  4QDL A;  1BDJ B;  1M57 C;  5A6B D;  3F47 A;  4WAB A;  5AGF A;  4BJ6 A;  4NY3 A;  4DBQ A;  3LNR A;  3TJ5 A;  2A69 F;  2YL0 A;  5E3C A;  1YDI A;  5JUA A;  3N0T A;  3POV A;  3T6J A;  5A6B A;  3C63 A;  2QNL A;  3CZ6 A;  4N6C A;  4P6I C;  1MMG A;  2E87 A;  5COM A;  3M15 A;  5CI9 A;  5A69 A;  3LS0 A;  1XZQ A;  2EIJ C;  2JX0 A;  3HTK C;  5EK0 A;  3EFO B;  5TJ5 E;  3EPV A;  4EBJ A;  2RSE B;  1JRA A;  3NMJ A;  4PR9 A;  1W2W A;  4DVZ A;  2IXO A;  1SZI A;  3O6X A;  2G3V A;  2XLW A;  4WJ0 A;  1OR3 A;  3DAF A;  3ATP A;  2A6E F;  4O7G A;  1WN0 A;  1M2O A;  1WGW A;  2P7V A;  2Y69 C;  5EGY A;  3ZWI A;  2LD6 A;  4JTD B;  1Z7Q c;  5FZT A;  1D1B A;  4H54 A;  4L6R A;  1SYQ A;  2NUP A;  3EGD A;  5E33 A;  3UGP A;  1C02 A;  5A6K A;  4LDR A;  3CEX A;  3GEI A;  1YZC A;  1RMV A;  1NG1 A;  3DI5 A;  2J7P D;  3LEV A;  3AGT A;  1OCR C;  1AUE A;  2QLA A;  1SR2 A;  3HNI A;  4Q5S F;  5F5F A;  2YZS A;  4MW8 A;  4G7Z F;  3VAY A;  1I5N A;  2J7P A;  2XS8 A;  2R7O A;  2DB4 A;  1NU7 D;  2W45 A;  3FVY A;  2W9Y A;  3VYW A;  1SF8 A;  4JEA A;  2XL8 A;  2Q7R A;  1YAR O;  2LK4 A;  3AG2 C;  2HUJ A;  3IQC A;  1E85 A;  1PD1 A;  1ZW2 A;  2B0J A;  3DMD A;  4MVM A;  4E7Z A;  3VF0 A;  2OKU A;  3SXK A;  3HKK A;  1E83 A;  3A11 A;  3ABM C;  3DD7 A;  1YAU O;  3GM1 A;  3KPH A;  3L34 A;  3LJB A;  4P9T A;  3RIP A;  3S90 A;  3B0U X;  3TUL A;  4ZLD A;  1OW7 A;  3DWW A;  4OIO F;  2UUH A;  4HFF B;  3WOD F;  4I44 A;  4FES A;  3QW1 A;  2LFF A;  2DI3 A;  2J9U A;  2ASR A;  3JZ0 A;  4MVS A;  5JLI A;  3MFN A;  5JS5 A;  1CGM E;  1QQ3 A;  2ZPA A;  4CS9 C;  3S9O A;  2PBE A;  1T9K A;  2BL2 A;  3SZR A;  4LLE A;  3V5Y A;  4GYT A;  2GDC A;  5KYU B;  1I4Z A;  1K40 A;  4DRJ B;  4YL1 A;  2IXN A;  3DZA A;  3EGX A;  2J9W A;  3NKD A;  3LEO A;  3QZC A;  5L3V A;  2LP4 A;  3T6G B;  3TQO A;  2D5R B;  3NMI A;  4P9F A;  3B29 A;  4DBR A;  4KNW A;  3LAY A;  4IAO A;  3TK0 A;  4CS9 A;  3I5P A;  5B1B C;  4EBB A;  4A2N B;  5KYY B;  2ETS A;  1ZU4 A;  5CI8 A;  3MYF A;  1NFN A;  4Q4Z F;  3T6B A;  3RF3 A;  3FHD A;  1FMW A;  2WVO A;  2OEX A;  1NSG B;  3CSK A;  3E70 C;  4D4N A;  3KYI A;  1HW1 A;  3Q7G A;  4JRZ A;  1XWJ A;  2XLM A;  3EFO A;  4LAC B;  2HFI A;  2XS1 A;  4XQ1 A;  2X0C A;  1ZHZ A;  1M2V B;  1MMD A;  2D4U A;  3U9J A;  1T6U A;  4YK5 A;  3ZDL A;  3ZVR A;  4E18 A;  2BE5 F;  2HZ8 A;  3S29 A;  3ZQV A;  3C62 A;  3L0I A;  3NYL A;  5CIV A;  5D92 A;  1YLM A;  3NMK A;  4MQ9 F;  1TWH A;  2XLH A;  5D91 A;  3RW0 A;  1MMN A;  4YT4 A;  4ONS A;  2EPK X;  2GAQ A;  1OCZ C;  4CX9 A;  4JCZ A;  2FGY A;  2G62 A;  2IXP A;  3G50 A;  4PJM A;  1RKE B;  3PCV A;  5B1A C;  3T4R A;  2F22 A;  1LI7 A;  4MVU A;  1C03 A;  2PX0 A;  2V26 A;  4MTF A;  3TJ6 A;  1UFB A;  3IPM O;  4G78 A;  4MTO A;  1OCO C;  3LUT B;  5A6J A;  1Q0K A;  3IEE A;  1U6H A;  3M4C A;  4G0H A;  4EBK A;  3GEH A;  3VRC A;  1H7I A;  4EHP A;  5BUO A;  3SXM A;  5B3I A;  3AQB A;  3R2P A;  4GEH A;  5L0I A;  3HNL A;  1M56 C;  3BEH A;  3LES A;  3SXZ A;  4YT2 A;  2Q4F A;  3LS1 A;  1OQC A;  2Y3H A;  2LIG A;  2R7Q A;  2LCH A;  3C18 A;  1WWP A;  5F5H A;  4A4A A;  3A9C A;  3O39 A;  1HMD A;  1V4A A;  3MX3 A;  1J8M F;  1BR1 A;  2AVK A;  1VLS A;  4PJL A;  2HSB A;  4CBE A;  4NTB A;  4MVQ A;  4YL3 A;  1C17 M;  1RKC A;  3KL4 A;  3RVY A;  1L3P A;  4OIP F;  3RYL A;  2IOQ A;  2YVK A;  3ASN C;  5L0H A;  5DLJ A;  4ZLC A;  2A6H F;  4BG0 A;  1ZU5 A;  3C7J A;  5KYU A;  1Q0D A;  2KGO A;  2Y3B A;  3CAX A;  1HE9 A;  1T5O A;  3BRJ A;  2J45 A;  2PFD A;  2HV7 A;  3EH2 A;  2JD3 A;  3QVY A;  4IGG A;  2HMZ A;  3H2V A;  4OIQ F;  3FOO A;  3O55 A;  3CQZ A;  2KK1 A;  3N2Z B;  4AX2 A;  5KYY A;  1RXQ A;  2KNH A;  2WB7 A;  1M6T A;  3DJU B;  3MYI A;  4U5G A;  4BJ1 A;  4CDV A;  2OJQ A;  2R7U A;  1VK5 A;  3TOM A;  4EUK B;  1Q0M A;  1ZW3 A;  4Z9H A;  1G4W R;  4YN0 B;  2DGJ A;  2I15 A;  1QZX A;  3GM2 A;  5BQH A;  2Q9C A;  1OW6 A;  1FNT c;  1ORY A;  2P61 A;  1V74 B;  2J46 A;  2ZXP A;  4XPX A;  2XXA A;  3WG7 C;  3DXJ F;  1IZM A;  4C3D A;  3TD7 A;  4E17 A;  4JE9 A;  4WGY A;  2CW0 F;  3ABK C;  1NU9 C;  1Q0G A;  3NG1 A;  2WZF A;  5T3W A;  4DRH B;  2NUT A;  3ZIB A;  2FAP B;  2H7O A;  1DOV A;  4AE4 B;  4D4X A;  1EKY A;  3JRT A;  3M79 A;  2ICW G;  4B6I A;  5BQG A;  2YKZ A;  4JZA A;  4FAP B;  1MNE A;  1Y6D A;  1CPR A;  1PCX A;  1T6I A;  2A0U A;  1WOL A;  2YHS A;  1JMW A;  3DKA A;  2R7X A;  2IBF A;  3K1H A;  4K7B A;  4U9D A;  4Z9I A;  1LE4 A;  4HE8 D;  2ZD9 A;  4BPM A;  2WZG A;  3U2M A;  2DYS C;  3KH2 A;  4O6Y A;  3V5Z A;  1HMO A;  2CNW D;  3AG1 C;  4PJJ A;  1V54 C;  3SEO A;  3PDM P;  1WAT A;  2R03 A;  4I3M A;  1L7C A;  2DYR C;  4JIO A;  1LS1 A;  3NDB B;  1XZP A;  2PX3 A;  2CNW A;  5KYN A;  5DS5 A;  2YLD A;  3UMI A;  1LIH A;  4J30 B;  2MWQ A;  2KC3 A;  3X2Q C;  3DE8 A;  3EHM A;  1VYK A;  2J9B A;  3UMK A;  1EQ1 A;  5A6A A;  1BR2 A;  3IQT A;  4PK4 A;  2KQ9 A;  2M4E A;  2W4B A;  3RH3 A;  4LDK A;  5KYX A;  1GM5 A;  2W4M A;  2XLD A;  5AC4 A;  1H6G A;  1ZYR F;  2IYL D;  4OIN F;  2GFH A;  1NBB A;  2L6F A;  2Q9A A;  2C03 A;  2Y39 A;  2Y3G A;  3RKO F;  4E0I A;  1JR8 A;  1T01 A;  1RJ9 B;  2TMV P;  1OW8 A;  1QVX A;  4NCQ A;  4YJW A;  1Z3I X;  1QPU A;  4XTK A;  2HSQ A;  4MW3 A;  4W8P A;  1A41 A;  1EA8 A;  2QUP A;  3K7D A;  1G8X A;  2NPU A;  3NYJ A;  4PJN A;  3SP1 A;  4K0D A;  4XLN F;  1GS9 A;  2NSF A;  5DS6 A;  3EG9 B;  3V7O A;  2EIN C;  2I8B A;  3Q7L A;  4NTF A;  2VH3 A;  1TFO B;  3IHU A;  5IY5 C;  4XEV A;  2YQY A;  1YA7 O;  1GGQ A;  2EPL X;  1YJG A;  2VB6 A;  3JRM O;  1FFH A;  3E9V A;  1JAF A;  1HE1 A;  3ABL C;  3EHN A;  3OWT A;  1WAS A;  4OD4 A;  1K04 A;  3U5S A;  4X0R A;  1A7D A;  1QSP A;  3JCU Q;  4JKV A;  4PAC A;  2ZXR A;  2VCA A;  1HW2 A;  2XLE A;  5COF A;  1D0X A;  4IAQ A;  4IB4 A;  1FR0 A;  2EIK C;  3K1I C;  1KTM A;  4EWC A;  4AK9 A;  4LLC A;  1Y4C A;  2CYD A;  3JYY A;  3ECS A;  3G4X A;  1YYJ A;  5L0F A;  4AE4 A;  2NUP B;  1TWG A;  3RQE A;  1QKR A;  2Y3D A;  1A7V A;  1O3U A;  1AEP A;  3DM9 B;  4MND A;  4I1O B;  2HV6 A;  3EJN A;  4H4K C;  2YRF A;  3ZTM A;  5L0J A;  3L8J A;  3I4U A;  5HSW A;  3C8G B;  1CPQ A;  3K1I A;  4IWB A;  4U5F E;  1Z5Z A;  4JJG A;  3PHF 2;  5DQT A;  4G7O F;  3RFY A;  4U5H A;  4BJT A;  5L0D A;  2YL3 A;  2MHR A;  2EPM X;  1D1A A;  2QTV A;  4CIP A;  4C7O B;  1V55 C;  5JP7 A;  3LNM B;  3K33 A;  2R7V A;  3ZTZ A;  3NYM A;  1JPN A;  5BQI A;  2L6H A;  4U5E E;  3ITF A;  1J8Y F;  3DM5 A;  3FMS A;  1DOW A;  1RCP A;  4ER9 A;  3GOD A;  3U8V A;  1EI7 A;  1CGO A;  1FFT C;  1YVI A;  2YL7 A;  1Z63 A;  1G4U S;  2OJE D;  2QE9 A;  2HS5 A;  2WL8 A;  3Q6M A;  4I1M A;  2P6V A;  2XL6 A;  4RDA A;  3GWN A;  1OCC C;  3B0V C;  3NKE A;  2IM8 A;  3J06 A;  3O10 A;  3FXH A;  4KBL A;  2KW3 C;  4HEA J;  4OIR F;  3L8I A;  2VCC A;  5L0G A;  1RJ9 A;  2XLV A;  2G3K A;  3U2L A;  2XLO A;  1ZHT A;  3G4Z A;  1S05 A;  3JSZ A;  3PMR A;  4KNV A;  3ZG1 A;  4BJ6 C;  4WGZ A;  3W2W A;  3L1M A;  5AC5 A;  1TR2 A;  2OU6 A;  3FOP A;  3H2U A;  3U3F A;  1LM3 B;  2A0B A;  3FAJ A;  3HLZ A;  3RQG A;  3UNG C;  1S7Z A;  3ZC4 A;  3WHN A;  3T9O A;  1B68 A;  3W8I A;  3FDQ A;  1SMY F;  2J9V A;  1F1M A;  3WAQ A;  2EIL C;  2H7V C;  2QY9 A;  4CS8 C;  4EKW A;  2PF4 E;  3IQ5 A;  4ANJ A;  5L0C A;  4M63 A;  4E7S A;  1I4Y A;  2Q3T A;  2YLG A;  4NTA A;  3S28 A;  4O6M A;  3UMH A;  4JTA B;  4IAR A;  5K0I A;  2GWW A;  2VAS A;  1M2V A;  1KU2 A;  3Q6N A;  4OD5 A;  4XEK A;  2R7R A;  3UR3 C;  3QW0 A;  2H7B A;  3HJC A;  4JW1 A;  4XLP F;  1O87 A;  2OG2 A;  1ZVZ A;  4DOZ A;  1TWC A;  1NLX A;  4CDA A;  2VCB A;  1VTM P;  1YZA A;  2L7A A;  4CDY A;  4W8K A;  4CS8 A;  1BR4 A;  3GEE A;  3X1O A;  1PV3 A;  4JVS A;  1ORJ A;  2M64 A;  2X51 A;  5DVW A;  3S0X A;  3ASO C;  4RBN A;  3U3B A;  1A7E A;  1R4T A;  5GPG B;  3AJM A;  1D0Z A;  1VYI A;  3LLK A;  3VM6 A;  1RKE A;  1JPJ A;  1VOM A;  3EZI A;  2OCC C;  4AL1 A;  1VMA A;  2R05 A;  2NSG A;  4DJ9 A;  3AG4 C;  5T3T A;  1LE2 A;  2A68 F;  2RD9 A;  1LI5 A;  5T1D B;  5JVE A;  3MLG A;  3C8Z A;  1ORS C;  1JOG A;  1H9G A;  4N6H A;  4O6N A;  3AQC A;  2P0N A;  1OXB A;  4JEB A;  2XRH A;  2P1A A;  3C8G D;  1LKX A;  4C3E A;  4FX5 A;  2B0H A;  2YLI A;  2Z15 A;  4Z9J A;  3U9M A;  1LPE A;  3M4B A;  1NZE A;  3C8G A;  1BBH A;  2R02 A;  3HNK A;  1OR2 A;  3QTH A;  3W8H A;  4BEJ A;  5L3Q A;  1OKK D;  1TQG A;  3QMK A;  4J32 B;  4JTC B;  4DVY P;  2XL4 A;  1ZZP A;  3HNJ A;  1Z23 A;  1ZHY A;  2CDQ A;  3I5Q A;  3KYJ A;  4LDQ A;  2V3C C;  4C7O A;  1OKK A;  5EHH A;  3QVZ A;  4RD9 A;  4YWQ A;  3R7C A;  2WVN A;  2J0X A;  3UGO A;  3V5X A;  1LS4 A;  5JRA A;  5KYW B;  2KYH A;  2GA0 A;  3OA1 A;  1H9T A;  2OQM A;  3TOL A;  4CSA C;  4KI2 A;  3AG3 C;  1CGN A;  4ULV A;  3U0C A;  2C04 A;  1ZHW A;  4XWJ A;  2HJM A;  1BZ4 A;  2WZL A;  1TKN A;  4BJ5 C;  3SYN A;  4NC3 A;  3EZH A;  2MYS A;  3K6B A;  1E86 A;  3GWL A;  3JSE O;  1OXK A;  2LFD A;  2YEV A;  4PFP A;  4U5B E;  1IW7 F;  5JSL A;  4K1O A;  1VB5 A;  3S84 A;  2JPU A;  4GQH A;  4YL0 A;  2LQG A;  4XPY A;  4DRI B;  1APC A;  2AU5 A;  1YA9 A;  3KKB A;  4CSA A;  4G7H F;  4U5C E;  1WTY A;  4CJO A;  3DAG A;  4IJJ A;  4Q7C A;  4BJ5 A;  4MVR A;  5COG A;  2BC5 A;  1Q0F A;  4HFK B;  4N06 A;  1U89 A;  3RVZ A;  2AP3 A;  5DQZ A;  3H65 A;  5JT4 A;  3US6 A;  1GQA A;  1TFK B;  2LSE A;  2FFH A;  2L81 A;  5E3A A;  2YL1 A;  2XM0 A;  3S27 A;  1MQV A;  2L6G A;  4LER A;  4YT5 A;  2R7T A;  3B0P A;  1Z6A A;  1LVK A;  2R9R B;  2OEV A;  5HV9 A;  4MVZ A;  3SNH A;  1YYX A;  2CGE A;  4ULW A;  4O79 A;  4JUR I;  4MTG A;  3B71 A;  2UUI A;  4J7T A;  4KC9 A;  4JJF A;  4BEM J;  4PFO A;  2R7W A;  2Q00 A;  1HY5 A;  4UDV A;  1O5H A;  4U5D E;  3GAN A;  1NFO A;  2VC9 A;  3AGU A;  3EGD B;  4E0H A;  3F46 A;  2XXA B;  2PNO A;  3DE9 A;  3KMI A;  4N4W A;  3NRH A;  4AL0 A;  3DJN B;  2OOC A;  3K66 A;  4MS2 A;  3GOR A;  4CJG A;  1G5Z A;  4XEF A;  2H8A A;  2Q9B A;  3JYH A;  4JCH A;  1UG7 A;  2NUT B;  2PP4 A;  1ZHX A;  3FAP B;  1FTS A;  4IRU A;  1A0B A;  3RQF A;  3SXY A;  4CS7 A;  5B3S C;  3N24 A;  4NQF A;  1MND A;  1D1C A;  1PD0 A;  256B A;  2R25 A;  4YT8 A;  2XM4 A;  4QI2 A;  2EPN A;  1E2X A;  2EPO A;  4QI0 A;  3W4Y A;  4EIY A;  5FCL A;  1MMA A;  2EIM C;  2L9J A;  1ST6 A;  3B9Q A;  2HJ3 A;  2HMQ A;  3IQ6 A;  4U9E A;  1D0Y A;  4CIH A;  3JTL O;  3MBG A;  3U8P A;  2XSE A;  1QLE C;  4J7Y A;  2IXM A;  3EQL F;  1K05 A;  4C3B A;  4JC7 A;  4MVO A;  2YWA A;  5E2Q A;  4XPW A;  3ZSU A;  3AOU A;  5KYW A;  1U0B B;  1KNY A;  3EH1 A;  2ZXO A;  4R32 A;  3W2V A;  4DXW A;  5DS4 A;  4FWV A;  2KJG A;  1VLT A;  2AWC A;  1AVO B;  2KSF A;  2HKV A;  1FMV A;  4F4B A;  5KYX B;  3M1C B;  1T6Q A;  2AWY A;  2CCY A;  3LLI A;  2NG1 A;  3GM3 A;  2J0W A;  3OEO A;  3EGX B;  1R5I D; 
#chains in the Genus database with same CATH homology
 1EA8 A;  1BZ4 A;  1NFN A;  1GS9 A;  3S84 A;  1LPE A;  1NFO A;  1OR2 A;  1YA9 A;  1H7I A;  3R2P A;  1AEP A;  1EQ1 A;  1LS4 A;  1OR3 A;  1B68 A;  1LE2 A;  1LE4 A;  2KC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...