1LS4A

Nmr structure of apolipophorin-iii from locusta migratoria
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
164
structure length
164
Chain Sequence
RPDAAGHVNIAEAVQQLNHTIVNAAHELHETLGLPTPDEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNAFARNLNNSIHDAATSLNLQDQLNSLQSALTNVGHQWQDIATKTQASAQEAWAPVQSALQEAAEKTKEAAANLQNSIQSAVQKPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipophorin-III
publication title NMR solution structure and dynamics of an exchangeable apolipoprotein,locusta migratoria apolipophorin III.
pubmed doi rcsb
source organism Locusta migratoria
molecule tags Lipid transport
total genus 52
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2002-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ls4A00
2KC3A 1EQ1A 1GS9A 1H7IA 1BZ4A 1B68A 1YA9A 1NFNA 1AEPA 1OR3A 1OR2A 1LE2A 1LPEA 1NFOA 1LS4A 1LE4A 3S84A 3R2PA 1EA8A
chains in the Genus database with same CATH superfamily
2DI3A 2YRFA 5B1AC 2XL6A 3DJUB 5L0DA 1VK5A 3X1OA 4U5EE 2OJED 3EQLF 3F47A 2DGJA 5EK0A 1NFNA 1Z7Qc 4N6CA 2W45A 3SXZA 1SMYF 2QUPA 3S27A 4CBEA 1MNDA 4MVOA 4CS9A 4CX9A 1G4WR 2EPKX 4DRHB 1E83A 3UMIA 1TFOB 2YL1A 3VM6A 2P0NA 3FVYA 3L8JA 1QSPA 3QTHA 2OJQA 3AGUA 3EFOB 4U5HA 1IZMA 2P7VA 1LI5A 4IAOA 1OCZC 2XL4A 2GA0A 2J8WA 2M4EA 3US6A 2EINC 2RSEB 3MFNA 4E0HA 3TULA 1NG1A 2AU5A 1XZQA 4OD4A 4UDVA 3FOPA 4XEVA 1QVXA 1Z63A 3EG9B 1LVKA 1EQ1A 3UGOA 4A2NB 4MTOA 1T9KA 3VYWA 1NU7D 5GPGB 2ETSA 4IWBA 1HW1A 1V4AA 5KYWB 2LP4A 3C8GB 2Q7RA 3QMKA 5T3TA 1U0BB 1TWCA 1TKNA 2AWYA 4HFKB 1M2VB 1TR2A 4JRZA 2CGEA 4XWJA 3VF0A 2X51A 4P9FA 3EHMA 2L6HA 2OQMA 4PK4A 3SNHA 4N6HA 1AVOB 2ZPAA 3ATPA 1ZW3A 1VB5A 2I15A 1LI7A 3G50A 4IB4A 5B3SC 2DB4A 3GEHA 3JYHA 1MMAA 3UR3C 5JRAA 2Y3BA 2YLIA 4ULVA 1S05A 2LD6A 4J7TA 5JLIA 1NU9C 3BRJA 1FNTc 3MLGA 1G4US 2MYSA 3CQZA 2KW3C 2PX3A 1ZU4A 4O6MA 3LNMB 2YL3A 3TD7A 2NSGA 3H65A 4LACB 2W9YA 3SP1A 4C3DA 5A6BA 4OIQF 1F1MA 1YA9A 1HE1A 2EPOA 4XQ1A 3W2VA 2OOCA 1CGME 3ZTZA 1BR4A 3GANA 3KL4A 4E7SA 3SEOA 1SYQA 2O9XA 3U5SA 4CDVA 2LIGA 3I5PA 3NMKA 3MBGA 1FFTC 2G62A 3QW0A 3U9MA 3V7OA 3EZHA 2A0UA 2HMQA 4PR9A 3T9OA 1LPEA 1ZU5A 5EHHA 1PD1A 1KU2A 5KYXB 2W4MA 4YJWA 2KQ9A 4CS7A 4K1OA 5L0GA 4X0RA 3EZIA 4BEJA 3NYLA 4XEKA 4ZLCA 3F46A 4BPMA 4CDAA 2XM4A 3T4RA 3DMDA 2E87A 2VCCA 3GWNA 4MW3A 5BUOA 4PJMA 2V26A 1O5HA 4MNDA 2XS8A 3M15A 3H2VA 2CW0F 2VB6A 2A1DD 4BJTA 2LK4A 1BR1A 3SXKA 1WGWA 1ZHXA 3LS1A 1WOLA 5A6BD 3S0XA 2G3KA 3AG3C 4YL1A 2FFHA 4NTAA 2DYRC 5F28E 5HV9A 4G7OF 1GQAA 3EFOA 2XXAA 2NUTB 4JCHA 2OCCC 2IOQA 4DVYP 3IPMO 2OEXA 3B0PA 3FOOA 2Y39A 3QVYA 4LLCA 2YQYA 2Q00A 2R03A 3FAPB 1VMAA 1BR2A 5D91A 3U8VA 3DAGA 3C62A 3HNJA 2IXPA 5CIVA 3EJNA 3HJCA 3K1IC 5E2QA 5AC4A 1Z23A 1OCOC 2B0JA 4PJNA 2P61A 4L6RA 5KYWA 2C03A 4NC3A 4KNVA 1E86A 3POVA 3W2WA 1TWAA 1HY5A 4JZAA 1GS9A 1WN0A 4JURI 1XWJA 3EGXB 5COGA 2NUPB 4C7OA 3L34A 1YYXA 3QZCA 3WG7C 2R7SA 4MQ9F 5L3VA 1DOVA 5KYUA 3Q7GA 1OR3A 5K0IA 3LUTB 5DQZA 1LIHA 3JCUQ 4I3MA 5AGFA 3IEEA 4XLPF 1I4YA 4KNWA 1MMDA 3U3BA 1AUEA 5JS5A 5L0FA 4AE4B 1W2WA 256BA 4LERA 4O7GA 2H7VC 4IRUA 1CPRA 3ZWIA 4PJJA 5AC5A 3GEEA 4J7YA 3K1IA 1T6QA 2R7UA 5COMA 2HV7A 2YL0A 2PP4A 4IJJA 5DS6A 4H4KC 3FMSA 3ECSA 4CIPA 2WZLA 4G7ZF 4CSAC 2WZFA 4JEAA 2HUJA 3IQ6A 3NMIA 3SZRA 4YWQA 2WZGA 4A4AA 3S28A 1TWGA 2JX0A 4ULWA 3T6JA 2HMZA 1H9TA 1GGQA 3GORA 4OIPF 4AX2A 2OU6A 5IY5C 3U3FA 4XPWA 4XPYA 2HKVA 1ST6A 3IQ5A 2XLOA 3S9OA 1U6HA 3RH3A 1RJ9B 2TMVP 2HJMA 2HV6A 1VTMP 4EHPA 3E70C 1I5NA 2J45A 5KYXA 3LLIA 3OA1A 2Q9BA 4K7BA 3H2UA 3GODA 2Y69C 3EH1A 2YHSA 4BJ6C 1RCPA 2Y3GA 3ASNC 3E9VA 4JCZA 4MVZA 4XEFA 3EPVA 4Z9HA 3J06A 2IXOA 2YEVA 1CGNA 4M63A 1MMGA 4CSAA 1Y4CA 5JSLA 1E84A 4NTBA 1K04A 1YYJA 1NSGB 3LAYA 2Y3DA 3JRTA 2VC9A 2B0HA 1SR2A 5JUAA 3FHDA 1QPUA 3T6GB 3HNIA 2W4BA 3L1MA 3Q6NA 3WHNA 1A7DA 4LDQA 1JRAA 1H7IA 3PDMP 2WL8A 3EHNA 1OXKA 3ZVRA 4MVSA 4DXWA 4U5CE 5A6KA 3C63A 2HSBA 4DJ9A 2RD9A 3JT1A 3ABLC 2XS1A 1EI7A 4AL1A 2J9VA 4W8KA 4EBBA 4WJ0A 3ZSUA 2XLMA 2CYDA 3ABKC 3DM5A 3JSEO 5B1BC 3DE9A 5KYYA 3AG1C 3C8ZA 3B9QA 4BG0A 1HW2A 2R02A 4JJFA 1N1CA 1Z3IX 4NCQA 1H6GA 3LEOA 4XTKA 2Q9AA 2Q9CA 4DBRA 3EGXA 1ZHYA 3KKBA 4ANJA 3ZG1A 2JPUA 4U5FE 1M2OA 4GQHA 2QY9A 4O6YA 4RDAA 4NQFA 2C04A 3A11A 3DM9B 2GWWA 1JOGA 3L8IA 3TQOA 2XLEA 2R7XA 2LCHA 3ZQVA 1VLSA 1V55C 1ZZPA 4W8PA 1Q0DA 3GM3A 2A6EF 2WVNA 3LLKA 5COFA 3T6BA 3LNRA 2L6GA 1QLEC 2A68F 2J9UA 2PF4E 4Z9IA 1LE2A 4WGYA 3A9CA 2NG1A 3CAXA 4JE9A 1RKEA 3AOUA 3CZ6A 3HLZA 4IGGA 4OIOF 4G0HA 2BC5A 2EILC 3B0VC 3KH2A 3N2ZB 1GM5A 2VASA 1VYKA 1OKKA 2CNWA 2EPNA 3AQBA 5E3CA 5F5HA 2FAPB 1TWHA 1LS1A 2IM8A 2XL8A 4LDKA 1HMDA 1D0ZA 5CI8A 4HE8D 2EPLX 1C17M 3DE8A 1TQGA 4NTFA 1K05A 4D4XA 1ZW2A 4U5DE 1B68A 1E2XA 4CIHA 2L6FA 1NBBA 2F22A 1JAFA 1TFKB 3QVZA 3N0TA 1A7EA 1UG7A 3M1CB 3NMJA 3WODF 3B0UX 3DD7A 1RXQA 4JW1A 4PFPA 2GFHA 2HJ3A 3JSZA 1S7ZA 4MS2A 1CGOA 1JR8A 4DBQA 3K6BA 1YARO 2YLDA 4U9DA 3UGPA 4GYTA 1K40A 3UMHA 3LEVA 1QZXA 2D5RB 5FCLA 3DAFA 3AG2C 3C7JA 3ZC4A 1M57C 3NYJA 4KC9A 3UMKA 2A69F 3V5YA 3EG9A 1LKXA 4ZLDA 2BE5F 4XLNF 4WABA 3RF3A 1LS4A 3SXMA 1BDJB 1OKKD 3RW0A 3U2MA 5KYNA 4MW8A 1LM3B 1EA8A 3QW1A 3RFYA 2XLVA 3U2LA 3C8GA 1D1CA 3ITFA 1R5ID 3NKDA 3O6XA 1FMWA 4JTDB 1BZ4A 4EWCA 4OIRF 1L3PA 1M2VA 1T6UA 2QE9A 2VCBA 3Q7LA 1M56C 3G4ZA 2KNHA 3M4CA 3B29A 2J9BA 1L7CA 4YL0A 3TOLA 5A6JA 2H8AA 2XSEA 3IQTA 4O6NA 2R7WA 1YLMA 4MVUA 4QDLA 5E33A 3ZQYA 2GAQA 2HSQA 1Q0MA 1PCXA 2YKZA 4YT4A 4JEBA 2J7PA 1MMNA 5E3AA 1NLXA 1C03A 1JMWA 2KK1A 4E7ZA 1T01A 4P6IC 4BJ5C 3W8IA 4GEHA 4DOZA 3TJ6A 3O10A 2OKUA 2H7OA 3R7CA 2AP3A 2XM0A 5JP7A 1V54C 3X2QC 2ICWG 3FXHA 4R32A 3RQGA 3TJ5A 5EGYA 5A69A 3BEHA 3I4UA 4KI2A 1YDIA 2KSFA 1D1AA 3C8GD 4YT8A 4N4WA 4DRJB 1ORSC 4MVQA 3LS0A 1E85A 1H9GA 2L81A 1RMVA 4DRIB 2J9WA 3OEOA 3GEIA 1QQ3A 2PBEA 5TJ5E 1OCCC 2YLGA 4IARA 3ZDLA 2AWCA 4BJ5A 3NYMA 4O79A 3VRCA 3GM2A 4FX5A 4CJOA 4EKWA 2LFDA 1YA7O 1A0BA 3K1HA 2CCYA 2J7PD 1OW8A 2WB7A 4RD9A 1VYIA 1Q0GA 2ZXPA 5DVWA 3DZAA 1FTSA 1U89A 2FGYA 3DWWA 3MYFA 2R7TA 2M64A 4NY3A 1CPQA 1C02A 2PNOA 3LESA 2QTVA 5L0HA 1LE4A 1SF8A 2Q4FA 1VLTA 2L9JA 3MX3A 4QI2A 4WGZA 5DQTA 4I44A 4YL3A 2KC3A 5L0JA 3K7DA 2WVQA 5DS4A 4Q4ZF 1I4ZA 4MVRA 1ZHWA 3KYIA 3SXYA 2NUTA 1T6IA 1SZIA 1VOMA 2P1AA 1Q0FA 1ORJA 3AQCA 2AVKA 2KGOA 1FFHA 1Q0KA 2HZ8A 4Z9JA 4AK9A 5L3QA 1ZVZA 4BJ6A 4E18A 2PX0A 3KPHA 2YL7A 3DJNB 4E0IA 1XZPA 3I5QA 4H54A 2R7OA 4ONSA 3RQEA 2XXAB 2G3VA 3CEXA 1T5OA 1WWPA 1JPNA 1OXBA 2UUIA 3S29A 2J46A 2IXNA 2KYHA 1HMOA 3ABMC 4OINF 3JYYA 4N06A 5DS5A 1M6TA 3HTKC 3EGDB 3LJBA 4AL0A 5DLJA 4EBKA 3FAJA 4JKVA 2NUPA 3W4YA 2ASRA 4E17A 2HFIA 2I8BA 3S90A 4K0DA 5JVEA 3RYLA 1ZHZA 2ZXOA 1WASA 2IYLD 3NRHA 1D0XA 2R9RB 2CDQA 4FWVA 1BBHA 1APCA 3IQCA 4P9TA 1PD0A 1WTYA 2EIJC 3ZIBA 1PV3A 2YZSA 2D4UA 2MHRA 3HNKA 4AE4A 1DOWA 3CSKA 3Q6MA 3ZTMA 1Z6AA 1KTMA 1YZCA 5T1DB 4CJGA 1FAPB 3JTLO 5KYUB 1KNYA 1FR0A 3HNLA 4FESA 5FZTA 1Z5ZA 4U5BE 2ZD9A 3EH2A 3O55A 5D92A 4KBLA 2QNLA 2EPMX 5B3IA 2XLDA 3NG1A 3RVYA 2R25A 5L0CA 4Q7CA 1J8YF 4G78A 4LDRA 3R2PA 4I1MA 2OG2A 1EKYA 3B71A 1MNEA 3OWTA 2V3CC 1OCRC 1RJ9A 1FMVA 1YAUO 1OW7A 1WATA 1RKCA 4XPXA 3JRMO 3DXJF 1AEPA 2VCAA 5BQHA 5CI9A 3U0CA 4BJ1A 1OR2A 3AJMA 4HEAJ 4YT5A 1MQVA 5BQIA 1O87A 1ZYRF 1A7VA 4IAQA 3UNGC 3DKAA 1NZEA 2H7BA 2R05A 3AG4C 3GM1A 2NSFA 3PCVA 2VH3A 4ER9A 2R7RA 4J32B 1NFOA 2A6HF 2LQGA 4JVSA 4PJLA 4F4BA 3U8PA 2OEVA 4YN0B 3G4XA 4DVZA 1G8XA 2PFDA 2LSEA 4RBNA 2XRHA 2CNWD 2A0BA 2L7AA 2DYSC 3PMRA 3IHUA 2R7VA 2KJGA 3HKKA 4QI0A 4BEMJ 4PACA 1YVIA 2IBFA 2Q3TA 2P6VA 2J0WA 4J30B 4EIYA 3AGTA 5JT4A 3PHF2 2NPUA 2UUHA 4LLEA 1YZAA 1Y6DA 2ZXRA 3NKEA 4JIOA 3RVZA 2J0XA 4MTFA 2Y3HA 1YJGA 5T3WA 3EGDA 3K33A 1IW7F 2Z15A 3DI5A 1V74B 4EUKB 2YVKA 4JTAB 5KYYB 4CS8C 2HS5A 3NDBB 4FAPB 3V5XA 1G5ZA 1A41A 4JC7A 4C3BA 4I1OB 3GWLA 4MVMA 4C3EA 1J8MF 4PFOA 3S84A 1D1BA 1UFBA 2GDCA 4JTCB 2ZXWC 4U5GA 3MYIA 5A6AA 1QKRA 2R7QA 2IXMA 3L0IA 3M79A 4G7HF 2JD3A 1ORYA 3TK0A 2XLWA 3U9JA 2EIKC 2BL2A 1OW6A 4EBJA 4YT2A 3WAQA 4C7OB 3VAYA 1O3UA 3KMIA 3JZ0A 3RQFA 2YWAA 3RKOF 2EIMC 4YK5A 1D0YA 5L0IA 3FDQA 3O39A 1HE9A 1ZHTA 3TOMA 4CS8A 3W8HA 3N24A 3C18A 3SYNA 2MWQA 4MTGA 4CS9C 4Q5SF 2X0CA 1OQCA 1R4TA 2QLAA 3RIPA 3KYJA 2XLHA 4D4NA 5F5FA 4CDYA 1RKEB 4OD5A 3V5ZA 5HSWA 4JJGA 2WVOA 3ASOC 3K66A 3M4BA 5BQGA 4U9EA 1JPJA 4B6IA 2LFFA 4HFFB
chains in the Genus database with same CATH topology
2KC3A 1EQ1A 1GS9A 1H7IA 1BZ4A 1B68A 1YA9A 1NFNA 1AEPA 1OR3A 1OR2A 1LE2A 1LPEA 1NFOA 1LS4A 1LE4A 3S84A 3R2PA 1EA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC3 A;  1EQ1 A;  1GS9 A;  1H7I A;  1BZ4 A;  1B68 A;  1YA9 A;  1NFN A;  1AEP A;  1OR3 A;  1OR2 A;  1LE2 A;  1LPE A;  1NFO A;  1LS4 A;  1LE4 A;  3S84 A;  3R2P A;  1EA8 A; 
#chains in the Genus database with same CATH topology
 2DI3 A;  2YRF A;  5B1A C;  2XL6 A;  3DJU B;  5L0D A;  1VK5 A;  3X1O A;  4U5E E;  2OJE D;  3EQL F;  3F47 A;  2DGJ A;  5EK0 A;  1NFN A;  1Z7Q c;  4N6C A;  2W45 A;  3SXZ A;  1SMY F;  2QUP A;  3S27 A;  4CBE A;  1MND A;  4MVO A;  4CS9 A;  4CX9 A;  1G4W R;  2EPK X;  4DRH B;  1E83 A;  3UMI A;  1TFO B;  2YL1 A;  3VM6 A;  2P0N A;  3FVY A;  3L8J A;  1QSP A;  3QTH A;  2OJQ A;  3AGU A;  3EFO B;  4U5H A;  1IZM A;  2P7V A;  1LI5 A;  4IAO A;  1OCZ C;  2XL4 A;  2GA0 A;  2J8W A;  2M4E A;  3US6 A;  2EIN C;  2RSE B;  3MFN A;  4E0H A;  3TUL A;  1NG1 A;  2AU5 A;  1XZQ A;  4OD4 A;  4UDV A;  3FOP A;  4XEV A;  1QVX A;  1Z63 A;  3EG9 B;  1LVK A;  1EQ1 A;  3UGO A;  4A2N B;  4MTO A;  1T9K A;  3VYW A;  1NU7 D;  5GPG B;  2ETS A;  4IWB A;  1HW1 A;  1V4A A;  5KYW B;  2LP4 A;  3C8G B;  2Q7R A;  3QMK A;  5T3T A;  1U0B B;  1TWC A;  1TKN A;  2AWY A;  4HFK B;  1M2V B;  1TR2 A;  4JRZ A;  2CGE A;  4XWJ A;  3VF0 A;  2X51 A;  4P9F A;  3EHM A;  2L6H A;  2OQM A;  4PK4 A;  3SNH A;  4N6H A;  1AVO B;  2ZPA A;  3ATP A;  1ZW3 A;  1VB5 A;  2I15 A;  1LI7 A;  3G50 A;  4IB4 A;  5B3S C;  2DB4 A;  3GEH A;  3JYH A;  1MMA A;  3UR3 C;  5JRA A;  2Y3B A;  2YLI A;  4ULV A;  1S05 A;  2LD6 A;  4J7T A;  5JLI A;  1NU9 C;  3BRJ A;  1FNT c;  3MLG A;  1G4U S;  2MYS A;  3CQZ A;  2KW3 C;  2PX3 A;  1ZU4 A;  4O6M A;  3LNM B;  2YL3 A;  3TD7 A;  2NSG A;  3H65 A;  4LAC B;  2W9Y A;  3SP1 A;  4C3D A;  5A6B A;  4OIQ F;  1F1M A;  1YA9 A;  1HE1 A;  2EPO A;  4XQ1 A;  3W2V A;  2OOC A;  1CGM E;  3ZTZ A;  1BR4 A;  3GAN A;  3KL4 A;  4E7S A;  3SEO A;  1SYQ A;  2O9X A;  3U5S A;  4CDV A;  2LIG A;  3I5P A;  3NMK A;  3MBG A;  1FFT C;  2G62 A;  3QW0 A;  3U9M A;  3V7O A;  3EZH A;  2A0U A;  2HMQ A;  4PR9 A;  3T9O A;  1LPE A;  1ZU5 A;  5EHH A;  1PD1 A;  1KU2 A;  5KYX B;  2W4M A;  4YJW A;  2KQ9 A;  4CS7 A;  4K1O A;  5L0G A;  4X0R A;  3EZI A;  4BEJ A;  3NYL A;  4XEK A;  4ZLC A;  3F46 A;  4BPM A;  4CDA A;  2XM4 A;  3T4R A;  3DMD A;  2E87 A;  2VCC A;  3GWN A;  4MW3 A;  5BUO A;  4PJM A;  2V26 A;  1O5H A;  4MND A;  2XS8 A;  3M15 A;  3H2V A;  2CW0 F;  2VB6 A;  2A1D D;  4BJT A;  2LK4 A;  1BR1 A;  3SXK A;  1WGW A;  1ZHX A;  3LS1 A;  1WOL A;  5A6B D;  3S0X A;  2G3K A;  3AG3 C;  4YL1 A;  2FFH A;  4NTA A;  2DYR C;  5F28 E;  5HV9 A;  4G7O F;  1GQA A;  3EFO A;  2XXA A;  2NUT B;  4JCH A;  2OCC C;  2IOQ A;  4DVY P;  3IPM O;  2OEX A;  3B0P A;  3FOO A;  2Y39 A;  3QVY A;  4LLC A;  2YQY A;  2Q00 A;  2R03 A;  3FAP B;  1VMA A;  1BR2 A;  5D91 A;  3U8V A;  3DAG A;  3C62 A;  3HNJ A;  2IXP A;  5CIV A;  3EJN A;  3HJC A;  3K1I C;  5E2Q A;  5AC4 A;  1Z23 A;  1OCO C;  2B0J A;  4PJN A;  2P61 A;  4L6R A;  5KYW A;  2C03 A;  4NC3 A;  4KNV A;  1E86 A;  3POV A;  3W2W A;  1TWA A;  1HY5 A;  4JZA A;  1GS9 A;  1WN0 A;  4JUR I;  1XWJ A;  3EGX B;  5COG A;  2NUP B;  4C7O A;  3L34 A;  1YYX A;  3QZC A;  3WG7 C;  2R7S A;  4MQ9 F;  5L3V A;  1DOV A;  5KYU A;  3Q7G A;  1OR3 A;  5K0I A;  3LUT B;  5DQZ A;  1LIH A;  3JCU Q;  4I3M A;  5AGF A;  3IEE A;  4XLP F;  1I4Y A;  4KNW A;  1MMD A;  3U3B A;  1AUE A;  5JS5 A;  5L0F A;  4AE4 B;  1W2W A;  256B A;  4LER A;  4O7G A;  2H7V C;  4IRU A;  1CPR A;  3ZWI A;  4PJJ A;  5AC5 A;  3GEE A;  4J7Y A;  3K1I A;  1T6Q A;  2R7U A;  5COM A;  2HV7 A;  2YL0 A;  2PP4 A;  4IJJ A;  5DS6 A;  4H4K C;  3FMS A;  3ECS A;  4CIP A;  2WZL A;  4G7Z F;  4CSA C;  2WZF A;  4JEA A;  2HUJ A;  3IQ6 A;  3NMI A;  3SZR A;  4YWQ A;  2WZG A;  4A4A A;  3S28 A;  1TWG A;  2JX0 A;  4ULW A;  3T6J A;  2HMZ A;  1H9T A;  1GGQ A;  3GOR A;  4OIP F;  4AX2 A;  2OU6 A;  5IY5 C;  3U3F A;  4XPW A;  4XPY A;  2HKV A;  1ST6 A;  3IQ5 A;  2XLO A;  3S9O A;  1U6H A;  3RH3 A;  1RJ9 B;  2TMV P;  2HJM A;  2HV6 A;  1VTM P;  4EHP A;  3E70 C;  1I5N A;  2J45 A;  5KYX A;  3LLI A;  3OA1 A;  2Q9B A;  4K7B A;  3H2U A;  3GOD A;  2Y69 C;  3EH1 A;  2YHS A;  4BJ6 C;  1RCP A;  2Y3G A;  3ASN C;  3E9V A;  4JCZ A;  4MVZ A;  4XEF A;  3EPV A;  4Z9H A;  3J06 A;  2IXO A;  2YEV A;  1CGN A;  4M63 A;  1MMG A;  4CSA A;  1Y4C A;  5JSL A;  1E84 A;  4NTB A;  1K04 A;  1YYJ A;  1NSG B;  3LAY A;  2Y3D A;  3JRT A;  2VC9 A;  2B0H A;  1SR2 A;  5JUA A;  3FHD A;  1QPU A;  3T6G B;  3HNI A;  2W4B A;  3L1M A;  3Q6N A;  3WHN A;  1A7D A;  4LDQ A;  1JRA A;  1H7I A;  3PDM P;  2WL8 A;  3EHN A;  1OXK A;  3ZVR A;  4MVS A;  4DXW A;  4U5C E;  5A6K A;  3C63 A;  2HSB A;  4DJ9 A;  2RD9 A;  3JT1 A;  3ABL C;  2XS1 A;  1EI7 A;  4AL1 A;  2J9V A;  4W8K A;  4EBB A;  4WJ0 A;  3ZSU A;  2XLM A;  2CYD A;  3ABK C;  3DM5 A;  3JSE O;  5B1B C;  3DE9 A;  5KYY A;  3AG1 C;  3C8Z A;  3B9Q A;  4BG0 A;  1HW2 A;  2R02 A;  4JJF A;  1N1C A;  1Z3I X;  4NCQ A;  1H6G A;  3LEO A;  4XTK A;  2Q9A A;  2Q9C A;  4DBR A;  3EGX A;  1ZHY A;  3KKB A;  4ANJ A;  3ZG1 A;  2JPU A;  4U5F E;  1M2O A;  4GQH A;  2QY9 A;  4O6Y A;  4RDA A;  4NQF A;  2C04 A;  3A11 A;  3DM9 B;  2GWW A;  1JOG A;  3L8I A;  3TQO A;  2XLE A;  2R7X A;  2LCH A;  3ZQV A;  1VLS A;  1V55 C;  1ZZP A;  4W8P A;  1Q0D A;  3GM3 A;  2A6E F;  2WVN A;  3LLK A;  5COF A;  3T6B A;  3LNR A;  2L6G A;  1QLE C;  2A68 F;  2J9U A;  2PF4 E;  4Z9I A;  1LE2 A;  4WGY A;  3A9C A;  2NG1 A;  3CAX A;  4JE9 A;  1RKE A;  3AOU A;  3CZ6 A;  3HLZ A;  4IGG A;  4OIO F;  4G0H A;  2BC5 A;  2EIL C;  3B0V C;  3KH2 A;  3N2Z B;  1GM5 A;  2VAS A;  1VYK A;  1OKK A;  2CNW A;  2EPN A;  3AQB A;  5E3C A;  5F5H A;  2FAP B;  1TWH A;  1LS1 A;  2IM8 A;  2XL8 A;  4LDK A;  1HMD A;  1D0Z A;  5CI8 A;  4HE8 D;  2EPL X;  1C17 M;  3DE8 A;  1TQG A;  4NTF A;  1K05 A;  4D4X A;  1ZW2 A;  4U5D E;  1B68 A;  1E2X A;  4CIH A;  2L6F A;  1NBB A;  2F22 A;  1JAF A;  1TFK B;  3QVZ A;  3N0T A;  1A7E A;  1UG7 A;  3M1C B;  3NMJ A;  3WOD F;  3B0U X;  3DD7 A;  1RXQ A;  4JW1 A;  4PFP A;  2GFH A;  2HJ3 A;  3JSZ A;  1S7Z A;  4MS2 A;  1CGO A;  1JR8 A;  4DBQ A;  3K6B A;  1YAR O;  2YLD A;  4U9D A;  3UGP A;  4GYT A;  1K40 A;  3UMH A;  3LEV A;  1QZX A;  2D5R B;  5FCL A;  3DAF A;  3AG2 C;  3C7J A;  3ZC4 A;  1M57 C;  3NYJ A;  4KC9 A;  3UMK A;  2A69 F;  3V5Y A;  3EG9 A;  1LKX A;  4ZLD A;  2BE5 F;  4XLN F;  4WAB A;  3RF3 A;  1LS4 A;  3SXM A;  1BDJ B;  1OKK D;  3RW0 A;  3U2M A;  5KYN A;  4MW8 A;  1LM3 B;  1EA8 A;  3QW1 A;  3RFY A;  2XLV A;  3U2L A;  3C8G A;  1D1C A;  3ITF A;  1R5I D;  3NKD A;  3O6X A;  1FMW A;  4JTD B;  1BZ4 A;  4EWC A;  4OIR F;  1L3P A;  1M2V A;  1T6U A;  2QE9 A;  2VCB A;  3Q7L A;  1M56 C;  3G4Z A;  2KNH A;  3M4C A;  3B29 A;  2J9B A;  1L7C A;  4YL0 A;  3TOL A;  5A6J A;  2H8A A;  2XSE A;  3IQT A;  4O6N A;  2R7W A;  1YLM A;  4MVU A;  4QDL A;  5E33 A;  3ZQY A;  2GAQ A;  2HSQ A;  1Q0M A;  1PCX A;  2YKZ A;  4YT4 A;  4JEB A;  2J7P A;  1MMN A;  5E3A A;  1NLX A;  1C03 A;  1JMW A;  2KK1 A;  4E7Z A;  1T01 A;  4P6I C;  4BJ5 C;  3W8I A;  4GEH A;  4DOZ A;  3TJ6 A;  3O10 A;  2OKU A;  2H7O A;  3R7C A;  2AP3 A;  2XM0 A;  5JP7 A;  1V54 C;  3X2Q C;  2ICW G;  3FXH A;  4R32 A;  3RQG A;  3TJ5 A;  5EGY A;  5A69 A;  3BEH A;  3I4U A;  4KI2 A;  1YDI A;  2KSF A;  1D1A A;  3C8G D;  4YT8 A;  4N4W A;  4DRJ B;  1ORS C;  4MVQ A;  3LS0 A;  1E85 A;  1H9G A;  2L81 A;  1RMV A;  4DRI B;  2J9W A;  3OEO A;  3GEI A;  1QQ3 A;  2PBE A;  5TJ5 E;  1OCC C;  2YLG A;  4IAR A;  3ZDL A;  2AWC A;  4BJ5 A;  3NYM A;  4O79 A;  3VRC A;  3GM2 A;  4FX5 A;  4CJO A;  4EKW A;  2LFD A;  1YA7 O;  1A0B A;  3K1H A;  2CCY A;  2J7P D;  1OW8 A;  2WB7 A;  4RD9 A;  1VYI A;  1Q0G A;  2ZXP A;  5DVW A;  3DZA A;  1FTS A;  1U89 A;  2FGY A;  3DWW A;  3MYF A;  2R7T A;  2M64 A;  4NY3 A;  1CPQ A;  1C02 A;  2PNO A;  3LES A;  2QTV A;  5L0H A;  1LE4 A;  1SF8 A;  2Q4F A;  1VLT A;  2L9J A;  3MX3 A;  4QI2 A;  4WGZ A;  5DQT A;  4I44 A;  4YL3 A;  2KC3 A;  5L0J A;  3K7D A;  2WVQ A;  5DS4 A;  4Q4Z F;  1I4Z A;  4MVR A;  1ZHW A;  3KYI A;  3SXY A;  2NUT A;  1T6I A;  1SZI A;  1VOM A;  2P1A A;  1Q0F A;  1ORJ A;  3AQC A;  2AVK A;  2KGO A;  1FFH A;  1Q0K A;  2HZ8 A;  4Z9J A;  4AK9 A;  5L3Q A;  1ZVZ A;  4BJ6 A;  4E18 A;  2PX0 A;  3KPH A;  2YL7 A;  3DJN B;  4E0I A;  1XZP A;  3I5Q A;  4H54 A;  2R7O A;  4ONS A;  3RQE A;  2XXA B;  2G3V A;  3CEX A;  1T5O A;  1WWP A;  1JPN A;  1OXB A;  2UUI A;  3S29 A;  2J46 A;  2IXN A;  2KYH A;  1HMO A;  3ABM C;  4OIN F;  3JYY A;  4N06 A;  5DS5 A;  1M6T A;  3HTK C;  3EGD B;  3LJB A;  4AL0 A;  5DLJ A;  4EBK A;  3FAJ A;  4JKV A;  2NUP A;  3W4Y A;  2ASR A;  4E17 A;  2HFI A;  2I8B A;  3S90 A;  4K0D A;  5JVE A;  3RYL A;  1ZHZ A;  2ZXO A;  1WAS A;  2IYL D;  3NRH A;  1D0X A;  2R9R B;  2CDQ A;  4FWV A;  1BBH A;  1APC A;  3IQC A;  4P9T A;  1PD0 A;  1WTY A;  2EIJ C;  3ZIB A;  1PV3 A;  2YZS A;  2D4U A;  2MHR A;  3HNK A;  4AE4 A;  1DOW A;  3CSK A;  3Q6M A;  3ZTM A;  1Z6A A;  1KTM A;  1YZC A;  5T1D B;  4CJG A;  1FAP B;  3JTL O;  5KYU B;  1KNY A;  1FR0 A;  3HNL A;  4FES A;  5FZT A;  1Z5Z A;  4U5B E;  2ZD9 A;  3EH2 A;  3O55 A;  5D92 A;  4KBL A;  2QNL A;  2EPM X;  5B3I A;  2XLD A;  3NG1 A;  3RVY A;  2R25 A;  5L0C A;  4Q7C A;  1J8Y F;  4G78 A;  4LDR A;  3R2P A;  4I1M A;  2OG2 A;  1EKY A;  3B71 A;  1MNE A;  3OWT A;  2V3C C;  1OCR C;  1RJ9 A;  1FMV A;  1YAU O;  1OW7 A;  1WAT A;  1RKC A;  4XPX A;  3JRM O;  3DXJ F;  1AEP A;  2VCA A;  5BQH A;  5CI9 A;  3U0C A;  4BJ1 A;  1OR2 A;  3AJM A;  4HEA J;  4YT5 A;  1MQV A;  5BQI A;  1O87 A;  1ZYR F;  1A7V A;  4IAQ A;  3UNG C;  3DKA A;  1NZE A;  2H7B A;  2R05 A;  3AG4 C;  3GM1 A;  2NSF A;  3PCV A;  2VH3 A;  4ER9 A;  2R7R A;  4J32 B;  1NFO A;  2A6H F;  2LQG A;  4JVS A;  4PJL A;  4F4B A;  3U8P A;  2OEV A;  4YN0 B;  3G4X A;  4DVZ A;  1G8X A;  2PFD A;  2LSE A;  4RBN A;  2XRH A;  2CNW D;  2A0B A;  2L7A A;  2DYS C;  3PMR A;  3IHU A;  2R7V A;  2KJG A;  3HKK A;  4QI0 A;  4BEM J;  4PAC A;  1YVI A;  2IBF A;  2Q3T A;  2P6V A;  2J0W A;  4J30 B;  4EIY A;  3AGT A;  5JT4 A;  3PHF 2;  2NPU A;  2UUH A;  4LLE A;  1YZA A;  1Y6D A;  2ZXR A;  3NKE A;  4JIO A;  3RVZ A;  2J0X A;  4MTF A;  2Y3H A;  1YJG A;  5T3W A;  3EGD A;  3K33 A;  1IW7 F;  2Z15 A;  3DI5 A;  1V74 B;  4EUK B;  2YVK A;  4JTA B;  5KYY B;  4CS8 C;  2HS5 A;  3NDB B;  4FAP B;  3V5X A;  1G5Z A;  1A41 A;  4JC7 A;  4C3B A;  4I1O B;  3GWL A;  4MVM A;  4C3E A;  1J8M F;  4PFO A;  3S84 A;  1D1B A;  1UFB A;  2GDC A;  4JTC B;  2ZXW C;  4U5G A;  3MYI A;  5A6A A;  1QKR A;  2R7Q A;  2IXM A;  3L0I A;  3M79 A;  4G7H F;  2JD3 A;  1ORY A;  3TK0 A;  2XLW A;  3U9J A;  2EIK C;  2BL2 A;  1OW6 A;  4EBJ A;  4YT2 A;  3WAQ A;  4C7O B;  3VAY A;  1O3U A;  3KMI A;  3JZ0 A;  3RQF A;  2YWA A;  3RKO F;  2EIM C;  4YK5 A;  1D0Y A;  5L0I A;  3FDQ A;  3O39 A;  1HE9 A;  1ZHT A;  3TOM A;  4CS8 A;  3W8H A;  3N24 A;  3C18 A;  3SYN A;  2MWQ A;  4MTG A;  4CS9 C;  4Q5S F;  2X0C A;  1OQC A;  1R4T A;  2QLA A;  3RIP A;  3KYJ A;  2XLH A;  4D4N A;  5F5F A;  4CDY A;  1RKE B;  4OD5 A;  3V5Z A;  5HSW A;  4JJG A;  2WVO A;  3ASO C;  3K66 A;  3M4B A;  5BQG A;  4U9E A;  1JPJ A;  4B6I A;  2LFF A;  4HFF B; 
#chains in the Genus database with same CATH homology
 2KC3 A;  1EQ1 A;  1GS9 A;  1H7I A;  1BZ4 A;  1B68 A;  1YA9 A;  1NFN A;  1AEP A;  1OR3 A;  1OR2 A;  1LE2 A;  1LPE A;  1NFO A;  1LS4 A;  1LE4 A;  3S84 A;  3R2P A;  1EA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...