3JRTA

Structure from the mobile metagenome of v. paracholerae: integron cassette protein vpc_cass2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
170
structure length
166
Chain Sequence
b'GVKMSDKWIEIEEILSGLIGDLTIAVTVLKDYEGKAFLREPQHQTKRQCIWRLCVYSIVINCRKYVELNQKYGKEIPGHNHIRGVYNNEINKNTAIKKLRNHCVAHVSDKSKYLKPAEVQEEIIKMFDGNFADEFLDWICPDNISTTDKSESLVGVIELLRDAVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integron cassette protein Vpc_cass2
publication title Integron gene cassettes: a repository of novel protein folds with distinct interaction sites.
pubmed doi rcsb
source organism Vibrio paracholerae
molecule tags Structural genomics, unknown function
total genus 57
structure length 166
sequence length 170
ec nomenclature
pdb deposition date 2009-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1060 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3jrtA00
3JRTA
chains in the Genus database with same CATH superfamily
1MMNA 2WVQA 3NYJA 2AU5A 2PFDA 5L0DA 4J30B 1Q0KA 1H9GA 5D91A 3C63A 5E3AA 3T6BA 1OR3A 2J9WA 2MWQA 4DBRA 2R7OA 2L6GA 3I5PA 3SXZA 4CS9C 2JX0A 4PJNA 3UMHA 3JT1A 1OXBA 3N24A 3GM3A 3O55A 1QVXA 2C03A 3EGXA 3CEXA 2P6VA 2DYSC 5BQGA 4RD9A 1APCA 2KNHA 3LLKA 2PP4A 3RH3A 2P0NA 2WZFA 2G62A 4YL3A 4EKWA 2XS1A 3G50A 2V26A 1DOWA 1ORJA 3QTHA 4YN0B 4H4KC 3RFYA 3U2MA 5KYXA 3WHNA 3FMSA 1GM5A 1V74B 4H54A 2FGYA 1BBHA 2NSFA 3TJ5A 1R4TA 4E18A 1W2WA 4YT5A 4KNVA 4ER9A 1TWHA 2BL2A 3ABMC 5IY5C 2XXAB 3DM9B 4P6IC 5E33A 1JAFA 2J0WA 2YLIA 4YT2A 5CIVA 2UUHA 5KYYB 3HJCA 3JCUQ 4JEAA 5EHHA 5T1DB 3LJBA 1A7VA 1ZHZA 4JCHA 3W2WA 2H7VC 1T6UA 3UGPA 1ZW3A 3V5YA 3TOMA 5L0HA 5D92A 1HE9A 3K33A 1LPEA 1FTSA 4U5EE 3S27A 1SF8A 4O7GA 2QNLA 2VCBA 1PD0A 1J8YF 2XLDA 4K1OA 1OW6A 3NMJA 4O6NA 4OINF 3UNGC 1LI7A 1CPRA 3Q6NA 2Y3BA 3QZCA 1RJ9B 3W4YA 4OIOF 1LIHA 1C02A 3EH1A 3LLIA 1ZHYA 5F28E 4KC9A 3R2PA 4IAOA 2Y3GA 2E87A 2WB7A 3IQ6A 3NMKA 4LDKA 4MTFA 2FFHA 4NC3A 1OCCC 2J9VA 2J7PA 2A69F 4E17A 3M15A 4LLCA 4W8PA 1U89A 3SNHA 2TMVP 1QKRA 1VYIA 256BA 3QMKA 2L6HA 3B0VC 1DOVA 2AVKA 4HEAJ 2HV7A 2IXNA 3HNLA 3QVZA 5L0JA 3EFOB 2R02A 4N4WA 4BG0A 1Z23A 2ZXWC 2L7AA 3HNKA 3JTLO 4LDQA 4N06A 3SP1A 3X2QC 4CJGA 1QSPA 3QVYA 3N0TA 1Z5ZA 4XPWA 4EHPA 1R5ID 3FHDA 3T9OA 1M6TA 5A6AA 2YL7A 1BDJB 3JZ0A 2HJMA 2R7VA 2NUPA 3M1CB 2WVNA 1JR8A 4ULVA 2Q4FA 3S90A 4U5GA 3LS0A 1VYKA 1RKEA 2XRHA 4XEVA 1MNDA 5BQHA 4Z9JA 5B1AC 1V55C 4JW1A 4DJ9A 3W8IA 1JMWA 2J9BA 3ECSA 3LEOA 3MBGA 4N6HA 5HV9A 3GWLA 4NTBA 1TWGA 2BE5F 1LVKA 2KYHA 3B9QA 4CJOA 3B0UX 1HMDA 3LNMB 5F5HA 3EG9A 3UMIA 4BJTA 4KI2A 3EGDB 2YLDA 1WGWA 1PD1A 3LESA 3OA1A 2AWYA 4QI2A 5T3TA 3DKAA 2R05A 3LAYA 2XS8A 4J7YA 4HE8D 3LEVA 1RXQA 4ZLCA 3G4ZA 4LLEA 1YARO 2CNWA 1BZ4A 2I8BA 4KBLA 2IYLD 2R9RB 4U9DA 4MVQA 3PMRA 3J06A 1T5OA 4BEJA 3X1OA 1BR2A 1VK5A 2YWAA 5DVWA 3V7OA 1EI7A 1ZHTA 2A6EF 3POVA 3U9JA 4MS2A 1YA9A 1OQCA 2X51A 2R25A 4JTDB 1S7ZA 4MVUA 3VYWA 1JRAA 4DRIB 5KYUB 1OR2A 1S05A 4XWJA 5K0IA 3HKKA 4DVZA 2YL1A 1CPQA 2EPLX 3RIPA 5A6KA 2Y3DA 3Q6MA 2A0UA 4NTAA 2R7RA 2QY9A 2P7VA 1WATA 4JE9A 1Q0GA 2EPNA 3R7CA 4B6IA 4CS8A 1TR2A 1LKXA 3ABLC 3DJUB 3GM2A 2EPOA 1YVIA 2ZD9A 1TWCA 3UMKA 5AC4A 1XZQA 4JURI 4U5HA 3HTKC 3CSKA 5JUAA 3A9CA 1E84A 3EQLF 2VCCA 2GFHA 3EGXB 3FOOA 3V5ZA 3WODF 4U9EA 4I44A 3AOUA 1V4AA 3JSZA 4CDAA 3JYHA 1RKCA 4A4AA 2A6HF 5CI8A 5TJ5E 4FAPB 1AVOB 3BRJA 5KYXB 5JRAA 4C7OA 4HFKB 1N1CA 1MMAA 1PV3A 4Q7CA 2AP3A 1D1CA 2XLWA 1OCOC 1ZZPA 3DXJF 3M4BA 1O3UA 2P1AA 1SZIA 1C17M 3IQCA 4JTCB 4MVZA 4Q4ZF 1U6HA 4AE4A 4DVYP 2Z15A 2YRFA 2CGEA 3FVYA 3RVZA 1K05A 1ST6A 3AG2C 1NLXA 1Q0DA 4BEMJ 1K04A 4JJGA 1JPJA 3M79A 2J7PD 3ZTZA 4MW8A 4MVOA 4PK4A 4AX2A 3C8GA 2L6FA 4YT8A 5T3WA 4L6RA 1D0ZA 3FXHA 4MTGA 5DS5A 4CDYA 4XLPF 1FR0A 3SXMA 3ATPA 1O5HA 2KGOA 5L0FA 3TD7A 2EIKC 3ZWIA 1TFKB 2YKZA 1HMOA 3B0PA 1Z7Qc 3RQGA 3VF0A 1I5NA 5JVEA 1LE2A 3NYMA 1Y6DA 1RCPA 5JLIA 4BJ5C 3E70C 4MNDA 2GWWA 3BEHA 2QE9A 3K1HA 4OD5A 4G7ZF 1NFNA 4U5FE 4BPMA 1XZPA 4CDVA 2JD3A 2ZPAA 1ZHXA 2J45A 2G3KA 4I1MA 2LFFA 2XL4A 4ANJA 2KQ9A 5KYWB 5DQZA 2HS5A 1E83A 4O79A 1QPUA 4G7OF 4NQFA 1OKKA 2WL8A 2WZLA 2EIMC 2G3VA 3JSEO 4D4XA 4YL0A 4Z9IA 2IOQA 1J8MF 1E85A 2VCAA 3Q7GA 4ULWA 1G4WR 2ZXPA 2FAPB 3K66A 4I1OB 1M56C 3L1MA 2OKUA 5E3CA 2F22A 2YQYA 5B3IA 2Q9AA 3ZVRA 4CSAA 4MVRA 2Q7RA 2CNWD 4NY3A 3EJNA 2NUPB 1SR2A 2C04A 2CYDA 3T6GB 4IWBA 1A41A 1FFHA 2EINC 1RKEB 1VOMA 3L8IA 3ZIBA 3JRTA 4BJ6A 3IQ5A 1AUEA 3QW0A 1OW8A 4LACB 2MYSA 2VH3A 1YJGA 1EQ1A 1ZU4A 2XLVA 3DI5A 2OJED 1FMVA 3EG9B 1NU7D 3K1IC 3I5QA 4CBEA 3U8PA 3ITFA 4XPXA 2DB4A 2D4UA 2IXMA 1KNYA 3EZHA 3O39A 3VAYA 2Y3HA 1ZW2A 1MQVA 1ORSC 5COMA 4NTFA 2Q9BA 1I4ZA 1LI5A 1BR4A 3KYJA 2J0XA 3A11A 1LS4A 3AG1C 3C62A 3U9MA 1ZU5A 1YLMA 2KK1A 3E9VA 3NMIA 2OG2A 3CAXA 1O87A 1MMDA 1TFOB 1VLTA 1A7DA 3ZG1A 1L7CA 5E2QA 2HSBA 1D1AA 4E0IA 2R03A 1WTYA 4CIHA 3EHMA 5FZTA 4CS9A 2EPKX 4AL0A 1GS9A 2W45A 4P9TA 1Z6AA 2W4MA 4YJWA 4JCZA 3U3BA 4FX5A 5GPGB 2YHSA 1G8XA 2XM0A 3KL4A 2JPUA 4P9FA 4M63A 4MVSA 4JTAB 4PFPA 4U5CE 3S29A 2YVKA 4C3DA 3AGUA 2KC3A 1I4YA 2XM4A 1NU9C 1PCXA 2I15A 4IJJA 4PJMA 3RYLA 1NZEA 1OCZC 2PNOA 2VC9A 4A2NB 2NSGA 2EILC 3F46A 1D1BA 3AQCA 3DWWA 4JRZA 2HV6A 2PBEA 2LCHA 3C8GD 4DRJB 5JT4A 1OW7A 1JPNA 2LP4A 5KYYA 1NBBA 3IHUA 3K6BA 2YEVA 4G0HA 4GEHA 4OD4A 4XPYA 3VM6A 1FNTc 1ZHWA 3DAGA 1T9KA 5B3SC 4C7OB 5DS6A 1HE1A 4FESA 2HUJA 4JVSA 4OIRF 3KKBA 4YL1A 1LE4A 3ABKC 2V3CC 2L9JA 3DJNB 2LSEA 4U5DE 5A6BA 3V5XA 2BC5A 4IGGA 2NUTA 3ZDLA 1MMGA 1H7IA 4AE4B 4WGZA 4DXWA 1ZVZA 3ZQVA 3SXKA 1CGNA 2D5RB 2GDCA 2XLMA 3RKOF 2M64A 4PR9A 1B68A 1FMWA 2ETSA 1NSGB 2WVOA 1YZAA 3KYIA 3LNRA 4YK5A 1YAUO 3S28A 4JKVA 4NCQA 2B0JA 3C8GB 3GEIA 3FAJA 3ZTMA 2XLOA 1A7EA 1TKNA 4J32B 4R32A 3RW0A 3H2UA 1L3PA 3QW1A 1OKKD 1UG7A 2RD9A 1ZYRF 3JRMO 3I4UA 2GAQA 2KSFA 4BJ1A 3CQZA 4AL1A 3L0IA 2R7SA 1M57C 2IXPA 4EIYA 1HW2A 2P61A 1M2VA 3L8JA 4JZAA 3Q7LA 2ASRA 2Q9CA 3TQOA 2W4BA 1WN0A 2YLGA 1VB5A 4PFOA 2LIGA 4E7SA 2W9YA 3SYNA 1T6IA 2MHRA 2OEVA 3DAFA 3HLZA 3NG1A 3U0CA 4GYTA 2OU6A 3C7JA 4OIQF 4IRUA 5COFA 2AWCA 1E86A 3K7DA 3GODA 2YL0A 4PJJA 1OCRC 4XEKA 4E7ZA 5L0IA 3OEOA 1LS1A 1K40A 2EIJC 3H2VA 4W8KA 3RF3A 2R7QA 4OIPF 4WJ0A 4QI0A 3C8ZA 4ONSA 4UDVA 4N6CA 2R7TA 4FWVA 2DYRC 1YYJA 3RQFA 4JJFA 2HSQA 1FFTC 2DI3A 1TWAA 1Z3IX 2CDQA 3JYYA 3NYLA 4MQ9F 5L3VA 4IARA 3NKEA 1H6GA 5KYNA 4XQ1A 1HW1A 1T6QA 2OQMA 3T4RA 2L81A 3NKDA 2LQGA 5HSWA 3LUTB 3AG4C 1T01A 2DGJA 2X0CA 2Q00A 1KU2A 5JS5A 3HNIA 3DE9A 1LM3B 4YWQA 3OWTA 2YL3A 4RDAA 4DBQA 3WG7C 2H8AA 3TULA 3FOPA 2R7WA 1IZMA 2A0BA 2LD6A 2IXOA 3KMIA 2H7BA 2A1DD 3VRCA 4RBNA 5DS4A 5CI9A 1YZCA 4IB4A 4YT4A 1GQAA 3W2VA 2A68F 4ZLDA 3EPVA 2XL6A 3LS1A 4MW3A 4J7TA 1RMVA 5A69A 2XLEA 1MNEA 2Y69C 2O9XA 3B71A 3EHNA 4IAQA 3W8HA 4EUKB 5BQIA 4CS8C 1WASA 2YZSA 2LK4A 3U2LA 3KPHA 1H9TA 5BUOA 4Q5SF 2CW0F 3F47A 4WABA 5B1BC 2XXAA 2OOCA 4C3BA 1YDIA 3B29A 3WAQA 1CGME 3RVYA 1G4US 4KNWA 1QQ3A 4Z9HA 3U5SA 4E0HA 5COGA 5AGFA 4DOZA 4EBJA 1GGQA 2M4EA 5L0CA 1VLSA 4X0RA 3IPMO 3S84A 1HY5A 3H65A 2XL8A 2QTVA 3AGTA 3DMDA 3KH2A 5A6BD 4JEBA 5KYWA 3PCVA 2IM8A 3RQEA 4I3MA 2H7OA 4D4NA 4F4BA 2PX0A 4PJLA 4MVMA 2XLHA 2HJ3A 2KW3C 1RJ9A 4O6YA 1U0BB 1JOGA 1Y4CA 1NFOA 1YYXA 3CZ6A 4DRHB 1D0XA 2GA0A 3GEEA 3GORA 3DD7A 2PX3A 3MFNA 4LERA 2IBFA 3M4CA 3MX3A 1VMAA 2RSEB 3EZIA 4HFFB 1V54C 1F1MA 3GEHA 5DLJA 4JIOA 1Q0FA 1SMYF 2HFIA 1WOLA 3MLGA 2QLAA 4K7BA 3U8VA 4CX9A 1IW7F 4EBBA 3EFOA 3TK0A 4EBKA 1D0YA 1FAPB 2NUTB 2QUPA 1M2OA 3TJ6A 2HMQA 3GWNA 2NG1A 5DQTA 1EKYA 3MYIA 1G5ZA 3TOLA 2J46A 3O10A 5A6JA 4C3EA 4XLNF 1BR1A 5L0GA 1ORYA 2OJQA 3DZAA 2PF4E 2NPUA 3IEEA 4XTKA 4BJ5A 1VTMP 5JSLA 3N2ZB 1TQGA 3DM5A 5JP7A 2R7XA 3EH2A 2VB6A 4K0DA 3SZRA 1YA7O 5EGYA 4XEFA 3NDBB 2OEXA 1SYQA 1KTMA 4G7HF 1CGOA 2J9UA 1Z63A 3FAPB 2HMZA 3S9OA 2Y39A 2KJGA 4AK9A 4CS7A 4CSAC 3G4XA 2Q3TA 3GANA 3O6XA 1M2VB 1NG1A 3T6JA 4EWCA 3NRHA 4G78A 1AEPA 3EGDA 2J8WA 4GQHA 5L3QA 3GM1A 4MTOA 3AJMA 4QDLA 3PHF2 4BJ6C 2B0HA 2OCCC 3S0XA 1A0BA 1OXKA 2XSEA 2ZXOA 3IQTA 3C18A 3ZC4A 1C03A 3AG3C 3ASNC 1XWJA 5EK0A 3ZQYA 4WGYA 4CIPA 3PDMP 3UGOA 3MYFA 3FDQA 1QZXA 2EPMX 3U3FA 3L34A 2R7UA 3UR3C 5AC5A 1E2XA 1QLEC 4PACA 2ZXRA 3ZSUA 1Q0MA 2HZ8A 4JC7A 5F5FA 3DE8A 2ICWG 4U5BE 2UUIA 2WZGA 5KYUA 3HNJA 3US6A 5FCLA 1EA8A 1WWPA 2VASA 1UFBA 2CCYA 4O6MA 2LFDA 3SXYA 3K1IA 3SEOA 2HKVA 4LDRA 3AQBA 3ASOC
chains in the Genus database with same CATH topology
1MMNA 2WVQA 3NYJA 2PFDA 4J30B 5D91A 5E3AA 3T6BA 2MWQA 2J9WA 4DBRA 2R7OA 3I5PA 4CS9C 4PJNA 3UMHA 3JT1A 3N24A 2C03A 3EGXA 2P6VA 2DYSC 4RD9A 2KNHA 3LLKA 2PP4A 3RH3A 2WZFA 2G62A 1Z63A 4YN0B 3RFYA 2V26A 5KYXA 4H4KC 4YWQA 2FGYA 1W2WA 4YT5A 4KNVA 1TWHA 3ABMC 5IY5C 2XXAB 3DM9B 4P6IC 5E33A 2J0WA 4YT2A 3HJCA 3JCUQ 5EHHA 5T1DB 3LJBA 1ZHZA 4JCHA 3W2WA 2H7VC 3UGPA 5D92A 3K33A 1FTSA 4U5EE 3S27A 1SF8A 4O7GA 1PD0A 1J8YF 4OINF 4O6NA 3UNGC 3Q6NA 2Y3BA 3QZCA 1RJ9B 4OIOF 3EH1A 3LLIA 1ZHYA 4KC9A 4IAOA 2Y3GA 2E87A 2WB7A 2FFHA 1OCCC 2J9VA 2J7PA 2A69F 4LLCA 3SNHA 1VYIA 3QMKA 3B0VC 4HEAJ 2HV7A 2IXNA 3EFOB 4BG0A 3NDBB 1Z23A 2ZXWC 3SP1A 4N06A 3X2QC 3N0TA 1Z5ZA 3FHDA 2R7VA 2NUPA 3M1CB 2WVNA 4U5GA 3LS0A 1VYKA 2XRHA 1MNDA 5B1AC 1V55C 4JW1A 3W8IA 3ECSA 1TWGA 2BE5F 1LVKA 3B9QA 3B0UX 5F5HA 3UMIA 3EG9A 4BJTA 4KI2A 3EGDB 1WGWA 1PD1A 3LESA 3OA1A 5T3TA 3LAYA 4HE8D 3LEVA 4ZLCA 4LLEA 2CNWA 2I8BA 4KBLA 2IYLD 3PMRA 4BEJA 3X1OA 1BR2A 1VK5A 5DVWA 3V7OA 1ZHTA 2A6EF 3POVA 2X51A 1S7ZA 3VYWA 5KYUB 4XWJA 4DVZA 3RIPA 2Y3DA 3Q6MA 2R7RA 2QY9A 2P7VA 4B6IA 4CS8A 1TR2A 1LKXA 3ABLC 3DJUB 1TWCA 4JURI 4U5HA 3HTKC 3CSKA 3EQLF 2GFHA 3EGXB 3WODF 4I44A 3JSZA 3JYHA 2A6HF 5CI8A 4C7OA 5KYXB 4HFKB 1N1CA 1MMAA 4Q7CA 3DXJF 1D1CA 3UMKA 1OCOC 5DS5A 1SZIA 4Q4ZF 4AE4A 4DVYP 2Z15A 3FVYA 2CGEA 1ST6A 3AG2C 4JJGA 1JPJA 2J7PD 4PK4A 4AX2A 4YT8A 5T3WA 1D0ZA 4XLPF 1O5HA 2KGOA 3TD7A 2EIKC 3B0PA 3NYMA 4BJ5C 3E70C 4MNDA 4OD5A 3K1HA 4G7ZF 4U5FE 2JD3A 2ZPAA 1ZHXA 2J45A 2G3KA 4I1MA 2XL4A 4ANJA 2KQ9A 5KYWB 5DQZA 4G7OF 4O79A 1OKKA 2WL8A 2WZLA 2EIMC 2G3VA 2IOQA 1J8MF 3Q7GA 4ULWA 2ZXPA 3K66A 4I1OB 1M56C 5E3CA 4CSAA 2Q9AA 3ZVRA 2CNWD 4NY3A 3EJNA 2NUPB 2C04A 4QI2A 4IWBA 1FFHA 1VOMA 2EINC 3ZIBA 4BJ6A 3JRTA 4LACB 2MYSA 2VH3A 1ZU4A 1FMVA 3EG9B 1NU7D 3K1IC 3I5QA 4CBEA 3ITFA 2IXMA 3EZHA 3O39A 3VAYA 2Y3HA 2Q9BA 1BR4A 2J0XA 3AG1C 1ZU5A 3E9VA 2OG2A 1O87A 1MMDA 3ZG1A 5E2QA 1D1AA 4CIHA 3EHMA 4CS9A 2W45A 1Z6AA 2W4MA 4YJWA 4FX5A 2YHSA 1G8XA 3KL4A 4M63A 4PFPA 4U5CE 3S29A 4C3DA 4IJJA 1PCXA 1NU9C 4PJMA 3RYLA 1NZEA 1OCZC 4A2NB 3F46A 2EILC 1D1BA 3AQCA 2HV6A 1JPNA 5KYYA 3K6BA 4GEHA 4G0HA 2YEVA 4OD4A 1ZHWA 3DAGA 5B3SC 4C7OB 5DS6A 4FESA 4JVSA 4OIRF 3KKBA 2V3CC 3ABKC 2L9JA 3DJNB 2LSEA 4U5DE 2NUTA 4AE4B 1MMGA 2D5RB 3RKOF 1FMWA 2WVOA 3LNRA 3S28A 2B0JA 3FAJA 1TKNA 4J32B 1OKKD 1ZYRF 3I4UA 4BJ1A 3CQZA 3L0IA 2R7SA 1M57C 2IXPA 1M2VA 4JZAA 3Q7LA 2Q9CA 2W4BA 4PFOA 4E7SA 2W9YA 3SYNA 3DAFA 3HLZA 3NG1A 4GYTA 4OIQF 4IRUA 3K7DA 3GODA 4PJJA 1OCRC 4E7ZA 3OEOA 1LS1A 2EIJC 4W8KA 2R7QA 4OIPF 4WJ0A 4QI0A 2R7TA 4FWVA 2DYRC 4JJFA 1FFTC 1TWAA 1Z3IX 2CDQA 3NYLA 4MQ9F 5L3VA 3NKEA 5KYNA 3T4RA 2L81A 3NKDA 5HSWA 3AG4C 2DGJA 1KU2A 3OWTA 4RDAA 4DBQA 3WG7C 2R7WA 1IZMA 2IXOA 3KMIA 2H7BA 2A1DD 4RBNA 5DS4A 5CI9A 4YT4A 3W2VA 2A68F 4ZLDA 3EPVA 3LS1A 3EHNA 1MNEA 2Y69C 2O9XA 3W8HA 4CS8C 2YZSA 5BUOA 4Q5SF 2CW0F 3F47A 5B1BC 2XXAA 4C3BA 4KNWA 4DOZA 2M4EA 4X0RA 3H65A 2QTVA 3DMDA 3KH2A 5KYWA 4I3MA 2H7OA 4F4BA 2PX0A 4PJLA 2KW3C 1RJ9A 4O6YA 3CZ6A 1D0XA 3DD7A 2PX3A 5KYYB 4LERA 3MX3A 1VMAA 3EZIA 4HFFB 5DLJA 1V54C 1SMYF 3MLGA 4K7BA 1IW7F 4EBBA 3EFOA 1D0YA 2NUTB 1M2OA 2NG1A 5DQTA 2J46A 4C3EA 4XLNF 1BR1A 3DZAA 2PF4E 3IEEA 4XTKA 4BJ5A 3N2ZB 2R7XA 3DM5A 3EH2A 2VB6A 4K0DA 3SZRA 5EGYA 4G7HF 2J9UA 2Y39A 2KJGA 4AK9A 4CS7A 4CSAC 2Q3TA 3GANA 3O6XA 1M2VB 1NG1A 3T6JA 4EWCA 3NRHA 3EGDA 5L3QA 4QDLA 3PHF2 4BJ6C 2OCCC 3S0XA 2XSEA 2ZXOA 3ZC4A 3AG3C 3ASNC 3UGOA 3FDQA 1QZXA 2R7UA 3L34A 3UR3C 1QLEC 2ZXRA 3ZSUA 5F5FA 4U5BE 2WZGA 5KYUA 5FCLA 2VASA 4O6MA 3SEOA 3AQBA 3ASOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRT A; 
#chains in the Genus database with same CATH topology
 1MMN A;  2WVQ A;  3NYJ A;  2AU5 A;  2PFD A;  5L0D A;  4J30 B;  1Q0K A;  1H9G A;  5D91 A;  3C63 A;  5E3A A;  3T6B A;  1OR3 A;  2J9W A;  2MWQ A;  4DBR A;  2R7O A;  2L6G A;  3I5P A;  3SXZ A;  4CS9 C;  2JX0 A;  4PJN A;  3UMH A;  3JT1 A;  1OXB A;  3N24 A;  3GM3 A;  3O55 A;  1QVX A;  2C03 A;  3EGX A;  3CEX A;  2P6V A;  2DYS C;  5BQG A;  4RD9 A;  1APC A;  2KNH A;  3LLK A;  2PP4 A;  3RH3 A;  2P0N A;  2WZF A;  2G62 A;  4YL3 A;  4EKW A;  2XS1 A;  3G50 A;  2V26 A;  1DOW A;  1ORJ A;  3QTH A;  4YN0 B;  4H4K C;  3RFY A;  3U2M A;  5KYX A;  3WHN A;  3FMS A;  1GM5 A;  1V74 B;  4H54 A;  2FGY A;  1BBH A;  2NSF A;  3TJ5 A;  1R4T A;  4E18 A;  1W2W A;  4YT5 A;  4KNV A;  4ER9 A;  1TWH A;  2BL2 A;  3ABM C;  5IY5 C;  2XXA B;  3DM9 B;  4P6I C;  5E33 A;  1JAF A;  2J0W A;  2YLI A;  4YT2 A;  5CIV A;  2UUH A;  5KYY B;  3HJC A;  3JCU Q;  4JEA A;  5EHH A;  5T1D B;  3LJB A;  1A7V A;  1ZHZ A;  4JCH A;  3W2W A;  2H7V C;  1T6U A;  3UGP A;  1ZW3 A;  3V5Y A;  3TOM A;  5L0H A;  5D92 A;  1HE9 A;  3K33 A;  1LPE A;  1FTS A;  4U5E E;  3S27 A;  1SF8 A;  4O7G A;  2QNL A;  2VCB A;  1PD0 A;  1J8Y F;  2XLD A;  4K1O A;  1OW6 A;  3NMJ A;  4O6N A;  4OIN F;  3UNG C;  1LI7 A;  1CPR A;  3Q6N A;  2Y3B A;  3QZC A;  1RJ9 B;  3W4Y A;  4OIO F;  1LIH A;  1C02 A;  3EH1 A;  3LLI A;  1ZHY A;  5F28 E;  4KC9 A;  3R2P A;  4IAO A;  2Y3G A;  2E87 A;  2WB7 A;  3IQ6 A;  3NMK A;  4LDK A;  4MTF A;  2FFH A;  4NC3 A;  1OCC C;  2J9V A;  2J7P A;  2A69 F;  4E17 A;  3M15 A;  4LLC A;  4W8P A;  1U89 A;  3SNH A;  2TMV P;  1QKR A;  1VYI A;  256B A;  3QMK A;  2L6H A;  3B0V C;  1DOV A;  2AVK A;  4HEA J;  2HV7 A;  2IXN A;  3HNL A;  3QVZ A;  5L0J A;  3EFO B;  2R02 A;  4N4W A;  4BG0 A;  1Z23 A;  2ZXW C;  2L7A A;  3HNK A;  3JTL O;  4LDQ A;  4N06 A;  3SP1 A;  3X2Q C;  4CJG A;  1QSP A;  3QVY A;  3N0T A;  1Z5Z A;  4XPW A;  4EHP A;  1R5I D;  3FHD A;  3T9O A;  1M6T A;  5A6A A;  2YL7 A;  1BDJ B;  3JZ0 A;  2HJM A;  2R7V A;  2NUP A;  3M1C B;  2WVN A;  1JR8 A;  4ULV A;  2Q4F A;  3S90 A;  4U5G A;  3LS0 A;  1VYK A;  1RKE A;  2XRH A;  4XEV A;  1MND A;  5BQH A;  4Z9J A;  5B1A C;  1V55 C;  4JW1 A;  4DJ9 A;  3W8I A;  1JMW A;  2J9B A;  3ECS A;  3LEO A;  3MBG A;  4N6H A;  5HV9 A;  3GWL A;  4NTB A;  1TWG A;  2BE5 F;  1LVK A;  2KYH A;  3B9Q A;  4CJO A;  3B0U X;  1HMD A;  3LNM B;  5F5H A;  3EG9 A;  3UMI A;  4BJT A;  4KI2 A;  3EGD B;  2YLD A;  1WGW A;  1PD1 A;  3LES A;  3OA1 A;  2AWY A;  4QI2 A;  5T3T A;  3DKA A;  2R05 A;  3LAY A;  2XS8 A;  4J7Y A;  4HE8 D;  3LEV A;  1RXQ A;  4ZLC A;  3G4Z A;  4LLE A;  1YAR O;  2CNW A;  1BZ4 A;  2I8B A;  4KBL A;  2IYL D;  2R9R B;  4U9D A;  4MVQ A;  3PMR A;  3J06 A;  1T5O A;  4BEJ A;  3X1O A;  1BR2 A;  1VK5 A;  2YWA A;  5DVW A;  3V7O A;  1EI7 A;  1ZHT A;  2A6E F;  3POV A;  3U9J A;  4MS2 A;  1YA9 A;  1OQC A;  2X51 A;  2R25 A;  4JTD B;  1S7Z A;  4MVU A;  3VYW A;  1JRA A;  4DRI B;  5KYU B;  1OR2 A;  1S05 A;  4XWJ A;  5K0I A;  3HKK A;  4DVZ A;  2YL1 A;  1CPQ A;  2EPL X;  3RIP A;  5A6K A;  2Y3D A;  3Q6M A;  2A0U A;  4NTA A;  2R7R A;  2QY9 A;  2P7V A;  1WAT A;  4JE9 A;  1Q0G A;  2EPN A;  3R7C A;  4B6I A;  4CS8 A;  1TR2 A;  1LKX A;  3ABL C;  3DJU B;  3GM2 A;  2EPO A;  1YVI A;  2ZD9 A;  1TWC A;  3UMK A;  5AC4 A;  1XZQ A;  4JUR I;  4U5H A;  3HTK C;  3CSK A;  5JUA A;  3A9C A;  1E84 A;  3EQL F;  2VCC A;  2GFH A;  3EGX B;  3FOO A;  3V5Z A;  3WOD F;  4U9E A;  4I44 A;  3AOU A;  1V4A A;  3JSZ A;  4CDA A;  3JYH A;  1RKC A;  4A4A A;  2A6H F;  5CI8 A;  5TJ5 E;  4FAP B;  1AVO B;  3BRJ A;  5KYX B;  5JRA A;  4C7O A;  4HFK B;  1N1C A;  1MMA A;  1PV3 A;  4Q7C A;  2AP3 A;  1D1C A;  2XLW A;  1OCO C;  1ZZP A;  3DXJ F;  3M4B A;  1O3U A;  2P1A A;  1SZI A;  1C17 M;  3IQC A;  4JTC B;  4MVZ A;  4Q4Z F;  1U6H A;  4AE4 A;  4DVY P;  2Z15 A;  2YRF A;  2CGE A;  3FVY A;  3RVZ A;  1K05 A;  1ST6 A;  3AG2 C;  1NLX A;  1Q0D A;  4BEM J;  1K04 A;  4JJG A;  1JPJ A;  3M79 A;  2J7P D;  3ZTZ A;  4MW8 A;  4MVO A;  4PK4 A;  4AX2 A;  3C8G A;  2L6F A;  4YT8 A;  5T3W A;  4L6R A;  1D0Z A;  3FXH A;  4MTG A;  5DS5 A;  4CDY A;  4XLP F;  1FR0 A;  3SXM A;  3ATP A;  1O5H A;  2KGO A;  5L0F A;  3TD7 A;  2EIK C;  3ZWI A;  1TFK B;  2YKZ A;  1HMO A;  3B0P A;  1Z7Q c;  3RQG A;  3VF0 A;  1I5N A;  5JVE A;  1LE2 A;  3NYM A;  1Y6D A;  1RCP A;  5JLI A;  4BJ5 C;  3E70 C;  4MND A;  2GWW A;  3BEH A;  2QE9 A;  3K1H A;  4OD5 A;  4G7Z F;  1NFN A;  4U5F E;  4BPM A;  1XZP A;  4CDV A;  2JD3 A;  2ZPA A;  1ZHX A;  2J45 A;  2G3K A;  4I1M A;  2LFF A;  2XL4 A;  4ANJ A;  2KQ9 A;  5KYW B;  5DQZ A;  2HS5 A;  1E83 A;  4O79 A;  1QPU A;  4G7O F;  4NQF A;  1OKK A;  2WL8 A;  2WZL A;  2EIM C;  2G3V A;  3JSE O;  4D4X A;  4YL0 A;  4Z9I A;  2IOQ A;  1J8M F;  1E85 A;  2VCA A;  3Q7G A;  4ULW A;  1G4W R;  2ZXP A;  2FAP B;  3K66 A;  4I1O B;  1M56 C;  3L1M A;  2OKU A;  5E3C A;  2F22 A;  2YQY A;  5B3I A;  2Q9A A;  3ZVR A;  4CSA A;  4MVR A;  2Q7R A;  2CNW D;  4NY3 A;  3EJN A;  2NUP B;  1SR2 A;  2C04 A;  2CYD A;  3T6G B;  4IWB A;  1A41 A;  1FFH A;  2EIN C;  1RKE B;  1VOM A;  3L8I A;  3ZIB A;  3JRT A;  4BJ6 A;  3IQ5 A;  1AUE A;  3QW0 A;  1OW8 A;  4LAC B;  2MYS A;  2VH3 A;  1YJG A;  1EQ1 A;  1ZU4 A;  2XLV A;  3DI5 A;  2OJE D;  1FMV A;  3EG9 B;  1NU7 D;  3K1I C;  3I5Q A;  4CBE A;  3U8P A;  3ITF A;  4XPX A;  2DB4 A;  2D4U A;  2IXM A;  1KNY A;  3EZH A;  3O39 A;  3VAY A;  2Y3H A;  1ZW2 A;  1MQV A;  1ORS C;  5COM A;  4NTF A;  2Q9B A;  1I4Z A;  1LI5 A;  1BR4 A;  3KYJ A;  2J0X A;  3A11 A;  1LS4 A;  3AG1 C;  3C62 A;  3U9M A;  1ZU5 A;  1YLM A;  2KK1 A;  3E9V A;  3NMI A;  2OG2 A;  3CAX A;  1O87 A;  1MMD A;  1TFO B;  1VLT A;  1A7D A;  3ZG1 A;  1L7C A;  5E2Q A;  2HSB A;  1D1A A;  4E0I A;  2R03 A;  1WTY A;  4CIH A;  3EHM A;  5FZT A;  4CS9 A;  2EPK X;  4AL0 A;  1GS9 A;  2W45 A;  4P9T A;  1Z6A A;  2W4M A;  4YJW A;  4JCZ A;  3U3B A;  4FX5 A;  5GPG B;  2YHS A;  1G8X A;  2XM0 A;  3KL4 A;  2JPU A;  4P9F A;  4M63 A;  4MVS A;  4JTA B;  4PFP A;  4U5C E;  3S29 A;  2YVK A;  4C3D A;  3AGU A;  2KC3 A;  1I4Y A;  2XM4 A;  1NU9 C;  1PCX A;  2I15 A;  4IJJ A;  4PJM A;  3RYL A;  1NZE A;  1OCZ C;  2PNO A;  2VC9 A;  4A2N B;  2NSG A;  2EIL C;  3F46 A;  1D1B A;  3AQC A;  3DWW A;  4JRZ A;  2HV6 A;  2PBE A;  2LCH A;  3C8G D;  4DRJ B;  5JT4 A;  1OW7 A;  1JPN A;  2LP4 A;  5KYY A;  1NBB A;  3IHU A;  3K6B A;  2YEV A;  4G0H A;  4GEH A;  4OD4 A;  4XPY A;  3VM6 A;  1FNT c;  1ZHW A;  3DAG A;  1T9K A;  5B3S C;  4C7O B;  5DS6 A;  1HE1 A;  4FES A;  2HUJ A;  4JVS A;  4OIR F;  3KKB A;  4YL1 A;  1LE4 A;  3ABK C;  2V3C C;  2L9J A;  3DJN B;  2LSE A;  4U5D E;  5A6B A;  3V5X A;  2BC5 A;  4IGG A;  2NUT A;  3ZDL A;  1MMG A;  1H7I A;  4AE4 B;  4WGZ A;  4DXW A;  1ZVZ A;  3ZQV A;  3SXK A;  1CGN A;  2D5R B;  2GDC A;  2XLM A;  3RKO F;  2M64 A;  4PR9 A;  1B68 A;  1FMW A;  2ETS A;  1NSG B;  2WVO A;  1YZA A;  3KYI A;  3LNR A;  4YK5 A;  1YAU O;  3S28 A;  4JKV A;  4NCQ A;  2B0J A;  3C8G B;  3GEI A;  3FAJ A;  3ZTM A;  2XLO A;  1A7E A;  1TKN A;  4J32 B;  4R32 A;  3RW0 A;  3H2U A;  1L3P A;  3QW1 A;  1OKK D;  1UG7 A;  2RD9 A;  1ZYR F;  3JRM O;  3I4U A;  2GAQ A;  2KSF A;  4BJ1 A;  3CQZ A;  4AL1 A;  3L0I A;  2R7S A;  1M57 C;  2IXP A;  4EIY A;  1HW2 A;  2P61 A;  1M2V A;  3L8J A;  4JZA A;  3Q7L A;  2ASR A;  2Q9C A;  3TQO A;  2W4B A;  1WN0 A;  2YLG A;  1VB5 A;  4PFO A;  2LIG A;  4E7S A;  2W9Y A;  3SYN A;  1T6I A;  2MHR A;  2OEV A;  3DAF A;  3HLZ A;  3NG1 A;  3U0C A;  4GYT A;  2OU6 A;  3C7J A;  4OIQ F;  4IRU A;  5COF A;  2AWC A;  1E86 A;  3K7D A;  3GOD A;  2YL0 A;  4PJJ A;  1OCR C;  4XEK A;  4E7Z A;  5L0I A;  3OEO A;  1LS1 A;  1K40 A;  2EIJ C;  3H2V A;  4W8K A;  3RF3 A;  2R7Q A;  4OIP F;  4WJ0 A;  4QI0 A;  3C8Z A;  4ONS A;  4UDV A;  4N6C A;  2R7T A;  4FWV A;  2DYR C;  1YYJ A;  3RQF A;  4JJF A;  2HSQ A;  1FFT C;  2DI3 A;  1TWA A;  1Z3I X;  2CDQ A;  3JYY A;  3NYL A;  4MQ9 F;  5L3V A;  4IAR A;  3NKE A;  1H6G A;  5KYN A;  4XQ1 A;  1HW1 A;  1T6Q A;  2OQM A;  3T4R A;  2L81 A;  3NKD A;  2LQG A;  5HSW A;  3LUT B;  3AG4 C;  1T01 A;  2DGJ A;  2X0C A;  2Q00 A;  1KU2 A;  5JS5 A;  3HNI A;  3DE9 A;  1LM3 B;  4YWQ A;  3OWT A;  2YL3 A;  4RDA A;  4DBQ A;  3WG7 C;  2H8A A;  3TUL A;  3FOP A;  2R7W A;  1IZM A;  2A0B A;  2LD6 A;  2IXO A;  3KMI A;  2H7B A;  2A1D D;  3VRC A;  4RBN A;  5DS4 A;  5CI9 A;  1YZC A;  4IB4 A;  4YT4 A;  1GQA A;  3W2V A;  2A68 F;  4ZLD A;  3EPV A;  2XL6 A;  3LS1 A;  4MW3 A;  4J7T A;  1RMV A;  5A69 A;  2XLE A;  1MNE A;  2Y69 C;  2O9X A;  3B71 A;  3EHN A;  4IAQ A;  3W8H A;  4EUK B;  5BQI A;  4CS8 C;  1WAS A;  2YZS A;  2LK4 A;  3U2L A;  3KPH A;  1H9T A;  5BUO A;  4Q5S F;  2CW0 F;  3F47 A;  4WAB A;  5B1B C;  2XXA A;  2OOC A;  4C3B A;  1YDI A;  3B29 A;  3WAQ A;  1CGM E;  3RVY A;  1G4U S;  4KNW A;  1QQ3 A;  4Z9H A;  3U5S A;  4E0H A;  5COG A;  5AGF A;  4DOZ A;  4EBJ A;  1GGQ A;  2M4E A;  5L0C A;  1VLS A;  4X0R A;  3IPM O;  3S84 A;  1HY5 A;  3H65 A;  2XL8 A;  2QTV A;  3AGT A;  3DMD A;  3KH2 A;  5A6B D;  4JEB A;  5KYW A;  3PCV A;  2IM8 A;  3RQE A;  4I3M A;  2H7O A;  4D4N A;  4F4B A;  2PX0 A;  4PJL A;  4MVM A;  2XLH A;  2HJ3 A;  2KW3 C;  1RJ9 A;  4O6Y A;  1U0B B;  1JOG A;  1Y4C A;  1NFO A;  1YYX A;  3CZ6 A;  4DRH B;  1D0X A;  2GA0 A;  3GEE A;  3GOR A;  3DD7 A;  2PX3 A;  3MFN A;  4LER A;  2IBF A;  3M4C A;  3MX3 A;  1VMA A;  2RSE B;  3EZI A;  4HFF B;  1V54 C;  1F1M A;  3GEH A;  5DLJ A;  4JIO A;  1Q0F A;  1SMY F;  2HFI A;  1WOL A;  3MLG A;  2QLA A;  4K7B A;  3U8V A;  4CX9 A;  1IW7 F;  4EBB A;  3EFO A;  3TK0 A;  4EBK A;  1D0Y A;  1FAP B;  2NUT B;  2QUP A;  1M2O A;  3TJ6 A;  2HMQ A;  3GWN A;  2NG1 A;  5DQT A;  1EKY A;  3MYI A;  1G5Z A;  3TOL A;  2J46 A;  3O10 A;  5A6J A;  4C3E A;  4XLN F;  1BR1 A;  5L0G A;  1ORY A;  2OJQ A;  3DZA A;  2PF4 E;  2NPU A;  3IEE A;  4XTK A;  4BJ5 A;  1VTM P;  5JSL A;  3N2Z B;  1TQG A;  3DM5 A;  5JP7 A;  2R7X A;  3EH2 A;  2VB6 A;  4K0D A;  3SZR A;  1YA7 O;  5EGY A;  4XEF A;  3NDB B;  2OEX A;  1SYQ A;  1KTM A;  4G7H F;  1CGO A;  2J9U A;  1Z63 A;  3FAP B;  2HMZ A;  3S9O A;  2Y39 A;  2KJG A;  4AK9 A;  4CS7 A;  4CSA C;  3G4X A;  2Q3T A;  3GAN A;  3O6X A;  1M2V B;  1NG1 A;  3T6J A;  4EWC A;  3NRH A;  4G78 A;  1AEP A;  3EGD A;  2J8W A;  4GQH A;  5L3Q A;  3GM1 A;  4MTO A;  3AJM A;  4QDL A;  3PHF 2;  4BJ6 C;  2B0H A;  2OCC C;  3S0X A;  1A0B A;  1OXK A;  2XSE A;  2ZXO A;  3IQT A;  3C18 A;  3ZC4 A;  1C03 A;  3AG3 C;  3ASN C;  1XWJ A;  5EK0 A;  3ZQY A;  4WGY A;  4CIP A;  3PDM P;  3UGO A;  3MYF A;  3FDQ A;  1QZX A;  2EPM X;  3U3F A;  3L34 A;  2R7U A;  3UR3 C;  5AC5 A;  1E2X A;  1QLE C;  4PAC A;  2ZXR A;  3ZSU A;  1Q0M A;  2HZ8 A;  4JC7 A;  5F5F A;  3DE8 A;  2ICW G;  4U5B E;  2UUI A;  2WZG A;  5KYU A;  3HNJ A;  3US6 A;  5FCL A;  1EA8 A;  1WWP A;  2VAS A;  1UFB A;  2CCY A;  4O6M A;  2LFD A;  3SXY A;  3K1I A;  3SEO A;  2HKV A;  4LDR A;  3AQB A;  3ASO C; 
#chains in the Genus database with same CATH homology
 1MMN A;  2WVQ A;  3NYJ A;  2PFD A;  4J30 B;  5D91 A;  5E3A A;  3T6B A;  2MWQ A;  2J9W A;  4DBR A;  2R7O A;  3I5P A;  4CS9 C;  4PJN A;  3UMH A;  3JT1 A;  3N24 A;  2C03 A;  3EGX A;  2P6V A;  2DYS C;  4RD9 A;  2KNH A;  3LLK A;  2PP4 A;  3RH3 A;  2WZF A;  2G62 A;  1Z63 A;  4YN0 B;  3RFY A;  2V26 A;  5KYX A;  4H4K C;  4YWQ A;  2FGY A;  1W2W A;  4YT5 A;  4KNV A;  1TWH A;  3ABM C;  5IY5 C;  2XXA B;  3DM9 B;  4P6I C;  5E33 A;  2J0W A;  4YT2 A;  3HJC A;  3JCU Q;  5EHH A;  5T1D B;  3LJB A;  1ZHZ A;  4JCH A;  3W2W A;  2H7V C;  3UGP A;  5D92 A;  3K33 A;  1FTS A;  4U5E E;  3S27 A;  1SF8 A;  4O7G A;  1PD0 A;  1J8Y F;  4OIN F;  4O6N A;  3UNG C;  3Q6N A;  2Y3B A;  3QZC A;  1RJ9 B;  4OIO F;  3EH1 A;  3LLI A;  1ZHY A;  4KC9 A;  4IAO A;  2Y3G A;  2E87 A;  2WB7 A;  2FFH A;  1OCC C;  2J9V A;  2J7P A;  2A69 F;  4LLC A;  3SNH A;  1VYI A;  3QMK A;  3B0V C;  4HEA J;  2HV7 A;  2IXN A;  3EFO B;  4BG0 A;  3NDB B;  1Z23 A;  2ZXW C;  3SP1 A;  4N06 A;  3X2Q C;  3N0T A;  1Z5Z A;  3FHD A;  2R7V A;  2NUP A;  3M1C B;  2WVN A;  4U5G A;  3LS0 A;  1VYK A;  2XRH A;  1MND A;  5B1A C;  1V55 C;  4JW1 A;  3W8I A;  3ECS A;  1TWG A;  2BE5 F;  1LVK A;  3B9Q A;  3B0U X;  5F5H A;  3UMI A;  3EG9 A;  4BJT A;  4KI2 A;  3EGD B;  1WGW A;  1PD1 A;  3LES A;  3OA1 A;  5T3T A;  3LAY A;  4HE8 D;  3LEV A;  4ZLC A;  4LLE A;  2CNW A;  2I8B A;  4KBL A;  2IYL D;  3PMR A;  4BEJ A;  3X1O A;  1BR2 A;  1VK5 A;  5DVW A;  3V7O A;  1ZHT A;  2A6E F;  3POV A;  2X51 A;  1S7Z A;  3VYW A;  5KYU B;  4XWJ A;  4DVZ A;  3RIP A;  2Y3D A;  3Q6M A;  2R7R A;  2QY9 A;  2P7V A;  4B6I A;  4CS8 A;  1TR2 A;  1LKX A;  3ABL C;  3DJU B;  1TWC A;  4JUR I;  4U5H A;  3HTK C;  3CSK A;  3EQL F;  2GFH A;  3EGX B;  3WOD F;  4I44 A;  3JSZ A;  3JYH A;  2A6H F;  5CI8 A;  4C7O A;  5KYX B;  4HFK B;  1N1C A;  1MMA A;  4Q7C A;  3DXJ F;  1D1C A;  3UMK A;  1OCO C;  5DS5 A;  1SZI A;  4Q4Z F;  4AE4 A;  4DVY P;  2Z15 A;  3FVY A;  2CGE A;  1ST6 A;  3AG2 C;  4JJG A;  1JPJ A;  2J7P D;  4PK4 A;  4AX2 A;  4YT8 A;  5T3W A;  1D0Z A;  4XLP F;  1O5H A;  2KGO A;  3TD7 A;  2EIK C;  3B0P A;  3NYM A;  4BJ5 C;  3E70 C;  4MND A;  4OD5 A;  3K1H A;  4G7Z F;  4U5F E;  2JD3 A;  2ZPA A;  1ZHX A;  2J45 A;  2G3K A;  4I1M A;  2XL4 A;  4ANJ A;  2KQ9 A;  5KYW B;  5DQZ A;  4G7O F;  4O79 A;  1OKK A;  2WL8 A;  2WZL A;  2EIM C;  2G3V A;  2IOQ A;  1J8M F;  3Q7G A;  4ULW A;  2ZXP A;  3K66 A;  4I1O B;  1M56 C;  5E3C A;  4CSA A;  2Q9A A;  3ZVR A;  2CNW D;  4NY3 A;  3EJN A;  2NUP B;  2C04 A;  4QI2 A;  4IWB A;  1FFH A;  1VOM A;  2EIN C;  3ZIB A;  4BJ6 A;  3JRT A;  4LAC B;  2MYS A;  2VH3 A;  1ZU4 A;  1FMV A;  3EG9 B;  1NU7 D;  3K1I C;  3I5Q A;  4CBE A;  3ITF A;  2IXM A;  3EZH A;  3O39 A;  3VAY A;  2Y3H A;  2Q9B A;  1BR4 A;  2J0X A;  3AG1 C;  1ZU5 A;  3E9V A;  2OG2 A;  1O87 A;  1MMD A;  3ZG1 A;  5E2Q A;  1D1A A;  4CIH A;  3EHM A;  4CS9 A;  2W45 A;  1Z6A A;  2W4M A;  4YJW A;  4FX5 A;  2YHS A;  1G8X A;  3KL4 A;  4M63 A;  4PFP A;  4U5C E;  3S29 A;  4C3D A;  4IJJ A;  1PCX A;  1NU9 C;  4PJM A;  3RYL A;  1NZE A;  1OCZ C;  4A2N B;  3F46 A;  2EIL C;  1D1B A;  3AQC A;  2HV6 A;  1JPN A;  5KYY A;  3K6B A;  4GEH A;  4G0H A;  2YEV A;  4OD4 A;  1ZHW A;  3DAG A;  5B3S C;  4C7O B;  5DS6 A;  4FES A;  4JVS A;  4OIR F;  3KKB A;  2V3C C;  3ABK C;  2L9J A;  3DJN B;  2LSE A;  4U5D E;  2NUT A;  4AE4 B;  1MMG A;  2D5R B;  3RKO F;  1FMW A;  2WVO A;  3LNR A;  3S28 A;  2B0J A;  3FAJ A;  1TKN A;  4J32 B;  1OKK D;  1ZYR F;  3I4U A;  4BJ1 A;  3CQZ A;  3L0I A;  2R7S A;  1M57 C;  2IXP A;  1M2V A;  4JZA A;  3Q7L A;  2Q9C A;  2W4B A;  4PFO A;  4E7S A;  2W9Y A;  3SYN A;  3DAF A;  3HLZ A;  3NG1 A;  4GYT A;  4OIQ F;  4IRU A;  3K7D A;  3GOD A;  4PJJ A;  1OCR C;  4E7Z A;  3OEO A;  1LS1 A;  2EIJ C;  4W8K A;  2R7Q A;  4OIP F;  4WJ0 A;  4QI0 A;  2R7T A;  4FWV A;  2DYR C;  4JJF A;  1FFT C;  1TWA A;  1Z3I X;  2CDQ A;  3NYL A;  4MQ9 F;  5L3V A;  3NKE A;  5KYN A;  3T4R A;  2L81 A;  3NKD A;  5HSW A;  3AG4 C;  2DGJ A;  1KU2 A;  3OWT A;  4RDA A;  4DBQ A;  3WG7 C;  2R7W A;  1IZM A;  2IXO A;  3KMI A;  2H7B A;  2A1D D;  4RBN A;  5DS4 A;  5CI9 A;  4YT4 A;  3W2V A;  2A68 F;  4ZLD A;  3EPV A;  3LS1 A;  3EHN A;  1MNE A;  2Y69 C;  2O9X A;  3W8H A;  4CS8 C;  2YZS A;  5BUO A;  4Q5S F;  2CW0 F;  3F47 A;  5B1B C;  2XXA A;  4C3B A;  4KNW A;  4DOZ A;  2M4E A;  4X0R A;  3H65 A;  2QTV A;  3DMD A;  3KH2 A;  5KYW A;  4I3M A;  2H7O A;  4F4B A;  2PX0 A;  4PJL A;  2KW3 C;  1RJ9 A;  4O6Y A;  3CZ6 A;  1D0X A;  3DD7 A;  2PX3 A;  5KYY B;  4LER A;  3MX3 A;  1VMA A;  3EZI A;  4HFF B;  5DLJ A;  1V54 C;  1SMY F;  3MLG A;  4K7B A;  1IW7 F;  4EBB A;  3EFO A;  1D0Y A;  2NUT B;  1M2O A;  2NG1 A;  5DQT A;  2J46 A;  4C3E A;  4XLN F;  1BR1 A;  3DZA A;  2PF4 E;  3IEE A;  4XTK A;  4BJ5 A;  3N2Z B;  2R7X A;  3DM5 A;  3EH2 A;  2VB6 A;  4K0D A;  3SZR A;  5EGY A;  4G7H F;  2J9U A;  2Y39 A;  2KJG A;  4AK9 A;  4CS7 A;  4CSA C;  2Q3T A;  3GAN A;  3O6X A;  1M2V B;  1NG1 A;  3T6J A;  4EWC A;  3NRH A;  3EGD A;  5L3Q A;  4QDL A;  3PHF 2;  4BJ6 C;  2OCC C;  3S0X A;  2XSE A;  2ZXO A;  3ZC4 A;  3AG3 C;  3ASN C;  3UGO A;  3FDQ A;  1QZX A;  2R7U A;  3L34 A;  3UR3 C;  1QLE C;  2ZXR A;  3ZSU A;  5F5F A;  4U5B E;  2WZG A;  5KYU A;  5FCL A;  2VAS A;  4O6M A;  3SEO A;  3AQB A;  3ASO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...