3JRTA

Structure from the mobile metagenome of v. paracholerae: integron cassette protein vpc_cass2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
170
structure length
166
Chain Sequence
GVKMSDKWIEIEEILSGLIGDLTIAVTVLKDYEGKAFLREPQHQTKRQCIWRLCVYSIVINCRKYVELNQKYGKEIPGHNHIRGVYNNEINKNTAIKKLRNHCVAHVSDKSKYLKPAEVQEEIIKMFDGNFADEFLDWICPDNISTTDKSESLVGVIELLRDAVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integron cassette protein Vpc_cass2
publication title Integron gene cassettes: a repository of novel protein folds with distinct interaction sites.
pubmed doi rcsb
source organism Vibrio paracholerae
molecule tags Structural genomics, unknown function
total genus 57
structure length 166
sequence length 170
ec nomenclature
pdb deposition date 2009-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1060 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3jrtA00
3JRTA
chains in the Genus database with same CATH superfamily
3LS1A 4YJWA 2OEXA 4BJ1A 4DOZA 4YK5A 2ICWG 4OD5A 1ORYA 3EG9B 3LAYA 3LESA 5L0DA 4CS9C 3TD7A 3MX3A 3LJBA 5T3WA 5L0GA 1VYKA 3C18A 1OCRC 2YZSA 3LUTB 4JJGA 3GEEA 4LLCA 4ER9A 5B3IA 3QVYA 4W8PA 1EKYA 1ST6A 5EHHA 4QI2A 2NSGA 5KYWA 5DQZA 4XPYA 3ABLC 1HW1A 2XL6A 5CI8A 3K33A 2NUTB 4BJ5C 5COFA 3H2VA 2CNWA 1RXQA 3JYYA 3US6A 1E2XA 1OCCC 2Y3DA 3V5XA 4KBLA 4BG0A 4WGZA 5KYUB 1Z5ZA 1OXBA 1V4AA 4N6CA 3EGXA 3GODA 4OINF 3U3FA 1H7IA 4XEVA 2EIKC 2YKZA 3ECSA 1TWCA 2YLDA 3U8VA 3HKKA 2OQMA 3W8HA 4BJ6C 2EIMC 2GDCA 4XTKA 2IXMA 4P9FA 1AEPA 2VH3A 3WHNA 4AK9A 2V3CC 1RMVA 1OKKD 3ZQYA 5KYNA 5JSLA 1Q0GA 1GGQA 4KNVA 1TWGA 1F1MA 1FMWA 1MNDA 4YT2A 4CBEA 1A41A 1YAUO 2HSQA 1VK5A 2H7OA 1YA9A 3X1OA 1TFOB 2ZXPA 5CIVA 1CGOA 4MVUA 2QLAA 2KW3C 4J7TA 3HNJA 1ZHYA 4KNWA 3PCVA 4C7OB 4U5EE 3AOUA 4J7YA 1KU2A 3I4UA 1NFOA 4X0RA 3ZQVA 4KI2A 1LE4A 4K1OA 2KYHA 2G3VA 4CS9A 3U8PA 4AE4B 2IYLD 2NUTA 4CDAA 2Z15A 3EFOB 2DB4A 4ONSA 5F5HA 1T6QA 1LI5A 1YVIA 2EPOA 4P6IC 1YZAA 5KYUA 1Z23A 2YRFA 4CJGA 4JKVA 1A0BA 2EPKX 3L8IA 2DYRC 2BC5A 2VC9A 4J32B 4XWJA 3E9VA 5B1BC 3ZVRA 4OIPF 3B0PA 4BJ5A 3EPVA 2M64A 3NMKA 2ZPAA 4U5FE 3RQGA 5AC5A 3K1IA 1LVKA 3RYLA 3FVYA 4JTAB 2W4BA 1RCPA 3LLKA 3TOLA 2XM4A 3SEOA 2D4UA 2KQ9A 3LS0A 5A6KA 4EWCA 1LKXA 4IB4A 3M1CB 1SR2A 1IW7F 1E84A 3RIPA 2R02A 4LACB 5HSWA 2HSBA 2J45A 3V5YA 4C7OA 4LERA 2QUPA 2KJGA 4GYTA 2CCYA 1S05A 3ATPA 4JC7A 4YL1A 3WG7C 3C63A 3ZIBA 4BPMA 5A6BA 2L7AA 2WB7A 4IGGA 2AWCA 4AE4A 3RQFA 3GANA 4ULVA 3EFOA 2L9JA 1U89A 4EBBA 5CI9A 3OEOA 1T9KA 2A1DD 2WVOA 2OEVA 3KYJA 3IQ5A 4Z9HA 3AGUA 3TOMA 1GQAA 3LNRA 1HE9A 3OWTA 4YWQA 4E0IA 1H9TA 2LSEA 1EA8A 1KTMA 3KPHA 4IARA 4F4BA 5L0IA 3ZWIA 4E0HA 4U5CE 1RJ9A 5E3AA 2A0UA 2KSFA 3VAYA 1Y6DA 1D1AA 2HS5A 2XRHA 5DVWA 5A6AA 2Q3TA 4MTGA 1ZHWA 2OOCA 4PFPA 2R7UA 1HE1A 2ASRA 1UFBA 2P7VA 3GM1A 4Z9IA 5BQGA 2DI3A 5COGA 4RBNA 1WASA 1K04A 3TJ6A 2LCHA 1HMDA 1QZXA 2YWAA 4OD4A 4D4XA 3ZDLA 4CIPA 3S90A 5AGFA 4DRIB 2PF4E 1V74B 2RD9A 2WZLA 2R25A 5JP7A 2MWQA 4JTCB 2A68F 4AL1A 1PD1A 3VYWA 2Y3HA 2IXNA 1M2OA 1OQCA 1TR2A 3VF0A 2CNWD 3JRMO 4D4NA 3QTHA 1BDJB 1CPQA 1M2VB 2R7XA 1I4YA 3SP1A 2H7BA 4I44A 2NPUA 1HMOA 2R7OA 1C02A 3S9OA 3K1HA 4O79A 3JSEO 5AC4A 1A7VA 2PBEA 3EGXB 4XEFA 1Z6AA 4O6MA 1U0BB 1ZW2A 3KYIA 4GEHA 1MMAA 2OKUA 5E3CA 4I1OB 2A6HF 3KH2A 3CSKA 2I15A 2X51A 1LI7A 4YT8A 5D92A 2VB6A 3G50A 4IAQA 2Q7RA 2IXOA 3QZCA 2WL8A 4EBJA 1WTYA 1K05A 3AJMA 1MMNA 1YJGA 1R5ID 1M57C 3O10A 4DJ9A 2G3KA 1TQGA 2Y39A 4IJJA 3NYMA 3UR3C 3QMKA 4DBRA 2TMVP 1D0ZA 2EPLX 4PFOA 3TULA 4JTDB 3DKAA 4NTAA 3C7JA 1FFHA 1G4US 1FNTc 3POVA 4MVOA 5L0HA 5L3QA 2W45A 2YQYA 1VYIA 3U2LA 1BR2A 3VRCA 2QE9A 3G4XA 4U5DE 5TJ5E 3N24A 3RF3A 3EQLF 3ITFA 4MVZA 5L3VA 4K7BA 1M56C 1XZQA 4JE9A 2Y3BA 3DWWA 1CGNA 1HY5A 1M2VA 4IAOA 4CX9A 3CEXA 1JRAA 1WGWA 2H8AA 3DZAA 5T3TA 3QW0A 5DS6A 1JOGA 1H6GA 3K6BA 3N0TA 2OCCC 3HTKC 5BUOA 2LFFA 1NZEA 1VMAA 2WZGA 1Z7Qc 1WN0A 1ZHTA 2Y69C 4HFKB 4MVRA 4FX5A 2P6VA 1V55C 2B0JA 2XLOA 3JZ0A 3C62A 1D0XA 5A6JA 2XL4A 3RFYA 3SXZA 3MLGA 1WATA 5COMA 2WVQA 2PX3A 2DGJA 4Z9JA 1T5OA 1Q0FA 3IEEA 4K0DA 3UGPA 1OR2A 3K7DA 1D0YA 2JPUA 3EGDB 5JLIA 2J46A 3GM2A 4BJTA 1NSGB 4XLPF 2XLVA 4ULWA 4EUKB 2ZXRA 5F28E 4B6IA 5A6BD 2HKVA 4EHPA 2Q4FA 4J30B 4XPXA 2GFHA 3KMIA 1NU7D 5E33A 3NDBB 4WGYA 3GWNA 1NLXA 3C8ZA 5JT4A 4JJFA 2YL1A 3AG1C 4XLNF 3R2PA 1TKNA 4YT4A 3GEIA 3U2MA 2CW0F 4QI0A 3DJNB 3ZTMA 3FOPA 2R7TA 4YN0B 3DE8A 2HZ8A 3W2VA 4AL0A 3NMJA 2R7WA 3JYHA 3NYJA 3EJNA 5EGYA 1MMDA 1NFNA 1RJ9B 2OJED 1YLMA 2GA0A 3KKBA 3CAXA 3NKDA 4YL3A 2AWYA 3HJCA 4H4KC 4PACA 3T4RA 3T6GB 1VLTA 2EPMX 4XPWA 3NG1A 4BJ6A 5D91A 2HUJA 2L6GA 3T6BA 3O55A 1OW8A 1PV3A 2VCBA 3EGDA 4CJOA 4C3BA 2O9XA 2L81A 2Q9AA 1IZMA 2YLGA 3MYFA 2FFHA 2R05A 1Z3IX 3FHDA 1JR8A 4HEAJ 2IM8A 1JPNA 2XLHA 4BEJA 1T01A 2JD3A 3FMSA 1EI7A 4G78A 3H65A 2J0XA 3CZ6A 3DAGA 2IBFA 3Q6MA 4CS7A 4FAPB 4KC9A 2M4EA 3HLZA 2J7PD 4OIQF 1R4TA 4EBKA 1YDIA 3B9QA 3WAQA 1O3UA 2W4MA 3ASNC 5BQHA 2PFDA 3DD7A 3RW0A 3DXJF 5B1AC 4OIRF 3O39A 4WJ0A 1S7ZA 4DVZA 3UNGC 2H7VC 1L3PA 2YL0A 4OIOF 4PJMA 3IQTA 1G5ZA 2Q00A 4WABA 1DOVA 1YYXA 3W8IA 4DVYP 3B0UX 2XLMA 1Z63A 1RKEA 2P0NA 1T6IA 5DQTA 4U5GA 4JZAA 4EIYA 3M79A 3QVZA 3JRTA 1EQ1A 3AGTA 5DLJA 3GWLA 4NCQA 2R03A 4PJJA 4U5BE 4CIHA 3J06A 2R7RA 4C3EA 2R7SA 1G8XA 2EINC 2MHRA 3JT1A 3S29A 3ZTZA 4G7OF 4CS8C 3Q6NA 1ZW3A 2HJMA 2F22A 2L6FA 5L0CA 3MBGA 4A4AA 2AU5A 3JCUQ 1JMWA 2OG2A 2XLWA 3NRHA 4Q5SF 4IWBA 3UMKA 2J9WA 1AUEA 3SNHA 3VM6A 1YA7O 5FZTA 3I5PA 1OXKA 2LD6A 3EH2A 3X2QC 4CSAC 5JVEA 2FAPB 3ASOC 3M4CA 1CGME 3K66A 2J7PA 1N1CA 2J0WA 2C03A 2VCCA 2AVKA 1BR1A 1I4ZA 2QTVA 2ZD9A 3W2WA 3LEOA 3ZG1A 2LQGA 2P1AA 4MW3A 1ZU5A 4GQHA 1TFKB 2J9BA 2YVKA 2V26A 2X0CA 2ZXWC 2XSEA 2HJ3A 3SXYA 2PP4A 3LEVA 4E7ZA 3Q7GA 4IRUA 1LE2A 4DRHB 3T6JA 4Q4ZF 3LLIA 1JPJA 3TQOA 4ZLDA 1O87A 3A9CA 5K0IA 1SZIA 4M63A 3IQ6A 3L8JA 2EPNA 4G7ZF 4CDYA 2PX0A 1ZU4A 3ABMC 1APCA 2RSEB 2R7QA 2A0BA 3C8GD 1LIHA 1C17M 1UG7A 4O6NA 3EZHA 1VLSA 1ZHXA 3C8GB 1LM3B 3HNLA 4CDVA 4LDQA 5GPGB 5DS4A 2R9RB 2WVNA 2KK1A 2NG1A 2OU6A 2ETSA 3KL4A 4U9EA 2HMQA 4FESA 1NG1A 3TJ5A 3FDQA 2D5RB 2OJQA 2LFDA 3S0XA 4G0HA 2IXPA 4JCHA 5E2QA 2BE5F 2Q9CA 4NQFA 5F5FA 2QNLA 4R32A 1PCXA 1OCOC 4NTBA 3E70C 4CSAA 1T6UA 1ZYRF 2YL3A 2XXAA 3L0IA 4JURI 5KYYA 4JCZA 2Q9BA 3RH3A 4DXWA 5FCLA 4DBQA 4P9TA 4I3MA 256BA 3RKOF 1V54C 1SYQA 1VTMP 4LDRA 4PJNA 1QPUA 1SF8A 4L6RA 2Y3GA 3M15A 3O6XA 4JRZA 2FGYA 3JSZA 1Q0DA 3DE9A 2XL8A 3GORA 1QVXA 3R7CA 3T9OA 4G7HF 5A69A 1A7DA 4RDAA 3V5ZA 3ZC4A 2AP3A 3UMIA 4A2NB 5KYXB 3SXMA 2A69F 2J8WA 3K1IC 3UMHA 2J9UA 1E86A 3DAFA 1H9GA 3C8GA 2E87A 3IQCA 4N4WA 1AVOB 3N2ZB 2NUPA 3MYIA 3S28A 3FAPB 4LDKA 4RD9A 4ZLCA 3BRJA 3BEHA 2HFIA 4NY3A 1LS4A 4I1MA 1E83A 3G4ZA 4UDVA 1LPEA 1OR3A 4MVSA 2C04A 4N06A 3SXKA 2QY9A 4Q7CA 3UGOA 3NYLA 3EG9A 1FAPB 3U0CA 2CDQA 4FWVA 1D1CA 2GAQA 1RKEB 3EHNA 3ABKC 1A7EA 4JEBA 1OW6A 4YL0A 5T1DB 2I8BA 4JIOA 1LS1A 3EHMA 3B29A 1ZHZA 1D1BA 1QQ3A 5JRAA 2CYDA 2GWWA 2BL2A 1WOLA 4MTFA 2KNHA 3NKEA 1NBBA 2XS1A 1FTSA 3SYNA 1MQVA 4MTOA 4E7SA 1BBHA 2J9VA 2B0HA 3MFNA 2LP4A 1G4WR 1FFTC 1BZ4A 1QSPA 3ZSUA 3DM5A 4ANJA 3U3BA 4HFFB 1I5NA 1QKRA 5KYXA 2IOQA 2L6HA 2XS8A 2KC3A 2ZXOA 2LK4A 1DOWA 1YZCA 2EIJC 2VCAA 4AX2A 2VASA 2WZFA 4NC3A 1Y4CA 1MMGA 3F47A 2W9YA 1PD0A 4XQ1A 4MNDA 1FMVA 2KGOA 4H54A 1J8YF 1OKKA 4U5HA 4PR9A 1B68A 1U6HA 1BR4A 1E85A 3PHF2 1J8MF 1VB5A 4DRJB 5JS5A 3S27A 2JX0A 4JVSA 3V7OA 3W4YA 1TWAA 1MNEA 4XEKA 1M6TA 1ZZPA 3HNKA 5EK0A 3IHUA 3RVYA 1OCZC 4U9DA 2NSFA 3RQEA 2A6EF 4JW1A 5HV9A 1CPRA 2HV6A 3L1MA 3AG3C 4C3DA 4QDLA 2DYSC 2G62A 1JAFA 3AQCA 3DMDA 1HW2A 1ORSC 1ZVZA 3S84A 1GM5A 1RKCA 2XM0A 2PNOA 4NTFA 4E17A 1VOMA 3EZIA 2CGEA 2EILC 4HE8D 3U9MA 3F46A 4E18A 1NU9C 3IPMO 4PJLA 1O5HA 1Q0KA 1QLEC 3AG4C 4MQ9F 5L0JA 4W8KA 3DM9B 3I5QA 4MW8A 1XWJA 1XZPA 2YEVA 3DI5A 4MS2A 3GM3A 3A11A 1K40A 3U5SA 3CQZA 1YARO 3PMRA 3B71A 2UUHA 3QW1A 2UUIA 1L7CA 4O7GA 4MVQA 3NMIA 4JEAA 2XXAB 5KYYB 3LNMB 3JTLO 1ORJA 1WWPA 4LLEA 3HNIA 3RVZA 3L34A 3U9JA 1SMYF 4PK4A 2R7VA 5B3SC 5KYWB 1FR0A 4MVMA 1YYJA 3DJUB 3M4BA 1TWHA 3OA1A 1Q0MA 2YL7A 1OW7A 3SZRA 4BEMJ 1C03A 4EKWA 3AQBA 3FXHA 5JUAA 2MYSA 3Q7LA 3FAJA 3WODF 5IY5C 3H2UA 2P61A 4N6HA 2HMZA 3GEHA 3EH1A 1KNYA 2LIGA 2NUPB 1W2WA 2XLDA 2HV7A 3FOOA 3PDMP 2YHSA 5DS5A 5L0FA 5BQIA 4CS8A 3TK0A 4O6YA 4YT5A 2XLEA 3B0VC 1GS9A 3AG2C 2YLIA
chains in the Genus database with same CATH topology
3LS1A 4YJWA 4BJ1A 4DOZA 4OD5A 3EG9B 3LAYA 3LESA 4CS9C 3TD7A 3MX3A 3LJBA 5T3WA 1VYKA 4JJGA 1OCRC 2YZSA 4LLCA 1ST6A 5EHHA 4QI2A 5KYWA 5DQZA 3ABLC 5CI8A 3K33A 2NUTB 4BJ5C 2CNWA 1OCCC 2Y3DA 5KYUB 4KBLA 4BG0A 1Z5ZA 4OINF 3EGXA 3GODA 2EIKC 3W8HA 3ECSA 1TWCA 4BJ6C 2EIMC 4XTKA 2IXMA 2VH3A 4AK9A 2V3CC 1OKKD 5KYNA 4KNVA 1TWGA 1FMWA 1MNDA 4YT2A 4CBEA 1VK5A 2H7OA 3X1OA 2ZXPA 2KW3C 1ZHYA 4KNWA 4C7OB 4U5EE 1KU2A 3I4UA 4X0RA 4KI2A 2G3VA 4CS9A 4AE4B 2IYLD 2NUTA 2Z15A 3EFOB 5F5HA 5KYUA 4P6IC 1Z23A 3ZVRA 2DYRC 4J32B 5B1BC 4XWJA 3E9VA 4OIPF 3B0PA 4BJ5A 3EPVA 2ZPAA 4U5FE 1LVKA 3RYLA 3FVYA 2W4BA 3LLKA 3SEOA 2KQ9A 3LS0A 4EWCA 1LKXA 3M1CB 1IW7F 3RIPA 4LACB 5HSWA 4C7OA 2J45A 4LERA 2KJGA 4GYTA 3ZIBA 3WG7C 2WB7A 4AE4A 3GANA 3EFOA 2L9JA 4EBBA 5CI9A 3OEOA 2A1DD 2WVOA 3LNRA 3OWTA 4YWQA 2LSEA 4F4BA 4U5CE 1RJ9A 5E3AA 3VAYA 5DVWA 1D1AA 2XRHA 2Q3TA 1ZHWA 4PFPA 2R7UA 2P7VA 4RBNA 1QZXA 4OD4A 2PF4E 2WZLA 2MWQA 2A68F 1PD1A 3VYWA 2Y3HA 2IXNA 1M2OA 1TR2A 2CNWD 1M2VB 2R7XA 3SP1A 2H7BA 4I44A 2R7OA 3K1HA 4O79A 3EGXB 1Z6AA 4O6MA 4GEHA 1MMAA 5E3CA 4I1OB 2A6HF 3KH2A 3CSKA 2X51A 4YT8A 5D92A 2VB6A 2IXOA 3QZCA 2WL8A 1MMNA 1M57C 4DBRA 2G3KA 4IJJA 2Y39A 3UR3C 3NYMA 3QMKA 1D0ZA 4PFOA 1FFHA 3POVA 5L3QA 2W45A 1VYIA 1BR2A 4U5DE 3N24A 3EQLF 3ITFA 5L3VA 4K7BA 1M56C 2Y3BA 1M2VA 4IAOA 1WGWA 5T3TA 3DZAA 5DS6A 3K6BA 3N0TA 2OCCC 3HTKC 5BUOA 1NZEA 1VMAA 2WZGA 1ZHTA 2Y69C 4HFKB 4FX5A 2P6VA 1V55C 2B0JA 1D0XA 2XL4A 3RFYA 3MLGA 2WVQA 2PX3A 2DGJA 4K0DA 3IEEA 3UGPA 3K7DA 1D0YA 3EGDB 2J46A 4BJTA 4XLPF 4ULWA 2ZXRA 4B6IA 4J30B 2GFHA 3KMIA 1NU7D 5E33A 3NDBB 4JJFA 3AG1C 4XLNF 4YT4A 1TKNA 2CW0F 4QI0A 3DJNB 2R7TA 4YN0B 3W2VA 2R7WA 3JYHA 3NYJA 3EJNA 5EGYA 1MMDA 1RJ9B 3KKBA 3T4RA 3NKDA 3HJCA 4H4KC 3NG1A 4BJ6A 5D91A 3T6BA 3EGDA 4C3BA 2O9XA 2L81A 2Q9AA 1IZMA 2FFHA 1Z3IX 3FHDA 4HEAJ 1JPNA 4BEJA 2JD3A 3H65A 2J0XA 3CZ6A 3DAGA 3Q6MA 4CS7A 4KC9A 2M4EA 3HLZA 2J7PD 4OIQF 3B9QA 2W4MA 3ASNC 2PFDA 3DD7A 3DXJF 5B1AC 4OIRF 3O39A 4WJ0A 1S7ZA 4DVZA 3UNGC 2H7VC 4OIOF 4PJMA 3W8IA 4DVYP 3B0UX 1Z63A 5DQTA 4U5GA 4JZAA 3JRTA 5DLJA 4PJJA 4U5BE 4CIHA 2R7SA 2R7RA 4C3EA 1G8XA 2EINC 4G7OF 3JT1A 3S29A 4CS8C 3Q6NA 4Q5SF 3JCUQ 3NRHA 2OG2A 4IWBA 3UMKA 2J9WA 3SNHA 3I5PA 4CSAC 3EH2A 3X2QC 3ASOC 3K66A 2J7PA 1N1CA 2J0WA 2C03A 1BR1A 2QTVA 3W2WA 3ZG1A 1ZU5A 2V26A 2ZXWC 2XSEA 2PP4A 3LEVA 4E7ZA 3Q7GA 4IRUA 4Q4ZF 3T6JA 3LLIA 1JPJA 4ZLDA 1O87A 1SZIA 4M63A 4G7ZF 2PX0A 1ZU4A 3ABMC 2R7QA 4O6NA 3EZHA 1ZHXA 5DS4A 2WVNA 2NG1A 3KL4A 4FESA 1NG1A 3FDQA 2D5RB 3S0XA 4G0HA 2IXPA 4JCHA 5E2QA 2BE5F 2Q9CA 5F5FA 1PCXA 1OCOC 3E70C 4CSAA 1ZYRF 2XXAA 3L0IA 4JURI 5KYYA 3RH3A 2Q9BA 5FCLA 4DBQA 4I3MA 3RKOF 1V54C 4PJNA 1SF8A 2Y3GA 3O6XA 2FGYA 3JSZA 4G7HF 4RDAA 3ZC4A 3UMIA 4A2NB 5KYXB 2A69F 3UMHA 3K1IC 2J9UA 3DAFA 2E87A 3N2ZB 2NUPA 3S28A 4RD9A 4ZLCA 4NY3A 4I1MA 2C04A 4N06A 2QY9A 4Q7CA 3UGOA 3NYLA 3EG9A 2CDQA 4FWVA 1D1CA 3EHNA 3ABKC 5T1DB 2I8BA 1LS1A 3EHMA 1ZHZA 1D1BA 2KNHA 3NKEA 3SYNA 1FTSA 4E7SA 2J9VA 1FFTC 3ZSUA 3DM5A 4ANJA 4HFFB 5KYXA 2IOQA 2ZXOA 2EIJC 4AX2A 2VASA 2WZFA 1MMGA 3F47A 2W9YA 1PD0A 4MNDA 1FMVA 2KGOA 1J8YF 1OKKA 4U5HA 1BR4A 3PHF2 1J8MF 3S27A 3V7OA 4JVSA 1TWAA 1MNEA 1OCZC 2A6EF 4JW1A 2HV6A 3AG3C 4C3DA 4QDLA 2DYSC 2G62A 3AQCA 3DMDA 1VOMA 3EZIA 2CGEA 2EILC 4HE8D 3F46A 1NU9C 4PJLA 1O5HA 1QLEC 3AG4C 4MQ9F 4W8KA 3DM9B 3I5QA 2YEVA 3CQZA 3PMRA 4O7GA 2XXAB 5KYYB 4LLEA 3L34A 2R7VA 1SMYF 4PK4A 5B3SC 5KYWB 3DJUB 1TWHA 3OA1A 3SZRA 3AQBA 2MYSA 3Q7LA 3FAJA 3WODF 5IY5C 3EH1A 2NUPB 1W2WA 2HV7A 2YHSA 5DS5A 4CS8A 4O6YA 4YT5A 3B0VC 3AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRT A; 
#chains in the Genus database with same CATH topology
 3LS1 A;  4YJW A;  2OEX A;  4BJ1 A;  4DOZ A;  4YK5 A;  2ICW G;  4OD5 A;  1ORY A;  3EG9 B;  3LAY A;  3LES A;  5L0D A;  4CS9 C;  3TD7 A;  3MX3 A;  3LJB A;  5T3W A;  5L0G A;  1VYK A;  3C18 A;  1OCR C;  2YZS A;  3LUT B;  4JJG A;  3GEE A;  4LLC A;  4ER9 A;  5B3I A;  3QVY A;  4W8P A;  1EKY A;  1ST6 A;  5EHH A;  4QI2 A;  2NSG A;  5KYW A;  5DQZ A;  4XPY A;  3ABL C;  1HW1 A;  2XL6 A;  5CI8 A;  3K33 A;  2NUT B;  4BJ5 C;  5COF A;  3H2V A;  2CNW A;  1RXQ A;  3JYY A;  3US6 A;  1E2X A;  1OCC C;  2Y3D A;  3V5X A;  4KBL A;  4BG0 A;  4WGZ A;  5KYU B;  1Z5Z A;  1OXB A;  1V4A A;  4N6C A;  3EGX A;  3GOD A;  4OIN F;  3U3F A;  1H7I A;  4XEV A;  2EIK C;  2YKZ A;  3ECS A;  1TWC A;  2YLD A;  3U8V A;  3HKK A;  2OQM A;  3W8H A;  4BJ6 C;  2EIM C;  2GDC A;  4XTK A;  2IXM A;  4P9F A;  1AEP A;  2VH3 A;  3WHN A;  4AK9 A;  2V3C C;  1RMV A;  1OKK D;  3ZQY A;  5KYN A;  5JSL A;  1Q0G A;  1GGQ A;  4KNV A;  1TWG A;  1F1M A;  1FMW A;  1MND A;  4YT2 A;  4CBE A;  1A41 A;  1YAU O;  2HSQ A;  1VK5 A;  2H7O A;  1YA9 A;  3X1O A;  1TFO B;  2ZXP A;  5CIV A;  1CGO A;  4MVU A;  2QLA A;  2KW3 C;  4J7T A;  3HNJ A;  1ZHY A;  4KNW A;  3PCV A;  4C7O B;  4U5E E;  3AOU A;  4J7Y A;  1KU2 A;  3I4U A;  1NFO A;  4X0R A;  3ZQV A;  4KI2 A;  1LE4 A;  4K1O A;  2KYH A;  2G3V A;  4CS9 A;  3U8P A;  4AE4 B;  2IYL D;  2NUT A;  4CDA A;  2Z15 A;  3EFO B;  2DB4 A;  4ONS A;  5F5H A;  1T6Q A;  1LI5 A;  1YVI A;  2EPO A;  4P6I C;  1YZA A;  5KYU A;  1Z23 A;  2YRF A;  4CJG A;  4JKV A;  1A0B A;  2EPK X;  3L8I A;  2DYR C;  2BC5 A;  2VC9 A;  4J32 B;  4XWJ A;  3E9V A;  5B1B C;  3ZVR A;  4OIP F;  3B0P A;  4BJ5 A;  3EPV A;  2M64 A;  3NMK A;  2ZPA A;  4U5F E;  3RQG A;  5AC5 A;  3K1I A;  1LVK A;  3RYL A;  3FVY A;  4JTA B;  2W4B A;  1RCP A;  3LLK A;  3TOL A;  2XM4 A;  3SEO A;  2D4U A;  2KQ9 A;  3LS0 A;  5A6K A;  4EWC A;  1LKX A;  4IB4 A;  3M1C B;  1SR2 A;  1IW7 F;  1E84 A;  3RIP A;  2R02 A;  4LAC B;  5HSW A;  2HSB A;  2J45 A;  3V5Y A;  4C7O A;  4LER A;  2QUP A;  2KJG A;  4GYT A;  2CCY A;  1S05 A;  3ATP A;  4JC7 A;  4YL1 A;  3WG7 C;  3C63 A;  3ZIB A;  4BPM A;  5A6B A;  2L7A A;  2WB7 A;  4IGG A;  2AWC A;  4AE4 A;  3RQF A;  3GAN A;  4ULV A;  3EFO A;  2L9J A;  1U89 A;  4EBB A;  5CI9 A;  3OEO A;  1T9K A;  2A1D D;  2WVO A;  2OEV A;  3KYJ A;  3IQ5 A;  4Z9H A;  3AGU A;  3TOM A;  1GQA A;  3LNR A;  1HE9 A;  3OWT A;  4YWQ A;  4E0I A;  1H9T A;  2LSE A;  1EA8 A;  1KTM A;  3KPH A;  4IAR A;  4F4B A;  5L0I A;  3ZWI A;  4E0H A;  4U5C E;  1RJ9 A;  5E3A A;  2A0U A;  2KSF A;  3VAY A;  1Y6D A;  1D1A A;  2HS5 A;  2XRH A;  5DVW A;  5A6A A;  2Q3T A;  4MTG A;  1ZHW A;  2OOC A;  4PFP A;  2R7U A;  1HE1 A;  2ASR A;  1UFB A;  2P7V A;  3GM1 A;  4Z9I A;  5BQG A;  2DI3 A;  5COG A;  4RBN A;  1WAS A;  1K04 A;  3TJ6 A;  2LCH A;  1HMD A;  1QZX A;  2YWA A;  4OD4 A;  4D4X A;  3ZDL A;  4CIP A;  3S90 A;  5AGF A;  4DRI B;  2PF4 E;  1V74 B;  2RD9 A;  2WZL A;  2R25 A;  5JP7 A;  2MWQ A;  4JTC B;  2A68 F;  4AL1 A;  1PD1 A;  3VYW A;  2Y3H A;  2IXN A;  1M2O A;  1OQC A;  1TR2 A;  3VF0 A;  2CNW D;  3JRM O;  4D4N A;  3QTH A;  1BDJ B;  1CPQ A;  1M2V B;  2R7X A;  1I4Y A;  3SP1 A;  2H7B A;  4I44 A;  2NPU A;  1HMO A;  2R7O A;  1C02 A;  3S9O A;  3K1H A;  4O79 A;  3JSE O;  5AC4 A;  1A7V A;  2PBE A;  3EGX B;  4XEF A;  1Z6A A;  4O6M A;  1U0B B;  1ZW2 A;  3KYI A;  4GEH A;  1MMA A;  2OKU A;  5E3C A;  4I1O B;  2A6H F;  3KH2 A;  3CSK A;  2I15 A;  2X51 A;  1LI7 A;  4YT8 A;  5D92 A;  2VB6 A;  3G50 A;  4IAQ A;  2Q7R A;  2IXO A;  3QZC A;  2WL8 A;  4EBJ A;  1WTY A;  1K05 A;  3AJM A;  1MMN A;  1YJG A;  1R5I D;  1M57 C;  3O10 A;  4DJ9 A;  2G3K A;  1TQG A;  2Y39 A;  4IJJ A;  3NYM A;  3UR3 C;  3QMK A;  4DBR A;  2TMV P;  1D0Z A;  2EPL X;  4PFO A;  3TUL A;  4JTD B;  3DKA A;  4NTA A;  3C7J A;  1FFH A;  1G4U S;  1FNT c;  3POV A;  4MVO A;  5L0H A;  5L3Q A;  2W45 A;  2YQY A;  1VYI A;  3U2L A;  1BR2 A;  3VRC A;  2QE9 A;  3G4X A;  4U5D E;  5TJ5 E;  3N24 A;  3RF3 A;  3EQL F;  3ITF A;  4MVZ A;  5L3V A;  4K7B A;  1M56 C;  1XZQ A;  4JE9 A;  2Y3B A;  3DWW A;  1CGN A;  1HY5 A;  1M2V A;  4IAO A;  4CX9 A;  3CEX A;  1JRA A;  1WGW A;  2H8A A;  3DZA A;  5T3T A;  3QW0 A;  5DS6 A;  1JOG A;  1H6G A;  3K6B A;  3N0T A;  2OCC C;  3HTK C;  5BUO A;  2LFF A;  1NZE A;  1VMA A;  2WZG A;  1Z7Q c;  1WN0 A;  1ZHT A;  2Y69 C;  4HFK B;  4MVR A;  4FX5 A;  2P6V A;  1V55 C;  2B0J A;  2XLO A;  3JZ0 A;  3C62 A;  1D0X A;  5A6J A;  2XL4 A;  3RFY A;  3SXZ A;  3MLG A;  1WAT A;  5COM A;  2WVQ A;  2PX3 A;  2DGJ A;  4Z9J A;  1T5O A;  1Q0F A;  3IEE A;  4K0D A;  3UGP A;  1OR2 A;  3K7D A;  1D0Y A;  2JPU A;  3EGD B;  5JLI A;  2J46 A;  3GM2 A;  4BJT A;  1NSG B;  4XLP F;  2XLV A;  4ULW A;  4EUK B;  2ZXR A;  5F28 E;  4B6I A;  5A6B D;  2HKV A;  4EHP A;  2Q4F A;  4J30 B;  4XPX A;  2GFH A;  3KMI A;  1NU7 D;  5E33 A;  3NDB B;  4WGY A;  3GWN A;  1NLX A;  3C8Z A;  5JT4 A;  4JJF A;  2YL1 A;  3AG1 C;  4XLN F;  3R2P A;  1TKN A;  4YT4 A;  3GEI A;  3U2M A;  2CW0 F;  4QI0 A;  3DJN B;  3ZTM A;  3FOP A;  2R7T A;  4YN0 B;  3DE8 A;  2HZ8 A;  3W2V A;  4AL0 A;  3NMJ A;  2R7W A;  3JYH A;  3NYJ A;  3EJN A;  5EGY A;  1MMD A;  1NFN A;  1RJ9 B;  2OJE D;  1YLM A;  2GA0 A;  3KKB A;  3CAX A;  3NKD A;  4YL3 A;  2AWY A;  3HJC A;  4H4K C;  4PAC A;  3T4R A;  3T6G B;  1VLT A;  2EPM X;  4XPW A;  3NG1 A;  4BJ6 A;  5D91 A;  2HUJ A;  2L6G A;  3T6B A;  3O55 A;  1OW8 A;  1PV3 A;  2VCB A;  3EGD A;  4CJO A;  4C3B A;  2O9X A;  2L81 A;  2Q9A A;  1IZM A;  2YLG A;  3MYF A;  2FFH A;  2R05 A;  1Z3I X;  3FHD A;  1JR8 A;  4HEA J;  2IM8 A;  1JPN A;  2XLH A;  4BEJ A;  1T01 A;  2JD3 A;  3FMS A;  1EI7 A;  4G78 A;  3H65 A;  2J0X A;  3CZ6 A;  3DAG A;  2IBF A;  3Q6M A;  4CS7 A;  4FAP B;  4KC9 A;  2M4E A;  3HLZ A;  2J7P D;  4OIQ F;  1R4T A;  4EBK A;  1YDI A;  3B9Q A;  3WAQ A;  1O3U A;  2W4M A;  3ASN C;  5BQH A;  2PFD A;  3DD7 A;  3RW0 A;  3DXJ F;  5B1A C;  4OIR F;  3O39 A;  4WJ0 A;  1S7Z A;  4DVZ A;  3UNG C;  2H7V C;  1L3P A;  2YL0 A;  4OIO F;  4PJM A;  3IQT A;  1G5Z A;  2Q00 A;  4WAB A;  1DOV A;  1YYX A;  3W8I A;  4DVY P;  3B0U X;  2XLM A;  1Z63 A;  1RKE A;  2P0N A;  1T6I A;  5DQT A;  4U5G A;  4JZA A;  4EIY A;  3M79 A;  3QVZ A;  3JRT A;  1EQ1 A;  3AGT A;  5DLJ A;  3GWL A;  4NCQ A;  2R03 A;  4PJJ A;  4U5B E;  4CIH A;  3J06 A;  2R7R A;  4C3E A;  2R7S A;  1G8X A;  2EIN C;  2MHR A;  3JT1 A;  3S29 A;  3ZTZ A;  4G7O F;  4CS8 C;  3Q6N A;  1ZW3 A;  2HJM A;  2F22 A;  2L6F A;  5L0C A;  3MBG A;  4A4A A;  2AU5 A;  3JCU Q;  1JMW A;  2OG2 A;  2XLW A;  3NRH A;  4Q5S F;  4IWB A;  3UMK A;  2J9W A;  1AUE A;  3SNH A;  3VM6 A;  1YA7 O;  5FZT A;  3I5P A;  1OXK A;  2LD6 A;  3EH2 A;  3X2Q C;  4CSA C;  5JVE A;  2FAP B;  3ASO C;  3M4C A;  1CGM E;  3K66 A;  2J7P A;  1N1C A;  2J0W A;  2C03 A;  2VCC A;  2AVK A;  1BR1 A;  1I4Z A;  2QTV A;  2ZD9 A;  3W2W A;  3LEO A;  3ZG1 A;  2LQG A;  2P1A A;  4MW3 A;  1ZU5 A;  4GQH A;  1TFK B;  2J9B A;  2YVK A;  2V26 A;  2X0C A;  2ZXW C;  2XSE A;  2HJ3 A;  3SXY A;  2PP4 A;  3LEV A;  4E7Z A;  3Q7G A;  4IRU A;  1LE2 A;  4DRH B;  3T6J A;  4Q4Z F;  3LLI A;  1JPJ A;  3TQO A;  4ZLD A;  1O87 A;  3A9C A;  5K0I A;  1SZI A;  4M63 A;  3IQ6 A;  3L8J A;  2EPN A;  4G7Z F;  4CDY A;  2PX0 A;  1ZU4 A;  3ABM C;  1APC A;  2RSE B;  2R7Q A;  2A0B A;  3C8G D;  1LIH A;  1C17 M;  1UG7 A;  4O6N A;  3EZH A;  1VLS A;  1ZHX A;  3C8G B;  1LM3 B;  3HNL A;  4CDV A;  4LDQ A;  5GPG B;  5DS4 A;  2R9R B;  2WVN A;  2KK1 A;  2NG1 A;  2OU6 A;  2ETS A;  3KL4 A;  4U9E A;  2HMQ A;  4FES A;  1NG1 A;  3TJ5 A;  3FDQ A;  2D5R B;  2OJQ A;  2LFD A;  3S0X A;  4G0H A;  2IXP A;  4JCH A;  5E2Q A;  2BE5 F;  2Q9C A;  4NQF A;  5F5F A;  2QNL A;  4R32 A;  1PCX A;  1OCO C;  4NTB A;  3E70 C;  4CSA A;  1T6U A;  1ZYR F;  2YL3 A;  2XXA A;  3L0I A;  4JUR I;  5KYY A;  4JCZ A;  2Q9B A;  3RH3 A;  4DXW A;  5FCL A;  4DBQ A;  4P9T A;  4I3M A;  256B A;  3RKO F;  1V54 C;  1SYQ A;  1VTM P;  4LDR A;  4PJN A;  1QPU A;  1SF8 A;  4L6R A;  2Y3G A;  3M15 A;  3O6X A;  4JRZ A;  2FGY A;  3JSZ A;  1Q0D A;  3DE9 A;  2XL8 A;  3GOR A;  1QVX A;  3R7C A;  3T9O A;  4G7H F;  5A69 A;  1A7D A;  4RDA A;  3V5Z A;  3ZC4 A;  2AP3 A;  3UMI A;  4A2N B;  5KYX B;  3SXM A;  2A69 F;  2J8W A;  3K1I C;  3UMH A;  2J9U A;  1E86 A;  3DAF A;  1H9G A;  3C8G A;  2E87 A;  3IQC A;  4N4W A;  1AVO B;  3N2Z B;  2NUP A;  3MYI A;  3S28 A;  3FAP B;  4LDK A;  4RD9 A;  4ZLC A;  3BRJ A;  3BEH A;  2HFI A;  4NY3 A;  1LS4 A;  4I1M A;  1E83 A;  3G4Z A;  4UDV A;  1LPE A;  1OR3 A;  4MVS A;  2C04 A;  4N06 A;  3SXK A;  2QY9 A;  4Q7C A;  3UGO A;  3NYL A;  3EG9 A;  1FAP B;  3U0C A;  2CDQ A;  4FWV A;  1D1C A;  2GAQ A;  1RKE B;  3EHN A;  3ABK C;  1A7E A;  4JEB A;  1OW6 A;  4YL0 A;  5T1D B;  2I8B A;  4JIO A;  1LS1 A;  3EHM A;  3B29 A;  1ZHZ A;  1D1B A;  1QQ3 A;  5JRA A;  2CYD A;  2GWW A;  2BL2 A;  1WOL A;  4MTF A;  2KNH A;  3NKE A;  1NBB A;  2XS1 A;  1FTS A;  3SYN A;  1MQV A;  4MTO A;  4E7S A;  1BBH A;  2J9V A;  2B0H A;  3MFN A;  2LP4 A;  1G4W R;  1FFT C;  1BZ4 A;  1QSP A;  3ZSU A;  3DM5 A;  4ANJ A;  3U3B A;  4HFF B;  1I5N A;  1QKR A;  5KYX A;  2IOQ A;  2L6H A;  2XS8 A;  2KC3 A;  2ZXO A;  2LK4 A;  1DOW A;  1YZC A;  2EIJ C;  2VCA A;  4AX2 A;  2VAS A;  2WZF A;  4NC3 A;  1Y4C A;  1MMG A;  3F47 A;  2W9Y A;  1PD0 A;  4XQ1 A;  4MND A;  1FMV A;  2KGO A;  4H54 A;  1J8Y F;  1OKK A;  4U5H A;  4PR9 A;  1B68 A;  1U6H A;  1BR4 A;  1E85 A;  3PHF 2;  1J8M F;  1VB5 A;  4DRJ B;  5JS5 A;  3S27 A;  2JX0 A;  4JVS A;  3V7O A;  3W4Y A;  1TWA A;  1MNE A;  4XEK A;  1M6T A;  1ZZP A;  3HNK A;  5EK0 A;  3IHU A;  3RVY A;  1OCZ C;  4U9D A;  2NSF A;  3RQE A;  2A6E F;  4JW1 A;  5HV9 A;  1CPR A;  2HV6 A;  3L1M A;  3AG3 C;  4C3D A;  4QDL A;  2DYS C;  2G62 A;  1JAF A;  3AQC A;  3DMD A;  1HW2 A;  1ORS C;  1ZVZ A;  3S84 A;  1GM5 A;  1RKC A;  2XM0 A;  2PNO A;  4NTF A;  4E17 A;  1VOM A;  3EZI A;  2CGE A;  2EIL C;  4HE8 D;  3U9M A;  3F46 A;  4E18 A;  1NU9 C;  3IPM O;  4PJL A;  1O5H A;  1Q0K A;  1QLE C;  3AG4 C;  4MQ9 F;  5L0J A;  4W8K A;  3DM9 B;  3I5Q A;  4MW8 A;  1XWJ A;  1XZP A;  2YEV A;  3DI5 A;  4MS2 A;  3GM3 A;  3A11 A;  1K40 A;  3U5S A;  3CQZ A;  1YAR O;  3PMR A;  3B71 A;  2UUH A;  3QW1 A;  2UUI A;  1L7C A;  4O7G A;  4MVQ A;  3NMI A;  4JEA A;  2XXA B;  5KYY B;  3LNM B;  3JTL O;  1ORJ A;  1WWP A;  4LLE A;  3HNI A;  3RVZ A;  3L34 A;  3U9J A;  1SMY F;  4PK4 A;  2R7V A;  5B3S C;  5KYW B;  1FR0 A;  4MVM A;  1YYJ A;  3DJU B;  3M4B A;  1TWH A;  3OA1 A;  1Q0M A;  2YL7 A;  1OW7 A;  3SZR A;  4BEM J;  1C03 A;  4EKW A;  3AQB A;  3FXH A;  5JUA A;  2MYS A;  3Q7L A;  3FAJ A;  3WOD F;  5IY5 C;  3H2U A;  2P61 A;  4N6H A;  2HMZ A;  3GEH A;  3EH1 A;  1KNY A;  2LIG A;  2NUP B;  1W2W A;  2XLD A;  2HV7 A;  3FOO A;  3PDM P;  2YHS A;  5DS5 A;  5L0F A;  5BQI A;  4CS8 A;  3TK0 A;  4O6Y A;  4YT5 A;  2XLE A;  3B0V C;  1GS9 A;  3AG2 C;  2YLI A; 
#chains in the Genus database with same CATH homology
 3LS1 A;  4YJW A;  4BJ1 A;  4DOZ A;  4OD5 A;  3EG9 B;  3LAY A;  3LES A;  4CS9 C;  3TD7 A;  3MX3 A;  3LJB A;  5T3W A;  1VYK A;  4JJG A;  1OCR C;  2YZS A;  4LLC A;  1ST6 A;  5EHH A;  4QI2 A;  5KYW A;  5DQZ A;  3ABL C;  5CI8 A;  3K33 A;  2NUT B;  4BJ5 C;  2CNW A;  1OCC C;  2Y3D A;  5KYU B;  4KBL A;  4BG0 A;  1Z5Z A;  4OIN F;  3EGX A;  3GOD A;  2EIK C;  3W8H A;  3ECS A;  1TWC A;  4BJ6 C;  2EIM C;  4XTK A;  2IXM A;  2VH3 A;  4AK9 A;  2V3C C;  1OKK D;  5KYN A;  4KNV A;  1TWG A;  1FMW A;  1MND A;  4YT2 A;  4CBE A;  1VK5 A;  2H7O A;  3X1O A;  2ZXP A;  2KW3 C;  1ZHY A;  4KNW A;  4C7O B;  4U5E E;  1KU2 A;  3I4U A;  4X0R A;  4KI2 A;  2G3V A;  4CS9 A;  4AE4 B;  2IYL D;  2NUT A;  2Z15 A;  3EFO B;  5F5H A;  5KYU A;  4P6I C;  1Z23 A;  3ZVR A;  2DYR C;  4J32 B;  5B1B C;  4XWJ A;  3E9V A;  4OIP F;  3B0P A;  4BJ5 A;  3EPV A;  2ZPA A;  4U5F E;  1LVK A;  3RYL A;  3FVY A;  2W4B A;  3LLK A;  3SEO A;  2KQ9 A;  3LS0 A;  4EWC A;  1LKX A;  3M1C B;  1IW7 F;  3RIP A;  4LAC B;  5HSW A;  4C7O A;  2J45 A;  4LER A;  2KJG A;  4GYT A;  3ZIB A;  3WG7 C;  2WB7 A;  4AE4 A;  3GAN A;  3EFO A;  2L9J A;  4EBB A;  5CI9 A;  3OEO A;  2A1D D;  2WVO A;  3LNR A;  3OWT A;  4YWQ A;  2LSE A;  4F4B A;  4U5C E;  1RJ9 A;  5E3A A;  3VAY A;  5DVW A;  1D1A A;  2XRH A;  2Q3T A;  1ZHW A;  4PFP A;  2R7U A;  2P7V A;  4RBN A;  1QZX A;  4OD4 A;  2PF4 E;  2WZL A;  2MWQ A;  2A68 F;  1PD1 A;  3VYW A;  2Y3H A;  2IXN A;  1M2O A;  1TR2 A;  2CNW D;  1M2V B;  2R7X A;  3SP1 A;  2H7B A;  4I44 A;  2R7O A;  3K1H A;  4O79 A;  3EGX B;  1Z6A A;  4O6M A;  4GEH A;  1MMA A;  5E3C A;  4I1O B;  2A6H F;  3KH2 A;  3CSK A;  2X51 A;  4YT8 A;  5D92 A;  2VB6 A;  2IXO A;  3QZC A;  2WL8 A;  1MMN A;  1M57 C;  4DBR A;  2G3K A;  4IJJ A;  2Y39 A;  3UR3 C;  3NYM A;  3QMK A;  1D0Z A;  4PFO A;  1FFH A;  3POV A;  5L3Q A;  2W45 A;  1VYI A;  1BR2 A;  4U5D E;  3N24 A;  3EQL F;  3ITF A;  5L3V A;  4K7B A;  1M56 C;  2Y3B A;  1M2V A;  4IAO A;  1WGW A;  5T3T A;  3DZA A;  5DS6 A;  3K6B A;  3N0T A;  2OCC C;  3HTK C;  5BUO A;  1NZE A;  1VMA A;  2WZG A;  1ZHT A;  2Y69 C;  4HFK B;  4FX5 A;  2P6V A;  1V55 C;  2B0J A;  1D0X A;  2XL4 A;  3RFY A;  3MLG A;  2WVQ A;  2PX3 A;  2DGJ A;  4K0D A;  3IEE A;  3UGP A;  3K7D A;  1D0Y A;  3EGD B;  2J46 A;  4BJT A;  4XLP F;  4ULW A;  2ZXR A;  4B6I A;  4J30 B;  2GFH A;  3KMI A;  1NU7 D;  5E33 A;  3NDB B;  4JJF A;  3AG1 C;  4XLN F;  4YT4 A;  1TKN A;  2CW0 F;  4QI0 A;  3DJN B;  2R7T A;  4YN0 B;  3W2V A;  2R7W A;  3JYH A;  3NYJ A;  3EJN A;  5EGY A;  1MMD A;  1RJ9 B;  3KKB A;  3T4R A;  3NKD A;  3HJC A;  4H4K C;  3NG1 A;  4BJ6 A;  5D91 A;  3T6B A;  3EGD A;  4C3B A;  2O9X A;  2L81 A;  2Q9A A;  1IZM A;  2FFH A;  1Z3I X;  3FHD A;  4HEA J;  1JPN A;  4BEJ A;  2JD3 A;  3H65 A;  2J0X A;  3CZ6 A;  3DAG A;  3Q6M A;  4CS7 A;  4KC9 A;  2M4E A;  3HLZ A;  2J7P D;  4OIQ F;  3B9Q A;  2W4M A;  3ASN C;  2PFD A;  3DD7 A;  3DXJ F;  5B1A C;  4OIR F;  3O39 A;  4WJ0 A;  1S7Z A;  4DVZ A;  3UNG C;  2H7V C;  4OIO F;  4PJM A;  3W8I A;  4DVY P;  3B0U X;  1Z63 A;  5DQT A;  4U5G A;  4JZA A;  3JRT A;  5DLJ A;  4PJJ A;  4U5B E;  4CIH A;  2R7S A;  2R7R A;  4C3E A;  1G8X A;  2EIN C;  4G7O F;  3JT1 A;  3S29 A;  4CS8 C;  3Q6N A;  4Q5S F;  3JCU Q;  3NRH A;  2OG2 A;  4IWB A;  3UMK A;  2J9W A;  3SNH A;  3I5P A;  4CSA C;  3EH2 A;  3X2Q C;  3ASO C;  3K66 A;  2J7P A;  1N1C A;  2J0W A;  2C03 A;  1BR1 A;  2QTV A;  3W2W A;  3ZG1 A;  1ZU5 A;  2V26 A;  2ZXW C;  2XSE A;  2PP4 A;  3LEV A;  4E7Z A;  3Q7G A;  4IRU A;  4Q4Z F;  3T6J A;  3LLI A;  1JPJ A;  4ZLD A;  1O87 A;  1SZI A;  4M63 A;  4G7Z F;  2PX0 A;  1ZU4 A;  3ABM C;  2R7Q A;  4O6N A;  3EZH A;  1ZHX A;  5DS4 A;  2WVN A;  2NG1 A;  3KL4 A;  4FES A;  1NG1 A;  3FDQ A;  2D5R B;  3S0X A;  4G0H A;  2IXP A;  4JCH A;  5E2Q A;  2BE5 F;  2Q9C A;  5F5F A;  1PCX A;  1OCO C;  3E70 C;  4CSA A;  1ZYR F;  2XXA A;  3L0I A;  4JUR I;  5KYY A;  3RH3 A;  2Q9B A;  5FCL A;  4DBQ A;  4I3M A;  3RKO F;  1V54 C;  4PJN A;  1SF8 A;  2Y3G A;  3O6X A;  2FGY A;  3JSZ A;  4G7H F;  4RDA A;  3ZC4 A;  3UMI A;  4A2N B;  5KYX B;  2A69 F;  3UMH A;  3K1I C;  2J9U A;  3DAF A;  2E87 A;  3N2Z B;  2NUP A;  3S28 A;  4RD9 A;  4ZLC A;  4NY3 A;  4I1M A;  2C04 A;  4N06 A;  2QY9 A;  4Q7C A;  3UGO A;  3NYL A;  3EG9 A;  2CDQ A;  4FWV A;  1D1C A;  3EHN A;  3ABK C;  5T1D B;  2I8B A;  1LS1 A;  3EHM A;  1ZHZ A;  1D1B A;  2KNH A;  3NKE A;  3SYN A;  1FTS A;  4E7S A;  2J9V A;  1FFT C;  3ZSU A;  3DM5 A;  4ANJ A;  4HFF B;  5KYX A;  2IOQ A;  2ZXO A;  2EIJ C;  4AX2 A;  2VAS A;  2WZF A;  1MMG A;  3F47 A;  2W9Y A;  1PD0 A;  4MND A;  1FMV A;  2KGO A;  1J8Y F;  1OKK A;  4U5H A;  1BR4 A;  3PHF 2;  1J8M F;  3S27 A;  3V7O A;  4JVS A;  1TWA A;  1MNE A;  1OCZ C;  2A6E F;  4JW1 A;  2HV6 A;  3AG3 C;  4C3D A;  4QDL A;  2DYS C;  2G62 A;  3AQC A;  3DMD A;  1VOM A;  3EZI A;  2CGE A;  2EIL C;  4HE8 D;  3F46 A;  1NU9 C;  4PJL A;  1O5H A;  1QLE C;  3AG4 C;  4MQ9 F;  4W8K A;  3DM9 B;  3I5Q A;  2YEV A;  3CQZ A;  3PMR A;  4O7G A;  2XXA B;  5KYY B;  4LLE A;  3L34 A;  2R7V A;  1SMY F;  4PK4 A;  5B3S C;  5KYW B;  3DJU B;  1TWH A;  3OA1 A;  3SZR A;  3AQB A;  2MYS A;  3Q7L A;  3FAJ A;  3WOD F;  5IY5 C;  3EH1 A;  2NUP B;  1W2W A;  2HV7 A;  2YHS A;  5DS5 A;  4CS8 A;  4O6Y A;  4YT5 A;  3B0V C;  3AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...