3JRTA

Structure from the mobile metagenome of v. paracholerae: integron cassette protein vpc_cass2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
170
structure length
166
Chain Sequence
GVKMSDKWIEIEEILSGLIGDLTIAVTVLKDYEGKAFLREPQHQTKRQCIWRLCVYSIVINCRKYVELNQKYGKEIPGHNHIRGVYNNEINKNTAIKKLRNHCVAHVSDKSKYLKPAEVQEEIIKMFDGNFADEFLDWICPDNISTTDKSESLVGVIELLRDAVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integron cassette protein Vpc_cass2
publication title Integron gene cassettes: a repository of novel protein folds with distinct interaction sites.
pubmed doi rcsb
source organism Vibrio paracholerae
molecule tags Structural genomics, unknown function
total genus 57
structure length 166
sequence length 170
ec nomenclature
pdb deposition date 2009-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1060 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3jrtA00
3JRTA
chains in the Genus database with same CATH superfamily
4EHPA 5DLJA 1G5ZA 1LI5A 4KNVA 2NUTB 3TD7A 2IXMA 4EBKA 3CEXA 3C18A 2E87A 4Q7CA 3ZDLA 2HFIA 4I3MA 4XPXA 5EHHA 1ZYRF 2DGJA 2KJGA 4EIYA 4YT2A 1RKEB 3FOOA 2MHRA 2C04A 3FOPA 1NFOA 3EQLF 4C3EA 1T6QA 2VC9A 4OINF 3NKDA 1VOMA 2BL2A 3EGDB 3T6BA 2NUPA 5E3CA 1GM5A 1ZVZA 2P6VA 1LS1A 5BQIA 3ZTMA 4P9TA 5A69A 3UGPA 2M64A 2YRFA 3W8HA 2NSGA 1QLEC 2P61A 5CIVA 2D4UA 5KYUB 2OKUA 3RW0A 3VF0A 1V55C 4DBRA 4YN0B 3JT1A 3H2UA 5L0FA 4C7OA 3AJMA 4XPWA 2EPLX 3SXYA 2OEVA 1IW7F 4ANJA 2W45A 4BPMA 1FFTC 1Y6DA 4PFPA 1L3PA 5KYYA 2XM4A 1RMVA 2QLAA 4OD4A 2FAPB 1HE9A 4KNWA 4CJOA 3U3BA 5D92A 4AE4A 4DBQA 3V5XA 3NKEA 4CDYA 3G4XA 1E83A 1NBBA 2VCBA 3JSZA 3TK0A 4DJ9A 1JPJA 3DWWA 2EPNA 4JRZA 1ZU4A 1R5ID 2JD3A 4LLEA 3B0PA 4Z9IA 5FCLA 1A7DA 3N24A 1Q0KA 1T9KA 2P0NA 2XL4A 1LM3B 2XS8A 2PX0A 4JW1A 3ASOC 2VB6A 1F1MA 4NC3A 2LK4A 3OWTA 4KC9A 5BQHA 4CSAC 3WG7C 2L7AA 4OD5A 4C7OB 2B0JA 3S84A 2AWYA 2C03A 4KI2A 2H7BA 4OIOF 3KYJA 3KYIA 2Q9BA 4U5FE 4U5CE 2HUJA 5L3VA 1ZZPA 3K33A 4YJWA 2L6FA 2J0XA 2YLDA 2LD6A 5A6AA 2J7PA 4JKVA 2OEXA 4DXWA 2HSBA 2XSEA 5B1BC 3NRHA 3X1OA 4D4XA 5L3QA 2R7RA 3NG1A 2LSEA 1VK5A 4IGGA 1I4ZA 2J0WA 3C63A 4IB4A 4MTFA 3L34A 5TJ5E 4DRJB 3N0TA 1SYQA 3JYYA 4U5GA 2Q9CA 2ZD9A 1NG1A 4N06A 1FFHA 2NPUA 3I4UA 2PFDA 2LCHA 2ZPAA 5JRAA 3AQBA 5EGYA 2OCCC 1OR3A 1ZHXA 4WGZA 3B71A 1FNTc 2OU6A 3MBGA 2V26A 1LI7A 3U9JA 2IXOA 3IQCA 2R7TA 1QPUA 2Y3GA 3HNIA 5AGFA 1MMAA 2AP3A 3I5QA 1BR1A 4QI2A 1FAPB 4O6YA 1MQVA 4LDKA 1KTMA 2YWAA 3KL4A 2Q9AA 4YL0A 2CDQA 2HS5A 3K7DA 5L0GA 2R7VA 3ZQVA 1CPQA 3UNGC 3FDQA 2W9YA 4CS8A 1Q0DA 3F46A 3RYLA 1CPRA 2EIJC 5EK0A 1O3UA 3TQOA 4A4AA 2J9WA 3W2VA 3U5SA 1HY5A 2L6GA 1TQGA 4WGYA 4XEFA 5KYNA 1MMGA 3G4ZA 3K1HA 5JT4A 1AUEA 1QSPA 3NYMA 4MVOA 4U9EA 3EG9A 4FESA 2PP4A 3TJ6A 4O79A 3ZTZA 4IWBA 1NU7D 3LNMB 3U9MA 3EFOB 3ZWIA 4I1MA 1M6TA 1WN0A 2ZXOA 4QI0A 5DS5A 2Q4FA 2WZFA 3ZSUA 2G3KA 4LLCA 4XPYA 2Z15A 3JRTA 3H2VA 4O6MA 3U8PA 1D1CA 4EBBA 2V3CC 3K1IA 3TOMA 1QQ3A 3SXZA 3TOLA 3ZVRA 4XTKA 2J9UA 2H7VC 3SEOA 3KKBA 1OKKD 1M2VA 3DAFA 4BEMJ 5B3IA 3RIPA 5E33A 3DZAA 3VYWA 4I44A 5HV9A 4EBJA 2PBEA 5A6BA 3EG9B 2M4EA 1GS9A 2A6HF 1UFBA 4G0HA 5F28E 3SP1A 1OW8A 2QUPA 2HJMA 2KGOA 2HMQA 4MVSA 5HSWA 2XRHA 1L7CA 2Y3BA 3ZG1A 2XXAA 3G50A 1LPEA 1Z5ZA 3F47A 3UGOA 1NLXA 2A68F 3US6A 4C3DA 3O6XA 4ER9A 1BR4A 2XLWA 1FMWA 2YLIA 4J7TA 2NG1A 3GM2A 1GGQA 2R05A 4PACA 3R7CA 4G78A 3DAGA 1EKYA 2Q3TA 2CYDA 3DE9A 3HNLA 1D0XA 4N6CA 2R7UA 3GM1A 1VMAA 1Z3IX 2EINC 2XLVA 3MYIA 4HFFB 5JLIA 1NZEA 3VRCA 1E85A 3IPMO 1VLSA 2L81A 1JOGA 1MMDA 1WWPA 2IBFA 2WVQA 2WZLA 1OW6A 2ZXRA 2OQMA 3ITFA 3KPHA 5DQZA 1SF8A 2YLGA 2A69F 3JRMO 4E0HA 4JIOA 1XZPA 3JTLO 4CDAA 3AGTA 1YYJA 2FFHA 2HJ3A 2XLMA 3V7OA 3TULA 2J45A 3S27A 2Y69C 3LESA 3LNRA 1E2XA 2HV6A 1R4TA 1YAUO 4CJGA 4LERA 2YQYA 3RH3A 1ST6A 1J8MF 1WOLA 3W8IA 4NTBA 4JURI 1OR2A 2XLDA 5T1DB 3L1MA 3X2QC 1VYKA 5COMA 4E18A 5A6KA 3S28A 1DOWA 3HTKC 1NFNA 5L0CA 1I4YA 1B68A 3MLGA 1HMDA 3U3FA 2NUPB 4MS2A 3POVA 1DOVA 1A0BA 3E70C 3LS1A 4RD9A 2B0HA 3W2WA 2XL6A 5E3AA 1VYIA 4MTGA 2IM8A 2VCAA 2J9VA 2LQGA 1Q0GA 4W8PA 3VAYA 2YHSA 3M1CB 4BJ6C 4ZLDA 3C62A 3GEHA 2IXNA 5D91A 1MNDA 4XEVA 1ZW3A 4Z9HA 4DOZA 2EPOA 2HSQA 1FR0A 4LDQA 4OIRF 1RJ9A 2X51A 5DQTA 2BC5A 2YL0A 1PD1A 5KYYB 2OG2A 1S7ZA 1M2OA 1TWAA 3LAYA 5COGA 2H7OA 2X0CA 1E84A 5CI8A 1HE1A 4AE4B 4EWCA 1ORSC 2YL1A 3HNJA 4KBLA 4JEAA 4U9DA 2OJED 3GWNA 2OJQA 4XQ1A 1VB5A 3FVYA 4DRIB 3DM9B 3U2MA 3SYNA 1XZQA 1T6UA 2R25A 1HMOA 1YZCA 2IXPA 3UMHA 1S05A 4P6IC 2P7VA 1EQ1A 1G4WR 2XLHA 2Y39A 3PMRA 3QZCA 2H8AA 3R2PA 3UMKA 2BE5F 2AU5A 3VM6A 4JVSA 4LACB 2R02A 3NYJA 4U5HA 2DB4A 4G7OF 2PNOA 2XLOA 1JRAA 1H7IA 4L6RA 5BQGA 1AEPA 2LFFA 2GAQA 4W8KA 4DVZA 1ZW2A 2EPMX 1YA7O 3V5ZA 1QZXA 2CW0F 4FX5A 3CZ6A 4H54A 2HZ8A 4A2NB 3IQ6A 1YDIA 1Z6AA 4DVYP 3DXJF 3LEOA 1Q0MA 5DVWA 3FMSA 5E2QA 3ECSA 1YARO 2OOCA 2GWWA 3IQTA 1LIHA 3Q7GA 3RQFA 3FAPB 3UR3C 4CDVA 4JTAB 4YK5A 1D1BA 3HNKA 1PD0A 4M63A 3JCUQ 2A1DD 4DRHB 3ZIBA 5B3SC 1H9TA 1TWGA 1JR8A 2G62A 4MQ9F 1ZHZA 5T3WA 1JMWA 3LS0A 2O9XA 4CBEA 1PV3A 5L0JA 2QY9A 3B0UX 3RQEA 1RCPA 2QE9A 3B9QA 1LKXA 2R03A 4ULVA 2R7SA 3RVZA 4BJ5C 1J8YF 2R7WA 4MW8A 3JZ0A 4X0RA 3DKAA 5KYXA 1D0ZA 1T5OA 2L9JA 1FMVA 4UDVA 4NTAA 4C3BA 5GPGB 1H9GA 4MW3A 4XLNF 1CGME 4IARA 4CS9C 3Q6NA 4XEKA 1KNYA 1C03A 2J9BA 2VASA 4CX9A 1OCZC 3T4RA 1YZAA 3GWLA 2YVKA 1Y4CA 1GQAA 2RSEB 3ABMC 3M15A 3GORA 3HKKA 256BA 3PDMP 5B1AC 4QDLA 2KK1A 3EJNA 4GQHA 1OKKA 2YZSA 1LVKA 4U5EE 1HW1A 2W4BA 3FXHA 3NMJA 4J7YA 4RBNA 4EUKB 5KYXB 3DMDA 4GEHA 4IAQA 3C7JA 3WHNA 1LE2A 1NSGB 4PJNA 3Q7LA 1LE4A 2GDCA 1A41A 4YL3A 1CGNA 3FAJA 2NUTA 5L0DA 2HV7A 3KMIA 2GA0A 1NU9C 4K0DA 2HMZA 1ZHYA 4WABA 4PJJA 4HFKB 1RKEA 3CQZA 2A0UA 2LFDA 1M2VB 3EH1A 1QVXA 3EZHA 3M79A 1K05A 4BJ1A 2AWCA 1PCXA 3ABLC 3S0XA 4AL1A 2J8WA 3EHMA 4JEBA 1EI7A 4K1OA 1Z7Qc 1D1AA 3Q6MA 4JTCB 4AK9A 1WASA 3EH2A 4J32B 3L8JA 5JP7A 3KH2A 4BJ6A 2XXAB 4YT5A 4Q4ZF 4CSAA 3E9VA 1ZHTA 4N4WA 3GEIA 1D0YA 4O7GA 3RKOF 1U6HA 1OW7A 5COFA 5AC5A 3L0IA 1T6IA 3OEOA 4FAPB 4D4NA 2WVNA 4O6NA 4PR9A 5A6JA 2XM0A 4IAOA 2WZGA 4K7BA 1VTMP 1OXBA 1UG7A 3QVYA 1V74B 1AVOB 2EIMC 3K1IC 3K6BA 3U8VA 2XL8A 4CS7A 1XWJA 2UUIA 4NTFA 2F22A 1OCRC 2R7XA 3U0CA 1C17M 1YJGA 2CCYA 1OCCC 3RFYA 3WODF 3I5PA 1YVIA 2GFHA 2WL8A 4LDRA 4E7ZA 2ZXPA 3J06A 4NY3A 3B0VC 3MX3A 2R7OA 2QNLA 4JZAA 2JPUA 1ZU5A 3LLIA 2QTVA 4ZLCA 2I15A 2KSFA 2AVKA 4BJTA 1TKNA 1V4AA 2DYRC 4PJLA 3ZQYA 3DJNB 4N6HA 1G4US 4NQFA 4E17A 1G8XA 5JVEA 3B29A 2UUHA 2YL7A 3A11A 2DI3A 3AQCA 1TWHA 1M56C 3A9CA 1LS4A 1Q0FA 1OQCA 2EPKX 4F4BA 3M4BA 1BR2A 3DJUB 3QMKA 3QW1A 4E7SA 2EIKC 3NYLA 3NMIA 4MVMA 1EA8A 4JTDB 4P9FA 1VLTA 3DE8A 3WAQA 3U2LA 3EZIA 2IOQA 1H6GA 1MMNA 2LIGA 2CGEA 4YWQA 2P1AA 5DS4A 5IY5C 2VH3A 1V54C 2WVOA 1A7VA 1OXKA 4MVQA 1QKRA 4Z9JA 1I5NA 2D5RB 4JCZA 4XLPF 4AX2A 4BEJA 2KQ9A 3C8ZA 4BJ5A 3LJBA 2EILC 1JPNA 2Y3HA 2ZXWC 3AG4C 3DM5A 1JAFA 2A0BA 1TFKB 4MTOA 2CNWD 2I8BA 3TJ5A 4PFOA 1WTYA 4HEAJ 1K40A 3IHUA 1RJ9B 3LEVA 2J7PD 3N2ZB 2CNWA 1WATA 3T9OA 3UMIA 4CS9A 4Q5SF 3L8IA 3C8GD 2KNHA 4MVZA 4RDAA 3S29A 2Y3DA 1APCA 3O39A 5L0HA 2R7QA 3FHDA 3BEHA 1A7EA 1YLMA 3C8GA 3GODA 1U89A 3PCVA 3RVYA 3H65A 1O5HA 4YT4A 5BUOA 3W4YA 3MFNA 3DI5A 5T3TA 1IZMA 3AG2C 3O55A 5JS5A 4GYTA 4J30B 1SR2A 3SNHA 2KYHA 3QTHA 4ULWA 4JE9A 4PJMA 3JYHA 4G7HF 2HKVA 3ABKC 2IYLD 4EKWA 4JJGA 5K0IA 3T6JA 2NSFA 3EPVA 3ZC4A 1SZIA 2R9RB 1YYXA 1M57C 1RXQA 3DD7A 3GANA 1BZ4A 1OCOC 2A6EF 4IRUA 3EFOA 4CIPA 3AG1C 2RD9A 3EHNA 3SZRA 3OA1A 3HLZA 5KYWA 1ORYA 5DS6A 4XWJA 5F5HA 3SXKA 3M4CA 4IJJA 4BG0A 5JUAA 4MVRA 3NDBB 3BRJA 3C8GB 2XLEA 2VCCA 2MYSA 4PK4A 1YA9A 2ETSA 3EGXA 3K66A 2MWQA 2YEVA 1ZHWA 4ONSA 3S9OA 2KW3C 4JC7A 3QW0A 1TR2A 4JJFA 1TWCA 2XS1A 2Q00A 3MYFA 3ASNC 1TFOB 1E86A 4OIPF 2TMVP 3O10A 2JX0A 3LLKA 1SMYF 1K04A 1CGOA 2W4MA 5KYWB 4U5DE 5FZTA 2PX3A 1C02A 5L0IA 4G7ZF 3ATPA 3RF3A 4AL0A 1BBHA 4YT8A 3V5YA 3GEEA 3T6GB 1T01A 1FTSA 2FGYA 2WB7A 3AOUA 5AC4A 5CI9A 3EGXB 4E0IA 4JCHA 3PHF2 4CIHA 1O87A 2DYSC 4H4KC 4FWVA 5A6BD 1HW2A 2G3VA 2PF4E 3LUTB 2YKZA 1BDJB 4MNDA 4MVUA 4R32A 4CS8C 3IEEA 3AGUA 2L6HA 1N1CA 1RKCA 3HJCA 3NMKA 2KC3A 4U5BE 4I1OB 2Q7RA 1Z23A 3CSKA 2ASRA 2J46A 3EGDA 3IQ5A 3CAXA 3JSEO 3QVZA 3SXMA 1MNEA 4B6IA 1W2WA 4OIQF 1U0BB 4YL1A 3GM3A 3RQGA 5F5FA 1KU2A 2LP4A 5JSLA 2YL3A 4NCQA 4WJ0A 5KYUA 1Z63A 1ORJA 3S90A 4HE8D 2ICWG 3AG3C 1WGWA
chains in the Genus database with same CATH topology
5DLJA 4KNVA 2NUTB 3TD7A 2IXMA 5EHHA 2E87A 4Q7CA 4I3MA 1ZYRF 2DGJA 2KJGA 4YT2A 2C04A 3EQLF 4C3EA 4OINF 3NKDA 1VOMA 3EGDB 3T6BA 2NUPA 5E3CA 2P6VA 1LS1A 3UGPA 3W8HA 1QLEC 5KYUB 1V55C 4DBRA 4YN0B 3JT1A 4C7OA 1IW7F 4ANJA 2W45A 5KYYA 1FFTC 4PFPA 4OD4A 4KNWA 4AE4A 5D92A 4DBQA 3NKEA 3JSZA 1JPJA 5FCLA 1ZU4A 2JD3A 4LLEA 3B0PA 3N24A 2XL4A 2PX0A 4JW1A 3ASOC 2VB6A 3OWTA 4KC9A 4CSAC 3WG7C 4OD5A 4C7OB 2B0JA 2C03A 4KI2A 2H7BA 4OIOF 2Q9BA 4U5FE 4U5CE 5L3VA 3K33A 4YJWA 2J0XA 2J7PA 2XSEA 3X1OA 5B1BC 3NRHA 5L3QA 2R7RA 3NG1A 2LSEA 1VK5A 2J0WA 3L34A 3N0TA 4U5GA 2Q9CA 1NG1A 4N06A 1FFHA 3I4UA 2PFDA 2ZPAA 3AQBA 5EGYA 2OCCC 1ZHXA 2V26A 2R7TA 2IXOA 2Y3GA 1MMAA 3I5QA 1BR1A 4QI2A 4O6YA 3KL4A 2Q9AA 2CDQA 3K7DA 2R7VA 3FDQA 3UNGC 2W9YA 4CS8A 3F46A 3RYLA 2EIJC 2J9WA 3W2VA 5KYNA 1MMGA 3K1HA 3NYMA 3EG9A 4FESA 2PP4A 4O79A 4IWBA 1NU7D 3EFOB 4I1MA 2ZXOA 4QI0A 5DS5A 2WZFA 3ZSUA 2G3KA 4LLCA 2Z15A 3JRTA 4O6MA 1D1CA 4EBBA 2V3CC 3ZVRA 4XTKA 2J9UA 2H7VC 3SEOA 3KKBA 1OKKD 1M2VA 3DAFA 3RIPA 5E33A 3DZAA 3VYWA 4I44A 3EG9B 2M4EA 4G0HA 2A6HF 3SP1A 2KGOA 5HSWA 2XRHA 2Y3BA 3ZG1A 2XXAA 1Z5ZA 3F47A 3UGOA 2A68F 4C3DA 3O6XA 1BR4A 1FMWA 2NG1A 3DAGA 2Q3TA 1D0XA 2R7UA 1VMAA 1Z3IX 2EINC 4HFFB 1NZEA 2L81A 2WZLA 1MMDA 2WVQA 2ZXRA 3ITFA 5DQZA 1SF8A 2A69F 2FFHA 3V7OA 2J45A 3S27A 2Y69C 3LESA 3LNRA 2HV6A 4LERA 3RH3A 1ST6A 1J8MF 3W8IA 4JURI 5T1DB 3X2QC 1VYKA 3S28A 3HTKC 3MLGA 2NUPB 3POVA 3LS1A 3E70C 4RD9A 3W2WA 5E3AA 1VYIA 3VAYA 2J9VA 4BJ6C 2YHSA 3M1CB 4ZLDA 5D91A 2IXNA 1MNDA 4DOZA 4OIRF 1RJ9A 2X51A 5DQTA 1PD1A 5KYYB 2OG2A 1S7ZA 1M2OA 1TWAA 3LAYA 2H7OA 5CI8A 4AE4B 4EWCA 4KBLA 3FVYA 3DM9B 3SYNA 2IXPA 3UMHA 4P6IC 2P7VA 2Y39A 3PMRA 3QZCA 3UMKA 2BE5F 4JVSA 4LACB 3NYJA 4U5HA 4G7OF 4W8KA 4DVZA 1QZXA 2CW0F 4FX5A 3CZ6A 4A2NB 1Z6AA 4DVYP 3DXJF 5DVWA 5E2QA 3ECSA 3Q7GA 3UR3C 1D1BA 1PD0A 4M63A 3JCUQ 2A1DD 5B3SC 3ZIBA 1TWGA 2G62A 4MQ9F 1ZHZA 5T3WA 3LS0A 2O9XA 4CBEA 2QY9A 3B0UX 3B9QA 1LKXA 2R7SA 4BJ5C 1J8YF 2R7WA 4X0RA 5KYXA 1D0ZA 2L9JA 1FMVA 4C3BA 4XLNF 4CS9C 3Q6NA 2VASA 1OCZC 3T4RA 3ABMC 5B1AC 4QDLA 3EJNA 1OKKA 2YZSA 1LVKA 4U5EE 2W4BA 4RBNA 5KYXB 3DMDA 4GEHA 4PJNA 3Q7LA 3FAJA 2NUTA 2HV7A 3KMIA 1NU9C 4K0DA 1ZHYA 4PJJA 4HFKB 3CQZA 1M2VB 3EH1A 3EZHA 4BJ1A 1PCXA 3ABLC 3S0XA 3EHMA 4AK9A 1D1AA 3Q6MA 3EH2A 4J32B 3KH2A 4BJ6A 2XXAB 4YT5A 4Q4ZF 4CSAA 3E9VA 1ZHTA 4O7GA 1D0YA 3RKOF 3L0IA 3OEOA 2WVNA 4O6NA 4IAOA 4K7BA 2WZGA 3K1IC 2EIMC 3K6BA 2R7XA 4CS7A 1OCRC 1OCCC 3RFYA 3WODF 3I5PA 2GFHA 2WL8A 4E7ZA 2ZXPA 4NY3A 3B0VC 3MX3A 2R7OA 4JZAA 1ZU5A 3LLIA 2QTVA 4ZLCA 4BJTA 1TKNA 2DYRC 4PJLA 3DJNB 1G8XA 3AQCA 1TWHA 1M56C 4F4BA 3QMKA 1BR2A 3DJUB 4E7SA 2EIKC 3NYLA 3EZIA 2IOQA 1MMNA 2CGEA 4YWQA 5DS4A 5IY5C 2VH3A 1V54C 2WVOA 2D5RB 4XLPF 4AX2A 4BEJA 2KQ9A 4BJ5A 3LJBA 2EILC 1JPNA 2Y3HA 2ZXWC 3AG4C 3DM5A 2CNWD 2I8BA 4PFOA 4HEAJ 1RJ9B 3LEVA 2J7PD 3N2ZB 2CNWA 4CS9A 3UMIA 4Q5SF 2KNHA 4RDAA 3S29A 2Y3DA 3O39A 2R7QA 3FHDA 3GODA 4YT4A 3H65A 1O5HA 5BUOA 5T3TA 1IZMA 3AG2C 4GYTA 4J30B 3SNHA 4ULWA 4PJMA 3JYHA 4G7HF 3ABKC 2IYLD 4JJGA 3T6JA 3EPVA 3ZC4A 1SZIA 3DD7A 1M57C 3GANA 2A6EF 1OCOC 4IRUA 3EFOA 3AG1C 3EHNA 3SZRA 3OA1A 3HLZA 5KYWA 5DS6A 4XWJA 5F5HA 4IJJA 4BG0A 3NDBB 4PK4A 2MYSA 3EGXA 3K66A 2MWQA 2YEVA 1ZHWA 2KW3C 1TR2A 4JJFA 1TWCA 3ASNC 4OIPF 3LLKA 1SMYF 2W4MA 5KYWB 4U5DE 2PX3A 4G7ZF 4YT8A 1FTSA 2FGYA 2WB7A 5CI9A 3EGXB 4JCHA 3PHF2 4CIHA 1O87A 2DYSC 4H4KC 4FWVA 2G3VA 2PF4E 4CS8C 4MNDA 3IEEA 1N1CA 3HJCA 4U5BE 4I1OB 1Z23A 3CSKA 2J46A 3EGDA 1MNEA 4B6IA 1W2WA 4OIQF 5F5FA 1KU2A 4WJ0A 5KYUA 1Z63A 4HE8D 3AG3C 1WGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRT A; 
#chains in the Genus database with same CATH topology
 4EHP A;  5DLJ A;  1G5Z A;  1LI5 A;  4KNV A;  2NUT B;  3TD7 A;  2IXM A;  4EBK A;  3CEX A;  3C18 A;  2E87 A;  4Q7C A;  3ZDL A;  2HFI A;  4I3M A;  4XPX A;  5EHH A;  1ZYR F;  2DGJ A;  2KJG A;  4EIY A;  4YT2 A;  1RKE B;  3FOO A;  2MHR A;  2C04 A;  3FOP A;  1NFO A;  3EQL F;  4C3E A;  1T6Q A;  2VC9 A;  4OIN F;  3NKD A;  1VOM A;  2BL2 A;  3EGD B;  3T6B A;  2NUP A;  5E3C A;  1GM5 A;  1ZVZ A;  2P6V A;  1LS1 A;  5BQI A;  3ZTM A;  4P9T A;  5A69 A;  3UGP A;  2M64 A;  2YRF A;  3W8H A;  2NSG A;  1QLE C;  2P61 A;  5CIV A;  2D4U A;  5KYU B;  2OKU A;  3RW0 A;  3VF0 A;  1V55 C;  4DBR A;  4YN0 B;  3JT1 A;  3H2U A;  5L0F A;  4C7O A;  3AJM A;  4XPW A;  2EPL X;  3SXY A;  2OEV A;  1IW7 F;  4ANJ A;  2W45 A;  4BPM A;  1FFT C;  1Y6D A;  4PFP A;  1L3P A;  5KYY A;  2XM4 A;  1RMV A;  2QLA A;  4OD4 A;  2FAP B;  1HE9 A;  4KNW A;  4CJO A;  3U3B A;  5D92 A;  4AE4 A;  4DBQ A;  3V5X A;  3NKE A;  4CDY A;  3G4X A;  1E83 A;  1NBB A;  2VCB A;  3JSZ A;  3TK0 A;  4DJ9 A;  1JPJ A;  3DWW A;  2EPN A;  4JRZ A;  1ZU4 A;  1R5I D;  2JD3 A;  4LLE A;  3B0P A;  4Z9I A;  5FCL A;  1A7D A;  3N24 A;  1Q0K A;  1T9K A;  2P0N A;  2XL4 A;  1LM3 B;  2XS8 A;  2PX0 A;  4JW1 A;  3ASO C;  2VB6 A;  1F1M A;  4NC3 A;  2LK4 A;  3OWT A;  4KC9 A;  5BQH A;  4CSA C;  3WG7 C;  2L7A A;  4OD5 A;  4C7O B;  2B0J A;  3S84 A;  2AWY A;  2C03 A;  4KI2 A;  2H7B A;  4OIO F;  3KYJ A;  3KYI A;  2Q9B A;  4U5F E;  4U5C E;  2HUJ A;  5L3V A;  1ZZP A;  3K33 A;  4YJW A;  2L6F A;  2J0X A;  2YLD A;  2LD6 A;  5A6A A;  2J7P A;  4JKV A;  2OEX A;  4DXW A;  2HSB A;  2XSE A;  5B1B C;  3NRH A;  3X1O A;  4D4X A;  5L3Q A;  2R7R A;  3NG1 A;  2LSE A;  1VK5 A;  4IGG A;  1I4Z A;  2J0W A;  3C63 A;  4IB4 A;  4MTF A;  3L34 A;  5TJ5 E;  4DRJ B;  3N0T A;  1SYQ A;  3JYY A;  4U5G A;  2Q9C A;  2ZD9 A;  1NG1 A;  4N06 A;  1FFH A;  2NPU A;  3I4U A;  2PFD A;  2LCH A;  2ZPA A;  5JRA A;  3AQB A;  5EGY A;  2OCC C;  1OR3 A;  1ZHX A;  4WGZ A;  3B71 A;  1FNT c;  2OU6 A;  3MBG A;  2V26 A;  1LI7 A;  3U9J A;  2IXO A;  3IQC A;  2R7T A;  1QPU A;  2Y3G A;  3HNI A;  5AGF A;  1MMA A;  2AP3 A;  3I5Q A;  1BR1 A;  4QI2 A;  1FAP B;  4O6Y A;  1MQV A;  4LDK A;  1KTM A;  2YWA A;  3KL4 A;  2Q9A A;  4YL0 A;  2CDQ A;  2HS5 A;  3K7D A;  5L0G A;  2R7V A;  3ZQV A;  1CPQ A;  3UNG C;  3FDQ A;  2W9Y A;  4CS8 A;  1Q0D A;  3F46 A;  3RYL A;  1CPR A;  2EIJ C;  5EK0 A;  1O3U A;  3TQO A;  4A4A A;  2J9W A;  3W2V A;  3U5S A;  1HY5 A;  2L6G A;  1TQG A;  4WGY A;  4XEF A;  5KYN A;  1MMG A;  3G4Z A;  3K1H A;  5JT4 A;  1AUE A;  1QSP A;  3NYM A;  4MVO A;  4U9E A;  3EG9 A;  4FES A;  2PP4 A;  3TJ6 A;  4O79 A;  3ZTZ A;  4IWB A;  1NU7 D;  3LNM B;  3U9M A;  3EFO B;  3ZWI A;  4I1M A;  1M6T A;  1WN0 A;  2ZXO A;  4QI0 A;  5DS5 A;  2Q4F A;  2WZF A;  3ZSU A;  2G3K A;  4LLC A;  4XPY A;  2Z15 A;  3JRT A;  3H2V A;  4O6M A;  3U8P A;  1D1C A;  4EBB A;  2V3C C;  3K1I A;  3TOM A;  1QQ3 A;  3SXZ A;  3TOL A;  3ZVR A;  4XTK A;  2J9U A;  2H7V C;  3SEO A;  3KKB A;  1OKK D;  1M2V A;  3DAF A;  4BEM J;  5B3I A;  3RIP A;  5E33 A;  3DZA A;  3VYW A;  4I44 A;  5HV9 A;  4EBJ A;  2PBE A;  5A6B A;  3EG9 B;  2M4E A;  1GS9 A;  2A6H F;  1UFB A;  4G0H A;  5F28 E;  3SP1 A;  1OW8 A;  2QUP A;  2HJM A;  2KGO A;  2HMQ A;  4MVS A;  5HSW A;  2XRH A;  1L7C A;  2Y3B A;  3ZG1 A;  2XXA A;  3G50 A;  1LPE A;  1Z5Z A;  3F47 A;  3UGO A;  1NLX A;  2A68 F;  3US6 A;  4C3D A;  3O6X A;  4ER9 A;  1BR4 A;  2XLW A;  1FMW A;  2YLI A;  4J7T A;  2NG1 A;  3GM2 A;  1GGQ A;  2R05 A;  4PAC A;  3R7C A;  4G78 A;  3DAG A;  1EKY A;  2Q3T A;  2CYD A;  3DE9 A;  3HNL A;  1D0X A;  4N6C A;  2R7U A;  3GM1 A;  1VMA A;  1Z3I X;  2EIN C;  2XLV A;  3MYI A;  4HFF B;  5JLI A;  1NZE A;  3VRC A;  1E85 A;  3IPM O;  1VLS A;  2L81 A;  1JOG A;  1MMD A;  1WWP A;  2IBF A;  2WVQ A;  2WZL A;  1OW6 A;  2ZXR A;  2OQM A;  3ITF A;  3KPH A;  5DQZ A;  1SF8 A;  2YLG A;  2A69 F;  3JRM O;  4E0H A;  4JIO A;  1XZP A;  3JTL O;  4CDA A;  3AGT A;  1YYJ A;  2FFH A;  2HJ3 A;  2XLM A;  3V7O A;  3TUL A;  2J45 A;  3S27 A;  2Y69 C;  3LES A;  3LNR A;  1E2X A;  2HV6 A;  1R4T A;  1YAU O;  4CJG A;  4LER A;  2YQY A;  3RH3 A;  1ST6 A;  1J8M F;  1WOL A;  3W8I A;  4NTB A;  4JUR I;  1OR2 A;  2XLD A;  5T1D B;  3L1M A;  3X2Q C;  1VYK A;  5COM A;  4E18 A;  5A6K A;  3S28 A;  1DOW A;  3HTK C;  1NFN A;  5L0C A;  1I4Y A;  1B68 A;  3MLG A;  1HMD A;  3U3F A;  2NUP B;  4MS2 A;  3POV A;  1DOV A;  1A0B A;  3E70 C;  3LS1 A;  4RD9 A;  2B0H A;  3W2W A;  2XL6 A;  5E3A A;  1VYI A;  4MTG A;  2IM8 A;  2VCA A;  2J9V A;  2LQG A;  1Q0G A;  4W8P A;  3VAY A;  2YHS A;  3M1C B;  4BJ6 C;  4ZLD A;  3C62 A;  3GEH A;  2IXN A;  5D91 A;  1MND A;  4XEV A;  1ZW3 A;  4Z9H A;  4DOZ A;  2EPO A;  2HSQ A;  1FR0 A;  4LDQ A;  4OIR F;  1RJ9 A;  2X51 A;  5DQT A;  2BC5 A;  2YL0 A;  1PD1 A;  5KYY B;  2OG2 A;  1S7Z A;  1M2O A;  1TWA A;  3LAY A;  5COG A;  2H7O A;  2X0C A;  1E84 A;  5CI8 A;  1HE1 A;  4AE4 B;  4EWC A;  1ORS C;  2YL1 A;  3HNJ A;  4KBL A;  4JEA A;  4U9D A;  2OJE D;  3GWN A;  2OJQ A;  4XQ1 A;  1VB5 A;  3FVY A;  4DRI B;  3DM9 B;  3U2M A;  3SYN A;  1XZQ A;  1T6U A;  2R25 A;  1HMO A;  1YZC A;  2IXP A;  3UMH A;  1S05 A;  4P6I C;  2P7V A;  1EQ1 A;  1G4W R;  2XLH A;  2Y39 A;  3PMR A;  3QZC A;  2H8A A;  3R2P A;  3UMK A;  2BE5 F;  2AU5 A;  3VM6 A;  4JVS A;  4LAC B;  2R02 A;  3NYJ A;  4U5H A;  2DB4 A;  4G7O F;  2PNO A;  2XLO A;  1JRA A;  1H7I A;  4L6R A;  5BQG A;  1AEP A;  2LFF A;  2GAQ A;  4W8K A;  4DVZ A;  1ZW2 A;  2EPM X;  1YA7 O;  3V5Z A;  1QZX A;  2CW0 F;  4FX5 A;  3CZ6 A;  4H54 A;  2HZ8 A;  4A2N B;  3IQ6 A;  1YDI A;  1Z6A A;  4DVY P;  3DXJ F;  3LEO A;  1Q0M A;  5DVW A;  3FMS A;  5E2Q A;  3ECS A;  1YAR O;  2OOC A;  2GWW A;  3IQT A;  1LIH A;  3Q7G A;  3RQF A;  3FAP B;  3UR3 C;  4CDV A;  4JTA B;  4YK5 A;  1D1B A;  3HNK A;  1PD0 A;  4M63 A;  3JCU Q;  2A1D D;  4DRH B;  3ZIB A;  5B3S C;  1H9T A;  1TWG A;  1JR8 A;  2G62 A;  4MQ9 F;  1ZHZ A;  5T3W A;  1JMW A;  3LS0 A;  2O9X A;  4CBE A;  1PV3 A;  5L0J A;  2QY9 A;  3B0U X;  3RQE A;  1RCP A;  2QE9 A;  3B9Q A;  1LKX A;  2R03 A;  4ULV A;  2R7S A;  3RVZ A;  4BJ5 C;  1J8Y F;  2R7W A;  4MW8 A;  3JZ0 A;  4X0R A;  3DKA A;  5KYX A;  1D0Z A;  1T5O A;  2L9J A;  1FMV A;  4UDV A;  4NTA A;  4C3B A;  5GPG B;  1H9G A;  4MW3 A;  4XLN F;  1CGM E;  4IAR A;  4CS9 C;  3Q6N A;  4XEK A;  1KNY A;  1C03 A;  2J9B A;  2VAS A;  4CX9 A;  1OCZ C;  3T4R A;  1YZA A;  3GWL A;  2YVK A;  1Y4C A;  1GQA A;  2RSE B;  3ABM C;  3M15 A;  3GOR A;  3HKK A;  256B A;  3PDM P;  5B1A C;  4QDL A;  2KK1 A;  3EJN A;  4GQH A;  1OKK A;  2YZS A;  1LVK A;  4U5E E;  1HW1 A;  2W4B A;  3FXH A;  3NMJ A;  4J7Y A;  4RBN A;  4EUK B;  5KYX B;  3DMD A;  4GEH A;  4IAQ A;  3C7J A;  3WHN A;  1LE2 A;  1NSG B;  4PJN A;  3Q7L A;  1LE4 A;  2GDC A;  1A41 A;  4YL3 A;  1CGN A;  3FAJ A;  2NUT A;  5L0D A;  2HV7 A;  3KMI A;  2GA0 A;  1NU9 C;  4K0D A;  2HMZ A;  1ZHY A;  4WAB A;  4PJJ A;  4HFK B;  1RKE A;  3CQZ A;  2A0U A;  2LFD A;  1M2V B;  3EH1 A;  1QVX A;  3EZH A;  3M79 A;  1K05 A;  4BJ1 A;  2AWC A;  1PCX A;  3ABL C;  3S0X A;  4AL1 A;  2J8W A;  3EHM A;  4JEB A;  1EI7 A;  4K1O A;  1Z7Q c;  1D1A A;  3Q6M A;  4JTC B;  4AK9 A;  1WAS A;  3EH2 A;  4J32 B;  3L8J A;  5JP7 A;  3KH2 A;  4BJ6 A;  2XXA B;  4YT5 A;  4Q4Z F;  4CSA A;  3E9V A;  1ZHT A;  4N4W A;  3GEI A;  1D0Y A;  4O7G A;  3RKO F;  1U6H A;  1OW7 A;  5COF A;  5AC5 A;  3L0I A;  1T6I A;  3OEO A;  4FAP B;  4D4N A;  2WVN A;  4O6N A;  4PR9 A;  5A6J A;  2XM0 A;  4IAO A;  2WZG A;  4K7B A;  1VTM P;  1OXB A;  1UG7 A;  3QVY A;  1V74 B;  1AVO B;  2EIM C;  3K1I C;  3K6B A;  3U8V A;  2XL8 A;  4CS7 A;  1XWJ A;  2UUI A;  4NTF A;  2F22 A;  1OCR C;  2R7X A;  3U0C A;  1C17 M;  1YJG A;  2CCY A;  1OCC C;  3RFY A;  3WOD F;  3I5P A;  1YVI A;  2GFH A;  2WL8 A;  4LDR A;  4E7Z A;  2ZXP A;  3J06 A;  4NY3 A;  3B0V C;  3MX3 A;  2R7O A;  2QNL A;  4JZA A;  2JPU A;  1ZU5 A;  3LLI A;  2QTV A;  4ZLC A;  2I15 A;  2KSF A;  2AVK A;  4BJT A;  1TKN A;  1V4A A;  2DYR C;  4PJL A;  3ZQY A;  3DJN B;  4N6H A;  1G4U S;  4NQF A;  4E17 A;  1G8X A;  5JVE A;  3B29 A;  2UUH A;  2YL7 A;  3A11 A;  2DI3 A;  3AQC A;  1TWH A;  1M56 C;  3A9C A;  1LS4 A;  1Q0F A;  1OQC A;  2EPK X;  4F4B A;  3M4B A;  1BR2 A;  3DJU B;  3QMK A;  3QW1 A;  4E7S A;  2EIK C;  3NYL A;  3NMI A;  4MVM A;  1EA8 A;  4JTD B;  4P9F A;  1VLT A;  3DE8 A;  3WAQ A;  3U2L A;  3EZI A;  2IOQ A;  1H6G A;  1MMN A;  2LIG A;  2CGE A;  4YWQ A;  2P1A A;  5DS4 A;  5IY5 C;  2VH3 A;  1V54 C;  2WVO A;  1A7V A;  1OXK A;  4MVQ A;  1QKR A;  4Z9J A;  1I5N A;  2D5R B;  4JCZ A;  4XLP F;  4AX2 A;  4BEJ A;  2KQ9 A;  3C8Z A;  4BJ5 A;  3LJB A;  2EIL C;  1JPN A;  2Y3H A;  2ZXW C;  3AG4 C;  3DM5 A;  1JAF A;  2A0B A;  1TFK B;  4MTO A;  2CNW D;  2I8B A;  3TJ5 A;  4PFO A;  1WTY A;  4HEA J;  1K40 A;  3IHU A;  1RJ9 B;  3LEV A;  2J7P D;  3N2Z B;  2CNW A;  1WAT A;  3T9O A;  3UMI A;  4CS9 A;  4Q5S F;  3L8I A;  3C8G D;  2KNH A;  4MVZ A;  4RDA A;  3S29 A;  2Y3D A;  1APC A;  3O39 A;  5L0H A;  2R7Q A;  3FHD A;  3BEH A;  1A7E A;  1YLM A;  3C8G A;  3GOD A;  1U89 A;  3PCV A;  3RVY A;  3H65 A;  1O5H A;  4YT4 A;  5BUO A;  3W4Y A;  3MFN A;  3DI5 A;  5T3T A;  1IZM A;  3AG2 C;  3O55 A;  5JS5 A;  4GYT A;  4J30 B;  1SR2 A;  3SNH A;  2KYH A;  3QTH A;  4ULW A;  4JE9 A;  4PJM A;  3JYH A;  4G7H F;  2HKV A;  3ABK C;  2IYL D;  4EKW A;  4JJG A;  5K0I A;  3T6J A;  2NSF A;  3EPV A;  3ZC4 A;  1SZI A;  2R9R B;  1YYX A;  1M57 C;  1RXQ A;  3DD7 A;  3GAN A;  1BZ4 A;  1OCO C;  2A6E F;  4IRU A;  3EFO A;  4CIP A;  3AG1 C;  2RD9 A;  3EHN A;  3SZR A;  3OA1 A;  3HLZ A;  5KYW A;  1ORY A;  5DS6 A;  4XWJ A;  5F5H A;  3SXK A;  3M4C A;  4IJJ A;  4BG0 A;  5JUA A;  4MVR A;  3NDB B;  3BRJ A;  3C8G B;  2XLE A;  2VCC A;  2MYS A;  4PK4 A;  1YA9 A;  2ETS A;  3EGX A;  3K66 A;  2MWQ A;  2YEV A;  1ZHW A;  4ONS A;  3S9O A;  2KW3 C;  4JC7 A;  3QW0 A;  1TR2 A;  4JJF A;  1TWC A;  2XS1 A;  2Q00 A;  3MYF A;  3ASN C;  1TFO B;  1E86 A;  4OIP F;  2TMV P;  3O10 A;  2JX0 A;  3LLK A;  1SMY F;  1K04 A;  1CGO A;  2W4M A;  5KYW B;  4U5D E;  5FZT A;  2PX3 A;  1C02 A;  5L0I A;  4G7Z F;  3ATP A;  3RF3 A;  4AL0 A;  1BBH A;  4YT8 A;  3V5Y A;  3GEE A;  3T6G B;  1T01 A;  1FTS A;  2FGY A;  2WB7 A;  3AOU A;  5AC4 A;  5CI9 A;  3EGX B;  4E0I A;  4JCH A;  3PHF 2;  4CIH A;  1O87 A;  2DYS C;  4H4K C;  4FWV A;  5A6B D;  1HW2 A;  2G3V A;  2PF4 E;  3LUT B;  2YKZ A;  1BDJ B;  4MND A;  4MVU A;  4R32 A;  4CS8 C;  3IEE A;  3AGU A;  2L6H A;  1N1C A;  1RKC A;  3HJC A;  3NMK A;  2KC3 A;  4U5B E;  4I1O B;  2Q7R A;  1Z23 A;  3CSK A;  2ASR A;  2J46 A;  3EGD A;  3IQ5 A;  3CAX A;  3JSE O;  3QVZ A;  3SXM A;  1MNE A;  4B6I A;  1W2W A;  4OIQ F;  1U0B B;  4YL1 A;  3GM3 A;  3RQG A;  5F5F A;  1KU2 A;  2LP4 A;  5JSL A;  2YL3 A;  4NCQ A;  4WJ0 A;  5KYU A;  1Z63 A;  1ORJ A;  3S90 A;  4HE8 D;  2ICW G;  3AG3 C;  1WGW A; 
#chains in the Genus database with same CATH homology
 5DLJ A;  4KNV A;  2NUT B;  3TD7 A;  2IXM A;  5EHH A;  2E87 A;  4Q7C A;  4I3M A;  1ZYR F;  2DGJ A;  2KJG A;  4YT2 A;  2C04 A;  3EQL F;  4C3E A;  4OIN F;  3NKD A;  1VOM A;  3EGD B;  3T6B A;  2NUP A;  5E3C A;  2P6V A;  1LS1 A;  3UGP A;  3W8H A;  1QLE C;  5KYU B;  1V55 C;  4DBR A;  4YN0 B;  3JT1 A;  4C7O A;  1IW7 F;  4ANJ A;  2W45 A;  5KYY A;  1FFT C;  4PFP A;  4OD4 A;  4KNW A;  4AE4 A;  5D92 A;  4DBQ A;  3NKE A;  3JSZ A;  1JPJ A;  5FCL A;  1ZU4 A;  2JD3 A;  4LLE A;  3B0P A;  3N24 A;  2XL4 A;  2PX0 A;  4JW1 A;  3ASO C;  2VB6 A;  3OWT A;  4KC9 A;  4CSA C;  3WG7 C;  4OD5 A;  4C7O B;  2B0J A;  2C03 A;  4KI2 A;  2H7B A;  4OIO F;  2Q9B A;  4U5F E;  4U5C E;  5L3V A;  3K33 A;  4YJW A;  2J0X A;  2J7P A;  2XSE A;  3X1O A;  5B1B C;  3NRH A;  5L3Q A;  2R7R A;  3NG1 A;  2LSE A;  1VK5 A;  2J0W A;  3L34 A;  3N0T A;  4U5G A;  2Q9C A;  1NG1 A;  4N06 A;  1FFH A;  3I4U A;  2PFD A;  2ZPA A;  3AQB A;  5EGY A;  2OCC C;  1ZHX A;  2V26 A;  2R7T A;  2IXO A;  2Y3G A;  1MMA A;  3I5Q A;  1BR1 A;  4QI2 A;  4O6Y A;  3KL4 A;  2Q9A A;  2CDQ A;  3K7D A;  2R7V A;  3FDQ A;  3UNG C;  2W9Y A;  4CS8 A;  3F46 A;  3RYL A;  2EIJ C;  2J9W A;  3W2V A;  5KYN A;  1MMG A;  3K1H A;  3NYM A;  3EG9 A;  4FES A;  2PP4 A;  4O79 A;  4IWB A;  1NU7 D;  3EFO B;  4I1M A;  2ZXO A;  4QI0 A;  5DS5 A;  2WZF A;  3ZSU A;  2G3K A;  4LLC A;  2Z15 A;  3JRT A;  4O6M A;  1D1C A;  4EBB A;  2V3C C;  3ZVR A;  4XTK A;  2J9U A;  2H7V C;  3SEO A;  3KKB A;  1OKK D;  1M2V A;  3DAF A;  3RIP A;  5E33 A;  3DZA A;  3VYW A;  4I44 A;  3EG9 B;  2M4E A;  4G0H A;  2A6H F;  3SP1 A;  2KGO A;  5HSW A;  2XRH A;  2Y3B A;  3ZG1 A;  2XXA A;  1Z5Z A;  3F47 A;  3UGO A;  2A68 F;  4C3D A;  3O6X A;  1BR4 A;  1FMW A;  2NG1 A;  3DAG A;  2Q3T A;  1D0X A;  2R7U A;  1VMA A;  1Z3I X;  2EIN C;  4HFF B;  1NZE A;  2L81 A;  2WZL A;  1MMD A;  2WVQ A;  2ZXR A;  3ITF A;  5DQZ A;  1SF8 A;  2A69 F;  2FFH A;  3V7O A;  2J45 A;  3S27 A;  2Y69 C;  3LES A;  3LNR A;  2HV6 A;  4LER A;  3RH3 A;  1ST6 A;  1J8M F;  3W8I A;  4JUR I;  5T1D B;  3X2Q C;  1VYK A;  3S28 A;  3HTK C;  3MLG A;  2NUP B;  3POV A;  3LS1 A;  3E70 C;  4RD9 A;  3W2W A;  5E3A A;  1VYI A;  3VAY A;  2J9V A;  4BJ6 C;  2YHS A;  3M1C B;  4ZLD A;  5D91 A;  2IXN A;  1MND A;  4DOZ A;  4OIR F;  1RJ9 A;  2X51 A;  5DQT A;  1PD1 A;  5KYY B;  2OG2 A;  1S7Z A;  1M2O A;  1TWA A;  3LAY A;  2H7O A;  5CI8 A;  4AE4 B;  4EWC A;  4KBL A;  3FVY A;  3DM9 B;  3SYN A;  2IXP A;  3UMH A;  4P6I C;  2P7V A;  2Y39 A;  3PMR A;  3QZC A;  3UMK A;  2BE5 F;  4JVS A;  4LAC B;  3NYJ A;  4U5H A;  4G7O F;  4W8K A;  4DVZ A;  1QZX A;  2CW0 F;  4FX5 A;  3CZ6 A;  4A2N B;  1Z6A A;  4DVY P;  3DXJ F;  5DVW A;  5E2Q A;  3ECS A;  3Q7G A;  3UR3 C;  1D1B A;  1PD0 A;  4M63 A;  3JCU Q;  2A1D D;  5B3S C;  3ZIB A;  1TWG A;  2G62 A;  4MQ9 F;  1ZHZ A;  5T3W A;  3LS0 A;  2O9X A;  4CBE A;  2QY9 A;  3B0U X;  3B9Q A;  1LKX A;  2R7S A;  4BJ5 C;  1J8Y F;  2R7W A;  4X0R A;  5KYX A;  1D0Z A;  2L9J A;  1FMV A;  4C3B A;  4XLN F;  4CS9 C;  3Q6N A;  2VAS A;  1OCZ C;  3T4R A;  3ABM C;  5B1A C;  4QDL A;  3EJN A;  1OKK A;  2YZS A;  1LVK A;  4U5E E;  2W4B A;  4RBN A;  5KYX B;  3DMD A;  4GEH A;  4PJN A;  3Q7L A;  3FAJ A;  2NUT A;  2HV7 A;  3KMI A;  1NU9 C;  4K0D A;  1ZHY A;  4PJJ A;  4HFK B;  3CQZ A;  1M2V B;  3EH1 A;  3EZH A;  4BJ1 A;  1PCX A;  3ABL C;  3S0X A;  3EHM A;  4AK9 A;  1D1A A;  3Q6M A;  3EH2 A;  4J32 B;  3KH2 A;  4BJ6 A;  2XXA B;  4YT5 A;  4Q4Z F;  4CSA A;  3E9V A;  1ZHT A;  4O7G A;  1D0Y A;  3RKO F;  3L0I A;  3OEO A;  2WVN A;  4O6N A;  4IAO A;  4K7B A;  2WZG A;  3K1I C;  2EIM C;  3K6B A;  2R7X A;  4CS7 A;  1OCR C;  1OCC C;  3RFY A;  3WOD F;  3I5P A;  2GFH A;  2WL8 A;  4E7Z A;  2ZXP A;  4NY3 A;  3B0V C;  3MX3 A;  2R7O A;  4JZA A;  1ZU5 A;  3LLI A;  2QTV A;  4ZLC A;  4BJT A;  1TKN A;  2DYR C;  4PJL A;  3DJN B;  1G8X A;  3AQC A;  1TWH A;  1M56 C;  4F4B A;  3QMK A;  1BR2 A;  3DJU B;  4E7S A;  2EIK C;  3NYL A;  3EZI A;  2IOQ A;  1MMN A;  2CGE A;  4YWQ A;  5DS4 A;  5IY5 C;  2VH3 A;  1V54 C;  2WVO A;  2D5R B;  4XLP F;  4AX2 A;  4BEJ A;  2KQ9 A;  4BJ5 A;  3LJB A;  2EIL C;  1JPN A;  2Y3H A;  2ZXW C;  3AG4 C;  3DM5 A;  2CNW D;  2I8B A;  4PFO A;  4HEA J;  1RJ9 B;  3LEV A;  2J7P D;  3N2Z B;  2CNW A;  4CS9 A;  3UMI A;  4Q5S F;  2KNH A;  4RDA A;  3S29 A;  2Y3D A;  3O39 A;  2R7Q A;  3FHD A;  3GOD A;  4YT4 A;  3H65 A;  1O5H A;  5BUO A;  5T3T A;  1IZM A;  3AG2 C;  4GYT A;  4J30 B;  3SNH A;  4ULW A;  4PJM A;  3JYH A;  4G7H F;  3ABK C;  2IYL D;  4JJG A;  3T6J A;  3EPV A;  3ZC4 A;  1SZI A;  3DD7 A;  1M57 C;  3GAN A;  2A6E F;  1OCO C;  4IRU A;  3EFO A;  3AG1 C;  3EHN A;  3SZR A;  3OA1 A;  3HLZ A;  5KYW A;  5DS6 A;  4XWJ A;  5F5H A;  4IJJ A;  4BG0 A;  3NDB B;  4PK4 A;  2MYS A;  3EGX A;  3K66 A;  2MWQ A;  2YEV A;  1ZHW A;  2KW3 C;  1TR2 A;  4JJF A;  1TWC A;  3ASN C;  4OIP F;  3LLK A;  1SMY F;  2W4M A;  5KYW B;  4U5D E;  2PX3 A;  4G7Z F;  4YT8 A;  1FTS A;  2FGY A;  2WB7 A;  5CI9 A;  3EGX B;  4JCH A;  3PHF 2;  4CIH A;  1O87 A;  2DYS C;  4H4K C;  4FWV A;  2G3V A;  2PF4 E;  4CS8 C;  4MND A;  3IEE A;  1N1C A;  3HJC A;  4U5B E;  4I1O B;  1Z23 A;  3CSK A;  2J46 A;  3EGD A;  1MNE A;  4B6I A;  1W2W A;  4OIQ F;  5F5F A;  1KU2 A;  4WJ0 A;  5KYU A;  1Z63 A;  4HE8 D;  3AG3 C;  1WGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...