5GPGB

Co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
92
Chain Sequence
SILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Proximity-Directed Labeling Reveals a New Rapamycin-Induced Heterodimer of FKBP25 and FRB in Live Cells
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 92
sequence length 93
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 5gpgB00
2GAQA 1NSGB 2RSEB 4DRJB 4DRIB 2NPUA 4DRHB 5GPGB 3FAPB 1FAPB 1AUEA 2FAPB 4FAPB
chains in the Genus database with same CATH superfamily
2X0CA 2XL8A 3B0VC 1LPEA 3AQBA 4C7OA 4G78A 3U5SA 3AG3C 2W4MA 5KYYA 3HNLA 1LIHA 2IXOA 2ZD9A 4U5CE 2GA0A 3C8GD 2YL0A 1ZYRF 1EQ1A 2EILC 1OR3A 1R4TA 1FMVA 1VLTA 1EKYA 4PR9A 5F28E 2Q7RA 5AC5A 3B29A 4U9DA 1E86A 1XZPA 4IWBA 3RIPA 2WZGA 3B0UX 2FGYA 4ZLDA 1OR2A 4YJWA 3TULA 1OW6A 3OWTA 4JIOA 5L0IA 2RSEB 1TWGA 3X1OA 1LS4A 4EBBA 3J06A 2QNLA 3K6BA 4CDAA 2EIJC 3IQ5A 3DAFA 5T1DB 3RVYA 3ZIBA 1FAPB 4BEJA 4DJ9A 5K0IA 1E83A 2Y3GA 2XL4A 3VAYA 4MTFA 3Q6MA 1OCZC 2GWWA 4OIPF 3CEXA 4O79A 1H6GA 1QPUA 4MVUA 5HV9A 3LAYA 2ETSA 3LEVA 4AE4A 3PHF2 1BR4A 1E2XA 1NBBA 1YLMA 2WZLA 4BEMJ 3SXZA 4K1OA 3FMSA 4YK5A 1JPJA 2XL6A 1QQ3A 3HKKA 3JYYA 2LIGA 4E0HA 1JRAA 1OCOC 1KTMA 4IARA 3UGPA 1HY5A 5F5FA 1T01A 2YWAA 4O7GA 4WGZA 3JSEO 2ZPAA 1Q0KA 2XS1A 3DD7A 5KYUA 3K66A 2J46A 4EHPA 2XM4A 3AQCA 5L3QA 4XWJA 4YL3A 1NG1A 5COGA 5A6BA 2YZSA 2WZFA 1R5ID 4J32B 2G3VA 4F4BA 2E87A 4H54A 2Y39A 1OW7A 3DXJF 4DBRA 2UUHA 4JW1A 4HE8D 1VTMP 2R7VA 4JZAA 3ATPA 1RXQA 3LS0A 4J30B 1Q0MA 2J9WA 2EPKX 4U5BE 3EGXB 5DQTA 2PBEA 4JKVA 1OXBA 3NDBB 1CGNA 1EI7A 1MNEA 2YKZA 3WHNA 4PJMA 3PCVA 3VYWA 2IBFA 3GM3A 4IAOA 4U5HA 4N6HA 1D0XA 2BE5F 2R7QA 1D0YA 4E0IA 1FTSA 3SEOA 2YL3A 3SXKA 3RQFA 3CAXA 5KYWA 4MNDA 2OG2A 3QW0A 3H2UA 4DRHB 1I4YA 3HJCA 2P7VA 2PX3A 3C8GA 4YT5A 3V5YA 4N6CA 3ASNC 4WJ0A 2LCHA 3GODA 1M56C 2XLOA 4DOZA 1Q0GA 3GEEA 2VC9A 3NKDA 1A41A 2Q00A 1C03A 3CZ6A 5F5HA 4MVZA 1OKKD 2KK1A 3GM2A 4N06A 4CS9C 1EA8A 2J9UA 4MVOA 3EFOB 2XS8A 2MYSA 5L0CA 3T6JA 4KC9A 1YZCA 4A4AA 5B1AC 1TWHA 5KYXB 3C18A 1BZ4A 1ZHTA 2LP4A 2XSEA 3ZTZA 1IW7F 2A0BA 4MTOA 2NPUA 3FDQA 4JC7A 4CDYA 2HMQA 4LLCA 4MQ9F 4IJJA 2C04A 4LDRA 2YHSA 4O6MA 1CPRA 2W45A 5COMA 1KU2A 4AL1A 4K7BA 4P9TA 2XLHA 3K1IC 4IB4A 3DZAA 3WAQA 1O3UA 1VB5A 3O6XA 3VM6A 1T5OA 5AGFA 4DVZA 5E33A 4IAQA 5HSWA 4LLEA 4Q5SF 1O5HA 1Z3IX 4KNWA 1A7DA 2A1DD 3NYJA 3SYNA 4DRIB 3SP1A 2B0HA 3FOPA 4H4KC 3KH2A 2R7UA 3X2QC 2AWYA 4Z9HA 2OJQA 2WL8A 5DS5A 3V7OA 1V55C 4CS8A 5JT4A 1WASA 3FOOA 4DVYP 3HNKA 4MW3A 3UMKA 2CYDA 3RFYA 3POVA 2DYRC 3G50A 1CGOA 3RH3A 1L7CA 4MVQA 2MHRA 2Q9BA 1AVOB 4OD5A 2DGJA 4HFKB 4JRZA 4O6NA 5JSLA 1HE9A 3FXHA 4BG0A 2QY9A 1OCCC 1NFOA 2XLDA 2NG1A 1J8MF 2Z15A 4XLPF 4XEKA 4A2NB 3GM1A 2EPOA 4PFPA 4XEFA 1WWPA 4MTGA 4D4XA 2R02A 4HFFB 3DM9B 3IQ6A 3RQEA 3US6A 1APCA 3O55A 4MW8A 5E2QA 3K1HA 5TJ5E 3W2VA 4CIPA 2R7RA 1JMWA 1M2VA 1T6IA 2OU6A 2W4BA 1M6TA 4JCHA 2J0WA 2NUPA 3G4ZA 2XLEA 3AJMA 3B71A 2OKUA 1NU9C 3NG1A 3U9MA 2XLWA 4Q7CA 3TJ6A 2BC5A 3UMIA 2BL2A 3U8PA 4GYTA 4AX2A 1WTYA 2PP4A 3JRMO 4PJJA 1PV3A 2VH3A 2ASRA 3U2MA 3U9JA 3M4CA 3FAJA 2L6FA 3JSZA 3ITFA 1OKKA 1VYKA 4EKWA 2W9YA 3L1MA 4G7HF 3SZRA 4C3DA 1VMAA 4BJ6A 5CI8A 4I44A 5JVEA 4O6YA 4C3BA 1GS9A 4IRUA 5A6JA 4LDKA 3DKAA 1LI7A 4R32A 3F46A 1RKEA 2L6HA 3DM5A 1QZXA 3CQZA 3ZTMA 1XWJA 3EH2A 4LDQA 2J7PA 2R9RB 1Y4CA 3U3BA 2VCBA 3C8GB 4XEVA 3W4YA 5DVWA 2LFDA 4CJOA 1Q0FA 1G4US 1W2WA 5EHHA 3EGDB 4DBQA 1YYXA 1NZEA 4BJ5A 5L3VA 1ZVZA 2EPLX 2H7BA 2IOQA 1I4ZA 4P9FA 3T9OA 3S84A 2R25A 1Z63A 1C02A 3C63A 3K33A 3QVYA 5L0GA 2HJ3A 2YL7A 1TR2A 5BUOA 4G7ZF 1BR2A 2WB7A 1ZHWA 1XZQA 4KI2A 3QZCA 3U8VA 1AEPA 2R7OA 3O39A 3AOUA 4IGGA 3WG7C 4ER9A 2XXAA 1YVIA 2QTVA 2NUTB 3HNIA 1ZU4A 5L0FA 1Z7Qc 1M57C 2R7WA 1U0BB 1NU7D 3KPHA 2EPNA 1N1CA 3JZ0A 2Y3HA 3OA1A 3C7JA 4JVSA 4NTFA 2HS5A 1VOMA 1ZW2A 2EPMX 3RVZA 4CDVA 4E17A 3NMKA 3EQLF 4RDAA 5COFA 5JP7A 3I5QA 3KYJA 2GAQA 2YLIA 1SR2A 2X51A 2J8WA 4OIQF 2CCYA 4NY3A 3KKBA 3NYLA 4CSAA 2Q4FA 3IQTA 3I4UA 3W2WA 3FVYA 4YT2A 5L0JA 1K05A 2PNOA 2A69F 2WVOA 2ZXPA 4MVMA 3ZWIA 4BPMA 1FFTC 2IXNA 2LSEA 3AGTA 2KJGA 2AVKA 3HTKC 3O10A 2R7TA 3S90A 2QLAA 2J0XA 2OEVA 1H9TA 3V5ZA 4YT8A 1MNDA 1TWCA 5BQIA 2HKVA 1QSPA 2HV7A 4PFOA 3S28A 1C17M 4B6IA 2CNWD 2I15A 4KBLA 4L6RA 4YWQA 4ZLCA 1BBHA 1DOWA 2NSFA 3KL4A 1ZW3A 3EZIA 1K40A 1A7VA 4P6IC 3PDMP 3DMDA 2RD9A 1Z6AA 2B0JA 2G3KA 5FCLA 3MBGA 2UUIA 4C3EA 3TQOA 1YA9A 2L7AA 3UGOA 5DLJA 1M2OA 3H2VA 1F1MA 4EIYA 2P61A 4C7OB 5D92A 3SXYA 2O9XA 3EG9A 3ABKC 3MYFA 3E70C 5KYYB 2H8AA 4EBJA 1WGWA 4XPYA 4GQHA 5CI9A 4Q4ZF 5GPGB 1PD0A 3NKEA 3GANA 1NLXA 4JJGA 1S05A 4MVRA 3ZVRA 2JD3A 1CPQA 1G8XA 2R03A 4XPWA 2CDQA 2YEVA 2HSBA 3CSKA 3JTLO 4M63A 4NTBA 4U5DE 4Z9IA 4NCQA 2YVKA 3RQGA 1TWAA 4JJFA 2QE9A 3ZSUA 3IHUA 4W8PA 2R7SA 3EHNA 2L9JA 3T4RA 4YT4A 3RF3A 3KYIA 5JS5A 3EH1A 1GQAA 1JAFA 3KMIA 1OW8A 2XM0A 2IXPA 3B9QA 2HFIA 2XLVA 5EGYA 1V54C 2WVNA 3LUTB 4JE9A 1TFKB 1WATA 3NMIA 4AE4B 3QW1A 4NQFA 3AGUA 1RMVA 2L6GA 2GDCA 2P0NA 3VF0A 4EBKA 2XXAB 1OCRC 3GEIA 3HLZA 3QMKA 1NSGB 1ORSC 4CS7A 3BRJA 1YA7O 4CIHA 3N24A 2DB4A 2JPUA 1TKNA 3LLIA 3G4XA 1LKXA 2JX0A 1YYJA 5BQGA 3TJ5A 5KYUB 4G0HA 4LACB 1UFBA 3PMRA 3EHMA 3JT1A 2KW3C 2M4EA 2DI3A 2YQYA 3LNRA 1Z23A 1LVKA 1V74B 1HMOA 2PFDA 4QDLA 4XPXA 2CNWA 3C8ZA 4FAPB 1QLEC 3VRCA 1D1AA 2ICWG 5A6AA 1MMDA 4ULVA 2PX0A 3B0PA 1FMWA 4I3MA 2OOCA 5DS4A 3QTHA 2HUJA 3A9CA 3NYMA 4JCZA 1SYQA 2YLDA 1TFOB 1JOGA 2ZXRA 3UR3C 1LE4A 3W8HA 1ZHXA 2WVQA 1AUEA 1LE2A 1CGME 2EINC 3E9VA 1A0BA 4I1OB 5KYWB 3S9OA 5B3SC 1DOVA 2HSQA 5L0HA 4DXWA 3N2ZB 1WOLA 5KYXA 1LS1A 2LD6A 2LFFA 3S0XA 4CS9A 2TMVP 4YL1A 2V3CC 1JR8A 1BDJB 3ECSA 3S27A 3IQCA 3K7DA 3FAPB 2MWQA 5CIVA 1FR0A 3RKOF 4DRJB 5JLIA 2P1AA 1ZHZA 2HMZA 3AG2C 1YARO 3T6GB 2PF4E 3WODF 2VB6A 4X0RA 2FAPB 3IPMO 1Y6DA 2OQMA 3JYHA 2KQ9A 5A69A 1Q0DA 2IM8A 1ZHYA 4BJTA 3EG9B 1S7ZA 4ULWA 5B3IA 5L0DA 1A7EA 2D4UA 1D1CA 1RKCA 2G62A 3JRTA 3K1IA 1LM3B 1GGQA 1B68A 2A0UA 3GEHA 3GWLA 3RW0A 3AG1C 4GEHA 3SNHA 1V4AA 2Q9CA 4PACA 4PK4A 2CW0F 3EZHA 3AG4C 3ABLC 1VYIA 1SF8A 5T3TA 1G4WR 2AP3A 3L8IA 2Y69C 4CS8C 1E85A 3LNMB 4RBNA 1T6QA 3ZC4A 3MX3A 3JCUQ 1ST6A 4MS2A 5DQZA 1SMYF 3HNJA 4AK9A 2J45A 5D91A 1MQVA 2M64A 1RJ9A 3GORA 4QI0A 2HZ8A 2IYLD 4OINF 3OEOA 4FWVA 5JRAA 1H7IA 2XLMA 3C62A 3F47A 3MLGA 1GM5A 2R7XA 1T9KA 5E3CA 2DYSC 2EIMC 4U5GA 5JUAA 3TOLA 1U89A 2VCCA 3DJUB 4CJGA 3H65A 3ZQYA 4E18A 2Y3DA 3R2PA 1O87A 3Q7LA 1E84A 1IZMA 1LI5A 3IEEA 2ZXWC 4JTDB 4YN0B 1FNTc 2KC3A 2NSGA 1PD1A 1RCPA 3FHDA 3TOMA 4XQ1A 1HMDA 3I5PA 3DE8A 3ASOC 3QVZA 1M2VB 4J7YA 2NUPB 3ZQVA 1HW1A 1SZIA 3NRHA 3DAGA 4J7TA 4FESA 1TQGA 3LESA 4XLNF 2VCAA 4E7SA 1OQCA 1T6UA 4YL0A 4AL0A 4BJ6C 1NFNA 2A6HF 2KYHA 2OJED 2OCCC 5IY5C 2A68F 3MYIA 3TD7A 4G7OF 2FFHA 5T3WA 3L34A 1VK5A 4JEAA 4LERA 4RD9A 4E7ZA 3SXMA 3DE9A 2V26A 4ONSA 4MVSA 3T6BA 2H7OA 3EGDA 2KGOA 1L3PA 2D5RB 3LLKA 4N4WA 3GWNA 1WN0A 2Q3TA 1RKEB 4JURI 1K04A 1MMNA 4U5FE 5E3AA 3EPVA 4BJ5C 2H7VC 5BQHA 3U2LA 1UG7A 3EJNA 4OIRF 1D0ZA 1G5ZA 2LK4A 3LJBA 4HEAJ 3UMHA 1YZAA 4FX5A 2OEXA 3DI5A 3M79A 4JTCB 1D1BA 1U6HA 5A6KA 2NUTA 3R7CA 5DS6A 2J7PD 4OD4A 3L0IA 2KSFA 2CGEA 1J8YF 1HW2A 1ORYA 3UNGC 4EWCA 5FZTA 2J9VA 3DWWA 2F22A 3Q6NA 4KNVA 4W8KA 2LQGA 1H9GA 3TK0A 256BA 3NMJA 1QVXA 2A6EF 2XRHA 3V5XA 2AWCA 1HE1A 1QKRA 2L81A 3Q7GA 4NTAA 4PJNA 2KNHA 3L8JA 2YLGA 3LS1A 4I1MA 1FFHA 1ORJA 1I5NA 2R05A 4NC3A 3W8IA 5EK0A 2GFHA 2C03A 2Q9AA 3EGXA 3ZDLA 2YL1A 2Y3BA 3LEOA 4CSAC 1BR1A 2AU5A 4U9EA 1MMGA 1YAUO 2HV6A 3M15A 3ABMC 4Z9JA 1YDIA 4OIOF 1OXKA 3M4BA 3MFNA 3M1CB 3N0TA 3S29A 3ZG1A 2VASA 5A6BD 3U0CA 4QI2A 2J9BA 4JTAB 1RJ9B 3DJNB 1MMAA 1ZZPA 1JPNA 2IXMA 1PCXA 4PJLA 2YRFA 3U3FA 4CBEA 1ZU5A 5AC4A 4WGYA 2ZXOA 1VLSA 4WABA 1KNYA 4U5EE 4ANJA 5B1BC 4CX9A 4D4NA 4UDVA 5KYNA 1YJGA 2HJMA 1Z5ZA 2P6VA 4K0DA 4JEBA 2EIKC 2QUPA 2I8BA 4XTKA 4EUKB 3RYLA 3EFOA 3A11A 3BEHA 4BJ1A
chains in the Genus database with same CATH topology
2GAQA 1NSGB 2RSEB 4DRJB 4DRIB 2NPUA 4DRHB 5GPGB 3FAPB 1FAPB 1AUEA 2FAPB 4FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAQ A;  1NSG B;  2RSE B;  4DRJ B;  4DRI B;  2NPU A;  4DRH B;  5GPG B;  3FAP B;  1FAP B;  1AUE A;  2FAP B;  4FAP B; 
#chains in the Genus database with same CATH topology
 2X0C A;  2XL8 A;  3B0V C;  1LPE A;  3AQB A;  4C7O A;  4G78 A;  3U5S A;  3AG3 C;  2W4M A;  5KYY A;  3HNL A;  1LIH A;  2IXO A;  2ZD9 A;  4U5C E;  2GA0 A;  3C8G D;  2YL0 A;  1ZYR F;  1EQ1 A;  2EIL C;  1OR3 A;  1R4T A;  1FMV A;  1VLT A;  1EKY A;  4PR9 A;  5F28 E;  2Q7R A;  5AC5 A;  3B29 A;  4U9D A;  1E86 A;  1XZP A;  4IWB A;  3RIP A;  2WZG A;  3B0U X;  2FGY A;  4ZLD A;  1OR2 A;  4YJW A;  3TUL A;  1OW6 A;  3OWT A;  4JIO A;  5L0I A;  2RSE B;  1TWG A;  3X1O A;  1LS4 A;  4EBB A;  3J06 A;  2QNL A;  3K6B A;  4CDA A;  2EIJ C;  3IQ5 A;  3DAF A;  5T1D B;  3RVY A;  3ZIB A;  1FAP B;  4BEJ A;  4DJ9 A;  5K0I A;  1E83 A;  2Y3G A;  2XL4 A;  3VAY A;  4MTF A;  3Q6M A;  1OCZ C;  2GWW A;  4OIP F;  3CEX A;  4O79 A;  1H6G A;  1QPU A;  4MVU A;  5HV9 A;  3LAY A;  2ETS A;  3LEV A;  4AE4 A;  3PHF 2;  1BR4 A;  1E2X A;  1NBB A;  1YLM A;  2WZL A;  4BEM J;  3SXZ A;  4K1O A;  3FMS A;  4YK5 A;  1JPJ A;  2XL6 A;  1QQ3 A;  3HKK A;  3JYY A;  2LIG A;  4E0H A;  1JRA A;  1OCO C;  1KTM A;  4IAR A;  3UGP A;  1HY5 A;  5F5F A;  1T01 A;  2YWA A;  4O7G A;  4WGZ A;  3JSE O;  2ZPA A;  1Q0K A;  2XS1 A;  3DD7 A;  5KYU A;  3K66 A;  2J46 A;  4EHP A;  2XM4 A;  3AQC A;  5L3Q A;  4XWJ A;  4YL3 A;  1NG1 A;  5COG A;  5A6B A;  2YZS A;  2WZF A;  1R5I D;  4J32 B;  2G3V A;  4F4B A;  2E87 A;  4H54 A;  2Y39 A;  1OW7 A;  3DXJ F;  4DBR A;  2UUH A;  4JW1 A;  4HE8 D;  1VTM P;  2R7V A;  4JZA A;  3ATP A;  1RXQ A;  3LS0 A;  4J30 B;  1Q0M A;  2J9W A;  2EPK X;  4U5B E;  3EGX B;  5DQT A;  2PBE A;  4JKV A;  1OXB A;  3NDB B;  1CGN A;  1EI7 A;  1MNE A;  2YKZ A;  3WHN A;  4PJM A;  3PCV A;  3VYW A;  2IBF A;  3GM3 A;  4IAO A;  4U5H A;  4N6H A;  1D0X A;  2BE5 F;  2R7Q A;  1D0Y A;  4E0I A;  1FTS A;  3SEO A;  2YL3 A;  3SXK A;  3RQF A;  3CAX A;  5KYW A;  4MND A;  2OG2 A;  3QW0 A;  3H2U A;  4DRH B;  1I4Y A;  3HJC A;  2P7V A;  2PX3 A;  3C8G A;  4YT5 A;  3V5Y A;  4N6C A;  3ASN C;  4WJ0 A;  2LCH A;  3GOD A;  1M56 C;  2XLO A;  4DOZ A;  1Q0G A;  3GEE A;  2VC9 A;  3NKD A;  1A41 A;  2Q00 A;  1C03 A;  3CZ6 A;  5F5H A;  4MVZ A;  1OKK D;  2KK1 A;  3GM2 A;  4N06 A;  4CS9 C;  1EA8 A;  2J9U A;  4MVO A;  3EFO B;  2XS8 A;  2MYS A;  5L0C A;  3T6J A;  4KC9 A;  1YZC A;  4A4A A;  5B1A C;  1TWH A;  5KYX B;  3C18 A;  1BZ4 A;  1ZHT A;  2LP4 A;  2XSE A;  3ZTZ A;  1IW7 F;  2A0B A;  4MTO A;  2NPU A;  3FDQ A;  4JC7 A;  4CDY A;  2HMQ A;  4LLC A;  4MQ9 F;  4IJJ A;  2C04 A;  4LDR A;  2YHS A;  4O6M A;  1CPR A;  2W45 A;  5COM A;  1KU2 A;  4AL1 A;  4K7B A;  4P9T A;  2XLH A;  3K1I C;  4IB4 A;  3DZA A;  3WAQ A;  1O3U A;  1VB5 A;  3O6X A;  3VM6 A;  1T5O A;  5AGF A;  4DVZ A;  5E33 A;  4IAQ A;  5HSW A;  4LLE A;  4Q5S F;  1O5H A;  1Z3I X;  4KNW A;  1A7D A;  2A1D D;  3NYJ A;  3SYN A;  4DRI B;  3SP1 A;  2B0H A;  3FOP A;  4H4K C;  3KH2 A;  2R7U A;  3X2Q C;  2AWY A;  4Z9H A;  2OJQ A;  2WL8 A;  5DS5 A;  3V7O A;  1V55 C;  4CS8 A;  5JT4 A;  1WAS A;  3FOO A;  4DVY P;  3HNK A;  4MW3 A;  3UMK A;  2CYD A;  3RFY A;  3POV A;  2DYR C;  3G50 A;  1CGO A;  3RH3 A;  1L7C A;  4MVQ A;  2MHR A;  2Q9B A;  1AVO B;  4OD5 A;  2DGJ A;  4HFK B;  4JRZ A;  4O6N A;  5JSL A;  1HE9 A;  3FXH A;  4BG0 A;  2QY9 A;  1OCC C;  1NFO A;  2XLD A;  2NG1 A;  1J8M F;  2Z15 A;  4XLP F;  4XEK A;  4A2N B;  3GM1 A;  2EPO A;  4PFP A;  4XEF A;  1WWP A;  4MTG A;  4D4X A;  2R02 A;  4HFF B;  3DM9 B;  3IQ6 A;  3RQE A;  3US6 A;  1APC A;  3O55 A;  4MW8 A;  5E2Q A;  3K1H A;  5TJ5 E;  3W2V A;  4CIP A;  2R7R A;  1JMW A;  1M2V A;  1T6I A;  2OU6 A;  2W4B A;  1M6T A;  4JCH A;  2J0W A;  2NUP A;  3G4Z A;  2XLE A;  3AJM A;  3B71 A;  2OKU A;  1NU9 C;  3NG1 A;  3U9M A;  2XLW A;  4Q7C A;  3TJ6 A;  2BC5 A;  3UMI A;  2BL2 A;  3U8P A;  4GYT A;  4AX2 A;  1WTY A;  2PP4 A;  3JRM O;  4PJJ A;  1PV3 A;  2VH3 A;  2ASR A;  3U2M A;  3U9J A;  3M4C A;  3FAJ A;  2L6F A;  3JSZ A;  3ITF A;  1OKK A;  1VYK A;  4EKW A;  2W9Y A;  3L1M A;  4G7H F;  3SZR A;  4C3D A;  1VMA A;  4BJ6 A;  5CI8 A;  4I44 A;  5JVE A;  4O6Y A;  4C3B A;  1GS9 A;  4IRU A;  5A6J A;  4LDK A;  3DKA A;  1LI7 A;  4R32 A;  3F46 A;  1RKE A;  2L6H A;  3DM5 A;  1QZX A;  3CQZ A;  3ZTM A;  1XWJ A;  3EH2 A;  4LDQ A;  2J7P A;  2R9R B;  1Y4C A;  3U3B A;  2VCB A;  3C8G B;  4XEV A;  3W4Y A;  5DVW A;  2LFD A;  4CJO A;  1Q0F A;  1G4U S;  1W2W A;  5EHH A;  3EGD B;  4DBQ A;  1YYX A;  1NZE A;  4BJ5 A;  5L3V A;  1ZVZ A;  2EPL X;  2H7B A;  2IOQ A;  1I4Z A;  4P9F A;  3T9O A;  3S84 A;  2R25 A;  1Z63 A;  1C02 A;  3C63 A;  3K33 A;  3QVY A;  5L0G A;  2HJ3 A;  2YL7 A;  1TR2 A;  5BUO A;  4G7Z F;  1BR2 A;  2WB7 A;  1ZHW A;  1XZQ A;  4KI2 A;  3QZC A;  3U8V A;  1AEP A;  2R7O A;  3O39 A;  3AOU A;  4IGG A;  3WG7 C;  4ER9 A;  2XXA A;  1YVI A;  2QTV A;  2NUT B;  3HNI A;  1ZU4 A;  5L0F A;  1Z7Q c;  1M57 C;  2R7W A;  1U0B B;  1NU7 D;  3KPH A;  2EPN A;  1N1C A;  3JZ0 A;  2Y3H A;  3OA1 A;  3C7J A;  4JVS A;  4NTF A;  2HS5 A;  1VOM A;  1ZW2 A;  2EPM X;  3RVZ A;  4CDV A;  4E17 A;  3NMK A;  3EQL F;  4RDA A;  5COF A;  5JP7 A;  3I5Q A;  3KYJ A;  2GAQ A;  2YLI A;  1SR2 A;  2X51 A;  2J8W A;  4OIQ F;  2CCY A;  4NY3 A;  3KKB A;  3NYL A;  4CSA A;  2Q4F A;  3IQT A;  3I4U A;  3W2W A;  3FVY A;  4YT2 A;  5L0J A;  1K05 A;  2PNO A;  2A69 F;  2WVO A;  2ZXP A;  4MVM A;  3ZWI A;  4BPM A;  1FFT C;  2IXN A;  2LSE A;  3AGT A;  2KJG A;  2AVK A;  3HTK C;  3O10 A;  2R7T A;  3S90 A;  2QLA A;  2J0X A;  2OEV A;  1H9T A;  3V5Z A;  4YT8 A;  1MND A;  1TWC A;  5BQI A;  2HKV A;  1QSP A;  2HV7 A;  4PFO A;  3S28 A;  1C17 M;  4B6I A;  2CNW D;  2I15 A;  4KBL A;  4L6R A;  4YWQ A;  4ZLC A;  1BBH A;  1DOW A;  2NSF A;  3KL4 A;  1ZW3 A;  3EZI A;  1K40 A;  1A7V A;  4P6I C;  3PDM P;  3DMD A;  2RD9 A;  1Z6A A;  2B0J A;  2G3K A;  5FCL A;  3MBG A;  2UUI A;  4C3E A;  3TQO A;  1YA9 A;  2L7A A;  3UGO A;  5DLJ A;  1M2O A;  3H2V A;  1F1M A;  4EIY A;  2P61 A;  4C7O B;  5D92 A;  3SXY A;  2O9X A;  3EG9 A;  3ABK C;  3MYF A;  3E70 C;  5KYY B;  2H8A A;  4EBJ A;  1WGW A;  4XPY A;  4GQH A;  5CI9 A;  4Q4Z F;  5GPG B;  1PD0 A;  3NKE A;  3GAN A;  1NLX A;  4JJG A;  1S05 A;  4MVR A;  3ZVR A;  2JD3 A;  1CPQ A;  1G8X A;  2R03 A;  4XPW A;  2CDQ A;  2YEV A;  2HSB A;  3CSK A;  3JTL O;  4M63 A;  4NTB A;  4U5D E;  4Z9I A;  4NCQ A;  2YVK A;  3RQG A;  1TWA A;  4JJF A;  2QE9 A;  3ZSU A;  3IHU A;  4W8P A;  2R7S A;  3EHN A;  2L9J A;  3T4R A;  4YT4 A;  3RF3 A;  3KYI A;  5JS5 A;  3EH1 A;  1GQA A;  1JAF A;  3KMI A;  1OW8 A;  2XM0 A;  2IXP A;  3B9Q A;  2HFI A;  2XLV A;  5EGY A;  1V54 C;  2WVN A;  3LUT B;  4JE9 A;  1TFK B;  1WAT A;  3NMI A;  4AE4 B;  3QW1 A;  4NQF A;  3AGU A;  1RMV A;  2L6G A;  2GDC A;  2P0N A;  3VF0 A;  4EBK A;  2XXA B;  1OCR C;  3GEI A;  3HLZ A;  3QMK A;  1NSG B;  1ORS C;  4CS7 A;  3BRJ A;  1YA7 O;  4CIH A;  3N24 A;  2DB4 A;  2JPU A;  1TKN A;  3LLI A;  3G4X A;  1LKX A;  2JX0 A;  1YYJ A;  5BQG A;  3TJ5 A;  5KYU B;  4G0H A;  4LAC B;  1UFB A;  3PMR A;  3EHM A;  3JT1 A;  2KW3 C;  2M4E A;  2DI3 A;  2YQY A;  3LNR A;  1Z23 A;  1LVK A;  1V74 B;  1HMO A;  2PFD A;  4QDL A;  4XPX A;  2CNW A;  3C8Z A;  4FAP B;  1QLE C;  3VRC A;  1D1A A;  2ICW G;  5A6A A;  1MMD A;  4ULV A;  2PX0 A;  3B0P A;  1FMW A;  4I3M A;  2OOC A;  5DS4 A;  3QTH A;  2HUJ A;  3A9C A;  3NYM A;  4JCZ A;  1SYQ A;  2YLD A;  1TFO B;  1JOG A;  2ZXR A;  3UR3 C;  1LE4 A;  3W8H A;  1ZHX A;  2WVQ A;  1AUE A;  1LE2 A;  1CGM E;  2EIN C;  3E9V A;  1A0B A;  4I1O B;  5KYW B;  3S9O A;  5B3S C;  1DOV A;  2HSQ A;  5L0H A;  4DXW A;  3N2Z B;  1WOL A;  5KYX A;  1LS1 A;  2LD6 A;  2LFF A;  3S0X A;  4CS9 A;  2TMV P;  4YL1 A;  2V3C C;  1JR8 A;  1BDJ B;  3ECS A;  3S27 A;  3IQC A;  3K7D A;  3FAP B;  2MWQ A;  5CIV A;  1FR0 A;  3RKO F;  4DRJ B;  5JLI A;  2P1A A;  1ZHZ A;  2HMZ A;  3AG2 C;  1YAR O;  3T6G B;  2PF4 E;  3WOD F;  2VB6 A;  4X0R A;  2FAP B;  3IPM O;  1Y6D A;  2OQM A;  3JYH A;  2KQ9 A;  5A69 A;  1Q0D A;  2IM8 A;  1ZHY A;  4BJT A;  3EG9 B;  1S7Z A;  4ULW A;  5B3I A;  5L0D A;  1A7E A;  2D4U A;  1D1C A;  1RKC A;  2G62 A;  3JRT A;  3K1I A;  1LM3 B;  1GGQ A;  1B68 A;  2A0U A;  3GEH A;  3GWL A;  3RW0 A;  3AG1 C;  4GEH A;  3SNH A;  1V4A A;  2Q9C A;  4PAC A;  4PK4 A;  2CW0 F;  3EZH A;  3AG4 C;  3ABL C;  1VYI A;  1SF8 A;  5T3T A;  1G4W R;  2AP3 A;  3L8I A;  2Y69 C;  4CS8 C;  1E85 A;  3LNM B;  4RBN A;  1T6Q A;  3ZC4 A;  3MX3 A;  3JCU Q;  1ST6 A;  4MS2 A;  5DQZ A;  1SMY F;  3HNJ A;  4AK9 A;  2J45 A;  5D91 A;  1MQV A;  2M64 A;  1RJ9 A;  3GOR A;  4QI0 A;  2HZ8 A;  2IYL D;  4OIN F;  3OEO A;  4FWV A;  5JRA A;  1H7I A;  2XLM A;  3C62 A;  3F47 A;  3MLG A;  1GM5 A;  2R7X A;  1T9K A;  5E3C A;  2DYS C;  2EIM C;  4U5G A;  5JUA A;  3TOL A;  1U89 A;  2VCC A;  3DJU B;  4CJG A;  3H65 A;  3ZQY A;  4E18 A;  2Y3D A;  3R2P A;  1O87 A;  3Q7L A;  1E84 A;  1IZM A;  1LI5 A;  3IEE A;  2ZXW C;  4JTD B;  4YN0 B;  1FNT c;  2KC3 A;  2NSG A;  1PD1 A;  1RCP A;  3FHD A;  3TOM A;  4XQ1 A;  1HMD A;  3I5P A;  3DE8 A;  3ASO C;  3QVZ A;  1M2V B;  4J7Y A;  2NUP B;  3ZQV A;  1HW1 A;  1SZI A;  3NRH A;  3DAG A;  4J7T A;  4FES A;  1TQG A;  3LES A;  4XLN F;  2VCA A;  4E7S A;  1OQC A;  1T6U A;  4YL0 A;  4AL0 A;  4BJ6 C;  1NFN A;  2A6H F;  2KYH A;  2OJE D;  2OCC C;  5IY5 C;  2A68 F;  3MYI A;  3TD7 A;  4G7O F;  2FFH A;  5T3W A;  3L34 A;  1VK5 A;  4JEA A;  4LER A;  4RD9 A;  4E7Z A;  3SXM A;  3DE9 A;  2V26 A;  4ONS A;  4MVS A;  3T6B A;  2H7O A;  3EGD A;  2KGO A;  1L3P A;  2D5R B;  3LLK A;  4N4W A;  3GWN A;  1WN0 A;  2Q3T A;  1RKE B;  4JUR I;  1K04 A;  1MMN A;  4U5F E;  5E3A A;  3EPV A;  4BJ5 C;  2H7V C;  5BQH A;  3U2L A;  1UG7 A;  3EJN A;  4OIR F;  1D0Z A;  1G5Z A;  2LK4 A;  3LJB A;  4HEA J;  3UMH A;  1YZA A;  4FX5 A;  2OEX A;  3DI5 A;  3M79 A;  4JTC B;  1D1B A;  1U6H A;  5A6K A;  2NUT A;  3R7C A;  5DS6 A;  2J7P D;  4OD4 A;  3L0I A;  2KSF A;  2CGE A;  1J8Y F;  1HW2 A;  1ORY A;  3UNG C;  4EWC A;  5FZT A;  2J9V A;  3DWW A;  2F22 A;  3Q6N A;  4KNV A;  4W8K A;  2LQG A;  1H9G A;  3TK0 A;  256B A;  3NMJ A;  1QVX A;  2A6E F;  2XRH A;  3V5X A;  2AWC A;  1HE1 A;  1QKR A;  2L81 A;  3Q7G A;  4NTA A;  4PJN A;  2KNH A;  3L8J A;  2YLG A;  3LS1 A;  4I1M A;  1FFH A;  1ORJ A;  1I5N A;  2R05 A;  4NC3 A;  3W8I A;  5EK0 A;  2GFH A;  2C03 A;  2Q9A A;  3EGX A;  3ZDL A;  2YL1 A;  2Y3B A;  3LEO A;  4CSA C;  1BR1 A;  2AU5 A;  4U9E A;  1MMG A;  1YAU O;  2HV6 A;  3M15 A;  3ABM C;  4Z9J A;  1YDI A;  4OIO F;  1OXK A;  3M4B A;  3MFN A;  3M1C B;  3N0T A;  3S29 A;  3ZG1 A;  2VAS A;  5A6B D;  3U0C A;  4QI2 A;  2J9B A;  4JTA B;  1RJ9 B;  3DJN B;  1MMA A;  1ZZP A;  1JPN A;  2IXM A;  1PCX A;  4PJL A;  2YRF A;  3U3F A;  4CBE A;  1ZU5 A;  5AC4 A;  4WGY A;  2ZXO A;  1VLS A;  4WAB A;  1KNY A;  4U5E E;  4ANJ A;  5B1B C;  4CX9 A;  4D4N A;  4UDV A;  5KYN A;  1YJG A;  2HJM A;  1Z5Z A;  2P6V A;  4K0D A;  4JEB A;  2EIK C;  2QUP A;  2I8B A;  4XTK A;  4EUK B;  3RYL A;  3EFO A;  3A11 A;  3BEH A;  4BJ1 A; 
#chains in the Genus database with same CATH homology
 2GAQ A;  1NSG B;  2RSE B;  4DRJ B;  4DRI B;  2NPU A;  4DRH B;  5GPG B;  3FAP B;  1FAP B;  1AUE A;  2FAP B;  4FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...