5GPGB

Co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
92
Chain Sequence
b'SILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWRKYMKSGNVKDLTQAWDLYYHVFRRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Proximity-Directed Labeling Reveals a New Rapamycin-Induced Heterodimer of FKBP25 and FRB in Live Cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 35
structure length 92
sequence length 93
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 5gpgB00
4FAPB 2FAPB 4DRIB 2GAQA 2RSEB 1FAPB 4DRJB 2NPUA 1NSGB 1AUEA 3FAPB 4DRHB 5GPGB
chains in the Genus database with same CATH superfamily
5L0CA 2EILC 4WGZA 3IPMO 4HFKB 2J9VA 1RCPA 2R7TA 3GANA 3AG2C 3K1IA 2WZGA 3FDQA 5JT4A 3IQCA 1NBBA 3AJMA 1HW1A 2WL8A 4MVUA 1M57C 2LQGA 2Q9BA 3C18A 3DE9A 4PJMA 2W9YA 5EK0A 4C3EA 5L0DA 5A6BA 3ZDLA 1T6UA 3HKKA 4JVSA 4U5FE 1HMDA 2IXPA 2JD3A 3EJNA 3PHF2 2WVQA 3RQGA 1APCA 2D5RB 1ZHTA 5E2QA 3TOLA 1FNTc 2TMVP 3GM1A 1OKKD 3DM5A 2J9BA 2HS5A 4I1OB 2RD9A 4DJ9A 5AC5A 3DE8A 1MMAA 4MVZA 4DRIB 5A69A 5FCLA 3AGUA 1H7IA 2YL1A 5D92A 2OKUA 2X51A 3I4UA 4GQHA 2BL2A 4Z9IA 2PP4A 3ZTZA 4AE4B 2YLDA 2XL4A 3FAJA 2AU5A 4AL1A 3SZRA 5EGYA 1OW7A 2XLHA 2Z15A 1WOLA 4O6NA 4CS8C 3TJ5A 4LDQA 3GODA 3RQFA 5KYYB 3KMIA 2J7PD 1FAPB 3DXJF 2J8WA 3T6GB 4D4NA 1JOGA 3MYIA 1Z7Qc 2KNHA 2OU6A 4U5HA 3W4YA 2CCYA 2DB4A 2NUTB 1A0BA 4Q4ZF 4WABA 1KU2A 4YT5A 2LK4A 3C8GA 3B0UX 3A9CA 3DWWA 1YLMA 4IAOA 3RF3A 4EBJA 4OINF 4BJ5A 4MNDA 3HNJA 1ZHXA 4U5BE 3DJUB 4BPMA 2M64A 1Y6DA 1TWAA 2J9WA 1RMVA 4C7OA 1AEPA 3EGXB 2VH3A 4YT4A 4L6RA 4CS9C 3DKAA 4N6CA 3EH2A 1ZHYA 3UGPA 1M6TA 2MWQA 1HE9A 4EWCA 4A2NB 1JMWA 1R5ID 3EFOA 2EPNA 1SR2A 3GEEA 4BJTA 2VASA 2XLVA 2A6EF 1FMVA 5E3CA 3EPVA 1RJ9B 2NG1A 4E0IA 1OR2A 3HNLA 2YLGA 4BJ1A 1KTMA 2LCHA 2A0BA 2HUJA 1RKEA 1O3UA 1T9KA 3NMKA 4Q5SF 4ULVA 3ZTMA 2NPUA 2J9UA 2ASRA 1MMNA 2YRFA 2VCCA 3QVZA 3IQTA 3M4CA 3S84A 1HY5A 1ZZPA 2HJ3A 3R2PA 4EKWA 5D91A 4IARA 2RSEB 2C03A 3FOPA 1FFHA 4CIHA 2R7VA 2OJED 4E18A 4ER9A 1FFTC 3LS1A 3V5XA 1H9TA 3A11A 3MYFA 2KW3C 3ECSA 5CI8A 2EIMC 4HFFB 3S29A 2HJMA 2OEVA 3S28A 2YLIA 1D1CA 2KYHA 2OQMA 3DD7A 3PDMP 2V3CC 1OCOC 3KYIA 4BJ6A 3B29A 4ZLDA 2XXAA 3M4BA 1EKYA 1YVIA 2MHRA 2R25A 5A6BD 1Z63A 3JYHA 5TJ5E 3AOUA 4CSAA 1O5HA 3VAYA 3LEVA 3DJNB 1R4TA 1YJGA 4XEVA 3RVZA 3V7OA 3TJ6A 4K0DA 4DXWA 2R03A 1TFKB 3IQ5A 4JURI 4BEJA 3HNKA 4YL1A 3H65A 5KYNA 2HSQA 4XQ1A 1T5OA 2R02A 4NY3A 3I5PA 1GQAA 1NZEA 2XLMA 4G78A 5E3AA 3BEHA 2P0NA 4E17A 1QQ3A 2Y3GA 2L7AA 5B1AC 5JP7A 2ZXOA 1GM5A 1PD0A 3IHUA 3Q7LA 3TD7A 2ZD9A 3F46A 3RYLA 2IXNA 1Y4CA 1AUEA 1ST6A 2WVNA 2XM0A 2H7BA 5KYXB 3RFYA 2OOCA 5F5FA 2WZFA 4YT8A 3QMKA 3LESA 5KYWA 3KL4A 2P61A 3T6JA 3C8GD 1NU9C 5CI9A 3O6XA 2LSEA 3B9QA 3HLZA 4O6MA 5JRAA 2O9XA 3X2QC 4PJJA 3ABMC 4U5DE 3FOOA 4JCHA 3TOMA 1V54C 3VF0A 5HV9A 1D1BA 3NMJA 3K7DA 3SNHA 4N6HA 3JTLO 1BDJB 1TWHA 4LERA 1LVKA 2E87A 4AL0A 4B6IA 1A7DA 2CDQA 256BA 2G3VA 1M2VA 3KKBA 4K7BA 2BC5A 2GFHA 4ONSA 3ITFA 3RH3A 3LLKA 4RD9A 1S05A 1BBHA 3L8IA 1EA8A 3GM3A 3K1IC 4PK4A 4ZLCA 4XEFA 2ZXWC 3PMRA 4NCQA 2KC3A 3EG9A 3NKDA 1W2WA 1ZHZA 2XLDA 4XPYA 1BR2A 1V55C 2EPKX 1VYKA 3UR3C 3L34A 3V5ZA 5A6JA 2W4BA 4JC7A 2IXOA 4MVQA 1QZXA 4E7ZA 4NTFA 4JJFA 3MFNA 2MYSA 4Z9HA 3SYNA 1ZYRF 1CPRA 2IXMA 4YL3A 1ZU4A 1Z23A 1PCXA 1ZW3A 5KYUB 5DS5A 1A7VA 1WGWA 1MMDA 1WWPA 3S9OA 3S90A 4U5CE 2UUIA 4IB4A 3ZSUA 5L0FA 2FAPB 2DYSC 2A1DD 4MS2A 2Y3DA 3EGDB 3IQ6A 3N0TA 1QKRA 4Z9JA 3U5SA 2R7XA 3T9OA 1Q0DA 2M4EA 2XL6A 1VLTA 2Y39A 2YL0A 3EZHA 5T3WA 4DVYP 3EZIA 4MTFA 3NDBB 1YA9A 1G4WR 3O10A 4O79A 3US6A 2Y3HA 5DS4A 4E7SA 3GEIA 3GM2A 1UG7A 3SEOA 3M79A 1SYQA 1V4AA 2HZ8A 3B0PA 4J7TA 3LNRA 4LACB 2R7SA 1E86A 3AG3C 4HE8D 4BJ5C 4FX5A 2A0UA 1Z5ZA 4IGGA 5L0JA 4XPWA 3AQCA 4UDVA 4MVMA 4ANJA 5BQIA 3T4RA 1YARO 4CJOA 3ZVRA 1YA7O 2IBFA 1DOWA 5L0HA 2Q7RA 4CDAA 5L3QA 2CW0F 2PFDA 5FZTA 3FXHA 4DOZA 4JTCB 5GPGB 1KNYA 5AC4A 2Q3TA 2F22A 2NUPB 4MTGA 3C8ZA 5JSLA 2KK1A 5DQTA 2YL3A 2HSBA 4W8PA 2CNWA 4P9TA 4QI0A 3DMDA 2R7OA 3E70C 3J06A 3JT1A 2BE5F 2YWAA 1VOMA 3LLIA 3CQZA 3W8IA 1ZW2A 4PFPA 4DVZA 4EBKA 1TWGA 3LUTB 3HJCA 4LDRA 2R7RA 4PACA 3U9JA 2HV7A 3VM6A 1QVXA 4EIYA 1LI7A 4X0RA 4AK9A 4RDAA 1QSPA 1E2XA 1O87A 2EPMX 2VCBA 2V26A 1GS9A 4FAPB 3DZAA 3N24A 3X1OA 3SXYA 1VTMP 2H8AA 5JUAA 1E84A 4WGYA 4DBRA 1AVOB 3DI5A 3MLGA 1FMWA 1MNEA 2FFHA 4MW3A 2IOQA 1H9GA 4XEKA 4YJWA 3SP1A 3SXZA 3DAFA 4NTAA 1DOVA 2OG2A 4BJ6C 1ZHWA 1U89A 3C8GB 3DAGA 3JRTA 1NLXA 4NQFA 3NMIA 3NRHA 4I3MA 1GGQA 1FR0A 1OQCA 5B3SC 4NC3A 4IRUA 5L3VA 1D1AA 2LFFA 4CSAC 1ORJA 2HMQA 3L1MA 4G0HA 5CIVA 3U0CA 4KI2A 3CEXA 4CDYA 1JRAA 4C7OB 2AVKA 4XPXA 1BR4A 1L3PA 3JSZA 3SXKA 3KH2A 3V5YA 4JKVA 5BUOA 3EFOB 1U6HA 4AX2A 1XWJA 1WASA 1VK5A 4JRZA 1TFOB 1JPNA 3SXMA 4CJGA 3FMSA 4YN0B 1I5NA 3Q6MA 2QLAA 4MVSA 3L8JA 4K1OA 1CGOA 2HV6A 3OWTA 1JPJA 3S27A 1RKEB 4PJNA 1G4US 1LI5A 3NG1A 1C03A 1OW8A 3OEOA 3JCUQ 1K04A 4KC9A 4OD4A 2W4MA 3U3FA 1E83A 3QTHA 2LIGA 4KNVA 2Q9AA 1LM3B 4J7YA 2Y3BA 1BZ4A 3ZQYA 4JZAA 1S7ZA 3RIPA 4R32A 3LNMB 3N2ZB 2QUPA 4U5EE 5BQGA 3ASNC 2KGOA 4JEAA 4O7GA 4AE4A 3QZCA 1A41A 1E85A 3B71A 4GYTA 1OW6A 1MMGA 1VYIA 2PF4E 1VLSA 2XXAB 2NSFA 4MTOA 2L81A 4PFOA 2XL8A 5KYYA 3LAYA 4M63A 2L9JA 4CS7A 4XLPF 3H2VA 1VB5A 3DM9B 4JW1A 1OXBA 2ZXRA 3Q7GA 1N1CA 2D4UA 1C17M 2GDCA 3G50A 3C62A 5JVEA 3FHDA 1LE4A 2CNWD 1NSGB 1G5ZA 3ATPA 2EPOA 1YYXA 4KNWA 4YK5A 1TQGA 2NUTA 4CDVA 3TULA 3K33A 3AGTA 3U2LA 4JEBA 3EQLF 1RKCA 3U8PA 1Q0GA 4FWVA 2ZXPA 2AWCA 4U9DA 3IEEA 1H6GA 3UMKA 4I44A 3EGXA 4MVOA 1QLEC 5HSWA 3QW1A 4FESA 2LD6A 4JE9A 2XSEA 3O39A 2C04A 4IJJA 4EHPA 5L0GA 2I15A 1CGME 4LDKA 4PJLA 2XLEA 1YAUO 1Q0FA 1RJ9A 3NKEA 2Y69C 1IZMA 2QNLA 2R7QA 2XS8A 3PCVA 1A7EA 1TR2A 2PX0A 5AGFA 3H2UA 5COGA 4CBEA 2NUPA 4EUKB 4F4BA 1Z3IX 1FTSA 3TK0A 5KYWB 2YL7A 5T3TA 2OEXA 2YEVA 3EHMA 5F28E 4NTBA 4QDLA 2EINC 4BG0A 4OIPF 1J8MF 5L0IA 1OCZC 2ZPAA 3ZQVA 1CGNA 3JYYA 4CS8A 4LLEA 2I8BA 1T6QA 2J46A 3K6BA 3MBGA 2R7WA 2A69F 4U9EA 2XM4A 5K0IA 3RVYA 2CGEA 2R7UA 1BR1A 1NFOA 3HNIA 1MNDA 5E33A 3NYMA 3QW0A 4DRJB 4OD5A 4PR9A 1WTYA 2PX3A 2B0JA 2YKZA 4E0HA 4W8KA 5IY5C 1M2VB 5BQHA 4JTAB 4G7OF 2A68F 5B1BC 3U3BA 3ZC4A 4A4AA 4G7ZF 1YZAA 2AWYA 4MW8A 1WATA 3W8HA 4MVRA 1M2OA 3E9VA 2YHSA 4IAQA 3EG9B 2GWWA 2IM8A 4P6IC 3MX3A 3F47A 3JZ0A 2HFIA 3G4XA 4JJGA 1M56C 1WN0A 3UGOA 2ETSA 4Q7CA 2FGYA 3GWNA 2ICWG 2DI3A 4JIOA 1NFNA 5DVWA 3WAQA 2LP4A 4CS9A 3EHNA 1PD1A 1Q0MA 2OCCC 3KPHA 4BEMJ 1YDIA 3RW0A 5DLJA 1CPQA 2DGJA 3C7JA 1I4YA 3ABLC 3Q6NA 4IWBA 2A6HF 4MQ9F 1Q0KA 3U8VA 4C3DA 4OIQF 3UMHA 2EIJC 3AG1C 2G3KA 3CAXA 1JR8A 4P9FA 1RXQA 4YWQA 2J0WA 3M1CB 5COMA 4EBBA 1MQVA 1YYJA 5EHHA 2L6FA 3WODF 2WVOA 1XZPA 3LJBA 2EPLX 1ORYA 1TWCA 4H54A 2JPUA 1QPUA 1VMAA 2Q00A 4ULWA 3QVYA 2X0CA 1UFBA 5T1DB 1OXKA 1T01A 3ZG1A 1K05A 4OIRF 2YQYA 5KYXA 1J8YF 1LE2A 2J45A 2WB7A 4J32B 3S0XA 1D0XA 1OKKA 1OR3A 3CZ6A 4WJ0A 4YT2A 3VYWA 2P7VA 1Z6AA 2R05A 5B3IA 2B0HA 2G62A 1LS4A 1D0ZA 3HTKC 1SZIA 2L6GA 1IW7F 1U0BB 2OJQA 1NU7D 3ASOC 4O6YA 2QTVA 1SF8A 2DYRC 2H7VC 1LS1A 1ZU5A 2Q4FA 2W45A 3NYLA 1I4ZA 3ABKC 1D0YA 3OA1A 3WHNA 3K1HA 4XTKA 1EQ1A 2VB6A 4RBNA 2PBEA 2IYLD 3M15A 4U5GA 3FAPB 1OCCC 3JSEO 2R9RB 2WZLA 4J30B 3W2WA 2XLOA 2XS1A 5A6KA 2J0XA 2J7PA 5F5HA 1YZCA 3GEHA 4CIPA 3RKOF 2KQ9A 4N06A 3ZIBA 3B0VC 4JCZA 4I1MA 2HKVA 3AG4C 4H4KC 1T6IA 5DS6A 1B68A 4OIOF 2Q9CA 2YVKA 3G4ZA 5COFA 5JS5A 1SMYF 4DRHB 1NG1A 3U2MA 3WG7C 3JRMO 4DBQA 3VRCA 5A6AA 2YZSA 3AQBA 1HW2A 2GAQA 3KYJA 2VCAA 3UNGC 3T6BA 2L6HA 1G8XA 1OCRC 4HEAJ 1V74B 1LPEA 4KBLA 1K40A 3GORA 2KSFA 2KJGA 4C3BA 3BRJA 3FVYA 2PNOA 3POVA 1F1MA 4QI2A 2P6VA 5KYUA 4JTDB 3K66A 3L0IA 2LFDA 2NSGA 2JX0A 4GEHA 4LLCA 3UMIA 2P1AA 2UUHA 2CYDA 4CX9A 2QE9A 2VC9A 2XLWA 3NYJA 3O55A 4N4WA 4XLNF 3EGDA 1HMOA 3EH1A 4D4XA 4YL0A 2GA0A 2AP3A 5DQZA 1ORSC 1TKNA 1JAFA 3I5QA 3LEOA 5JLIA 2EIKC 3GWLA 1HE1A 2XRHA 1L7CA 1ZVZA 1C02A 3CSKA 3C63A 1EI7A 1XZQA 2H7OA 3LS0A 1LIHA 3RQEA 1PV3A 3R7CA 3U9MA 3W2VA 3ZWIA 3TQOA 4G7HF 4XWJA 1LKXA 2HMZA 2QY9A
chains in the Genus database with same CATH topology
4FAPB 2FAPB 4DRIB 2GAQA 2RSEB 1FAPB 4DRJB 2NPUA 1NSGB 1AUEA 3FAPB 4DRHB 5GPGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAP B;  2FAP B;  4DRI B;  2GAQ A;  2RSE B;  1FAP B;  4DRJ B;  2NPU A;  1NSG B;  1AUE A;  3FAP B;  4DRH B;  5GPG B; 
#chains in the Genus database with same CATH topology
 5L0C A;  2EIL C;  4WGZ A;  3IPM O;  4HFK B;  2J9V A;  1RCP A;  2R7T A;  3GAN A;  3AG2 C;  3K1I A;  2WZG A;  3FDQ A;  5JT4 A;  3IQC A;  1NBB A;  3AJM A;  1HW1 A;  2WL8 A;  4MVU A;  1M57 C;  2LQG A;  2Q9B A;  3C18 A;  3DE9 A;  4PJM A;  2W9Y A;  5EK0 A;  4C3E A;  5L0D A;  5A6B A;  3ZDL A;  1T6U A;  3HKK A;  4JVS A;  4U5F E;  1HMD A;  2IXP A;  2JD3 A;  3EJN A;  3PHF 2;  2WVQ A;  3RQG A;  1APC A;  2D5R B;  1ZHT A;  5E2Q A;  3TOL A;  1FNT c;  2TMV P;  3GM1 A;  1OKK D;  3DM5 A;  2J9B A;  2HS5 A;  4I1O B;  2RD9 A;  4DJ9 A;  5AC5 A;  3DE8 A;  1MMA A;  4MVZ A;  4DRI B;  5A69 A;  5FCL A;  3AGU A;  1H7I A;  2YL1 A;  5D92 A;  2OKU A;  2X51 A;  3I4U A;  4GQH A;  2BL2 A;  4Z9I A;  2PP4 A;  3ZTZ A;  4AE4 B;  2YLD A;  2XL4 A;  3FAJ A;  2AU5 A;  4AL1 A;  3SZR A;  5EGY A;  1OW7 A;  2XLH A;  2Z15 A;  1WOL A;  4O6N A;  4CS8 C;  3TJ5 A;  4LDQ A;  3GOD A;  3RQF A;  5KYY B;  3KMI A;  2J7P D;  1FAP B;  3DXJ F;  2J8W A;  3T6G B;  4D4N A;  1JOG A;  3MYI A;  1Z7Q c;  2KNH A;  2OU6 A;  4U5H A;  3W4Y A;  2CCY A;  2DB4 A;  2NUT B;  1A0B A;  4Q4Z F;  4WAB A;  1KU2 A;  4YT5 A;  2LK4 A;  3C8G A;  3B0U X;  3A9C A;  3DWW A;  1YLM A;  4IAO A;  3RF3 A;  4EBJ A;  4OIN F;  4BJ5 A;  4MND A;  3HNJ A;  1ZHX A;  4U5B E;  3DJU B;  4BPM A;  2M64 A;  1Y6D A;  1TWA A;  2J9W A;  1RMV A;  4C7O A;  1AEP A;  3EGX B;  2VH3 A;  4YT4 A;  4L6R A;  4CS9 C;  3DKA A;  4N6C A;  3EH2 A;  1ZHY A;  3UGP A;  1M6T A;  2MWQ A;  1HE9 A;  4EWC A;  4A2N B;  1JMW A;  1R5I D;  3EFO A;  2EPN A;  1SR2 A;  3GEE A;  4BJT A;  2VAS A;  2XLV A;  2A6E F;  1FMV A;  5E3C A;  3EPV A;  1RJ9 B;  2NG1 A;  4E0I A;  1OR2 A;  3HNL A;  2YLG A;  4BJ1 A;  1KTM A;  2LCH A;  2A0B A;  2HUJ A;  1RKE A;  1O3U A;  1T9K A;  3NMK A;  4Q5S F;  4ULV A;  3ZTM A;  2NPU A;  2J9U A;  2ASR A;  1MMN A;  2YRF A;  2VCC A;  3QVZ A;  3IQT A;  3M4C A;  3S84 A;  1HY5 A;  1ZZP A;  2HJ3 A;  3R2P A;  4EKW A;  5D91 A;  4IAR A;  2RSE B;  2C03 A;  3FOP A;  1FFH A;  4CIH A;  2R7V A;  2OJE D;  4E18 A;  4ER9 A;  1FFT C;  3LS1 A;  3V5X A;  1H9T A;  3A11 A;  3MYF A;  2KW3 C;  3ECS A;  5CI8 A;  2EIM C;  4HFF B;  3S29 A;  2HJM A;  2OEV A;  3S28 A;  2YLI A;  1D1C A;  2KYH A;  2OQM A;  3DD7 A;  3PDM P;  2V3C C;  1OCO C;  3KYI A;  4BJ6 A;  3B29 A;  4ZLD A;  2XXA A;  3M4B A;  1EKY A;  1YVI A;  2MHR A;  2R25 A;  5A6B D;  1Z63 A;  3JYH A;  5TJ5 E;  3AOU A;  4CSA A;  1O5H A;  3VAY A;  3LEV A;  3DJN B;  1R4T A;  1YJG A;  4XEV A;  3RVZ A;  3V7O A;  3TJ6 A;  4K0D A;  4DXW A;  2R03 A;  1TFK B;  3IQ5 A;  4JUR I;  4BEJ A;  3HNK A;  4YL1 A;  3H65 A;  5KYN A;  2HSQ A;  4XQ1 A;  1T5O A;  2R02 A;  4NY3 A;  3I5P A;  1GQA A;  1NZE A;  2XLM A;  4G78 A;  5E3A A;  3BEH A;  2P0N A;  4E17 A;  1QQ3 A;  2Y3G A;  2L7A A;  5B1A C;  5JP7 A;  2ZXO A;  1GM5 A;  1PD0 A;  3IHU A;  3Q7L A;  3TD7 A;  2ZD9 A;  3F46 A;  3RYL A;  2IXN A;  1Y4C A;  1AUE A;  1ST6 A;  2WVN A;  2XM0 A;  2H7B A;  5KYX B;  3RFY A;  2OOC A;  5F5F A;  2WZF A;  4YT8 A;  3QMK A;  3LES A;  5KYW A;  3KL4 A;  2P61 A;  3T6J A;  3C8G D;  1NU9 C;  5CI9 A;  3O6X A;  2LSE A;  3B9Q A;  3HLZ A;  4O6M A;  5JRA A;  2O9X A;  3X2Q C;  4PJJ A;  3ABM C;  4U5D E;  3FOO A;  4JCH A;  3TOM A;  1V54 C;  3VF0 A;  5HV9 A;  1D1B A;  3NMJ A;  3K7D A;  3SNH A;  4N6H A;  3JTL O;  1BDJ B;  1TWH A;  4LER A;  1LVK A;  2E87 A;  4AL0 A;  4B6I A;  1A7D A;  2CDQ A;  256B A;  2G3V A;  1M2V A;  3KKB A;  4K7B A;  2BC5 A;  2GFH A;  4ONS A;  3ITF A;  3RH3 A;  3LLK A;  4RD9 A;  1S05 A;  1BBH A;  3L8I A;  1EA8 A;  3GM3 A;  3K1I C;  4PK4 A;  4ZLC A;  4XEF A;  2ZXW C;  3PMR A;  4NCQ A;  2KC3 A;  3EG9 A;  3NKD A;  1W2W A;  1ZHZ A;  2XLD A;  4XPY A;  1BR2 A;  1V55 C;  2EPK X;  1VYK A;  3UR3 C;  3L34 A;  3V5Z A;  5A6J A;  2W4B A;  4JC7 A;  2IXO A;  4MVQ A;  1QZX A;  4E7Z A;  4NTF A;  4JJF A;  3MFN A;  2MYS A;  4Z9H A;  3SYN A;  1ZYR F;  1CPR A;  2IXM A;  4YL3 A;  1ZU4 A;  1Z23 A;  1PCX A;  1ZW3 A;  5KYU B;  5DS5 A;  1A7V A;  1WGW A;  1MMD A;  1WWP A;  3S9O A;  3S90 A;  4U5C E;  2UUI A;  4IB4 A;  3ZSU A;  5L0F A;  2FAP B;  2DYS C;  2A1D D;  4MS2 A;  2Y3D A;  3EGD B;  3IQ6 A;  3N0T A;  1QKR A;  4Z9J A;  3U5S A;  2R7X A;  3T9O A;  1Q0D A;  2M4E A;  2XL6 A;  1VLT A;  2Y39 A;  2YL0 A;  3EZH A;  5T3W A;  4DVY P;  3EZI A;  4MTF A;  3NDB B;  1YA9 A;  1G4W R;  3O10 A;  4O79 A;  3US6 A;  2Y3H A;  5DS4 A;  4E7S A;  3GEI A;  3GM2 A;  1UG7 A;  3SEO A;  3M79 A;  1SYQ A;  1V4A A;  2HZ8 A;  3B0P A;  4J7T A;  3LNR A;  4LAC B;  2R7S A;  1E86 A;  3AG3 C;  4HE8 D;  4BJ5 C;  4FX5 A;  2A0U A;  1Z5Z A;  4IGG A;  5L0J A;  4XPW A;  3AQC A;  4UDV A;  4MVM A;  4ANJ A;  5BQI A;  3T4R A;  1YAR O;  4CJO A;  3ZVR A;  1YA7 O;  2IBF A;  1DOW A;  5L0H A;  2Q7R A;  4CDA A;  5L3Q A;  2CW0 F;  2PFD A;  5FZT A;  3FXH A;  4DOZ A;  4JTC B;  5GPG B;  1KNY A;  5AC4 A;  2Q3T A;  2F22 A;  2NUP B;  4MTG A;  3C8Z A;  5JSL A;  2KK1 A;  5DQT A;  2YL3 A;  2HSB A;  4W8P A;  2CNW A;  4P9T A;  4QI0 A;  3DMD A;  2R7O A;  3E70 C;  3J06 A;  3JT1 A;  2BE5 F;  2YWA A;  1VOM A;  3LLI A;  3CQZ A;  3W8I A;  1ZW2 A;  4PFP A;  4DVZ A;  4EBK A;  1TWG A;  3LUT B;  3HJC A;  4LDR A;  2R7R A;  4PAC A;  3U9J A;  2HV7 A;  3VM6 A;  1QVX A;  4EIY A;  1LI7 A;  4X0R A;  4AK9 A;  4RDA A;  1QSP A;  1E2X A;  1O87 A;  2EPM X;  2VCB A;  2V26 A;  1GS9 A;  4FAP B;  3DZA A;  3N24 A;  3X1O A;  3SXY A;  1VTM P;  2H8A A;  5JUA A;  1E84 A;  4WGY A;  4DBR A;  1AVO B;  3DI5 A;  3MLG A;  1FMW A;  1MNE A;  2FFH A;  4MW3 A;  2IOQ A;  1H9G A;  4XEK A;  4YJW A;  3SP1 A;  3SXZ A;  3DAF A;  4NTA A;  1DOV A;  2OG2 A;  4BJ6 C;  1ZHW A;  1U89 A;  3C8G B;  3DAG A;  3JRT A;  1NLX A;  4NQF A;  3NMI A;  3NRH A;  4I3M A;  1GGQ A;  1FR0 A;  1OQC A;  5B3S C;  4NC3 A;  4IRU A;  5L3V A;  1D1A A;  2LFF A;  4CSA C;  1ORJ A;  2HMQ A;  3L1M A;  4G0H A;  5CIV A;  3U0C A;  4KI2 A;  3CEX A;  4CDY A;  1JRA A;  4C7O B;  2AVK A;  4XPX A;  1BR4 A;  1L3P A;  3JSZ A;  3SXK A;  3KH2 A;  3V5Y A;  4JKV A;  5BUO A;  3EFO B;  1U6H A;  4AX2 A;  1XWJ A;  1WAS A;  1VK5 A;  4JRZ A;  1TFO B;  1JPN A;  3SXM A;  4CJG A;  3FMS A;  4YN0 B;  1I5N A;  3Q6M A;  2QLA A;  4MVS A;  3L8J A;  4K1O A;  1CGO A;  2HV6 A;  3OWT A;  1JPJ A;  3S27 A;  1RKE B;  4PJN A;  1G4U S;  1LI5 A;  3NG1 A;  1C03 A;  1OW8 A;  3OEO A;  3JCU Q;  1K04 A;  4KC9 A;  4OD4 A;  2W4M A;  3U3F A;  1E83 A;  3QTH A;  2LIG A;  4KNV A;  2Q9A A;  1LM3 B;  4J7Y A;  2Y3B A;  1BZ4 A;  3ZQY A;  4JZA A;  1S7Z A;  3RIP A;  4R32 A;  3LNM B;  3N2Z B;  2QUP A;  4U5E E;  5BQG A;  3ASN C;  2KGO A;  4JEA A;  4O7G A;  4AE4 A;  3QZC A;  1A41 A;  1E85 A;  3B71 A;  4GYT A;  1OW6 A;  1MMG A;  1VYI A;  2PF4 E;  1VLS A;  2XXA B;  2NSF A;  4MTO A;  2L81 A;  4PFO A;  2XL8 A;  5KYY A;  3LAY A;  4M63 A;  2L9J A;  4CS7 A;  4XLP F;  3H2V A;  1VB5 A;  3DM9 B;  4JW1 A;  1OXB A;  2ZXR A;  3Q7G A;  1N1C A;  2D4U A;  1C17 M;  2GDC A;  3G50 A;  3C62 A;  5JVE A;  3FHD A;  1LE4 A;  2CNW D;  1NSG B;  1G5Z A;  3ATP A;  2EPO A;  1YYX A;  4KNW A;  4YK5 A;  1TQG A;  2NUT A;  4CDV A;  3TUL A;  3K33 A;  3AGT A;  3U2L A;  4JEB A;  3EQL F;  1RKC A;  3U8P A;  1Q0G A;  4FWV A;  2ZXP A;  2AWC A;  4U9D A;  3IEE A;  1H6G A;  3UMK A;  4I44 A;  3EGX A;  4MVO A;  1QLE C;  5HSW A;  3QW1 A;  4FES A;  2LD6 A;  4JE9 A;  2XSE A;  3O39 A;  2C04 A;  4IJJ A;  4EHP A;  5L0G A;  2I15 A;  1CGM E;  4LDK A;  4PJL A;  2XLE A;  1YAU O;  1Q0F A;  1RJ9 A;  3NKE A;  2Y69 C;  1IZM A;  2QNL A;  2R7Q A;  2XS8 A;  3PCV A;  1A7E A;  1TR2 A;  2PX0 A;  5AGF A;  3H2U A;  5COG A;  4CBE A;  2NUP A;  4EUK B;  4F4B A;  1Z3I X;  1FTS A;  3TK0 A;  5KYW B;  2YL7 A;  5T3T A;  2OEX A;  2YEV A;  3EHM A;  5F28 E;  4NTB A;  4QDL A;  2EIN C;  4BG0 A;  4OIP F;  1J8M F;  5L0I A;  1OCZ C;  2ZPA A;  3ZQV A;  1CGN A;  3JYY A;  4CS8 A;  4LLE A;  2I8B A;  1T6Q A;  2J46 A;  3K6B A;  3MBG A;  2R7W A;  2A69 F;  4U9E A;  2XM4 A;  5K0I A;  3RVY A;  2CGE A;  2R7U A;  1BR1 A;  1NFO A;  3HNI A;  1MND A;  5E33 A;  3NYM A;  3QW0 A;  4DRJ B;  4OD5 A;  4PR9 A;  1WTY A;  2PX3 A;  2B0J A;  2YKZ A;  4E0H A;  4W8K A;  5IY5 C;  1M2V B;  5BQH A;  4JTA B;  4G7O F;  2A68 F;  5B1B C;  3U3B A;  3ZC4 A;  4A4A A;  4G7Z F;  1YZA A;  2AWY A;  4MW8 A;  1WAT A;  3W8H A;  4MVR A;  1M2O A;  3E9V A;  2YHS A;  4IAQ A;  3EG9 B;  2GWW A;  2IM8 A;  4P6I C;  3MX3 A;  3F47 A;  3JZ0 A;  2HFI A;  3G4X A;  4JJG A;  1M56 C;  1WN0 A;  3UGO A;  2ETS A;  4Q7C A;  2FGY A;  3GWN A;  2ICW G;  2DI3 A;  4JIO A;  1NFN A;  5DVW A;  3WAQ A;  2LP4 A;  4CS9 A;  3EHN A;  1PD1 A;  1Q0M A;  2OCC C;  3KPH A;  4BEM J;  1YDI A;  3RW0 A;  5DLJ A;  1CPQ A;  2DGJ A;  3C7J A;  1I4Y A;  3ABL C;  3Q6N A;  4IWB A;  2A6H F;  4MQ9 F;  1Q0K A;  3U8V A;  4C3D A;  4OIQ F;  3UMH A;  2EIJ C;  3AG1 C;  2G3K A;  3CAX A;  1JR8 A;  4P9F A;  1RXQ A;  4YWQ A;  2J0W A;  3M1C B;  5COM A;  4EBB A;  1MQV A;  1YYJ A;  5EHH A;  2L6F A;  3WOD F;  2WVO A;  1XZP A;  3LJB A;  2EPL X;  1ORY A;  1TWC A;  4H54 A;  2JPU A;  1QPU A;  1VMA A;  2Q00 A;  4ULW A;  3QVY A;  2X0C A;  1UFB A;  5T1D B;  1OXK A;  1T01 A;  3ZG1 A;  1K05 A;  4OIR F;  2YQY A;  5KYX A;  1J8Y F;  1LE2 A;  2J45 A;  2WB7 A;  4J32 B;  3S0X A;  1D0X A;  1OKK A;  1OR3 A;  3CZ6 A;  4WJ0 A;  4YT2 A;  3VYW A;  2P7V A;  1Z6A A;  2R05 A;  5B3I A;  2B0H A;  2G62 A;  1LS4 A;  1D0Z A;  3HTK C;  1SZI A;  2L6G A;  1IW7 F;  1U0B B;  2OJQ A;  1NU7 D;  3ASO C;  4O6Y A;  2QTV A;  1SF8 A;  2DYR C;  2H7V C;  1LS1 A;  1ZU5 A;  2Q4F A;  2W45 A;  3NYL A;  1I4Z A;  3ABK C;  1D0Y A;  3OA1 A;  3WHN A;  3K1H A;  4XTK A;  1EQ1 A;  2VB6 A;  4RBN A;  2PBE A;  2IYL D;  3M15 A;  4U5G A;  3FAP B;  1OCC C;  3JSE O;  2R9R B;  2WZL A;  4J30 B;  3W2W A;  2XLO A;  2XS1 A;  5A6K A;  2J0X A;  2J7P A;  5F5H A;  1YZC A;  3GEH A;  4CIP A;  3RKO F;  2KQ9 A;  4N06 A;  3ZIB A;  3B0V C;  4JCZ A;  4I1M A;  2HKV A;  3AG4 C;  4H4K C;  1T6I A;  5DS6 A;  1B68 A;  4OIO F;  2Q9C A;  2YVK A;  3G4Z A;  5COF A;  5JS5 A;  1SMY F;  4DRH B;  1NG1 A;  3U2M A;  3WG7 C;  3JRM O;  4DBQ A;  3VRC A;  5A6A A;  2YZS A;  3AQB A;  1HW2 A;  2GAQ A;  3KYJ A;  2VCA A;  3UNG C;  3T6B A;  2L6H A;  1G8X A;  1OCR C;  4HEA J;  1V74 B;  1LPE A;  4KBL A;  1K40 A;  3GOR A;  2KSF A;  2KJG A;  4C3B A;  3BRJ A;  3FVY A;  2PNO A;  3POV A;  1F1M A;  4QI2 A;  2P6V A;  5KYU A;  4JTD B;  3K66 A;  3L0I A;  2LFD A;  2NSG A;  2JX0 A;  4GEH A;  4LLC A;  3UMI A;  2P1A A;  2UUH A;  2CYD A;  4CX9 A;  2QE9 A;  2VC9 A;  2XLW A;  3NYJ A;  3O55 A;  4N4W A;  4XLN F;  3EGD A;  1HMO A;  3EH1 A;  4D4X A;  4YL0 A;  2GA0 A;  2AP3 A;  5DQZ A;  1ORS C;  1TKN A;  1JAF A;  3I5Q A;  3LEO A;  5JLI A;  2EIK C;  3GWL A;  1HE1 A;  2XRH A;  1L7C A;  1ZVZ A;  1C02 A;  3CSK A;  3C63 A;  1EI7 A;  1XZQ A;  2H7O A;  3LS0 A;  1LIH A;  3RQE A;  1PV3 A;  3R7C A;  3U9M A;  3W2V A;  3ZWI A;  3TQO A;  4G7H F;  4XWJ A;  1LKX A;  2HMZ A;  2QY9 A; 
#chains in the Genus database with same CATH homology
 4FAP B;  2FAP B;  4DRI B;  2GAQ A;  2RSE B;  1FAP B;  4DRJ B;  2NPU A;  1NSG B;  1AUE A;  3FAP B;  4DRH B;  5GPG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...