5GPGB

Co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
92
Chain Sequence
SILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Proximity-Directed Labeling Reveals a New Rapamycin-Induced Heterodimer of FKBP25 and FRB in Live Cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 35
structure length 92
sequence length 93
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 5gpgB00
4FAPB 2FAPB 1NSGB 4DRJB 3FAPB 4DRIB 1AUEA 5GPGB 4DRHB 2RSEB 2NPUA 1FAPB 2GAQA
chains in the Genus database with same CATH superfamily
1QKRA 3C8ZA 2A0BA 1E86A 4JE9A 1YDIA 5TJ5E 2KYHA 2PX0A 3QTHA 4Q7CA 5COFA 2L7AA 2EPNA 1L3PA 2Y3BA 3NKDA 4DVYP 5A6KA 4IAOA 1JRAA 1TFKB 1DOVA 2QTVA 3ASOC 1VYIA 3NRHA 4BJ6A 5KYUB 5K0IA 4D4NA 1VLTA 1ORSC 1Z5ZA 2LSEA 4O7GA 1TWAA 3JSZA 4BPMA 4EKWA 4FX5A 3RH3A 4O6NA 2UUHA 3ITFA 1QZXA 2VCAA 2YL0A 3RIPA 4QDLA 4RDAA 4DOZA 4JJGA 2BL2A 1H9GA 2XL4A 3A9CA 3JSEO 3MBGA 4OD5A 2R7TA 2HSQA 3VF0A 4C3DA 1WASA 4YT2A 3CZ6A 4MVOA 1OXBA 3B0PA 3EH1A 1LS4A 3LS1A 4U5BE 1M6TA 2H7VC 2HKVA 2J9UA 3EFOB 3FOPA 4E18A 5B3SC 2R7UA 1OCZC 2G62A 2WVQA 2XSEA 3AJMA 3QMKA 3SYNA 4NTAA 4OIRF 5L3QA 1OW6A 1APCA 2OEVA 4J32B 4I3MA 2Q7RA 2B0HA 1GGQA 3NYJA 1AUEA 2R7WA 1YA7O 2H7BA 3O6XA 3C62A 5DS4A 2DYRC 4PJNA 3US6A 2EILC 2CW0F 3AG2C 3AG3C 3V5YA 3C18A 4W8KA 4YK5A 1E2XA 5DS5A 4XWJA 2EPLX 2A0UA 4U5GA 3M4CA 4O6MA 4Z9HA 3UNGC 3W8IA 4AK9A 1LM3B 3PDMP 2FGYA 3DD7A 3DWWA 2NUTB 3RW0A 3I4UA 1ZZPA 3FVYA 1LE4A 3RFYA 2R7VA 2EIKC 4YL3A 3U8PA 4EHPA 1YZCA 1PV3A 3KKBA 2R7SA 1OR3A 2MYSA 2OCCC 3DZAA 3DMDA 4JTAB 4PFPA 4E0IA 3K1HA 1OW8A 2VCCA 5JRAA 1YARO 1VYKA 2M64A 2ZPAA 4I1MA 3QVZA 3AOUA 4XQ1A 3U5SA 1MMAA 1VOMA 2Q4FA 4C3EA 1JAFA 3G4XA 4KI2A 4WJ0A 1OCCC 1TR2A 4BEMJ 3N24A 5JVEA 2KGOA 3B0UX 1GM5A 3R2PA 1WATA 4NTFA 3Q6NA 1O87A 1WGWA 2HJMA 1BZ4A 4J30B 1RMVA 2EPKX 4YJWA 4L6RA 1T6UA 2NSFA 5AC4A 2W45A 3EGDB 1IZMA 2A6HF 2A6EF 2GFHA 2I15A 2IXNA 1UFBA 2P1AA 4IARA 4KNVA 2XLEA 1N1CA 5BQGA 3MYIA 1EKYA 4OINF 2XXAB 2C03A 4U5CE 1MMDA 2KJGA 4OIPF 3WHNA 3GEEA 1G4WR 3KYIA 3HKKA 4CDYA 2QY9A 3LLIA 3G4ZA 2Y3DA 1S05A 3ABLC 1KNYA 3LUTB 2YLGA 5DS6A 3HNKA 1YLMA 1NBBA 4IGGA 3E9VA 1YYXA 1ZW2A 4ER9A 2EPOA 5AGFA 2E87A 2J46A 4YL0A 4MVMA 2AWCA 3VRCA 5AC5A 3T4RA 2PX3A 3B9QA 2M4EA 1LVKA 4N6HA 3S9OA 3MLGA 4WGZA 2LIGA 3IQTA 3EH2A 3H2UA 3ECSA 3SEOA 5DQZA 2WZLA 2EPMX 3OWTA 3FMSA 3CQZA 4FWVA 4OD4A 3SXYA 3VM6A 1RKCA 3K7DA 1Q0DA 2KW3C 2ICWG 3EGXA 2XM4A 3G50A 4O6YA 3IPMO 3MFNA 2Q9AA 5JP7A 3M1CB 1YZAA 1OKKA 2LP4A 1OKKD 4JCZA 2CNWA 3EPVA 2CNWD 2TMVP 1TWHA 2YVKA 2XRHA 1Y6DA 3EJNA 2YEVA 5F28E 1SYQA 2B0JA 3NYMA 2OEXA 2LQGA 2J9VA 1C17M 2VASA 4LDKA 2YLDA 3C7JA 1Q0FA 1T5OA 1NU7D 1NFOA 1FFTC 4KC9A 5FCLA 1GQAA 4FESA 5KYUA 4P9TA 3SXKA 2GAQA 1TFOB 3A11A 1Q0KA 4B6IA 4BJTA 4CS8A 1AVOB 2J0WA 2YL1A 2NUPB 4PFOA 1M2VA 4OIQF 5A6AA 4D4XA 2HZ8A 3HLZA 1G5ZA 1SR2A 4WABA 3L1MA 3LAYA 3X2QC 2ZXRA 1CGME 4Q4ZF 1K04A 5A6JA 4MS2A 3U8VA 2ZXWC 1LKXA 2HV7A 2W4MA 1LE2A 4JTDB 2YZSA 3WG7C 4CS9A 1D1AA 2LCHA 2WL8A 2HMZA 4QI0A 3EFOA 5COMA 1CPQA 4AE4B 3KYJA 3VAYA 1M2VB 4CS9C 5CIVA 4BJ6C 2DGJA 3X1OA 3Q6MA 3QW1A 2J9BA 4LACB 1HW1A 1WTYA 2FAPB 3N2ZB 2R7OA 3FAPB 2OOCA 4ANJA 3ZTZA 3O39A 4YN0B 2KSFA 3IQ5A 2QNLA 4PK4A 3LEOA 4Z9IA 2AVKA 2KC3A 2Y3HA 4CDAA 5L0FA 1HY5A 3UMIA 5EGYA 2JPUA 3DJNB 4ULVA 3ABMC 1T6QA 4IRUA 4N4WA 5L0JA 3ZDLA 3I5PA 1MNDA 2OKUA 256BA 3LNMB 2CGEA 3UMKA 4YT8A 1D1CA 1NU9C 2F22A 4MVZA 4N6CA 3TJ5A 3ZC4A 3ZWIA 4BEJA 3N0TA 3S28A 2NUTA 3RQFA 3B71A 4DRHB 3JYHA 3ZQVA 1ZHTA 2BC5A 1MNEA 2WVNA 3L8IA 2LK4A 1YJGA 2J45A 4ULWA 3ZVRA 2DYSC 2DB4A 2OQMA 3GM2A 4LLEA 1DOWA 2XL6A 2KNHA 1OQCA 1SMYF 1ZVZA 4XLNF 5GPGB 2ZD9A 4P6IC 3K6BA 3UMHA 4PACA 4CJGA 1YAUO 4GYTA 1YVIA 2QE9A 2AU5A 4JJFA 4W8PA 2HS5A 2X0CA 3L34A 4E7SA 4E7ZA 1XWJA 5CI9A 4EBKA 2L9JA 1LI7A 2R05A 4IWBA 4CIPA 1ZHWA 2FFHA 3DE9A 3I5QA 4PJMA 5HSWA 3S90A 3GWLA 1VTMP 4CSAA 2GWWA 4WGYA 1Q0GA 4G7OF 1H9TA 1BDJB 5KYWB 2H7OA 4CBEA 3FHDA 5L3VA 1Q0MA 1ZHXA 1R5ID 1J8MF 2P6VA 4PJJA 1Z7Qc 4BG0A 5JS5A 1Z63A 2HFIA 3KL4A 1WOLA 1MMNA 3NG1A 5EK0A 3TOLA 3E70C 3U2LA 2CDQA 3EGDA 3O55A 4IAQA 4DRJB 2XL8A 4XEKA 2XLWA 3JZ0A 4U9EA 2L6GA 3U9JA 2CCYA 2HV6A 3LEVA 4ZLDA 3DI5A 1F1MA 1HMDA 2XXAA 3AG1C 3RVZA 5KYYB 2Q9CA 1CGOA 4LERA 2J7PA 3HNJA 1Y4CA 2J7PD 3ZQYA 3C8GB 5KYNA 5B1BC 3CSKA 3LESA 1NG1A 4BJ5A 2IM8A 4JIOA 3PCVA 1PD0A 4A2NB 2Y39A 2V26A 4ZLCA 1GS9A 5E3CA 2XLHA 4I44A 4LLCA 4AL0A 2ZXPA 3H2VA 4JCHA 4N06A 5T3WA 3TQOA 3F47A 1OR2A 2OG2A 2IYLD 3LNRA 3GEHA 5T3TA 2QUPA 3S0XA 3RQGA 4EBJA 2BE5F 5JLIA 1JPJA 4X0RA 3AQBA 1NFNA 3L0IA 4E0HA 1RKEB 1LI5A 1E85A 2P61A 2XLDA 4MW3A 4XPWA 4YT4A 2R7QA 4C7OB 3JTLO 2NSGA 1MMGA 2IBFA 5DQTA 3DM5A 4JVSA 3JYYA 1PD1A 3U3BA 3FDQA 1I4YA 1MQVA 4JTCB 1JMWA 2YWAA 4JURI 3T6BA 4R32A 3M79A 2D4UA 4OIOF 1A0BA 1ZU5A 2I8BA 4UDVA 2R7RA 3RYLA 4XPYA 2XM0A 3S27A 3T6GB 3TOMA 4CX9A 2A1DD 5A6BA 5A6BD 2PNOA 4XPXA 1KU2A 3LLKA 1G8XA 3JT1A 4LDQA 3M4BA 1V55C 5IY5C 1BBHA 3NDBB 4KNWA 2WB7A 4DBQA 2NUPA 3B29A 4DRIB 5BQHA 3K1IA 3ATPA 4G0HA 4JC7A 3FXHA 2XLVA 2CYDA 2P0NA 4FAPB 5KYXA 1XZQA 3K1IC 4XEFA 2IXOA 2ETSA 2J9WA 2W9YA 1LIHA 2V3CC 1OXKA 1BR2A 4IB4A 4J7YA 4U9DA 3ZTMA 3ABKC 4AE4A 3U0CA 1M56C 3LS0A 1TWGA 1WN0A 4JW1A 1QLEC 3W4YA 1TKNA 3OEOA 2RSEB 4MW8A 1T01A 2JD3A 3LJBA 3TK0A 2EIJC 4A4AA 4YWQA 4G7HF 1ZU4A 4C3BA 4CS8C 5D91A 5KYXB 3ASNC 4K7BA 4U5FE 4DVZA 2YHSA 4QI2A 2WVOA 5F5HA 5E3AA 2WZFA 1ZYRF 1W2WA 1RJ9B 3S84A 1V74B 1G4US 4XEVA 1FR0A 1UG7A 2OU6A 2R25A 3M15A 5B1AC 3SP1A 3AGUA 3NMKA 4DJ9A 2D5RB 4JZAA 1M2OA 4HEAJ 1FNTc 1OCOC 3ZG1A 5L0CA 3F46A 3GEIA 1OW7A 1O5HA 3GM3A 1FMVA 4J7TA 4JKVA 2XS1A 1D0ZA 1VMAA 3RF3A 3S29A 3GORA 1ORYA 3NMJA 2R7XA 4MTGA 4BJ1A 3TJ6A 2NG1A 3HNLA 1U6HA 4DXWA 3Q7GA 1A7EA 2NPUA 3PMRA 3SXMA 4CJOA 1A41A 1NLXA 1C02A 2VCBA 1LPEA 2YKZA 3SZRA 1E83A 5F5FA 1K05A 3NKEA 1HW2A 1FMWA 1SZIA 3K66A 3GANA 3KPHA 4RD9A 1CGNA 2YLIA 3K33A 2RD9A 1H7IA 4MTFA 3W2WA 3GM1A 1J8YF 4PJLA 3UGOA 2O9XA 2YL3A 3AGTA 2X51A 1QPUA 4MTOA 5L0DA 2A69F 4JEBA 2C04A 3PHF2 3EZHA 3DE8A 3IQCA 2OJQA 5KYWA 3W8HA 3ZSUA 4P9FA 1A7VA 1ST6A 3R7CA 4YL1A 4EBBA 1NZEA 1FFHA 4Q5SF 3V7OA 1C03A 2R03A 1LS1A 4MVUA 1U0BB 1ZHYA 3QVYA 3EZIA 2PF4E 4JRZA 3AG4C 5EHHA 2XLMA 4CDVA 1R4TA 4CIHA 2OJED 5KYYA 4CSAC 5JT4A 1SF8A 1Z6AA 2IXPA 1JR8A 5FZTA 2LFDA 4XTKA 2Y69C 2L6HA 3C8GA 3C8GD 4MNDA 4G7ZF 3RKOF 1D0XA 1EQ1A 4JEAA 1Z3IX 2WZGA 1JPNA 4NCQA 1D1BA 3NMIA 3DJUB 3UGPA 3DM9B 3IQ6A 2MHRA 4NQFA 4XLPF 3L8JA 4NC3A 1TQGA 2VH3A 5E2QA 5COGA 3AQCA 2PFDA 3J06A 4PR9A 2YL7A 2AWYA 2HJ3A 2YRFA 5JSLA 4DBRA 2KK1A 1I4ZA 1O3UA 1TWCA 4ONSA 5E33A 5DLJA 1T9KA 4Z9JA 2ASRA 1RKEA 3NYLA 1RXQA 2DI3A 5HV9A 4C7OA 2R02A 3DAGA 4BJ5C 2HUJA 3SXZA 2Q9BA 4HFKB 1HMOA 4O79A 3JRMO 3MX3A 5D92A 2XS8A 3IHUA 4F4BA 5A69A 2EIMC 1FTSA 2P7VA 5T1DB 4MVRA 1XZPA 3CAXA 1PCXA 1VLSA 3BEHA 2UUIA 4AX2A 3RVYA 3HNIA 2Y3GA 1KTMA 1OCRC 1YYJA 3HJCA 4LDRA 3EHNA 4M63A 3GWNA 5CI8A 1B68A 1YA9A 1VK5A 4RBNA 4EUKB 1RCPA 4H54A 3U2MA 1WWPA 1AEPA 2L6FA 1ZHZA 2QLAA 3KMIA 4NY3A 4U5HA 2Q00A 2MWQA 3V5ZA 4EIYA 1E84A 1V4AA 3OA1A 3C63A 3IEEA 3DKAA 3JRTA 2PBEA 3MYFA 3TULA 1FAPB 1QVXA 1U89A 1VB5A 3WODF 2J8WA 3POVA 2J0XA 2XLOA 2HSBA 3B0VC 3H65A 3KH2A 3QZCA 4K0DA 2JX0A 2HMQA 3JCUQ 4NTBA 4YT5A 4K1OA 4H4KC 2KQ9A 1I5NA 1QQ3A 1EI7A 3EG9A 1M57C 3FOOA 3BRJA 2IOQA 3GODA 3W2VA 2R9RB 4AL1A 2Q3TA 3DXJF 1EA8A 4U5DE 1QSPA 3DAFA 2G3VA 3RQEA 4GQHA 3U3FA 3CEXA 2GDCA 3EHMA 3FAJA 3U9MA 1CPRA 3SNHA 1D0YA 3QW0A 4HE8D 4MVQA 3ZIBA 2G3KA 4KBLA 4I1OB 1RJ9A 1Z23A 1HE1A 1ZW3A 5L0GA 1NSGB 2ZXOA 1ORJA 3EG9B 4CS7A 2H8AA 2VB6A 2YQYA 3T9OA 1IW7F 2PP4A 1K40A 5DVWA 2GA0A 1T6IA 2LD6A 1V54C 3O10A 3TD7A 5BQIA 4HFFB 2EINC 3V5XA 2AP3A 4GEHA 2W4BA 2Z15A 4EWCA 5L0IA 1A7DA 4IJJA 2VC9A 2IXMA 1L7CA 5BUOA 3UR3C 5B3IA 4G78A 3VYWA 1BR1A 4U5EE 1JOGA 3Q7LA 1H6GA 2L81A 3HTKC 3EQLF 4MVSA 2A68F 4MQ9F 3T6JA 5L0HA 3EGXB 1BR4A 3WAQA 5JUAA 2LFFA 1S7ZA 4E17A 1HE9A
chains in the Genus database with same CATH topology
4FAPB 2FAPB 1NSGB 4DRJB 3FAPB 4DRIB 1AUEA 5GPGB 4DRHB 2RSEB 2NPUA 1FAPB 2GAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAP B;  2FAP B;  1NSG B;  4DRJ B;  3FAP B;  4DRI B;  1AUE A;  5GPG B;  4DRH B;  2RSE B;  2NPU A;  1FAP B;  2GAQ A; 
#chains in the Genus database with same CATH topology
 1QKR A;  3C8Z A;  2A0B A;  1E86 A;  4JE9 A;  1YDI A;  5TJ5 E;  2KYH A;  2PX0 A;  3QTH A;  4Q7C A;  5COF A;  2L7A A;  2EPN A;  1L3P A;  2Y3B A;  3NKD A;  4DVY P;  5A6K A;  4IAO A;  1JRA A;  1TFK B;  1DOV A;  2QTV A;  3ASO C;  1VYI A;  3NRH A;  4BJ6 A;  5KYU B;  5K0I A;  4D4N A;  1VLT A;  1ORS C;  1Z5Z A;  2LSE A;  4O7G A;  1TWA A;  3JSZ A;  4BPM A;  4EKW A;  4FX5 A;  3RH3 A;  4O6N A;  2UUH A;  3ITF A;  1QZX A;  2VCA A;  2YL0 A;  3RIP A;  4QDL A;  4RDA A;  4DOZ A;  4JJG A;  2BL2 A;  1H9G A;  2XL4 A;  3A9C A;  3JSE O;  3MBG A;  4OD5 A;  2R7T A;  2HSQ A;  3VF0 A;  4C3D A;  1WAS A;  4YT2 A;  3CZ6 A;  4MVO A;  1OXB A;  3B0P A;  3EH1 A;  1LS4 A;  3LS1 A;  4U5B E;  1M6T A;  2H7V C;  2HKV A;  2J9U A;  3EFO B;  3FOP A;  4E18 A;  5B3S C;  2R7U A;  1OCZ C;  2G62 A;  2WVQ A;  2XSE A;  3AJM A;  3QMK A;  3SYN A;  4NTA A;  4OIR F;  5L3Q A;  1OW6 A;  1APC A;  2OEV A;  4J32 B;  4I3M A;  2Q7R A;  2B0H A;  1GGQ A;  3NYJ A;  1AUE A;  2R7W A;  1YA7 O;  2H7B A;  3O6X A;  3C62 A;  5DS4 A;  2DYR C;  4PJN A;  3US6 A;  2EIL C;  2CW0 F;  3AG2 C;  3AG3 C;  3V5Y A;  3C18 A;  4W8K A;  4YK5 A;  1E2X A;  5DS5 A;  4XWJ A;  2EPL X;  2A0U A;  4U5G A;  3M4C A;  4O6M A;  4Z9H A;  3UNG C;  3W8I A;  4AK9 A;  1LM3 B;  3PDM P;  2FGY A;  3DD7 A;  3DWW A;  2NUT B;  3RW0 A;  3I4U A;  1ZZP A;  3FVY A;  1LE4 A;  3RFY A;  2R7V A;  2EIK C;  4YL3 A;  3U8P A;  4EHP A;  1YZC A;  1PV3 A;  3KKB A;  2R7S A;  1OR3 A;  2MYS A;  2OCC C;  3DZA A;  3DMD A;  4JTA B;  4PFP A;  4E0I A;  3K1H A;  1OW8 A;  2VCC A;  5JRA A;  1YAR O;  1VYK A;  2M64 A;  2ZPA A;  4I1M A;  3QVZ A;  3AOU A;  4XQ1 A;  3U5S A;  1MMA A;  1VOM A;  2Q4F A;  4C3E A;  1JAF A;  3G4X A;  4KI2 A;  4WJ0 A;  1OCC C;  1TR2 A;  4BEM J;  3N24 A;  5JVE A;  2KGO A;  3B0U X;  1GM5 A;  3R2P A;  1WAT A;  4NTF A;  3Q6N A;  1O87 A;  1WGW A;  2HJM A;  1BZ4 A;  4J30 B;  1RMV A;  2EPK X;  4YJW A;  4L6R A;  1T6U A;  2NSF A;  5AC4 A;  2W45 A;  3EGD B;  1IZM A;  2A6H F;  2A6E F;  2GFH A;  2I15 A;  2IXN A;  1UFB A;  2P1A A;  4IAR A;  4KNV A;  2XLE A;  1N1C A;  5BQG A;  3MYI A;  1EKY A;  4OIN F;  2XXA B;  2C03 A;  4U5C E;  1MMD A;  2KJG A;  4OIP F;  3WHN A;  3GEE A;  1G4W R;  3KYI A;  3HKK A;  4CDY A;  2QY9 A;  3LLI A;  3G4Z A;  2Y3D A;  1S05 A;  3ABL C;  1KNY A;  3LUT B;  2YLG A;  5DS6 A;  3HNK A;  1YLM A;  1NBB A;  4IGG A;  3E9V A;  1YYX A;  1ZW2 A;  4ER9 A;  2EPO A;  5AGF A;  2E87 A;  2J46 A;  4YL0 A;  4MVM A;  2AWC A;  3VRC A;  5AC5 A;  3T4R A;  2PX3 A;  3B9Q A;  2M4E A;  1LVK A;  4N6H A;  3S9O A;  3MLG A;  4WGZ A;  2LIG A;  3IQT A;  3EH2 A;  3H2U A;  3ECS A;  3SEO A;  5DQZ A;  2WZL A;  2EPM X;  3OWT A;  3FMS A;  3CQZ A;  4FWV A;  4OD4 A;  3SXY A;  3VM6 A;  1RKC A;  3K7D A;  1Q0D A;  2KW3 C;  2ICW G;  3EGX A;  2XM4 A;  3G50 A;  4O6Y A;  3IPM O;  3MFN A;  2Q9A A;  5JP7 A;  3M1C B;  1YZA A;  1OKK A;  2LP4 A;  1OKK D;  4JCZ A;  2CNW A;  3EPV A;  2CNW D;  2TMV P;  1TWH A;  2YVK A;  2XRH A;  1Y6D A;  3EJN A;  2YEV A;  5F28 E;  1SYQ A;  2B0J A;  3NYM A;  2OEX A;  2LQG A;  2J9V A;  1C17 M;  2VAS A;  4LDK A;  2YLD A;  3C7J A;  1Q0F A;  1T5O A;  1NU7 D;  1NFO A;  1FFT C;  4KC9 A;  5FCL A;  1GQA A;  4FES A;  5KYU A;  4P9T A;  3SXK A;  2GAQ A;  1TFO B;  3A11 A;  1Q0K A;  4B6I A;  4BJT A;  4CS8 A;  1AVO B;  2J0W A;  2YL1 A;  2NUP B;  4PFO A;  1M2V A;  4OIQ F;  5A6A A;  4D4X A;  2HZ8 A;  3HLZ A;  1G5Z A;  1SR2 A;  4WAB A;  3L1M A;  3LAY A;  3X2Q C;  2ZXR A;  1CGM E;  4Q4Z F;  1K04 A;  5A6J A;  4MS2 A;  3U8V A;  2ZXW C;  1LKX A;  2HV7 A;  2W4M A;  1LE2 A;  4JTD B;  2YZS A;  3WG7 C;  4CS9 A;  1D1A A;  2LCH A;  2WL8 A;  2HMZ A;  4QI0 A;  3EFO A;  5COM A;  1CPQ A;  4AE4 B;  3KYJ A;  3VAY A;  1M2V B;  4CS9 C;  5CIV A;  4BJ6 C;  2DGJ A;  3X1O A;  3Q6M A;  3QW1 A;  2J9B A;  4LAC B;  1HW1 A;  1WTY A;  2FAP B;  3N2Z B;  2R7O A;  3FAP B;  2OOC A;  4ANJ A;  3ZTZ A;  3O39 A;  4YN0 B;  2KSF A;  3IQ5 A;  2QNL A;  4PK4 A;  3LEO A;  4Z9I A;  2AVK A;  2KC3 A;  2Y3H A;  4CDA A;  5L0F A;  1HY5 A;  3UMI A;  5EGY A;  2JPU A;  3DJN B;  4ULV A;  3ABM C;  1T6Q A;  4IRU A;  4N4W A;  5L0J A;  3ZDL A;  3I5P A;  1MND A;  2OKU A;  256B A;  3LNM B;  2CGE A;  3UMK A;  4YT8 A;  1D1C A;  1NU9 C;  2F22 A;  4MVZ A;  4N6C A;  3TJ5 A;  3ZC4 A;  3ZWI A;  4BEJ A;  3N0T A;  3S28 A;  2NUT A;  3RQF A;  3B71 A;  4DRH B;  3JYH A;  3ZQV A;  1ZHT A;  2BC5 A;  1MNE A;  2WVN A;  3L8I A;  2LK4 A;  1YJG A;  2J45 A;  4ULW A;  3ZVR A;  2DYS C;  2DB4 A;  2OQM A;  3GM2 A;  4LLE A;  1DOW A;  2XL6 A;  2KNH A;  1OQC A;  1SMY F;  1ZVZ A;  4XLN F;  5GPG B;  2ZD9 A;  4P6I C;  3K6B A;  3UMH A;  4PAC A;  4CJG A;  1YAU O;  4GYT A;  1YVI A;  2QE9 A;  2AU5 A;  4JJF A;  4W8P A;  2HS5 A;  2X0C A;  3L34 A;  4E7S A;  4E7Z A;  1XWJ A;  5CI9 A;  4EBK A;  2L9J A;  1LI7 A;  2R05 A;  4IWB A;  4CIP A;  1ZHW A;  2FFH A;  3DE9 A;  3I5Q A;  4PJM A;  5HSW A;  3S90 A;  3GWL A;  1VTM P;  4CSA A;  2GWW A;  4WGY A;  1Q0G A;  4G7O F;  1H9T A;  1BDJ B;  5KYW B;  2H7O A;  4CBE A;  3FHD A;  5L3V A;  1Q0M A;  1ZHX A;  1R5I D;  1J8M F;  2P6V A;  4PJJ A;  1Z7Q c;  4BG0 A;  5JS5 A;  1Z63 A;  2HFI A;  3KL4 A;  1WOL A;  1MMN A;  3NG1 A;  5EK0 A;  3TOL A;  3E70 C;  3U2L A;  2CDQ A;  3EGD A;  3O55 A;  4IAQ A;  4DRJ B;  2XL8 A;  4XEK A;  2XLW A;  3JZ0 A;  4U9E A;  2L6G A;  3U9J A;  2CCY A;  2HV6 A;  3LEV A;  4ZLD A;  3DI5 A;  1F1M A;  1HMD A;  2XXA A;  3AG1 C;  3RVZ A;  5KYY B;  2Q9C A;  1CGO A;  4LER A;  2J7P A;  3HNJ A;  1Y4C A;  2J7P D;  3ZQY A;  3C8G B;  5KYN A;  5B1B C;  3CSK A;  3LES A;  1NG1 A;  4BJ5 A;  2IM8 A;  4JIO A;  3PCV A;  1PD0 A;  4A2N B;  2Y39 A;  2V26 A;  4ZLC A;  1GS9 A;  5E3C A;  2XLH A;  4I44 A;  4LLC A;  4AL0 A;  2ZXP A;  3H2V A;  4JCH A;  4N06 A;  5T3W A;  3TQO A;  3F47 A;  1OR2 A;  2OG2 A;  2IYL D;  3LNR A;  3GEH A;  5T3T A;  2QUP A;  3S0X A;  3RQG A;  4EBJ A;  2BE5 F;  5JLI A;  1JPJ A;  4X0R A;  3AQB A;  1NFN A;  3L0I A;  4E0H A;  1RKE B;  1LI5 A;  1E85 A;  2P61 A;  2XLD A;  4MW3 A;  4XPW A;  4YT4 A;  2R7Q A;  4C7O B;  3JTL O;  2NSG A;  1MMG A;  2IBF A;  5DQT A;  3DM5 A;  4JVS A;  3JYY A;  1PD1 A;  3U3B A;  3FDQ A;  1I4Y A;  1MQV A;  4JTC B;  1JMW A;  2YWA A;  4JUR I;  3T6B A;  4R32 A;  3M79 A;  2D4U A;  4OIO F;  1A0B A;  1ZU5 A;  2I8B A;  4UDV A;  2R7R A;  3RYL A;  4XPY A;  2XM0 A;  3S27 A;  3T6G B;  3TOM A;  4CX9 A;  2A1D D;  5A6B A;  5A6B D;  2PNO A;  4XPX A;  1KU2 A;  3LLK A;  1G8X A;  3JT1 A;  4LDQ A;  3M4B A;  1V55 C;  5IY5 C;  1BBH A;  3NDB B;  4KNW A;  2WB7 A;  4DBQ A;  2NUP A;  3B29 A;  4DRI B;  5BQH A;  3K1I A;  3ATP A;  4G0H A;  4JC7 A;  3FXH A;  2XLV A;  2CYD A;  2P0N A;  4FAP B;  5KYX A;  1XZQ A;  3K1I C;  4XEF A;  2IXO A;  2ETS A;  2J9W A;  2W9Y A;  1LIH A;  2V3C C;  1OXK A;  1BR2 A;  4IB4 A;  4J7Y A;  4U9D A;  3ZTM A;  3ABK C;  4AE4 A;  3U0C A;  1M56 C;  3LS0 A;  1TWG A;  1WN0 A;  4JW1 A;  1QLE C;  3W4Y A;  1TKN A;  3OEO A;  2RSE B;  4MW8 A;  1T01 A;  2JD3 A;  3LJB A;  3TK0 A;  2EIJ C;  4A4A A;  4YWQ A;  4G7H F;  1ZU4 A;  4C3B A;  4CS8 C;  5D91 A;  5KYX B;  3ASN C;  4K7B A;  4U5F E;  4DVZ A;  2YHS A;  4QI2 A;  2WVO A;  5F5H A;  5E3A A;  2WZF A;  1ZYR F;  1W2W A;  1RJ9 B;  3S84 A;  1V74 B;  1G4U S;  4XEV A;  1FR0 A;  1UG7 A;  2OU6 A;  2R25 A;  3M15 A;  5B1A C;  3SP1 A;  3AGU A;  3NMK A;  4DJ9 A;  2D5R B;  4JZA A;  1M2O A;  4HEA J;  1FNT c;  1OCO C;  3ZG1 A;  5L0C A;  3F46 A;  3GEI A;  1OW7 A;  1O5H A;  3GM3 A;  1FMV A;  4J7T A;  4JKV A;  2XS1 A;  1D0Z A;  1VMA A;  3RF3 A;  3S29 A;  3GOR A;  1ORY A;  3NMJ A;  2R7X A;  4MTG A;  4BJ1 A;  3TJ6 A;  2NG1 A;  3HNL A;  1U6H A;  4DXW A;  3Q7G A;  1A7E A;  2NPU A;  3PMR A;  3SXM A;  4CJO A;  1A41 A;  1NLX A;  1C02 A;  2VCB A;  1LPE A;  2YKZ A;  3SZR A;  1E83 A;  5F5F A;  1K05 A;  3NKE A;  1HW2 A;  1FMW A;  1SZI A;  3K66 A;  3GAN A;  3KPH A;  4RD9 A;  1CGN A;  2YLI A;  3K33 A;  2RD9 A;  1H7I A;  4MTF A;  3W2W A;  3GM1 A;  1J8Y F;  4PJL A;  3UGO A;  2O9X A;  2YL3 A;  3AGT A;  2X51 A;  1QPU A;  4MTO A;  5L0D A;  2A69 F;  4JEB A;  2C04 A;  3PHF 2;  3EZH A;  3DE8 A;  3IQC A;  2OJQ A;  5KYW A;  3W8H A;  3ZSU A;  4P9F A;  1A7V A;  1ST6 A;  3R7C A;  4YL1 A;  4EBB A;  1NZE A;  1FFH A;  4Q5S F;  3V7O A;  1C03 A;  2R03 A;  1LS1 A;  4MVU A;  1U0B B;  1ZHY A;  3QVY A;  3EZI A;  2PF4 E;  4JRZ A;  3AG4 C;  5EHH A;  2XLM A;  4CDV A;  1R4T A;  4CIH A;  2OJE D;  5KYY A;  4CSA C;  5JT4 A;  1SF8 A;  1Z6A A;  2IXP A;  1JR8 A;  5FZT A;  2LFD A;  4XTK A;  2Y69 C;  2L6H A;  3C8G A;  3C8G D;  4MND A;  4G7Z F;  3RKO F;  1D0X A;  1EQ1 A;  4JEA A;  1Z3I X;  2WZG A;  1JPN A;  4NCQ A;  1D1B A;  3NMI A;  3DJU B;  3UGP A;  3DM9 B;  3IQ6 A;  2MHR A;  4NQF A;  4XLP F;  3L8J A;  4NC3 A;  1TQG A;  2VH3 A;  5E2Q A;  5COG A;  3AQC A;  2PFD A;  3J06 A;  4PR9 A;  2YL7 A;  2AWY A;  2HJ3 A;  2YRF A;  5JSL A;  4DBR A;  2KK1 A;  1I4Z A;  1O3U A;  1TWC A;  4ONS A;  5E33 A;  5DLJ A;  1T9K A;  4Z9J A;  2ASR A;  1RKE A;  3NYL A;  1RXQ A;  2DI3 A;  5HV9 A;  4C7O A;  2R02 A;  3DAG A;  4BJ5 C;  2HUJ A;  3SXZ A;  2Q9B A;  4HFK B;  1HMO A;  4O79 A;  3JRM O;  3MX3 A;  5D92 A;  2XS8 A;  3IHU A;  4F4B A;  5A69 A;  2EIM C;  1FTS A;  2P7V A;  5T1D B;  4MVR A;  1XZP A;  3CAX A;  1PCX A;  1VLS A;  3BEH A;  2UUI A;  4AX2 A;  3RVY A;  3HNI A;  2Y3G A;  1KTM A;  1OCR C;  1YYJ A;  3HJC A;  4LDR A;  3EHN A;  4M63 A;  3GWN A;  5CI8 A;  1B68 A;  1YA9 A;  1VK5 A;  4RBN A;  4EUK B;  1RCP A;  4H54 A;  3U2M A;  1WWP A;  1AEP A;  2L6F A;  1ZHZ A;  2QLA A;  3KMI A;  4NY3 A;  4U5H A;  2Q00 A;  2MWQ A;  3V5Z A;  4EIY A;  1E84 A;  1V4A A;  3OA1 A;  3C63 A;  3IEE A;  3DKA A;  3JRT A;  2PBE A;  3MYF A;  3TUL A;  1FAP B;  1QVX A;  1U89 A;  1VB5 A;  3WOD F;  2J8W A;  3POV A;  2J0X A;  2XLO A;  2HSB A;  3B0V C;  3H65 A;  3KH2 A;  3QZC A;  4K0D A;  2JX0 A;  2HMQ A;  3JCU Q;  4NTB A;  4YT5 A;  4K1O A;  4H4K C;  2KQ9 A;  1I5N A;  1QQ3 A;  1EI7 A;  3EG9 A;  1M57 C;  3FOO A;  3BRJ A;  2IOQ A;  3GOD A;  3W2V A;  2R9R B;  4AL1 A;  2Q3T A;  3DXJ F;  1EA8 A;  4U5D E;  1QSP A;  3DAF A;  2G3V A;  3RQE A;  4GQH A;  3U3F A;  3CEX A;  2GDC A;  3EHM A;  3FAJ A;  3U9M A;  1CPR A;  3SNH A;  1D0Y A;  3QW0 A;  4HE8 D;  4MVQ A;  3ZIB A;  2G3K A;  4KBL A;  4I1O B;  1RJ9 A;  1Z23 A;  1HE1 A;  1ZW3 A;  5L0G A;  1NSG B;  2ZXO A;  1ORJ A;  3EG9 B;  4CS7 A;  2H8A A;  2VB6 A;  2YQY A;  3T9O A;  1IW7 F;  2PP4 A;  1K40 A;  5DVW A;  2GA0 A;  1T6I A;  2LD6 A;  1V54 C;  3O10 A;  3TD7 A;  5BQI A;  4HFF B;  2EIN C;  3V5X A;  2AP3 A;  4GEH A;  2W4B A;  2Z15 A;  4EWC A;  5L0I A;  1A7D A;  4IJJ A;  2VC9 A;  2IXM A;  1L7C A;  5BUO A;  3UR3 C;  5B3I A;  4G78 A;  3VYW A;  1BR1 A;  4U5E E;  1JOG A;  3Q7L A;  1H6G A;  2L81 A;  3HTK C;  3EQL F;  4MVS A;  2A68 F;  4MQ9 F;  3T6J A;  5L0H A;  3EGX B;  1BR4 A;  3WAQ A;  5JUA A;  2LFF A;  1S7Z A;  4E17 A;  1HE9 A; 
#chains in the Genus database with same CATH homology
 4FAP B;  2FAP B;  1NSG B;  4DRJ B;  3FAP B;  4DRI B;  1AUE A;  5GPG B;  4DRH B;  2RSE B;  2NPU A;  1FAP B;  2GAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...