3EZHA

Crystal structure of the e. coli histidine kinase narx sensor domain in complex with nitrate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
114
Chain Sequence
GSAHAINKAGSLRMQSYRLLAAVPLSEKDKPLIKEMEQTAFSAELTRAAERDGQLAQLQGLQDYWRNELIPALMRAQNRETVSADVSQFVAGLDQLVSGFDRTTEMRIETAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate/nitrite sensor protein narX
publication title Structural Analysis of Ligand Stimulation of the Histidine Kinase NarX.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 40
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.960 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ezhA00
3EZHA 3EZIA
chains in the Genus database with same CATH superfamily
2BL2A 2GWWA 2YKZA 5AC4A 4MTOA 3DI5A 4LACB 2HUJA 3GEEA 3T6BA 1ORYA 2OCCC 2ZXRA 5BQHA 2AU5A 2KC3A 3NRHA 3VYWA 3HLZA 3VRCA 4CS9C 3Q6NA 2R7UA 1A7EA 3H2VA 4ONSA 3LNMB 3ZTZA 5BQIA 5KYNA 1Z63A 2XSEA 4ANJA 5B1AC 1E84A 1ZHZA 1CGNA 3JTLO 1VYIA 2G3KA 3ATPA 3JSEO 3ZIBA 2R7RA 4DRIB 1EA8A 2DB4A 1ZU4A 1OW6A 1NG1A 3LUTB 1M2OA 2M4EA 3A11A 3A9CA 2HKVA 3GANA 5DS6A 2HMQA 3DWWA 4E17A 2YVKA 1V55C 4KBLA 3NYMA 5E2QA 4YT8A 4CSAC 1TWHA 2H7VC 2P0NA 2J9UA 1BR2A 2A6HF 2WVQA 3E70C 4P6IC 3TOLA 2OKUA 3CAXA 1KU2A 1AUEA 2YLDA 2W9YA 3RH3A 5KYYA 1LVKA 3EG9A 2ZXPA 3I5PA 4K7BA 4EBBA 4AE4B 1H7IA 2C04A 2HV6A 2AWCA 2PF4E 3NG1A 3ZWIA 1D1BA 4JCZA 4I44A 3IQTA 1HE9A 1ZYRF 3FHDA 3U5SA 4MVQA 5KYWA 4YN0B 3KH2A 4AX2A 2R05A 5BUOA 4H4KC 4H54A 3DAFA 4N6HA 4WABA 4K1OA 2XM0A 1MMDA 5D91A 1LS4A 2WVNA 2XRHA 4XQ1A 4E0IA 2R7WA 4C7OB 3FDQA 3B0PA 3H65A 3QMKA 3G4ZA 3JYYA 4OIRF 4NTFA 4LERA 4MQ9F 3SXMA 1NLXA 2H7OA 1HMOA 3ABLC 3ASOC 1K05A 5D92A 1OKKA 2AVKA 2NUTB 3MLGA 1RCPA 3AOUA 3SXKA 3AG3C 5F5HA 1WASA 3PCVA 3ZQVA 2I8BA 4DRHB 4EIYA 5JSLA 1RJ9A 1UG7A 4A2NB 2BC5A 2XL6A 2B0JA 4JW1A 3UR3C 5L0HA 1APCA 1NSGB 4U9DA 4EUKB 1LE4A 3EFOA 4XEVA 2YL1A 1U6HA 1M57C 2PBEA 2YWAA 3LESA 3R2PA 5EK0A 2KGOA 1A7VA 3RVYA 1EKYA 2OJQA 3O6XA 2R9RB 3HKKA 4L6RA 2R03A 4W8KA 1LI7A 4ZLDA 2IOQA 4JIOA 1QSPA 1BDJB 2P1AA 4PJLA 5AC5A 4QDLA 1HW2A 3AG4C 3U2MA 3V5ZA 2Y3BA 3K7DA 2CW0F 3I4UA 2CNWA 1BR1A 5L0DA 4FESA 1A41A 2DGJA 2XLOA 4HFKB 4OIPF 2PX0A 4AL1A 4JVSA 3B0UX 3IQCA 2YL7A 4NTAA 4AK9A 2YEVA 1T6IA 1PD0A 1NU7D 3EGXA 2A6EF 1C03A 1YA9A 3HNJA 4I1OB 4IB4A 3AGUA 3GEHA 1RKEA 4E18A 3PHF2 4IAOA 3DAGA 1OKKD 2MHRA 2HSBA 2Q9CA 2WB7A 3C62A 1JMWA 1Z5ZA 1PD1A 3O55A 5KYXB 4P9TA 3RVZA 1QPUA 2IXOA 1SYQA 2YL3A 3KKBA 3KYJA 4BJ5A 1WATA 3HJCA 3AGTA 3DKAA 1T5OA 2DYSC 3MBGA 3NYJA 4Z9HA 1JRAA 4BEJA 3FVYA 1ZHYA 2L6HA 3DE9A 1K04A 4JE9A 2OEVA 3SEOA 3V7OA 1Y6DA 3DM5A 3EH1A 3FOPA 3GWNA 3G50A 3EJNA 5COGA 3TOMA 3IQ5A 4U5CE 1OW7A 4J32B 3RF3A 1YZCA 1SMYF 3NMJA 4YL0A 3US6A 2QLAA 3S27A 3U0CA 3RKOF 4JEBA 5L3QA 2QNLA 5B3SC 2XXAB 4EBKA 4D4XA 1S7ZA 3K1IA 1LE2A 1WOLA 1LM3B 3X1OA 1G4WR 1G4US 2CDQA 4CS8A 4IGGA 4CIHA 4BG0A 2CNWD 3S0XA 2L6GA 3C18A 4JURI 4MTGA 5A6AA 1MMNA 3VAYA 1VTMP 2KQ9A 4DVYP 1HMDA 4O6YA 4BJ6A 1N1CA 3IPMO 4FAPB 3AJMA 3NMKA 2UUIA 2X51A 3U9JA 3L0IA 1CPRA 1YLMA 3U2LA 4Q5SF 4PFOA 3T9OA 4GEHA 3N0TA 3IEEA 2NSFA 3VM6A 3UMKA 1O5HA 2G3VA 3AG1C 4Z9IA 1E2XA 2J8WA 4BPMA 4NC3A 1Q0GA 3H2UA 2XLVA 4C3BA 2PFDA 4MNDA 5JLIA 4O7GA 5JRAA 4CBEA 2LK4A 1WTYA 2OJED 3GEIA 3AG2C 2M64A 2KNHA 2W45A 5CI9A 2Y39A 1JOGA 1OCRC 1ZHTA 2L7AA 2TMVP 4XLPF 2LSEA 2ZD9A 4MW8A 4ULVA 2PP4A 1FNTc 3S90A 5FZTA 1Z23A 3S9OA 5KYYB 5A6JA 1O87A 2Q4FA 3LS1A 4Q4ZF 1OXBA 2ICWG 3ZTMA 1MMGA 1A7DA 4CS9A 2NSGA 3V5XA 5COFA 4N4WA 3N24A 1L3PA 2LQGA 3C8GA 3LNRA 2H7BA 5KYWB 3IQ6A 1V74B 3L1MA 5K0IA 2YHSA 5L0FA 1Q0KA 1T9KA 1FAPB 1ZHWA 2J0XA 3MFNA 5JVEA 3RW0A 5KYUB 2VC9A 4U5EE 2J45A 3JT1A 1Q0MA 2J46A 4XEFA 4CSAA 4G7ZF 2YL0A 3LLIA 1VLTA 4JJGA 3RQEA 4XTKA 2DI3A 3Q7GA 4PK4A 1UFBA 3CZ6A 5FCLA 3EGDB 2B0HA 4MVSA 3KL4A 1NBBA 1MNEA 4G7OF 2AWYA 3JZ0A 3OEOA 4U5BE 3HNLA 1BBHA 1YJGA 4OD4A 2XLEA 1D0ZA 2Q9BA 2VCAA 2ZPAA 2EIMC 3E9VA 4DVZA 1WN0A 3WHNA 1HY5A 2F22A 3ZSUA 2R7VA 4CJGA 3GM1A 2JPUA 1SR2A 1ZHXA 4MVMA 1E86A 4DRJB 3TULA 1YVIA 2IBFA 2RD9A 2HFIA 3EFOB 3FAPB 4I3MA 4C3EA 4YT2A 2V3CC 5JS5A 4JC7A 5CI8A 1M56C 1XZPA 1YYJA 4LDKA 1T01A 1Y4CA 4XLNF 4JKVA 5A6KA 3C8GD 1M6TA 1DOVA 3B29A 1A0BA 2LFDA 3FAJA 4YT5A 1H9TA 4ULWA 4JTCB 3TD7A 2WZFA 3DMDA 2WZLA 2XL8A 4E0HA 2J0WA 3MYIA 2KYHA 4IARA 3SXYA 1HW1A 3RIPA 1NZEA 1ZW2A 2HJMA 4A4AA 5F5FA 5IY5C 2HZ8A 2R02A 3ASNC 4JCHA 1EQ1A 2Y3HA 3EGXB 2WZGA 4BEMJ 4F4BA 2EPKX 1OCZC 2HSQA 1RKCA 1RKEB 2BE5F 2YLGA 4EBJA 5E3AA 1FMVA 5COMA 1J8MF 3O10A 2NPUA 3U8VA 1JPJA 2HS5A 2NUTA 1L7CA 3LJBA 4U5DE 4XPXA 4CS7A 3CSKA 1YAUO 3DZAA 3S28A 1VOMA 3OA1A 3LEOA 5DVWA 3DXJF 3OWTA 2W4MA 2EIJC 5DQZA 4E7ZA 1R4TA 3K1HA 5B3IA 3JCUQ 4IRUA 3ZC4A 2L9JA 1Q0FA 1MQVA 1SZIA 2J9WA 3F47A 4JEAA 2IXNA 4MVUA 4XPWA 1OCCC 2XLHA 3SP1A 3UGOA 1CGME 2XL4A 3RQGA 5JT4A 1PCXA 2AP3A 3BRJA 4NTBA 1WGWA 2OEXA 3SXZA 3PDMP 4HFFB 3V5YA 3NYLA 4WJ0A 4BJ5C 2QE9A 3MYFA 1C17M 3WAQA 4W8PA 3LEVA 4BJTA 4WGYA 1RMVA 1CPQA 2PNOA 1OW8A 2ASRA 2IXPA 5E3CA 4ER9A 1JPNA 5DQTA 3TQOA 4CDVA 2X0CA 1ZVZA 4B6IA 3TJ5A 4CX9A 4GYTA 2Z15A 2R25A 3K6BA 4QI0A 4O6MA 2WL8A 2R7TA 4EHPA 2O9XA 2P61A 3UMHA 2OOCA 4MVOA 2G62A 3C8ZA 1FFTC 5L0IA 1GQAA 5B1BC 1CGOA 2RSEB 3K1IC 3QW0A 4EKWA 2EINC 1G8XA 4CS8C 1AVOB 1V54C 2H8AA 2D4UA 3EHMA 1I4YA 3W2VA 4CDAA 2R7OA 3JYHA 1H6GA 3Q6MA 4JZAA 1F1MA 4KI2A 2XLDA 4RD9A 1GS9A 3HTKC 4OD5A 3L34A 2OU6A 4JTDB 1MNDA 1YARO 2KSFA 1IW7F 1M2VA 2HJ3A 4U5HA 4EWCA 1T6UA 2VCBA 2EILC 3KPHA 3T6GB 1B68A 4YL1A 4DJ9A 1S05A 3POVA 1QLEC 2LP4A 5T1DB 3B71A 4YJWA 3DE8A 3LLKA 1PV3A 3HNIA 3LS0A 1XZQA 4P9FA 3ABMC 3GODA 2ETSA 1LIHA 4JTAB 3C63A 2R7QA 4U9EA 3RQFA 2LCHA 3DD7A 2ZXOA 3C8GB 3JRMO 1NFOA 3M4BA 3Q7LA 1TKNA 2EPMX 3EG9B 3NMIA 1TWAA 3B9QA 4DXWA 2EIKC 2I15A 4G0HA 3FXHA 2IXMA 1E85A 2OQMA 1GM5A 4GQHA 4NY3A 1W2WA 4IWBA 1WWPA 3ABKC 4XPYA 1TFOB 4O79A 2Q9AA 3LAYA 5T3WA 3J06A 1U89A 2EPLX 4MVRA 2CCYA 2NUPA 2MWQA 3G4XA 3L8IA 1G5ZA 2J9VA 1XWJA 3U9MA 3ZDLA 4J7YA 2XS8A 4MVZA 3RFYA 4YWQA 2NG1A 5HV9A 1OCOC 4IJJA 1T6QA 2J7PA 2KJGA 1Z7Qc 2XLWA 5A69A 4XWJA 4YT4A 1D1AA 4DOZA 1GGQA 5L3VA 4OIOF 3AQCA 4O6NA 4QI2A 1U0BB 1OXKA 3GM3A 3ZVRA 3AQBA 2Y3DA 2YLIA 5CIVA 2P6VA 1TFKB 1C02A 1DOWA 1FTSA 3ZG1A 4CIPA 1VK5A 3F46A 2WVOA 1RJ9B 4UDVA 3EZHA 2VASA 3NDBB 4D4NA 4LLEA 2W4BA 2XLMA 5DS4A 4J30B 4IAQA 4WGZA 4J7TA 1YDIA 3I5QA 2FAPB 2IYLD 1J8YF 2XS1A 3QW1A 2KW3C 2VCCA 3JSZA 2HMZA 1D0YA 1FMWA 4MW3A 1AEPA 1FR0A 5F28E 1QKRA 2E87A 3RYLA 5L0JA 1E83A 4OIQF 5KYUA 2JD3A 4AE4A 2ZXWC 3T4RA 3GM2A 4YL3A 1VB5A 4HE8D 2XM4A 4KNVA 4PACA 3PMRA 3SYNA 4JRZA 4FWVA 2GAQA 3DM9B 4R32A 3C7JA 3UMIA 2C03A 4U5FE 1KTMA 2J7PD 2LIGA 4MS2A 3UNGC 2QTVA 3EGDA 4X0RA 1OR2A 2JX0A 4Z9JA 4NCQA 1QVXA 3K66A 4PJJA 4FX5A 1NU9C 4PFPA 3ECSA 3GWLA 1YYXA 3FMSA 4KC9A 1TQGA 3W4YA 4C3DA 4DBQA 3SNHA 4C7OA 4U5GA 2R7SA 1FFHA 1BZ4A 1IZMA 1KNYA 3ITFA 3U3BA 4PJNA 2YZSA 2A68F 2V26A 3U3FA 5BQGA 2EPNA 3TK0A 4BJ1A 2L6FA 5JUAA 3KYIA 4XEKA 3S29A 2EPOA 1RXQA 3SZRA 5DLJA 1LPEA 3K33A 5TJ5E 2QY9A 2Y3GA 4NQFA 2Q7RA 2L81A 3L8JA 3TJ6A 3QVZA 3QZCA 3U8PA 2A1DD 3FOOA 3N2ZB 2CYDA 2OG2A 2Q00A 5L0GA 5JP7A 5EHHA 3W8HA 1HE1A 3W8IA 1I4ZA 5A6BA 4PR9A 1R5ID 3M4CA 2VH3A 4JJFA 2FGYA 1ZU5A 2J9BA 2YQYA 1BR4A 3EPVA 4CJOA 2QUPA 2UUHA 3M1CB 5E33A 2PX3A 2P7VA 3T6JA 1LKXA 1TR2A 3HNKA 5L0CA 1JAFA 1H9GA 1Z3IX 2Q3TA 1OQCA 2GDCA 1MMAA 3JRTA 1I5NA 2GA0A 4E7SA 3UGPA 3EH2A 1VLSA 1VMAA 2LFFA 2MYSA 1LI5A 3GORA 2A69F 4ZLCA 3S84A 4G7HF 2D5RB 3QTHA 2KK1A 1ZW3A 3QVYA 4OINF 3WG7C 4CDYA 1ZZPA 3DJNB 3CQZA 1TWCA 4G78A 2GFHA 5AGFA 5EGYA 1K40A 1QZXA 4K0DA 3W2WA 1SF8A 4AL0A 3EQLF 1M2VB 1OR3A 1Z6AA 2LD6A 1EI7A 1Q0DA 2VB6A 1ORJA 4M63A 3R7CA 4Q7CA 1NFNA 1YZAA 2Y69C 4HEAJ 2DYRC 1ST6A 3MX3A 4N06A 5KYXA 3WODF 4RBNA 2YRFA 2CGEA 3M79A 4BJ6C 1D0XA 3NKEA 1VYKA 3NKDA 4PJMA 5HSWA 1V4AA 3ZQYA 4LDQA 2R7XA 5A6BD 3EHNA 5DS5A 4MTFA 3M15A 2IM8A 2XXAA 1O3UA 4YK5A 3B0VC 2A0UA 4DBRA 1D1CA 3EZIA 4LLCA 3KMIA 4N6CA 4I1MA 3IHUA 3CEXA 2HV7A 1YA7O 5T3TA 1QQ3A 1TWGA 5GPGB 4LDRA 1JR8A 3VF0A 4RDAA 1LS1A 3X2QC 3O39A 2NUPB 4KNWA 3DJUB 256BA 2FFHA 2A0BA 3BEHA 1ORSC
chains in the Genus database with same CATH topology
4LACB 3T6BA 2OCCC 2ZXRA 3VYWA 3NRHA 3HLZA 4CS9C 3Q6NA 2R7UA 5KYNA 1Z63A 2XSEA 4ANJA 5B1AC 1ZHZA 1VYIA 2G3KA 3ZIBA 1ZU4A 1NG1A 1M2OA 2M4EA 3GANA 5DS6A 4CSAC 4KBLA 1V55C 5E2QA 3NYMA 4YT8A 1TWHA 2H7VC 2WVQA 2J9UA 1BR2A 2A6HF 3E70C 4P6IC 1KU2A 3RH3A 2W9YA 5KYYA 1LVKA 3EG9A 2ZXPA 3I5PA 4K7BA 4EBBA 4AE4B 2C04A 2HV6A 2PF4E 3NG1A 1D1BA 4I44A 1ZYRF 3FHDA 5KYWA 4YN0B 3KH2A 4AX2A 5BUOA 4H4KC 3DAFA 1MMDA 5D91A 2WVNA 2XRHA 2R7WA 4C7OB 3FDQA 3B0PA 3H65A 3QMKA 4OIRF 4LERA 4MQ9F 2H7OA 3ASOC 3ABLC 5D92A 1OKKA 2NUTB 3MLGA 3AG3C 5F5HA 2I8BA 1RJ9A 4A2NB 4JW1A 2B0JA 3UR3C 3EFOA 3POVA 1M57C 3LESA 2KGOA 3O6XA 4W8KA 4ZLDA 2IOQA 4PJLA 4QDLA 3AG4C 2Y3BA 3K7DA 2CW0F 3I4UA 2CNWA 1BR1A 4FESA 2DGJA 4OIPF 4HFKB 2PX0A 3B0UX 4JVSA 4AK9A 2YEVA 1PD0A 1NU7D 3EGXA 2A6EF 4I1OB 3PHF2 4IAOA 3DAGA 1OKKD 2Q9CA 2WB7A 1Z5ZA 1PD1A 5KYXB 2IXOA 3KKBA 4BJ5A 3HJCA 2DYSC 3NYJA 4BEJA 3FVYA 1ZHYA 3SEOA 3V7OA 5EGYA 4EWCA 3DM5A 3EH1A 2XXAB 3EJNA 4U5CE 4J32B 1SMYF 3S27A 3RKOF 5L3QA 5B3SC 1S7ZA 3X1OA 2CDQA 4CS8A 4CIHA 4BG0A 2CNWD 3S0XA 4JURI 1MMNA 3VAYA 2KQ9A 4DVYP 4O6YA 4BJ6A 1N1CA 2X51A 3L0IA 4Q5SF 4PFOA 4GEHA 3N0TA 3IEEA 3UMKA 1O5HA 2G3VA 3AG1C 4C3BA 2PFDA 4MNDA 4O7GA 4CBEA 3AG2C 2KNHA 2W45A 5CI9A 2Y39A 1OCRC 1ZHTA 4XLPF 2LSEA 2PP4A 1Z23A 5KYYB 1O87A 3LS1A 4Q4ZF 1MMGA 4CS9A 3N24A 3LNRA 2H7BA 5KYWB 2YHSA 1ZHWA 2J0XA 5KYUB 4U5EE 2J45A 3JT1A 2J46A 4CSAA 4G7ZF 4JJGA 3LLIA 4XTKA 3Q7GA 4PK4A 3CZ6A 5FCLA 3EGDB 3KL4A 1MNEA 4G7OF 3OEOA 4U5BE 4OD4A 1D0ZA 2Q9BA 2ZPAA 2EIMC 3E9VA 4DVZA 3ZSUA 2R7VA 1ZHXA 3EFOB 4I3MA 4C3EA 4YT2A 2V3CC 5CI8A 1M56C 4XLNF 3FAJA 4YT5A 4ULWA 3TD7A 2WZFA 3DMDA 2WZLA 2J0WA 3RIPA 1NZEA 5F5FA 5IY5C 3ASNC 4JCHA 2Y3HA 3EGXB 2WZGA 4F4BA 2R7RA 1OCZC 2BE5F 5E3AA 1FMVA 1J8MF 1JPJA 2NUTA 3LJBA 4U5DE 4CS7A 3CSKA 3DZAA 3S28A 1VOMA 3OA1A 5DVWA 3DXJF 3OWTA 2W4MA 2EIJC 5DQZA 4E7ZA 3K1HA 3JCUQ 4IRUA 3ZC4A 2L9JA 2J9WA 1SZIA 3F47A 3SP1A 3UGOA 2IXNA 1OCCC 2XL4A 1PCXA 1WGWA 4HFFB 3NYLA 4WJ0A 4BJ5C 3LEVA 4BJTA 2IXPA 5E3CA 1JPNA 5DQTA 4B6IA 4GYTA 2Z15A 3K6BA 4QI0A 4O6MA 2WL8A 2R7TA 2O9XA 3UMHA 2G62A 1FFTC 5B1BC 3K1IC 2EINC 1G8XA 4CS8C 1V54C 3EHMA 3W2VA 2R7OA 3JYHA 3Q6MA 4JZAA 4KI2A 4RD9A 3HTKC 4OD5A 3L34A 1MNDA 1IW7F 1M2VA 4U5HA 2EILC 1QLEC 5T1DB 4YJWA 3LLKA 3LS0A 3ABMC 3GODA 2R7QA 3DD7A 2ZXOA 3Q7LA 1TKNA 3EG9B 1TWAA 3B9QA 2EIKC 4G0HA 2IXMA 4NY3A 1W2WA 4IWBA 3ABKC 4O79A 5T3WA 2Q9AA 3LAYA 2NUPA 2J9VA 3RFYA 4YWQA 2NG1A 1OCOC 4IJJA 2J7PA 2KJGA 4XWJA 4YT4A 1D1AA 4DOZA 4OIOF 5L3VA 3AQCA 4O6NA 4QI2A 3ZVRA 3AQBA 2Y3DA 2P6VA 1FTSA 3ZG1A 3F46A 1VK5A 2WVOA 1RJ9B 3EZHA 2VASA 3NDBB 4LLEA 2W4BA 5DS4A 4J30B 3I5QA 2IYLD 1J8YF 2KW3C 3JSZA 1D0YA 1FMWA 2E87A 3RYLA 4OIQF 5KYUA 2JD3A 4AE4A 2ZXWC 3T4RA 4HE8D 4KNVA 3PMRA 3SYNA 4FWVA 3UMIA 3DM9B 2C03A 4U5FE 2J7PD 3UNGC 2QTVA 3EGDA 4X0RA 3K66A 4PJJA 4FX5A 1NU9C 4PFPA 3ECSA 4C3DA 4KC9A 4DBQA 3SNHA 4C7OA 4U5GA 2R7SA 1FFHA 1IZMA 3ITFA 4PJNA 2YZSA 2A68F 2V26A 4BJ1A 3S29A 3SZRA 5DLJA 3K33A 2QY9A 2Y3GA 2L81A 3QZCA 2A1DD 3N2ZB 2OG2A 5EHHA 3W8HA 3W8IA 2VH3A 4JJFA 2FGYA 1ZU5A 1BR4A 3EPVA 3M1CB 5E33A 2PX3A 2P7VA 3T6JA 1LKXA 1TR2A 1Z3IX 2Q3TA 3JRTA 1MMAA 4E7SA 3UGPA 3EH2A 1VMAA 2MYSA 4ZLCA 2A69F 4G7HF 2D5RB 3WG7C 4OINF 3CQZA 3DJNB 1TWCA 2GFHA 1QZXA 4K0DA 3W2WA 1SF8A 3EQLF 1M2VB 1Z6AA 2VB6A 4M63A 4Q7CA 2Y69C 4HEAJ 2DYRC 1ST6A 3MX3A 4N06A 5KYXA 3WODF 4RBNA 2CGEA 4BJ6C 1D0XA 3NKEA 1VYKA 3NKDA 4PJMA 5HSWA 2R7XA 3EHNA 5DS5A 2XXAA 3B0VC 4DBRA 1D1CA 3EZIA 4LLCA 3KMIA 4I1MA 2HV7A 5T3TA 1TWGA 4RDAA 1LS1A 3X2QC 3O39A 2NUPB 4KNWA 3DJUB 2FFHA 2MWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZH A;  3EZI A; 
#chains in the Genus database with same CATH topology
 2BL2 A;  2GWW A;  2YKZ A;  5AC4 A;  4MTO A;  3DI5 A;  4LAC B;  2HUJ A;  3GEE A;  3T6B A;  1ORY A;  2OCC C;  2ZXR A;  5BQH A;  2AU5 A;  2KC3 A;  3NRH A;  3VYW A;  3HLZ A;  3VRC A;  4CS9 C;  3Q6N A;  2R7U A;  1A7E A;  3H2V A;  4ONS A;  3LNM B;  3ZTZ A;  5BQI A;  5KYN A;  1Z63 A;  2XSE A;  4ANJ A;  5B1A C;  1E84 A;  1ZHZ A;  1CGN A;  3JTL O;  1VYI A;  2G3K A;  3ATP A;  3JSE O;  3ZIB A;  2R7R A;  4DRI B;  1EA8 A;  2DB4 A;  1ZU4 A;  1OW6 A;  1NG1 A;  3LUT B;  1M2O A;  2M4E A;  3A11 A;  3A9C A;  2HKV A;  3GAN A;  5DS6 A;  2HMQ A;  3DWW A;  4E17 A;  2YVK A;  1V55 C;  4KBL A;  3NYM A;  5E2Q A;  4YT8 A;  4CSA C;  1TWH A;  2H7V C;  2P0N A;  2J9U A;  1BR2 A;  2A6H F;  2WVQ A;  3E70 C;  4P6I C;  3TOL A;  2OKU A;  3CAX A;  1KU2 A;  1AUE A;  2YLD A;  2W9Y A;  3RH3 A;  5KYY A;  1LVK A;  3EG9 A;  2ZXP A;  3I5P A;  4K7B A;  4EBB A;  4AE4 B;  1H7I A;  2C04 A;  2HV6 A;  2AWC A;  2PF4 E;  3NG1 A;  3ZWI A;  1D1B A;  4JCZ A;  4I44 A;  3IQT A;  1HE9 A;  1ZYR F;  3FHD A;  3U5S A;  4MVQ A;  5KYW A;  4YN0 B;  3KH2 A;  4AX2 A;  2R05 A;  5BUO A;  4H4K C;  4H54 A;  3DAF A;  4N6H A;  4WAB A;  4K1O A;  2XM0 A;  1MMD A;  5D91 A;  1LS4 A;  2WVN A;  2XRH A;  4XQ1 A;  4E0I A;  2R7W A;  4C7O B;  3FDQ A;  3B0P A;  3H65 A;  3QMK A;  3G4Z A;  3JYY A;  4OIR F;  4NTF A;  4LER A;  4MQ9 F;  3SXM A;  1NLX A;  2H7O A;  1HMO A;  3ABL C;  3ASO C;  1K05 A;  5D92 A;  1OKK A;  2AVK A;  2NUT B;  3MLG A;  1RCP A;  3AOU A;  3SXK A;  3AG3 C;  5F5H A;  1WAS A;  3PCV A;  3ZQV A;  2I8B A;  4DRH B;  4EIY A;  5JSL A;  1RJ9 A;  1UG7 A;  4A2N B;  2BC5 A;  2XL6 A;  2B0J A;  4JW1 A;  3UR3 C;  5L0H A;  1APC A;  1NSG B;  4U9D A;  4EUK B;  1LE4 A;  3EFO A;  4XEV A;  2YL1 A;  1U6H A;  1M57 C;  2PBE A;  2YWA A;  3LES A;  3R2P A;  5EK0 A;  2KGO A;  1A7V A;  3RVY A;  1EKY A;  2OJQ A;  3O6X A;  2R9R B;  3HKK A;  4L6R A;  2R03 A;  4W8K A;  1LI7 A;  4ZLD A;  2IOQ A;  4JIO A;  1QSP A;  1BDJ B;  2P1A A;  4PJL A;  5AC5 A;  4QDL A;  1HW2 A;  3AG4 C;  3U2M A;  3V5Z A;  2Y3B A;  3K7D A;  2CW0 F;  3I4U A;  2CNW A;  1BR1 A;  5L0D A;  4FES A;  1A41 A;  2DGJ A;  2XLO A;  4HFK B;  4OIP F;  2PX0 A;  4AL1 A;  4JVS A;  3B0U X;  3IQC A;  2YL7 A;  4NTA A;  4AK9 A;  2YEV A;  1T6I A;  1PD0 A;  1NU7 D;  3EGX A;  2A6E F;  1C03 A;  1YA9 A;  3HNJ A;  4I1O B;  4IB4 A;  3AGU A;  3GEH A;  1RKE A;  4E18 A;  3PHF 2;  4IAO A;  3DAG A;  1OKK D;  2MHR A;  2HSB A;  2Q9C A;  2WB7 A;  3C62 A;  1JMW A;  1Z5Z A;  1PD1 A;  3O55 A;  5KYX B;  4P9T A;  3RVZ A;  1QPU A;  2IXO A;  1SYQ A;  2YL3 A;  3KKB A;  3KYJ A;  4BJ5 A;  1WAT A;  3HJC A;  3AGT A;  3DKA A;  1T5O A;  2DYS C;  3MBG A;  3NYJ A;  4Z9H A;  1JRA A;  4BEJ A;  3FVY A;  1ZHY A;  2L6H A;  3DE9 A;  1K04 A;  4JE9 A;  2OEV A;  3SEO A;  3V7O A;  1Y6D A;  3DM5 A;  3EH1 A;  3FOP A;  3GWN A;  3G50 A;  3EJN A;  5COG A;  3TOM A;  3IQ5 A;  4U5C E;  1OW7 A;  4J32 B;  3RF3 A;  1YZC A;  1SMY F;  3NMJ A;  4YL0 A;  3US6 A;  2QLA A;  3S27 A;  3U0C A;  3RKO F;  4JEB A;  5L3Q A;  2QNL A;  5B3S C;  2XXA B;  4EBK A;  4D4X A;  1S7Z A;  3K1I A;  1LE2 A;  1WOL A;  1LM3 B;  3X1O A;  1G4W R;  1G4U S;  2CDQ A;  4CS8 A;  4IGG A;  4CIH A;  4BG0 A;  2CNW D;  3S0X A;  2L6G A;  3C18 A;  4JUR I;  4MTG A;  5A6A A;  1MMN A;  3VAY A;  1VTM P;  2KQ9 A;  4DVY P;  1HMD A;  4O6Y A;  4BJ6 A;  1N1C A;  3IPM O;  4FAP B;  3AJM A;  3NMK A;  2UUI A;  2X51 A;  3U9J A;  3L0I A;  1CPR A;  1YLM A;  3U2L A;  4Q5S F;  4PFO A;  3T9O A;  4GEH A;  3N0T A;  3IEE A;  2NSF A;  3VM6 A;  3UMK A;  1O5H A;  2G3V A;  3AG1 C;  4Z9I A;  1E2X A;  2J8W A;  4BPM A;  4NC3 A;  1Q0G A;  3H2U A;  2XLV A;  4C3B A;  2PFD A;  4MND A;  5JLI A;  4O7G A;  5JRA A;  4CBE A;  2LK4 A;  1WTY A;  2OJE D;  3GEI A;  3AG2 C;  2M64 A;  2KNH A;  2W45 A;  5CI9 A;  2Y39 A;  1JOG A;  1OCR C;  1ZHT A;  2L7A A;  2TMV P;  4XLP F;  2LSE A;  2ZD9 A;  4MW8 A;  4ULV A;  2PP4 A;  1FNT c;  3S90 A;  5FZT A;  1Z23 A;  3S9O A;  5KYY B;  5A6J A;  1O87 A;  2Q4F A;  3LS1 A;  4Q4Z F;  1OXB A;  2ICW G;  3ZTM A;  1MMG A;  1A7D A;  4CS9 A;  2NSG A;  3V5X A;  5COF A;  4N4W A;  3N24 A;  1L3P A;  2LQG A;  3C8G A;  3LNR A;  2H7B A;  5KYW B;  3IQ6 A;  1V74 B;  3L1M A;  5K0I A;  2YHS A;  5L0F A;  1Q0K A;  1T9K A;  1FAP B;  1ZHW A;  2J0X A;  3MFN A;  5JVE A;  3RW0 A;  5KYU B;  2VC9 A;  4U5E E;  2J45 A;  3JT1 A;  1Q0M A;  2J46 A;  4XEF A;  4CSA A;  4G7Z F;  2YL0 A;  3LLI A;  1VLT A;  4JJG A;  3RQE A;  4XTK A;  2DI3 A;  3Q7G A;  4PK4 A;  1UFB A;  3CZ6 A;  5FCL A;  3EGD B;  2B0H A;  4MVS A;  3KL4 A;  1NBB A;  1MNE A;  4G7O F;  2AWY A;  3JZ0 A;  3OEO A;  4U5B E;  3HNL A;  1BBH A;  1YJG A;  4OD4 A;  2XLE A;  1D0Z A;  2Q9B A;  2VCA A;  2ZPA A;  2EIM C;  3E9V A;  4DVZ A;  1WN0 A;  3WHN A;  1HY5 A;  2F22 A;  3ZSU A;  2R7V A;  4CJG A;  3GM1 A;  2JPU A;  1SR2 A;  1ZHX A;  4MVM A;  1E86 A;  4DRJ B;  3TUL A;  1YVI A;  2IBF A;  2RD9 A;  2HFI A;  3EFO B;  3FAP B;  4I3M A;  4C3E A;  4YT2 A;  2V3C C;  5JS5 A;  4JC7 A;  5CI8 A;  1M56 C;  1XZP A;  1YYJ A;  4LDK A;  1T01 A;  1Y4C A;  4XLN F;  4JKV A;  5A6K A;  3C8G D;  1M6T A;  1DOV A;  3B29 A;  1A0B A;  2LFD A;  3FAJ A;  4YT5 A;  1H9T A;  4ULW A;  4JTC B;  3TD7 A;  2WZF A;  3DMD A;  2WZL A;  2XL8 A;  4E0H A;  2J0W A;  3MYI A;  2KYH A;  4IAR A;  3SXY A;  1HW1 A;  3RIP A;  1NZE A;  1ZW2 A;  2HJM A;  4A4A A;  5F5F A;  5IY5 C;  2HZ8 A;  2R02 A;  3ASN C;  4JCH A;  1EQ1 A;  2Y3H A;  3EGX B;  2WZG A;  4BEM J;  4F4B A;  2EPK X;  1OCZ C;  2HSQ A;  1RKC A;  1RKE B;  2BE5 F;  2YLG A;  4EBJ A;  5E3A A;  1FMV A;  5COM A;  1J8M F;  3O10 A;  2NPU A;  3U8V A;  1JPJ A;  2HS5 A;  2NUT A;  1L7C A;  3LJB A;  4U5D E;  4XPX A;  4CS7 A;  3CSK A;  1YAU O;  3DZA A;  3S28 A;  1VOM A;  3OA1 A;  3LEO A;  5DVW A;  3DXJ F;  3OWT A;  2W4M A;  2EIJ C;  5DQZ A;  4E7Z A;  1R4T A;  3K1H A;  5B3I A;  3JCU Q;  4IRU A;  3ZC4 A;  2L9J A;  1Q0F A;  1MQV A;  1SZI A;  2J9W A;  3F47 A;  4JEA A;  2IXN A;  4MVU A;  4XPW A;  1OCC C;  2XLH A;  3SP1 A;  3UGO A;  1CGM E;  2XL4 A;  3RQG A;  5JT4 A;  1PCX A;  2AP3 A;  3BRJ A;  4NTB A;  1WGW A;  2OEX A;  3SXZ A;  3PDM P;  4HFF B;  3V5Y A;  3NYL A;  4WJ0 A;  4BJ5 C;  2QE9 A;  3MYF A;  1C17 M;  3WAQ A;  4W8P A;  3LEV A;  4BJT A;  4WGY A;  1RMV A;  1CPQ A;  2PNO A;  1OW8 A;  2ASR A;  2IXP A;  5E3C A;  4ER9 A;  1JPN A;  5DQT A;  3TQO A;  4CDV A;  2X0C A;  1ZVZ A;  4B6I A;  3TJ5 A;  4CX9 A;  4GYT A;  2Z15 A;  2R25 A;  3K6B A;  4QI0 A;  4O6M A;  2WL8 A;  2R7T A;  4EHP A;  2O9X A;  2P61 A;  3UMH A;  2OOC A;  4MVO A;  2G62 A;  3C8Z A;  1FFT C;  5L0I A;  1GQA A;  5B1B C;  1CGO A;  2RSE B;  3K1I C;  3QW0 A;  4EKW A;  2EIN C;  1G8X A;  4CS8 C;  1AVO B;  1V54 C;  2H8A A;  2D4U A;  3EHM A;  1I4Y A;  3W2V A;  4CDA A;  2R7O A;  3JYH A;  1H6G A;  3Q6M A;  4JZA A;  1F1M A;  4KI2 A;  2XLD A;  4RD9 A;  1GS9 A;  3HTK C;  4OD5 A;  3L34 A;  2OU6 A;  4JTD B;  1MND A;  1YAR O;  2KSF A;  1IW7 F;  1M2V A;  2HJ3 A;  4U5H A;  4EWC A;  1T6U A;  2VCB A;  2EIL C;  3KPH A;  3T6G B;  1B68 A;  4YL1 A;  4DJ9 A;  1S05 A;  3POV A;  1QLE C;  2LP4 A;  5T1D B;  3B71 A;  4YJW A;  3DE8 A;  3LLK A;  1PV3 A;  3HNI A;  3LS0 A;  1XZQ A;  4P9F A;  3ABM C;  3GOD A;  2ETS A;  1LIH A;  4JTA B;  3C63 A;  2R7Q A;  4U9E A;  3RQF A;  2LCH A;  3DD7 A;  2ZXO A;  3C8G B;  3JRM O;  1NFO A;  3M4B A;  3Q7L A;  1TKN A;  2EPM X;  3EG9 B;  3NMI A;  1TWA A;  3B9Q A;  4DXW A;  2EIK C;  2I15 A;  4G0H A;  3FXH A;  2IXM A;  1E85 A;  2OQM A;  1GM5 A;  4GQH A;  4NY3 A;  1W2W A;  4IWB A;  1WWP A;  3ABK C;  4XPY A;  1TFO B;  4O79 A;  2Q9A A;  3LAY A;  5T3W A;  3J06 A;  1U89 A;  2EPL X;  4MVR A;  2CCY A;  2NUP A;  2MWQ A;  3G4X A;  3L8I A;  1G5Z A;  2J9V A;  1XWJ A;  3U9M A;  3ZDL A;  4J7Y A;  2XS8 A;  4MVZ A;  3RFY A;  4YWQ A;  2NG1 A;  5HV9 A;  1OCO C;  4IJJ A;  1T6Q A;  2J7P A;  2KJG A;  1Z7Q c;  2XLW A;  5A69 A;  4XWJ A;  4YT4 A;  1D1A A;  4DOZ A;  1GGQ A;  5L3V A;  4OIO F;  3AQC A;  4O6N A;  4QI2 A;  1U0B B;  1OXK A;  3GM3 A;  3ZVR A;  3AQB A;  2Y3D A;  2YLI A;  5CIV A;  2P6V A;  1TFK B;  1C02 A;  1DOW A;  1FTS A;  3ZG1 A;  4CIP A;  1VK5 A;  3F46 A;  2WVO A;  1RJ9 B;  4UDV A;  3EZH A;  2VAS A;  3NDB B;  4D4N A;  4LLE A;  2W4B A;  2XLM A;  5DS4 A;  4J30 B;  4IAQ A;  4WGZ A;  4J7T A;  1YDI A;  3I5Q A;  2FAP B;  2IYL D;  1J8Y F;  2XS1 A;  3QW1 A;  2KW3 C;  2VCC A;  3JSZ A;  2HMZ A;  1D0Y A;  1FMW A;  4MW3 A;  1AEP A;  1FR0 A;  5F28 E;  1QKR A;  2E87 A;  3RYL A;  5L0J A;  1E83 A;  4OIQ F;  5KYU A;  2JD3 A;  4AE4 A;  2ZXW C;  3T4R A;  3GM2 A;  4YL3 A;  1VB5 A;  4HE8 D;  2XM4 A;  4KNV A;  4PAC A;  3PMR A;  3SYN A;  4JRZ A;  4FWV A;  2GAQ A;  3DM9 B;  4R32 A;  3C7J A;  3UMI A;  2C03 A;  4U5F E;  1KTM A;  2J7P D;  2LIG A;  4MS2 A;  3UNG C;  2QTV A;  3EGD A;  4X0R A;  1OR2 A;  2JX0 A;  4Z9J A;  4NCQ A;  1QVX A;  3K66 A;  4PJJ A;  4FX5 A;  1NU9 C;  4PFP A;  3ECS A;  3GWL A;  1YYX A;  3FMS A;  4KC9 A;  1TQG A;  3W4Y A;  4C3D A;  4DBQ A;  3SNH A;  4C7O A;  4U5G A;  2R7S A;  1FFH A;  1BZ4 A;  1IZM A;  1KNY A;  3ITF A;  3U3B A;  4PJN A;  2YZS A;  2A68 F;  2V26 A;  3U3F A;  5BQG A;  2EPN A;  3TK0 A;  4BJ1 A;  2L6F A;  5JUA A;  3KYI A;  4XEK A;  3S29 A;  2EPO A;  1RXQ A;  3SZR A;  5DLJ A;  1LPE A;  3K33 A;  5TJ5 E;  2QY9 A;  2Y3G A;  4NQF A;  2Q7R A;  2L81 A;  3L8J A;  3TJ6 A;  3QVZ A;  3QZC A;  3U8P A;  2A1D D;  3FOO A;  3N2Z B;  2CYD A;  2OG2 A;  2Q00 A;  5L0G A;  5JP7 A;  5EHH A;  3W8H A;  1HE1 A;  3W8I A;  1I4Z A;  5A6B A;  4PR9 A;  1R5I D;  3M4C A;  2VH3 A;  4JJF A;  2FGY A;  1ZU5 A;  2J9B A;  2YQY A;  1BR4 A;  3EPV A;  4CJO A;  2QUP A;  2UUH A;  3M1C B;  5E33 A;  2PX3 A;  2P7V A;  3T6J A;  1LKX A;  1TR2 A;  3HNK A;  5L0C A;  1JAF A;  1H9G A;  1Z3I X;  2Q3T A;  1OQC A;  2GDC A;  1MMA A;  3JRT A;  1I5N A;  2GA0 A;  4E7S A;  3UGP A;  3EH2 A;  1VLS A;  1VMA A;  2LFF A;  2MYS A;  1LI5 A;  3GOR A;  2A69 F;  4ZLC A;  3S84 A;  4G7H F;  2D5R B;  3QTH A;  2KK1 A;  1ZW3 A;  3QVY A;  4OIN F;  3WG7 C;  4CDY A;  1ZZP A;  3DJN B;  3CQZ A;  1TWC A;  4G78 A;  2GFH A;  5AGF A;  5EGY A;  1K40 A;  1QZX A;  4K0D A;  3W2W A;  1SF8 A;  4AL0 A;  3EQL F;  1M2V B;  1OR3 A;  1Z6A A;  2LD6 A;  1EI7 A;  1Q0D A;  2VB6 A;  1ORJ A;  4M63 A;  3R7C A;  4Q7C A;  1NFN A;  1YZA A;  2Y69 C;  4HEA J;  2DYR C;  1ST6 A;  3MX3 A;  4N06 A;  5KYX A;  3WOD F;  4RBN A;  2YRF A;  2CGE A;  3M79 A;  4BJ6 C;  1D0X A;  3NKE A;  1VYK A;  3NKD A;  4PJM A;  5HSW A;  1V4A A;  3ZQY A;  4LDQ A;  2R7X A;  5A6B D;  3EHN A;  5DS5 A;  4MTF A;  3M15 A;  2IM8 A;  2XXA A;  1O3U A;  4YK5 A;  3B0V C;  2A0U A;  4DBR A;  1D1C A;  3EZI A;  4LLC A;  3KMI A;  4N6C A;  4I1M A;  3IHU A;  3CEX A;  2HV7 A;  1YA7 O;  5T3T A;  1QQ3 A;  1TWG A;  5GPG B;  4LDR A;  1JR8 A;  3VF0 A;  4RDA A;  1LS1 A;  3X2Q C;  3O39 A;  2NUP B;  4KNW A;  3DJU B;  256B A;  2FFH A;  2A0B A;  3BEH A;  1ORS C; 
#chains in the Genus database with same CATH homology
 4LAC B;  3T6B A;  2OCC C;  2ZXR A;  3VYW A;  3NRH A;  3HLZ A;  4CS9 C;  3Q6N A;  2R7U A;  5KYN A;  1Z63 A;  2XSE A;  4ANJ A;  5B1A C;  1ZHZ A;  1VYI A;  2G3K A;  3ZIB A;  1ZU4 A;  1NG1 A;  1M2O A;  2M4E A;  3GAN A;  5DS6 A;  4CSA C;  4KBL A;  1V55 C;  5E2Q A;  3NYM A;  4YT8 A;  1TWH A;  2H7V C;  2WVQ A;  2J9U A;  1BR2 A;  2A6H F;  3E70 C;  4P6I C;  1KU2 A;  3RH3 A;  2W9Y A;  5KYY A;  1LVK A;  3EG9 A;  2ZXP A;  3I5P A;  4K7B A;  4EBB A;  4AE4 B;  2C04 A;  2HV6 A;  2PF4 E;  3NG1 A;  1D1B A;  4I44 A;  1ZYR F;  3FHD A;  5KYW A;  4YN0 B;  3KH2 A;  4AX2 A;  5BUO A;  4H4K C;  3DAF A;  1MMD A;  5D91 A;  2WVN A;  2XRH A;  2R7W A;  4C7O B;  3FDQ A;  3B0P A;  3H65 A;  3QMK A;  4OIR F;  4LER A;  4MQ9 F;  2H7O A;  3ASO C;  3ABL C;  5D92 A;  1OKK A;  2NUT B;  3MLG A;  3AG3 C;  5F5H A;  2I8B A;  1RJ9 A;  4A2N B;  4JW1 A;  2B0J A;  3UR3 C;  3EFO A;  3POV A;  1M57 C;  3LES A;  2KGO A;  3O6X A;  4W8K A;  4ZLD A;  2IOQ A;  4PJL A;  4QDL A;  3AG4 C;  2Y3B A;  3K7D A;  2CW0 F;  3I4U A;  2CNW A;  1BR1 A;  4FES A;  2DGJ A;  4OIP F;  4HFK B;  2PX0 A;  3B0U X;  4JVS A;  4AK9 A;  2YEV A;  1PD0 A;  1NU7 D;  3EGX A;  2A6E F;  4I1O B;  3PHF 2;  4IAO A;  3DAG A;  1OKK D;  2Q9C A;  2WB7 A;  1Z5Z A;  1PD1 A;  5KYX B;  2IXO A;  3KKB A;  4BJ5 A;  3HJC A;  2DYS C;  3NYJ A;  4BEJ A;  3FVY A;  1ZHY A;  3SEO A;  3V7O A;  5EGY A;  4EWC A;  3DM5 A;  3EH1 A;  2XXA B;  3EJN A;  4U5C E;  4J32 B;  1SMY F;  3S27 A;  3RKO F;  5L3Q A;  5B3S C;  1S7Z A;  3X1O A;  2CDQ A;  4CS8 A;  4CIH A;  4BG0 A;  2CNW D;  3S0X A;  4JUR I;  1MMN A;  3VAY A;  2KQ9 A;  4DVY P;  4O6Y A;  4BJ6 A;  1N1C A;  2X51 A;  3L0I A;  4Q5S F;  4PFO A;  4GEH A;  3N0T A;  3IEE A;  3UMK A;  1O5H A;  2G3V A;  3AG1 C;  4C3B A;  2PFD A;  4MND A;  4O7G A;  4CBE A;  3AG2 C;  2KNH A;  2W45 A;  5CI9 A;  2Y39 A;  1OCR C;  1ZHT A;  4XLP F;  2LSE A;  2PP4 A;  1Z23 A;  5KYY B;  1O87 A;  3LS1 A;  4Q4Z F;  1MMG A;  4CS9 A;  3N24 A;  3LNR A;  2H7B A;  5KYW B;  2YHS A;  1ZHW A;  2J0X A;  5KYU B;  4U5E E;  2J45 A;  3JT1 A;  2J46 A;  4CSA A;  4G7Z F;  4JJG A;  3LLI A;  4XTK A;  3Q7G A;  4PK4 A;  3CZ6 A;  5FCL A;  3EGD B;  3KL4 A;  1MNE A;  4G7O F;  3OEO A;  4U5B E;  4OD4 A;  1D0Z A;  2Q9B A;  2ZPA A;  2EIM C;  3E9V A;  4DVZ A;  3ZSU A;  2R7V A;  1ZHX A;  3EFO B;  4I3M A;  4C3E A;  4YT2 A;  2V3C C;  5CI8 A;  1M56 C;  4XLN F;  3FAJ A;  4YT5 A;  4ULW A;  3TD7 A;  2WZF A;  3DMD A;  2WZL A;  2J0W A;  3RIP A;  1NZE A;  5F5F A;  5IY5 C;  3ASN C;  4JCH A;  2Y3H A;  3EGX B;  2WZG A;  4F4B A;  2R7R A;  1OCZ C;  2BE5 F;  5E3A A;  1FMV A;  1J8M F;  1JPJ A;  2NUT A;  3LJB A;  4U5D E;  4CS7 A;  3CSK A;  3DZA A;  3S28 A;  1VOM A;  3OA1 A;  5DVW A;  3DXJ F;  3OWT A;  2W4M A;  2EIJ C;  5DQZ A;  4E7Z A;  3K1H A;  3JCU Q;  4IRU A;  3ZC4 A;  2L9J A;  2J9W A;  1SZI A;  3F47 A;  3SP1 A;  3UGO A;  2IXN A;  1OCC C;  2XL4 A;  1PCX A;  1WGW A;  4HFF B;  3NYL A;  4WJ0 A;  4BJ5 C;  3LEV A;  4BJT A;  2IXP A;  5E3C A;  1JPN A;  5DQT A;  4B6I A;  4GYT A;  2Z15 A;  3K6B A;  4QI0 A;  4O6M A;  2WL8 A;  2R7T A;  2O9X A;  3UMH A;  2G62 A;  1FFT C;  5B1B C;  3K1I C;  2EIN C;  1G8X A;  4CS8 C;  1V54 C;  3EHM A;  3W2V A;  2R7O A;  3JYH A;  3Q6M A;  4JZA A;  4KI2 A;  4RD9 A;  3HTK C;  4OD5 A;  3L34 A;  1MND A;  1IW7 F;  1M2V A;  4U5H A;  2EIL C;  1QLE C;  5T1D B;  4YJW A;  3LLK A;  3LS0 A;  3ABM C;  3GOD A;  2R7Q A;  3DD7 A;  2ZXO A;  3Q7L A;  1TKN A;  3EG9 B;  1TWA A;  3B9Q A;  2EIK C;  4G0H A;  2IXM A;  4NY3 A;  1W2W A;  4IWB A;  3ABK C;  4O79 A;  5T3W A;  2Q9A A;  3LAY A;  2NUP A;  2J9V A;  3RFY A;  4YWQ A;  2NG1 A;  1OCO C;  4IJJ A;  2J7P A;  2KJG A;  4XWJ A;  4YT4 A;  1D1A A;  4DOZ A;  4OIO F;  5L3V A;  3AQC A;  4O6N A;  4QI2 A;  3ZVR A;  3AQB A;  2Y3D A;  2P6V A;  1FTS A;  3ZG1 A;  3F46 A;  1VK5 A;  2WVO A;  1RJ9 B;  3EZH A;  2VAS A;  3NDB B;  4LLE A;  2W4B A;  5DS4 A;  4J30 B;  3I5Q A;  2IYL D;  1J8Y F;  2KW3 C;  3JSZ A;  1D0Y A;  1FMW A;  2E87 A;  3RYL A;  4OIQ F;  5KYU A;  2JD3 A;  4AE4 A;  2ZXW C;  3T4R A;  4HE8 D;  4KNV A;  3PMR A;  3SYN A;  4FWV A;  3UMI A;  3DM9 B;  2C03 A;  4U5F E;  2J7P D;  3UNG C;  2QTV A;  3EGD A;  4X0R A;  3K66 A;  4PJJ A;  4FX5 A;  1NU9 C;  4PFP A;  3ECS A;  4C3D A;  4KC9 A;  4DBQ A;  3SNH A;  4C7O A;  4U5G A;  2R7S A;  1FFH A;  1IZM A;  3ITF A;  4PJN A;  2YZS A;  2A68 F;  2V26 A;  4BJ1 A;  3S29 A;  3SZR A;  5DLJ A;  3K33 A;  2QY9 A;  2Y3G A;  2L81 A;  3QZC A;  2A1D D;  3N2Z B;  2OG2 A;  5EHH A;  3W8H A;  3W8I A;  2VH3 A;  4JJF A;  2FGY A;  1ZU5 A;  1BR4 A;  3EPV A;  3M1C B;  5E33 A;  2PX3 A;  2P7V A;  3T6J A;  1LKX A;  1TR2 A;  1Z3I X;  2Q3T A;  3JRT A;  1MMA A;  4E7S A;  3UGP A;  3EH2 A;  1VMA A;  2MYS A;  4ZLC A;  2A69 F;  4G7H F;  2D5R B;  3WG7 C;  4OIN F;  3CQZ A;  3DJN B;  1TWC A;  2GFH A;  1QZX A;  4K0D A;  3W2W A;  1SF8 A;  3EQL F;  1M2V B;  1Z6A A;  2VB6 A;  4M63 A;  4Q7C A;  2Y69 C;  4HEA J;  2DYR C;  1ST6 A;  3MX3 A;  4N06 A;  5KYX A;  3WOD F;  4RBN A;  2CGE A;  4BJ6 C;  1D0X A;  3NKE A;  1VYK A;  3NKD A;  4PJM A;  5HSW A;  2R7X A;  3EHN A;  5DS5 A;  2XXA A;  3B0V C;  4DBR A;  1D1C A;  3EZI A;  4LLC A;  3KMI A;  4I1M A;  2HV7 A;  5T3T A;  1TWG A;  4RDA A;  1LS1 A;  3X2Q C;  3O39 A;  2NUP B;  4KNW A;  3DJU B;  2FFH A;  2MWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...