3EZHA

Crystal structure of the e. coli histidine kinase narx sensor domain in complex with nitrate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
114
Chain Sequence
GSAHAINKAGSLRMQSYRLLAAVPLSEKDKPLIKEMEQTAFSAELTRAAERDGQLAQLQGLQDYWRNELIPALMRAQNRETVSADVSQFVAGLDQLVSGFDRTTEMRIETAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nitrate/nitrite sensor protein narX
publication title Structural Analysis of Ligand Stimulation of the Histidine Kinase NarX.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 40
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.960 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ezhA00
3EZHA 3EZIA
chains in the Genus database with same CATH superfamily
3FOPA 4EWCA 4GQHA 2KQ9A 3O6XA 4LLEA 4RD9A 2A6EF 4JC7A 2MYSA 2RD9A 2AVKA 3R7CA 1C03A 3AGTA 1TWCA 1VMAA 2YVKA 4K0DA 4PR9A 3LUTB 4CDYA 3DE8A 3EQLF 1JR8A 1BBHA 1LE2A 3RH3A 5HSWA 2P0NA 1TKNA 2A6HF 3NYLA 3SNHA 3BEHA 2IBFA 1HY5A 4FAPB 4EBJA 4C7OA 3JZ0A 1FNTc 5IY5C 2Q00A 1M2OA 5KYUA 1TWAA 5DS6A 1YZCA 3MYIA 3B0UX 3ABLC 1NLXA 1DOVA 4MQ9F 3TJ5A 3J06A 1OQCA 3DWWA 3EGDA 2Y69C 2CCYA 1YLMA 1J8MF 2HV6A 2EPMX 2HKVA 3LESA 2EIKC 1FR0A 1NBBA 2AWYA 3KMIA 2J9VA 2XLVA 2LQGA 2GWWA 4MVUA 3UMHA 1BR4A 1K05A 4PJNA 2NPUA 2YWAA 5JUAA 1PD1A 3OEOA 1LI7A 4JW1A 2OKUA 4NTFA 5L0CA 1R4TA 3AG1C 4YL0A 2PNOA 3LLIA 1JMWA 1JPJA 1Q0GA 1YVIA 2YLDA 3PMRA 4I3MA 1Z6AA 3VRCA 1OKKD 2PBEA 3IQ6A 2GDCA 1YA9A 2Y3HA 4W8KA 5AGFA 4Z9JA 4JCZA 2J9BA 3U9JA 1I5NA 5B3SC 1V4AA 2JX0A 2ZXWC 3I5PA 1RCPA 3K1IA 4JVSA 4C3BA 2VB6A 4EBBA 3EG9A 4W8PA 2EIMC 4XPYA 3TOMA 4IJJA 2P1AA 4NCQA 2OEVA 1WTYA 4KNVA 4BG0A 1ZVZA 3LLKA 4MS2A 4DOZA 1PV3A 2R02A 3Q7LA 4K7BA 1ORJA 3HNLA 5L0IA 2B0HA 1SMYF 2NUPA 4I1MA 3SEOA 1NU9C 1ZYRF 2XLHA 4MNDA 3ZDLA 1ZHTA 3WODF 3C8ZA 1D0YA 3LJBA 3ZG1A 5KYXB 1MMGA 3QVZA 4XPXA 3JRMO 3K7DA 2XS1A 4ULWA 4CJOA 2YLGA 1PD0A 1UFBA 5DLJA 1MNDA 2Q4FA 3NMIA 5B1AC 4E7SA 2HMQA 4CIPA 4E17A 1HE1A 1A0BA 1XWJA 1QLEC 3C62A 1JOGA 2P61A 3H2UA 4YWQA 4G7HF 5FCLA 2VH3A 2R7VA 1JAFA 1ZHWA 4M63A 1CGME 4L6RA 4IARA 1CGNA 1D0ZA 1XZQA 1SR2A 2HFIA 2J7PA 3ASNC 4PJJA 4MVZA 3K33A 1NFOA 3RQEA 3U3FA 2ZXRA 4CJGA 1ZU4A 1ST6A 2B0JA 3FXHA 3EGXB 3QW1A 2NUTB 4U5DE 5AC4A 5DS4A 1RMVA 1AEPA 3KYJA 2Y3DA 4CDAA 5T1DB 4KC9A 2IXPA 2IXMA 4JKVA 1M6TA 4KNWA 2L9JA 2XL6A 4JZAA 3RIPA 1TWGA 3GEEA 2CW0F 3QTHA 1LE4A 1A7EA 2XL8A 1IZMA 1K40A 2G62A 3GM2A 3QZCA 4NQFA 1S05A 3DM5A 1PCXA 1OW6A 2CDQA 2VCBA 4BJTA 4IAOA 2R7SA 3E9VA 3NRHA 1L7CA 1HMDA 2DB4A 4ER9A 4C3DA 1LIHA 5JS5A 4IB4A 4CSAC 3ABMC 1VK5A 1OR3A 4AE4B 1YJGA 2R05A 2Y3GA 3U0CA 1ZW3A 3POVA 3CQZA 4ZLDA 2OG2A 4LLCA 3AQBA 2J9WA 2PF4E 4XLPF 3EFOB 2D4UA 3O10A 4DBQA 1ZHZA 2EINC 3U5SA 2XS8A 2XL4A 3DM9B 2QE9A 4O6NA 4N4WA 4H54A 2VC9A 2XLOA 3RQFA 4EKWA 1ZZPA 1YDIA 3TOLA 5KYWB 1LS1A 4D4XA 2FGYA 3U8PA 2OOCA 3CSKA 1OXBA 3UNGC 3LS1A 4J7YA 4XPWA 2YKZA 3C8GB 1AVOB 4YK5A 3T6GB 1KNYA 3KYIA 4YL3A 2VCCA 4PFOA 1QPUA 3JSEO 2YEVA 2CNWA 2XM4A 5EK0A 2IYLD 1E86A 4YT5A 3H2VA 2J45A 1GM5A 3S0XA 4O79A 2KSFA 5JVEA 1MMAA 2GAQA 4YT4A 3GODA 2OU6A 1VYIA 1WOLA 3ZVRA 1C17M 3EZHA 5B1BC 3KH2A 3ECSA 4N06A 2QY9A 2AWCA 2PFDA 3AGUA 2EPLX 3ATPA 1JRAA 1WN0A 4J30B 1VYKA 4NTBA 1H6GA 3W2WA 3OA1A 3FHDA 2LSEA 1DOWA 4HFFB 4CIHA 2L6FA 1VLTA 1L3PA 1T5OA 2HJ3A 1JPNA 2IXNA 3DJUB 3X1OA 4HE8D 2CYDA 3T6JA 3TQOA 5JP7A 5L0FA 2Q9BA 2QTVA 2LFDA 2J46A 1M56C 2KGOA 3G4XA 2J7PD 4DRIB 3PDMP 1KU2A 4WGYA 3FVYA 4FESA 2P7VA 2EILC 1Z7Qc 2ZPAA 4DXWA 5CIVA 2YZSA 3T4RA 5EGYA 3GEIA 4ULVA 1VB5A 2DI3A 4B6IA 1T6IA 4CS9C 3H65A 1Z63A 1G4WR 5DVWA 4FWVA 3NMJA 2LP4A 4LDKA 3DI5A 4GYTA 4K1OA 1J8YF 2A68F 4PJLA 3N24A 3V5YA 1E85A 3VYWA 3IHUA 4NY3A 1OCCC 3T9OA 2JPUA 3GORA 1G8XA 4XQ1A 4BJ6A 3UGOA 2TMVP 2YHSA 1RKEB 1V55C 2J0WA 4U9EA 3B0VC 3FOOA 2YRFA 3LEOA 3NKEA 3U9MA 5HV9A 4CSAA 2XXAA 4MW8A 3JSZA 4XEKA 3VM6A 1YZAA 3CEXA 2L6HA 2HJMA 5FZTA 2F22A 1BR2A 5COMA 2BL2A 3DD7A 4XEVA 4D4NA 3K66A 5E3CA 4JEAA 4O7GA 2WVQA 3B0PA 3WHNA 2DYRC 4DRJB 1FAPB 1U89A 5KYYB 1LM3B 1G5ZA 1T6UA 1A41A 3NMKA 256BA 2A0BA 2GFHA 3KKBA 4CS8A 3UGPA 4I1OB 4Q7CA 3L8IA 2Z15A 2PP4A 1EQ1A 2DGJA 4IAQA 3IEEA 4U5HA 3PHF2 4BJ1A 5F5FA 3MX3A 3LEVA 2R7TA 3UR3C 1TWHA 3UMKA 1V74B 1MQVA 3VAYA 2WZGA 1LS4A 1NSGB 3GM3A 2C03A 3R2PA 1R5ID 3ZC4A 4U5FE 4U5GA 1NZEA 1RXQA 5E3AA 4O6YA 4AL0A 4OIPF 4EBKA 2NSGA 5COFA 4A2NB 1D1BA 3A9CA 5DQZA 1FMVA 4BEJA 1M57C 3FDQA 3HKKA 4MVRA 5COGA 1W2WA 2WZLA 1EI7A 1TQGA 3EZIA 3RF3A 3U8VA 3ZIBA 4JURI 4ZLCA 1M2VB 2EPNA 4EHPA 2Q9AA 3NKDA 3JCUQ 2R9RB 2C04A 2FFHA 1MMDA 1O5HA 3ASOC 5F5HA 4Q4ZF 4P9FA 3VF0A 1OW8A 1SF8A 2HSQA 1OW7A 3CAXA 4JTDB 4YJWA 2E87A 4Z9HA 3L34A 3S29A 1NFNA 1TFKB 1Q0KA 3EJNA 1E84A 3T6BA 4AL1A 1N1CA 3DKAA 4A4AA 2XSEA 3JRTA 5BQHA 2A1DD 3DMDA 2L7AA 1WGWA 3DAGA 1YAUO 3O39A 4OIQF 1F1MA 2RSEB 3SXKA 4DVZA 4JJFA 4BJ5C 2EPKX 2O9XA 1U0BB 1O87A 4YN0B 1IW7F 2YL3A 3IQTA 4ANJA 3C7JA 1K04A 4CS9A 3U2MA 1RJ9B 3PCVA 1S7ZA 2W9YA 4G78A 2WZFA 2YL1A 3LNMB 3M79A 1VOMA 4G0HA 1H9GA 2A69F 4YL1A 4QDLA 1XZPA 2JD3A 2X51A 5A6BA 2EIJC 3SZRA 3TK0A 1AUEA 2LIGA 1A7DA 1YARO 2MWQA 2ASRA 2I8BA 1ZHYA 5JSLA 3EPVA 2Q7RA 3GM1A 5F28E 2V26A 5KYXA 4N6HA 2MHRA 2KNHA 1CPQA 1LPEA 1Y6DA 3I4UA 4WJ0A 4X0RA 4O6MA 4I44A 5T3WA 5L3QA 1ZU5A 5JRAA 1QQ3A 4MVMA 4MTGA 3TD7A 3B71A 1OCOC 4E0IA 2ETSA 2Y39A 1NG1A 3U3BA 4E0HA 4C7OB 1TFOB 3DE9A 4JEBA 2ICWG 4GEHA 4PJMA 3SXZA 5KYUB 3EH2A 2YL0A 3C63A 3E70C 2HMZA 2WB7A 3F47A 3B9QA 2FAPB 2HUJA 3A11A 4R32A 1Z3IX 5L0HA 3EH1A 3EGDB 1LI5A 1VLSA 1OR2A 3EGXA 2NUTA 4XLNF 2KJGA 3L0IA 1FMWA 2D5RB 3EHNA 2ZD9A 4MTFA 1SYQA 2A0UA 2YL7A 4BEMJ 2R7XA 2R7QA 2IXOA 3AOUA 3KPHA 3NYJA 3G4ZA 2R7RA 3QW0A 4EUKB 4UDVA 4NC3A 1OCZC 2KK1A 2Q3TA 3BRJA 3JT1A 4PK4A 4DRHB 3NDBB 3DXJF 1KTMA 1LVKA 4LACB 2BC5A 4LERA 3SXYA 4AE4A 1GGQA 3LS0A 3GEHA 5KYYA 4N6CA 4HFKB 4XTKA 1QZXA 4OD4A 2YLIA 4U9DA 3EFOA 3G50A 3GANA 1HW1A 2L6GA 3DJNB 3EG9B 3MFNA 2HS5A 3O55A 4PFPA 4P6IC 4U5CE 5AC5A 1OXKA 5EHHA 3QVYA 5BUOA 1NU7D 2Q9CA 4MVOA 3W8HA 4RDAA 2R25A 1ZHXA 5DQTA 1E83A 2UUIA 2LFFA 1YYXA 4E7ZA 2IOQA 4IGGA 1Q0MA 2L81A 1WWPA 2NUPB 3WAQA 5KYWA 3V5ZA 1I4ZA 4BJ5A 1EKYA 1Z23A 2GA0A 3ZTZA 3C8GA 1VTMP 3M4BA 4G7ZF 1Q0FA 1T01A 2M64A 3EHMA 5L0JA 3KL4A 3RVZA 3QMKA 5CI9A 4U5BE 3M15A 4JJGA 3S84A 1QVXA 1WASA 2IM8A 4ONSA 2R03A 3AG4C 3HNIA 3JTLO 5BQIA 3RFYA 1YA7O 3JYYA 1B68A 4WABA 4J7TA 5A6BD 4Z9IA 3DZAA 1GS9A 4E18A 3MBGA 1FFHA 2H8AA 1WATA 3ZQYA 2ZXOA 2VCAA 1Y4CA 1EA8A 3AQCA 3ZSUA 2AP3A 3ABKC 1HW2A 1T6QA 3GWNA 2WL8A 3Q7GA 4CBEA 3L8JA 2DYSC 3B29A 4P9TA 3GWLA 2QUPA 1D0XA 2OCCC 3ZTMA 3N2ZB 2HSBA 2LD6A 3AJMA 1LKXA 3C18A 3IPMO 3Q6MA 2EPOA 3LAYA 2CNWD 3SYNA 2PX3A 4KBLA 2WVOA 3WG7C 3ZWIA 1FTSA 1G4US 2W4BA 3HLZA 3ZQVA 4NTAA 5E33A 1D1CA 4JRZA 1BZ4A 2OJQA 2Y3BA 2WVNA 2XLEA 3W4YA 1OCRC 4DVYP 3F46A 3K1HA 3AG3C 3M4CA 4JE9A 2KYHA 3TULA 1E2XA 3NG1A 5A69A 1H7IA 1A7VA 4KI2A 1I4YA 4MW3A 5TJ5E 2W45A 3US6A 3MYFA 1RKEA 5JT4A 2NG1A 2I15A 3L1MA 3AG2C 1MMNA 5B3IA 2XRHA 3HJCA 2LK4A 3U2LA 3RW0A 3IQCA 5JLIA 4LDQA 4WGZA 2R7WA 4RBNA 4XWJA 3RYLA 4Q5SF 5K0IA 4XEFA 5L0DA 1CGOA 3SXMA 2PX0A 1APCA 4AK9A 3FAJA 4JCHA 3TJ6A 4F4BA 5GPGB 3LNRA 3S27A 1FFTC 4OINF 3N0TA 1HE9A 4YT8A 3RKOF 2BE5F 4YT2A 2G3KA 5E2QA 3HNKA 2X0CA 1TR2A 2R7OA 4FX5A 4U5EE 4JTCB 4BPMA 4QI0A 3HTKC 1Z5ZA 3S90A 2V3CC 1YYJA 2ZXPA 4CX9A 5A6KA 3W8IA 3K6BA 1V54C 5T3TA 2XM0A 2P6VA 2XLMA 3JYHA 4QI2A 5BQGA 4G7OF 2J9UA 3C8GD 2J0XA 4BJ6C 4C3EA 1C02A 4J32B 1BDJB 4IWBA 4JIOA 1GQAA 1ZW2A 5A6AA 1OKKA 4PACA 2M4EA 5KYNA 4CS7A 4JTAB 2CGEA 2OJED 4MTOA 4OD5A 1HMOA 1ORSC 5D92A 2YQYA 3RQGA 3S28A 1M2VA 3V7OA 1SZIA 1QKRA 2KC3A 3W2VA 3K1IC 3V5XA 2XLWA 3FAPB 5L3VA 4CDVA 4OIOF 2VASA 1D1AA 2W4MA 2J8WA 2H7VC 2G3VA 4IRUA 5DS5A 1ORYA 4AX2A 3SP1A 3IQ5A 4CS8C 4HEAJ 3MLGA 2H7OA 2XLDA 3FMSA 3X2QC 2HV7A 2OQMA 3Q6NA 4LDRA 4OIRF 1CPRA 3I5QA 1H9TA 4H4KC 4DJ9A 1T9KA 4MVQA 2QLAA 5CI8A 1MNEA 1Q0DA 1UG7A 3M1CB 3RVYA 2XXAB 1O3UA 1RKCA 1RJ9A 3CZ6A 3UMIA 2HZ8A 2LCHA 2H7BA 2R7UA 3S9OA 2OEXA 2UUHA 3NYMA 3OWTA 1QSPA 4MVSA 2QNLA 4DBRA 5D91A 2AU5A 1U6HA 2NSFA 3DAFA 3ITFA 5A6JA 5L0GA 2KW3C 4EIYA 1BR1A 3HNJA
chains in the Genus database with same CATH topology
4EWCA 4LLEA 2KQ9A 3O6XA 4RD9A 3POVA 2A6EF 2MYSA 1TWCA 1VMAA 4K0DA 3EQLF 3RH3A 5HSWA 1TKNA 2A6HF 3NYLA 3SNHA 4C7OA 5IY5C 1M2OA 5KYUA 1TWAA 5DS6A 3B0UX 3ABLC 4MQ9F 3EGDA 2Y69C 1J8MF 2HV6A 3LESA 2EIKC 3KMIA 2J9VA 3UMHA 1BR4A 4PJNA 1PD1A 3OEOA 4JW1A 3AG1C 3LLIA 1JPJA 3PMRA 4I3MA 1Z6AA 1OKKD 2Y3HA 4W8KA 5B3SC 2ZXWC 3I5PA 4JVSA 4C3BA 2VB6A 4EBBA 3EG9A 2EIMC 4IJJA 4KNVA 4BG0A 3LLKA 4DOZA 3Q7LA 4K7BA 2NUPA 1SMYF 3SEOA 4I1MA 1NU9C 1ZYRF 4MNDA 1ZHTA 3WODF 1D0YA 3LJBA 3ZG1A 5KYXB 1MMGA 3K7DA 4ULWA 1PD0A 5DLJA 1MNDA 5B1AC 4E7SA 1QLEC 4YWQA 2R7VA 5FCLA 2VH3A 1ZHWA 4M63A 1D0ZA 2J7PA 3ASNC 4PJJA 3K33A 2ZXRA 1ZU4A 1ST6A 2B0JA 4U5DE 3EGXB 2NUTB 5DS4A 2Y3DA 5T1DB 4KC9A 2IXPA 2IXMA 4KNWA 4JZAA 3RIPA 2L9JA 1TWGA 2CW0F 1IZMA 2G62A 3QZCA 3DM5A 1PCXA 2CDQA 4BJTA 4IAOA 2R7SA 3E9VA 3NRHA 4C3DA 4CSAC 3ABMC 1VK5A 4AE4B 2Y3GA 3CQZA 4ZLDA 2OG2A 4LLCA 3AQBA 2J9WA 2PF4E 4XLPF 3EFOB 4DBQA 1ZHZA 2EINC 2XL4A 3DM9B 4O6NA 5KYWB 1LS1A 2FGYA 3CSKA 3UNGC 3LS1A 4PFOA 2YEVA 2CNWA 2IYLD 4YT5A 2J45A 3S0XA 4O79A 1MMAA 4YT4A 3GODA 1VYIA 3ZVRA 3EZHA 5B1BC 3KH2A 3ECSA 4N06A 2QY9A 2PFDA 4J30B 1VYKA 3W2WA 3OA1A 3FHDA 2LSEA 4HFFB 4CIHA 1JPNA 2IXNA 3DJUB 3X1OA 4HE8D 3T6JA 2Q9BA 2QTVA 2J46A 1M56C 2KGOA 2J7PD 1KU2A 3FVYA 4FESA 2P7VA 2EILC 2ZPAA 5EGYA 2YZSA 3T4RA 1Z63A 4CS9C 4B6IA 3H65A 5DVWA 4FWVA 4GYTA 1J8YF 2A68F 4PJLA 3N24A 3VYWA 4NY3A 1OCCC 4BJ6A 3UGOA 1G8XA 2YHSA 1V55C 2J0WA 3B0VC 3NKEA 4CSAA 2XXAA 3JSZA 1BR2A 3DD7A 3K66A 5E3CA 4O7GA 2WVQA 3B0PA 2DYRC 5KYYB 2GFHA 3KKBA 4CS8A 3UGPA 4I1OB 4Q7CA 2Z15A 2PP4A 2DGJA 3IEEA 4U5HA 3PHF2 4BJ1A 5F5FA 3MX3A 3LEVA 2R7TA 3UR3C 1TWHA 3UMKA 3VAYA 2WZGA 3ZC4A 2C03A 4U5FE 4U5GA 1NZEA 5E3AA 4O6YA 4OIPF 4A2NB 1D1BA 5DQZA 4BEJA 1FMVA 1M57C 3FDQA 1W2WA 2WZLA 3ZIBA 3EZIA 4JURI 4ZLCA 1M2VB 2Q9AA 3NKDA 3JCUQ 2C04A 2FFHA 1MMDA 1O5HA 3ASOC 5F5HA 4Q4ZF 1SF8A 4YJWA 2E87A 3L34A 3S29A 3EJNA 3T6BA 1N1CA 2XSEA 3JRTA 2A1DD 3DMDA 1WGWA 3DAGA 3O39A 4OIQF 2R7UA 4DVZA 4JJFA 4BJ5C 2O9XA 1O87A 4YN0B 1IW7F 4ANJA 4CS9A 1RJ9B 1S7ZA 2W9YA 2WZFA 1VOMA 4G0HA 2A69F 4QDLA 2JD3A 2X51A 2EIJC 3SZRA 2MWQA 2I8BA 1ZHYA 3EPVA 2V26A 5KYXA 2KNHA 4WJ0A 4X0RA 3I4UA 5T3WA 5L3QA 4O6MA 4I44A 1ZU5A 3TD7A 1OCOC 2Y39A 1NG1A 4C7OB 4GEHA 4PJMA 5KYUB 3EH2A 3E70C 3F47A 2WB7A 3B9QA 1Z3IX 3EH1A 3EGDB 3EGXA 2NUTA 4XLNF 2KJGA 3L0IA 1FMWA 2D5RB 3EHNA 2R7XA 2R7QA 2IXOA 3NYJA 2R7RA 1OCZC 2Q3TA 3JT1A 4PK4A 3NDBB 3DXJF 1LVKA 4LACB 4LERA 4AE4A 3LS0A 4XTKA 4HFKB 1QZXA 4OD4A 3EFOA 3GANA 3DJNB 3EG9B 4U5CE 4PFPA 5EHHA 4P6IC 5BUOA 1NU7D 2Q9CA 3W8HA 4RDAA 1ZHXA 5DQTA 4E7ZA 2IOQA 2L81A 2NUPB 5KYWA 4BJ5A 1Z23A 4G7ZF 3EHMA 3KL4A 3QMKA 5CI9A 4U5BE 4JJGA 3AG4C 3RFYA 3DZAA 1FFHA 2ZXOA 3AQCA 3ZSUA 3ABKC 2WL8A 3Q7GA 4CBEA 2DYSC 1D0XA 2OCCC 3N2ZB 3Q6MA 1LKXA 3LAYA 2CNWD 3SYNA 2PX3A 4KBLA 2WVOA 3WG7C 1FTSA 2W4BA 3HLZA 5E33A 1D1CA 2Y3BA 2WVNA 1OCRC 4DVYP 3F46A 3K1HA 3AG3C 3NG1A 4KI2A 2W45A 2NG1A 3AG2C 1MMNA 2XRHA 3HJCA 2R7WA 4RBNA 4XWJA 3RYLA 4Q5SF 2PX0A 4AK9A 3FAJA 4JCHA 4F4BA 3LNRA 3S27A 1FFTC 4OINF 3N0TA 4YT2A 4YT8A 3RKOF 2BE5F 5KYYA 2G3KA 5E2QA 1TR2A 2R7OA 4FX5A 4U5EE 4QI0A 3HTKC 1Z5ZA 2V3CC 2ZXPA 3W8IA 3K6BA 1V54C 5T3TA 3JYHA 2P6VA 4QI2A 4G7OF 2J9UA 2J0XA 4BJ6C 4C3EA 4J32B 4IWBA 1OKKA 2M4EA 5KYNA 4CS7A 2CGEA 4OD5A 5D92A 3S28A 3W2VA 1M2VA 3V7OA 1SZIA 3K1IC 4OIOF 5L3VA 2VASA 1D1AA 2W4MA 4IRUA 2H7VC 2G3VA 5DS5A 4AX2A 3SP1A 4CS8C 4HEAJ 3MLGA 2H7OA 3X2QC 2HV7A 3Q6NA 4OIRF 3I5QA 4H4KC 5CI8A 1MNEA 2XXAB 3M1CB 1RJ9A 3CZ6A 3UMIA 2H7BA 3NYMA 3OWTA 4DBRA 4G7HF 5D91A 3ITFA 3DAFA 2KW3C 1BR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZH A;  3EZI A; 
#chains in the Genus database with same CATH topology
 3FOP A;  4EWC A;  4GQH A;  2KQ9 A;  3O6X A;  4LLE A;  4RD9 A;  2A6E F;  4JC7 A;  2MYS A;  2RD9 A;  2AVK A;  3R7C A;  1C03 A;  3AGT A;  1TWC A;  1VMA A;  2YVK A;  4K0D A;  4PR9 A;  3LUT B;  4CDY A;  3DE8 A;  3EQL F;  1JR8 A;  1BBH A;  1LE2 A;  3RH3 A;  5HSW A;  2P0N A;  1TKN A;  2A6H F;  3NYL A;  3SNH A;  3BEH A;  2IBF A;  1HY5 A;  4FAP B;  4EBJ A;  4C7O A;  3JZ0 A;  1FNT c;  5IY5 C;  2Q00 A;  1M2O A;  5KYU A;  1TWA A;  5DS6 A;  1YZC A;  3MYI A;  3B0U X;  3ABL C;  1NLX A;  1DOV A;  4MQ9 F;  3TJ5 A;  3J06 A;  1OQC A;  3DWW A;  3EGD A;  2Y69 C;  2CCY A;  1YLM A;  1J8M F;  2HV6 A;  2EPM X;  2HKV A;  3LES A;  2EIK C;  1FR0 A;  1NBB A;  2AWY A;  3KMI A;  2J9V A;  2XLV A;  2LQG A;  2GWW A;  4MVU A;  3UMH A;  1BR4 A;  1K05 A;  4PJN A;  2NPU A;  2YWA A;  5JUA A;  1PD1 A;  3OEO A;  1LI7 A;  4JW1 A;  2OKU A;  4NTF A;  5L0C A;  1R4T A;  3AG1 C;  4YL0 A;  2PNO A;  3LLI A;  1JMW A;  1JPJ A;  1Q0G A;  1YVI A;  2YLD A;  3PMR A;  4I3M A;  1Z6A A;  3VRC A;  1OKK D;  2PBE A;  3IQ6 A;  2GDC A;  1YA9 A;  2Y3H A;  4W8K A;  5AGF A;  4Z9J A;  4JCZ A;  2J9B A;  3U9J A;  1I5N A;  5B3S C;  1V4A A;  2JX0 A;  2ZXW C;  3I5P A;  1RCP A;  3K1I A;  4JVS A;  4C3B A;  2VB6 A;  4EBB A;  3EG9 A;  4W8P A;  2EIM C;  4XPY A;  3TOM A;  4IJJ A;  2P1A A;  4NCQ A;  2OEV A;  1WTY A;  4KNV A;  4BG0 A;  1ZVZ A;  3LLK A;  4MS2 A;  4DOZ A;  1PV3 A;  2R02 A;  3Q7L A;  4K7B A;  1ORJ A;  3HNL A;  5L0I A;  2B0H A;  1SMY F;  2NUP A;  4I1M A;  3SEO A;  1NU9 C;  1ZYR F;  2XLH A;  4MND A;  3ZDL A;  1ZHT A;  3WOD F;  3C8Z A;  1D0Y A;  3LJB A;  3ZG1 A;  5KYX B;  1MMG A;  3QVZ A;  4XPX A;  3JRM O;  3K7D A;  2XS1 A;  4ULW A;  4CJO A;  2YLG A;  1PD0 A;  1UFB A;  5DLJ A;  1MND A;  2Q4F A;  3NMI A;  5B1A C;  4E7S A;  2HMQ A;  4CIP A;  4E17 A;  1HE1 A;  1A0B A;  1XWJ A;  1QLE C;  3C62 A;  1JOG A;  2P61 A;  3H2U A;  4YWQ A;  4G7H F;  5FCL A;  2VH3 A;  2R7V A;  1JAF A;  1ZHW A;  4M63 A;  1CGM E;  4L6R A;  4IAR A;  1CGN A;  1D0Z A;  1XZQ A;  1SR2 A;  2HFI A;  2J7P A;  3ASN C;  4PJJ A;  4MVZ A;  3K33 A;  1NFO A;  3RQE A;  3U3F A;  2ZXR A;  4CJG A;  1ZU4 A;  1ST6 A;  2B0J A;  3FXH A;  3EGX B;  3QW1 A;  2NUT B;  4U5D E;  5AC4 A;  5DS4 A;  1RMV A;  1AEP A;  3KYJ A;  2Y3D A;  4CDA A;  5T1D B;  4KC9 A;  2IXP A;  2IXM A;  4JKV A;  1M6T A;  4KNW A;  2L9J A;  2XL6 A;  4JZA A;  3RIP A;  1TWG A;  3GEE A;  2CW0 F;  3QTH A;  1LE4 A;  1A7E A;  2XL8 A;  1IZM A;  1K40 A;  2G62 A;  3GM2 A;  3QZC A;  4NQF A;  1S05 A;  3DM5 A;  1PCX A;  1OW6 A;  2CDQ A;  2VCB A;  4BJT A;  4IAO A;  2R7S A;  3E9V A;  3NRH A;  1L7C A;  1HMD A;  2DB4 A;  4ER9 A;  4C3D A;  1LIH A;  5JS5 A;  4IB4 A;  4CSA C;  3ABM C;  1VK5 A;  1OR3 A;  4AE4 B;  1YJG A;  2R05 A;  2Y3G A;  3U0C A;  1ZW3 A;  3POV A;  3CQZ A;  4ZLD A;  2OG2 A;  4LLC A;  3AQB A;  2J9W A;  2PF4 E;  4XLP F;  3EFO B;  2D4U A;  3O10 A;  4DBQ A;  1ZHZ A;  2EIN C;  3U5S A;  2XS8 A;  2XL4 A;  3DM9 B;  2QE9 A;  4O6N A;  4N4W A;  4H54 A;  2VC9 A;  2XLO A;  3RQF A;  4EKW A;  1ZZP A;  1YDI A;  3TOL A;  5KYW B;  1LS1 A;  4D4X A;  2FGY A;  3U8P A;  2OOC A;  3CSK A;  1OXB A;  3UNG C;  3LS1 A;  4J7Y A;  4XPW A;  2YKZ A;  3C8G B;  1AVO B;  4YK5 A;  3T6G B;  1KNY A;  3KYI A;  4YL3 A;  2VCC A;  4PFO A;  1QPU A;  3JSE O;  2YEV A;  2CNW A;  2XM4 A;  5EK0 A;  2IYL D;  1E86 A;  4YT5 A;  3H2V A;  2J45 A;  1GM5 A;  3S0X A;  4O79 A;  2KSF A;  5JVE A;  1MMA A;  2GAQ A;  4YT4 A;  3GOD A;  2OU6 A;  1VYI A;  1WOL A;  3ZVR A;  1C17 M;  3EZH A;  5B1B C;  3KH2 A;  3ECS A;  4N06 A;  2QY9 A;  2AWC A;  2PFD A;  3AGU A;  2EPL X;  3ATP A;  1JRA A;  1WN0 A;  4J30 B;  1VYK A;  4NTB A;  1H6G A;  3W2W A;  3OA1 A;  3FHD A;  2LSE A;  1DOW A;  4HFF B;  4CIH A;  2L6F A;  1VLT A;  1L3P A;  1T5O A;  2HJ3 A;  1JPN A;  2IXN A;  3DJU B;  3X1O A;  4HE8 D;  2CYD A;  3T6J A;  3TQO A;  5JP7 A;  5L0F A;  2Q9B A;  2QTV A;  2LFD A;  2J46 A;  1M56 C;  2KGO A;  3G4X A;  2J7P D;  4DRI B;  3PDM P;  1KU2 A;  4WGY A;  3FVY A;  4FES A;  2P7V A;  2EIL C;  1Z7Q c;  2ZPA A;  4DXW A;  5CIV A;  2YZS A;  3T4R A;  5EGY A;  3GEI A;  4ULV A;  1VB5 A;  2DI3 A;  4B6I A;  1T6I A;  4CS9 C;  3H65 A;  1Z63 A;  1G4W R;  5DVW A;  4FWV A;  3NMJ A;  2LP4 A;  4LDK A;  3DI5 A;  4GYT A;  4K1O A;  1J8Y F;  2A68 F;  4PJL A;  3N24 A;  3V5Y A;  1E85 A;  3VYW A;  3IHU A;  4NY3 A;  1OCC C;  3T9O A;  2JPU A;  3GOR A;  1G8X A;  4XQ1 A;  4BJ6 A;  3UGO A;  2TMV P;  2YHS A;  1RKE B;  1V55 C;  2J0W A;  4U9E A;  3B0V C;  3FOO A;  2YRF A;  3LEO A;  3NKE A;  3U9M A;  5HV9 A;  4CSA A;  2XXA A;  4MW8 A;  3JSZ A;  4XEK A;  3VM6 A;  1YZA A;  3CEX A;  2L6H A;  2HJM A;  5FZT A;  2F22 A;  1BR2 A;  5COM A;  2BL2 A;  3DD7 A;  4XEV A;  4D4N A;  3K66 A;  5E3C A;  4JEA A;  4O7G A;  2WVQ A;  3B0P A;  3WHN A;  2DYR C;  4DRJ B;  1FAP B;  1U89 A;  5KYY B;  1LM3 B;  1G5Z A;  1T6U A;  1A41 A;  3NMK A;  256B A;  2A0B A;  2GFH A;  3KKB A;  4CS8 A;  3UGP A;  4I1O B;  4Q7C A;  3L8I A;  2Z15 A;  2PP4 A;  1EQ1 A;  2DGJ A;  4IAQ A;  3IEE A;  4U5H A;  3PHF 2;  4BJ1 A;  5F5F A;  3MX3 A;  3LEV A;  2R7T A;  3UR3 C;  1TWH A;  3UMK A;  1V74 B;  1MQV A;  3VAY A;  2WZG A;  1LS4 A;  1NSG B;  3GM3 A;  2C03 A;  3R2P A;  1R5I D;  3ZC4 A;  4U5F E;  4U5G A;  1NZE A;  1RXQ A;  5E3A A;  4O6Y A;  4AL0 A;  4OIP F;  4EBK A;  2NSG A;  5COF A;  4A2N B;  1D1B A;  3A9C A;  5DQZ A;  1FMV A;  4BEJ A;  1M57 C;  3FDQ A;  3HKK A;  4MVR A;  5COG A;  1W2W A;  2WZL A;  1EI7 A;  1TQG A;  3EZI A;  3RF3 A;  3U8V A;  3ZIB A;  4JUR I;  4ZLC A;  1M2V B;  2EPN A;  4EHP A;  2Q9A A;  3NKD A;  3JCU Q;  2R9R B;  2C04 A;  2FFH A;  1MMD A;  1O5H A;  3ASO C;  5F5H A;  4Q4Z F;  4P9F A;  3VF0 A;  1OW8 A;  1SF8 A;  2HSQ A;  1OW7 A;  3CAX A;  4JTD B;  4YJW A;  2E87 A;  4Z9H A;  3L34 A;  3S29 A;  1NFN A;  1TFK B;  1Q0K A;  3EJN A;  1E84 A;  3T6B A;  4AL1 A;  1N1C A;  3DKA A;  4A4A A;  2XSE A;  3JRT A;  5BQH A;  2A1D D;  3DMD A;  2L7A A;  1WGW A;  3DAG A;  1YAU O;  3O39 A;  4OIQ F;  1F1M A;  2RSE B;  3SXK A;  4DVZ A;  4JJF A;  4BJ5 C;  2EPK X;  2O9X A;  1U0B B;  1O87 A;  4YN0 B;  1IW7 F;  2YL3 A;  3IQT A;  4ANJ A;  3C7J A;  1K04 A;  4CS9 A;  3U2M A;  1RJ9 B;  3PCV A;  1S7Z A;  2W9Y A;  4G78 A;  2WZF A;  2YL1 A;  3LNM B;  3M79 A;  1VOM A;  4G0H A;  1H9G A;  2A69 F;  4YL1 A;  4QDL A;  1XZP A;  2JD3 A;  2X51 A;  5A6B A;  2EIJ C;  3SZR A;  3TK0 A;  1AUE A;  2LIG A;  1A7D A;  1YAR O;  2MWQ A;  2ASR A;  2I8B A;  1ZHY A;  5JSL A;  3EPV A;  2Q7R A;  3GM1 A;  5F28 E;  2V26 A;  5KYX A;  4N6H A;  2MHR A;  2KNH A;  1CPQ A;  1LPE A;  1Y6D A;  3I4U A;  4WJ0 A;  4X0R A;  4O6M A;  4I44 A;  5T3W A;  5L3Q A;  1ZU5 A;  5JRA A;  1QQ3 A;  4MVM A;  4MTG A;  3TD7 A;  3B71 A;  1OCO C;  4E0I A;  2ETS A;  2Y39 A;  1NG1 A;  3U3B A;  4E0H A;  4C7O B;  1TFO B;  3DE9 A;  4JEB A;  2ICW G;  4GEH A;  4PJM A;  3SXZ A;  5KYU B;  3EH2 A;  2YL0 A;  3C63 A;  3E70 C;  2HMZ A;  2WB7 A;  3F47 A;  3B9Q A;  2FAP B;  2HUJ A;  3A11 A;  4R32 A;  1Z3I X;  5L0H A;  3EH1 A;  3EGD B;  1LI5 A;  1VLS A;  1OR2 A;  3EGX A;  2NUT A;  4XLN F;  2KJG A;  3L0I A;  1FMW A;  2D5R B;  3EHN A;  2ZD9 A;  4MTF A;  1SYQ A;  2A0U A;  2YL7 A;  4BEM J;  2R7X A;  2R7Q A;  2IXO A;  3AOU A;  3KPH A;  3NYJ A;  3G4Z A;  2R7R A;  3QW0 A;  4EUK B;  4UDV A;  4NC3 A;  1OCZ C;  2KK1 A;  2Q3T A;  3BRJ A;  3JT1 A;  4PK4 A;  4DRH B;  3NDB B;  3DXJ F;  1KTM A;  1LVK A;  4LAC B;  2BC5 A;  4LER A;  3SXY A;  4AE4 A;  1GGQ A;  3LS0 A;  3GEH A;  5KYY A;  4N6C A;  4HFK B;  4XTK A;  1QZX A;  4OD4 A;  2YLI A;  4U9D A;  3EFO A;  3G50 A;  3GAN A;  1HW1 A;  2L6G A;  3DJN B;  3EG9 B;  3MFN A;  2HS5 A;  3O55 A;  4PFP A;  4P6I C;  4U5C E;  5AC5 A;  1OXK A;  5EHH A;  3QVY A;  5BUO A;  1NU7 D;  2Q9C A;  4MVO A;  3W8H A;  4RDA A;  2R25 A;  1ZHX A;  5DQT A;  1E83 A;  2UUI A;  2LFF A;  1YYX A;  4E7Z A;  2IOQ A;  4IGG A;  1Q0M A;  2L81 A;  1WWP A;  2NUP B;  3WAQ A;  5KYW A;  3V5Z A;  1I4Z A;  4BJ5 A;  1EKY A;  1Z23 A;  2GA0 A;  3ZTZ A;  3C8G A;  1VTM P;  3M4B A;  4G7Z F;  1Q0F A;  1T01 A;  2M64 A;  3EHM A;  5L0J A;  3KL4 A;  3RVZ A;  3QMK A;  5CI9 A;  4U5B E;  3M15 A;  4JJG A;  3S84 A;  1QVX A;  1WAS A;  2IM8 A;  4ONS A;  2R03 A;  3AG4 C;  3HNI A;  3JTL O;  5BQI A;  3RFY A;  1YA7 O;  3JYY A;  1B68 A;  4WAB A;  4J7T A;  5A6B D;  4Z9I A;  3DZA A;  1GS9 A;  4E18 A;  3MBG A;  1FFH A;  2H8A A;  1WAT A;  3ZQY A;  2ZXO A;  2VCA A;  1Y4C A;  1EA8 A;  3AQC A;  3ZSU A;  2AP3 A;  3ABK C;  1HW2 A;  1T6Q A;  3GWN A;  2WL8 A;  3Q7G A;  4CBE A;  3L8J A;  2DYS C;  3B29 A;  4P9T A;  3GWL A;  2QUP A;  1D0X A;  2OCC C;  3ZTM A;  3N2Z B;  2HSB A;  2LD6 A;  3AJM A;  1LKX A;  3C18 A;  3IPM O;  3Q6M A;  2EPO A;  3LAY A;  2CNW D;  3SYN A;  2PX3 A;  4KBL A;  2WVO A;  3WG7 C;  3ZWI A;  1FTS A;  1G4U S;  2W4B A;  3HLZ A;  3ZQV A;  4NTA A;  5E33 A;  1D1C A;  4JRZ A;  1BZ4 A;  2OJQ A;  2Y3B A;  2WVN A;  2XLE A;  3W4Y A;  1OCR C;  4DVY P;  3F46 A;  3K1H A;  3AG3 C;  3M4C A;  4JE9 A;  2KYH A;  3TUL A;  1E2X A;  3NG1 A;  5A69 A;  1H7I A;  1A7V A;  4KI2 A;  1I4Y A;  4MW3 A;  5TJ5 E;  2W45 A;  3US6 A;  3MYF A;  1RKE A;  5JT4 A;  2NG1 A;  2I15 A;  3L1M A;  3AG2 C;  1MMN A;  5B3I A;  2XRH A;  3HJC A;  2LK4 A;  3U2L A;  3RW0 A;  3IQC A;  5JLI A;  4LDQ A;  4WGZ A;  2R7W A;  4RBN A;  4XWJ A;  3RYL A;  4Q5S F;  5K0I A;  4XEF A;  5L0D A;  1CGO A;  3SXM A;  2PX0 A;  1APC A;  4AK9 A;  3FAJ A;  4JCH A;  3TJ6 A;  4F4B A;  5GPG B;  3LNR A;  3S27 A;  1FFT C;  4OIN F;  3N0T A;  1HE9 A;  4YT8 A;  3RKO F;  2BE5 F;  4YT2 A;  2G3K A;  5E2Q A;  3HNK A;  2X0C A;  1TR2 A;  2R7O A;  4FX5 A;  4U5E E;  4JTC B;  4BPM A;  4QI0 A;  3HTK C;  1Z5Z A;  3S90 A;  2V3C C;  1YYJ A;  2ZXP A;  4CX9 A;  5A6K A;  3W8I A;  3K6B A;  1V54 C;  5T3T A;  2XM0 A;  2P6V A;  2XLM A;  3JYH A;  4QI2 A;  5BQG A;  4G7O F;  2J9U A;  3C8G D;  2J0X A;  4BJ6 C;  4C3E A;  1C02 A;  4J32 B;  1BDJ B;  4IWB A;  4JIO A;  1GQA A;  1ZW2 A;  5A6A A;  1OKK A;  4PAC A;  2M4E A;  5KYN A;  4CS7 A;  4JTA B;  2CGE A;  2OJE D;  4MTO A;  4OD5 A;  1HMO A;  1ORS C;  5D92 A;  2YQY A;  3RQG A;  3S28 A;  1M2V A;  3V7O A;  1SZI A;  1QKR A;  2KC3 A;  3W2V A;  3K1I C;  3V5X A;  2XLW A;  3FAP B;  5L3V A;  4CDV A;  4OIO F;  2VAS A;  1D1A A;  2W4M A;  2J8W A;  2H7V C;  2G3V A;  4IRU A;  5DS5 A;  1ORY A;  4AX2 A;  3SP1 A;  3IQ5 A;  4CS8 C;  4HEA J;  3MLG A;  2H7O A;  2XLD A;  3FMS A;  3X2Q C;  2HV7 A;  2OQM A;  3Q6N A;  4LDR A;  4OIR F;  1CPR A;  3I5Q A;  1H9T A;  4H4K C;  4DJ9 A;  1T9K A;  4MVQ A;  2QLA A;  5CI8 A;  1MNE A;  1Q0D A;  1UG7 A;  3M1C B;  3RVY A;  2XXA B;  1O3U A;  1RKC A;  1RJ9 A;  3CZ6 A;  3UMI A;  2HZ8 A;  2LCH A;  2H7B A;  2R7U A;  3S9O A;  2OEX A;  2UUH A;  3NYM A;  3OWT A;  1QSP A;  4MVS A;  2QNL A;  4DBR A;  5D91 A;  2AU5 A;  1U6H A;  2NSF A;  3DAF A;  3ITF A;  5A6J A;  5L0G A;  2KW3 C;  4EIY A;  1BR1 A;  3HNJ A; 
#chains in the Genus database with same CATH homology
 4EWC A;  4LLE A;  2KQ9 A;  3O6X A;  4RD9 A;  3POV A;  2A6E F;  2MYS A;  1TWC A;  1VMA A;  4K0D A;  3EQL F;  3RH3 A;  5HSW A;  1TKN A;  2A6H F;  3NYL A;  3SNH A;  4C7O A;  5IY5 C;  1M2O A;  5KYU A;  1TWA A;  5DS6 A;  3B0U X;  3ABL C;  4MQ9 F;  3EGD A;  2Y69 C;  1J8M F;  2HV6 A;  3LES A;  2EIK C;  3KMI A;  2J9V A;  3UMH A;  1BR4 A;  4PJN A;  1PD1 A;  3OEO A;  4JW1 A;  3AG1 C;  3LLI A;  1JPJ A;  3PMR A;  4I3M A;  1Z6A A;  1OKK D;  2Y3H A;  4W8K A;  5B3S C;  2ZXW C;  3I5P A;  4JVS A;  4C3B A;  2VB6 A;  4EBB A;  3EG9 A;  2EIM C;  4IJJ A;  4KNV A;  4BG0 A;  3LLK A;  4DOZ A;  3Q7L A;  4K7B A;  2NUP A;  1SMY F;  3SEO A;  4I1M A;  1NU9 C;  1ZYR F;  4MND A;  1ZHT A;  3WOD F;  1D0Y A;  3LJB A;  3ZG1 A;  5KYX B;  1MMG A;  3K7D A;  4ULW A;  1PD0 A;  5DLJ A;  1MND A;  5B1A C;  4E7S A;  1QLE C;  4YWQ A;  2R7V A;  5FCL A;  2VH3 A;  1ZHW A;  4M63 A;  1D0Z A;  2J7P A;  3ASN C;  4PJJ A;  3K33 A;  2ZXR A;  1ZU4 A;  1ST6 A;  2B0J A;  4U5D E;  3EGX B;  2NUT B;  5DS4 A;  2Y3D A;  5T1D B;  4KC9 A;  2IXP A;  2IXM A;  4KNW A;  4JZA A;  3RIP A;  2L9J A;  1TWG A;  2CW0 F;  1IZM A;  2G62 A;  3QZC A;  3DM5 A;  1PCX A;  2CDQ A;  4BJT A;  4IAO A;  2R7S A;  3E9V A;  3NRH A;  4C3D A;  4CSA C;  3ABM C;  1VK5 A;  4AE4 B;  2Y3G A;  3CQZ A;  4ZLD A;  2OG2 A;  4LLC A;  3AQB A;  2J9W A;  2PF4 E;  4XLP F;  3EFO B;  4DBQ A;  1ZHZ A;  2EIN C;  2XL4 A;  3DM9 B;  4O6N A;  5KYW B;  1LS1 A;  2FGY A;  3CSK A;  3UNG C;  3LS1 A;  4PFO A;  2YEV A;  2CNW A;  2IYL D;  4YT5 A;  2J45 A;  3S0X A;  4O79 A;  1MMA A;  4YT4 A;  3GOD A;  1VYI A;  3ZVR A;  3EZH A;  5B1B C;  3KH2 A;  3ECS A;  4N06 A;  2QY9 A;  2PFD A;  4J30 B;  1VYK A;  3W2W A;  3OA1 A;  3FHD A;  2LSE A;  4HFF B;  4CIH A;  1JPN A;  2IXN A;  3DJU B;  3X1O A;  4HE8 D;  3T6J A;  2Q9B A;  2QTV A;  2J46 A;  1M56 C;  2KGO A;  2J7P D;  1KU2 A;  3FVY A;  4FES A;  2P7V A;  2EIL C;  2ZPA A;  5EGY A;  2YZS A;  3T4R A;  1Z63 A;  4CS9 C;  4B6I A;  3H65 A;  5DVW A;  4FWV A;  4GYT A;  1J8Y F;  2A68 F;  4PJL A;  3N24 A;  3VYW A;  4NY3 A;  1OCC C;  4BJ6 A;  3UGO A;  1G8X A;  2YHS A;  1V55 C;  2J0W A;  3B0V C;  3NKE A;  4CSA A;  2XXA A;  3JSZ A;  1BR2 A;  3DD7 A;  3K66 A;  5E3C A;  4O7G A;  2WVQ A;  3B0P A;  2DYR C;  5KYY B;  2GFH A;  3KKB A;  4CS8 A;  3UGP A;  4I1O B;  4Q7C A;  2Z15 A;  2PP4 A;  2DGJ A;  3IEE A;  4U5H A;  3PHF 2;  4BJ1 A;  5F5F A;  3MX3 A;  3LEV A;  2R7T A;  3UR3 C;  1TWH A;  3UMK A;  3VAY A;  2WZG A;  3ZC4 A;  2C03 A;  4U5F E;  4U5G A;  1NZE A;  5E3A A;  4O6Y A;  4OIP F;  4A2N B;  1D1B A;  5DQZ A;  4BEJ A;  1FMV A;  1M57 C;  3FDQ A;  1W2W A;  2WZL A;  3ZIB A;  3EZI A;  4JUR I;  4ZLC A;  1M2V B;  2Q9A A;  3NKD A;  3JCU Q;  2C04 A;  2FFH A;  1MMD A;  1O5H A;  3ASO C;  5F5H A;  4Q4Z F;  1SF8 A;  4YJW A;  2E87 A;  3L34 A;  3S29 A;  3EJN A;  3T6B A;  1N1C A;  2XSE A;  3JRT A;  2A1D D;  3DMD A;  1WGW A;  3DAG A;  3O39 A;  4OIQ F;  2R7U A;  4DVZ A;  4JJF A;  4BJ5 C;  2O9X A;  1O87 A;  4YN0 B;  1IW7 F;  4ANJ A;  4CS9 A;  1RJ9 B;  1S7Z A;  2W9Y A;  2WZF A;  1VOM A;  4G0H A;  2A69 F;  4QDL A;  2JD3 A;  2X51 A;  2EIJ C;  3SZR A;  2MWQ A;  2I8B A;  1ZHY A;  3EPV A;  2V26 A;  5KYX A;  2KNH A;  4WJ0 A;  4X0R A;  3I4U A;  5T3W A;  5L3Q A;  4O6M A;  4I44 A;  1ZU5 A;  3TD7 A;  1OCO C;  2Y39 A;  1NG1 A;  4C7O B;  4GEH A;  4PJM A;  5KYU B;  3EH2 A;  3E70 C;  3F47 A;  2WB7 A;  3B9Q A;  1Z3I X;  3EH1 A;  3EGD B;  3EGX A;  2NUT A;  4XLN F;  2KJG A;  3L0I A;  1FMW A;  2D5R B;  3EHN A;  2R7X A;  2R7Q A;  2IXO A;  3NYJ A;  2R7R A;  1OCZ C;  2Q3T A;  3JT1 A;  4PK4 A;  3NDB B;  3DXJ F;  1LVK A;  4LAC B;  4LER A;  4AE4 A;  3LS0 A;  4XTK A;  4HFK B;  1QZX A;  4OD4 A;  3EFO A;  3GAN A;  3DJN B;  3EG9 B;  4U5C E;  4PFP A;  5EHH A;  4P6I C;  5BUO A;  1NU7 D;  2Q9C A;  3W8H A;  4RDA A;  1ZHX A;  5DQT A;  4E7Z A;  2IOQ A;  2L81 A;  2NUP B;  5KYW A;  4BJ5 A;  1Z23 A;  4G7Z F;  3EHM A;  3KL4 A;  3QMK A;  5CI9 A;  4U5B E;  4JJG A;  3AG4 C;  3RFY A;  3DZA A;  1FFH A;  2ZXO A;  3AQC A;  3ZSU A;  3ABK C;  2WL8 A;  3Q7G A;  4CBE A;  2DYS C;  1D0X A;  2OCC C;  3N2Z B;  3Q6M A;  1LKX A;  3LAY A;  2CNW D;  3SYN A;  2PX3 A;  4KBL A;  2WVO A;  3WG7 C;  1FTS A;  2W4B A;  3HLZ A;  5E33 A;  1D1C A;  2Y3B A;  2WVN A;  1OCR C;  4DVY P;  3F46 A;  3K1H A;  3AG3 C;  3NG1 A;  4KI2 A;  2W45 A;  2NG1 A;  3AG2 C;  1MMN A;  2XRH A;  3HJC A;  2R7W A;  4RBN A;  4XWJ A;  3RYL A;  4Q5S F;  2PX0 A;  4AK9 A;  3FAJ A;  4JCH A;  4F4B A;  3LNR A;  3S27 A;  1FFT C;  4OIN F;  3N0T A;  4YT2 A;  4YT8 A;  3RKO F;  2BE5 F;  5KYY A;  2G3K A;  5E2Q A;  1TR2 A;  2R7O A;  4FX5 A;  4U5E E;  4QI0 A;  3HTK C;  1Z5Z A;  2V3C C;  2ZXP A;  3W8I A;  3K6B A;  1V54 C;  5T3T A;  3JYH A;  2P6V A;  4QI2 A;  4G7O F;  2J9U A;  2J0X A;  4BJ6 C;  4C3E A;  4J32 B;  4IWB A;  1OKK A;  2M4E A;  5KYN A;  4CS7 A;  2CGE A;  4OD5 A;  5D92 A;  3S28 A;  3W2V A;  1M2V A;  3V7O A;  1SZI A;  3K1I C;  4OIO F;  5L3V A;  2VAS A;  1D1A A;  2W4M A;  4IRU A;  2H7V C;  2G3V A;  5DS5 A;  4AX2 A;  3SP1 A;  4CS8 C;  4HEA J;  3MLG A;  2H7O A;  3X2Q C;  2HV7 A;  3Q6N A;  4OIR F;  3I5Q A;  4H4K C;  5CI8 A;  1MNE A;  2XXA B;  3M1C B;  1RJ9 A;  3CZ6 A;  3UMI A;  2H7B A;  3NYM A;  3OWT A;  4DBR A;  4G7H F;  5D91 A;  3ITF A;  3DAF A;  2KW3 C;  1BR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...