1LIHA

Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
160
structure length
160
Chain Sequence
MGGLLFSSLQHCQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTFDQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
total genus 66
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1995-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1lihA00
3T9OA 1LIHA 1WASA 2LIGA 1VLSA 4Z9JA 1JMWA 2D4UA 3ATPA 1VLTA 4Z9IA 2ASRA 4Z9HA 4H54A 1WATA
chains in the Genus database with same CATH superfamily
4D4NA 4IB4A 1JRAA 4A4AA 3TQOA 4DVZA 3K66A 5JS5A 1EQ1A 4EBBA 2ZXOA 4YT8A 1OCCC 2LP4A 3KMIA 2ZD9A 2KQ9A 5KYUA 1A41A 2JD3A 4MTFA 1U89A 3MLGA 1V4AA 2PP4A 3U5SA 1G5ZA 5T3TA 3W8HA 3WODF 4OIRF 4JW1A 3UMKA 2OQMA 5HV9A 4W8PA 2R7XA 4IRUA 1O87A 1MNDA 1NFNA 4WJ0A 1CGNA 2AVKA 1YVIA 2YLIA 1M2VA 4K1OA 1GGQA 1YA9A 2XL8A 5BUOA 2XLWA 4LERA 1QSPA 5E3AA 3SZRA 4XEVA 2A68F 3B0PA 1HE9A 4XQ1A 5EHHA 2CDQA 1UFBA 2Q9BA 1R4TA 2J8WA 2WL8A 2C03A 3B29A 3EQLF 4A2NB 3HNIA 1E83A 1E84A 3PDMP 3SXKA 1LKXA 2MHRA 4Q5SF 1VB5A 2DB4A 3FAJA 2NUTA 5L0IA 3K6BA 2J7PD 3GORA 2R9RB 5AC5A 3MBGA 4I1OB 5L0GA 2OCCC 3DD7A 3GM1A 2G3VA 5AGFA 4JC7A 1OKKA 3DMDA 3DE9A 3TD7A 3AGUA 1D1BA 4RBNA 3T9OA 3E9VA 4CDVA 4EWCA 4J7TA 3L0IA 3DM5A 3O10A 2IXMA 3K7DA 3DI5A 3M4BA 3ABLC 3FVYA 1AVOB 3C7JA 2ETSA 5CI8A 4KNWA 5KYYA 3I5QA 4MW8A 1ZHWA 3F47A 2HV6A 3U3BA 1C17M 1QLEC 1VYKA 2HV7A 3Q6MA 4CSAA 1HMOA 1N1CA 1TKNA 3RQEA 2YRFA 2VCBA 4XTKA 4P9FA 2QUPA 2BC5A 1OR3A 4NC3A 4EKWA 4MQ9F 3HKKA 4MNDA 3N24A 4B6IA 4PJLA 4BJ6C 4E7SA 1H7IA 2CYDA 4PFPA 1WN0A 2YQYA 3O6XA 4CS7A 5A69A 2FAPB 1WATA 4XLNF 4CX9A 3EPVA 2LCHA 4BJ1A 4L6RA 1WASA 1ZU5A 1KU2A 2NSGA 3AOUA 3U9MA 2J46A 5GPGB 3K1IA 2DGJA 3C62A 2OEXA 4U5BE 3X2QC 2VH3A 2R7OA 1I5NA 3LS0A 2OG2A 3QW0A 1T01A 4J30B 5B3IA 4PJNA 2L6FA 2HUJA 2WB7A 2NUPB 1ZU4A 4K7BA 4RD9A 3GWLA 1SMYF 2QNLA 4DBQA 4JTCB 2QE9A 4CDYA 3EZIA 1CPQA 1T6UA 3C8ZA 4CS9C 2HKVA 1TFOB 1VOMA 4BEJA 3EZHA 2XM0A 3EG9A 5F28E 3ZVRA 1YJGA 1BZ4A 4JKVA 2YL1A 2M4EA 3AGTA 3HNKA 3JYYA 1D0ZA 3GEIA 2J9BA 2EPKX 4HEAJ 1DOVA 1TFKB 4U9EA 1M57C 1WTYA 2GAQA 3GWNA 3HNLA 1M6TA 3LUTB 2KW3C 4JCHA 1NG1A 3DE8A 1HMDA 5K0IA 4XPYA 2D5RB 2KSFA 3EGXA 3HJCA 2R7WA 1CPRA 2YKZA 2YVKA 2YLDA 2XXAB 4NTBA 1E86A 2Y3DA 4IJJA 1G8XA 1EI7A 1UG7A 1Y6DA 4HFFB 2XRHA 2LFDA 3NMKA 3I4UA 4NTFA 4Z9HA 4P9TA 3EHNA 2EILC 2UUIA 3R7CA 4MW3A 3LLIA 2A6EF 1HW2A 4LDKA 2XLOA 4UDVA 3MX3A 1Z3IX 4I1MA 2W4MA 5JP7A 1K04A 5JLIA 3C63A 3U2MA 5IY5C 2A69F 3SP1A 4D4XA 4E18A 3ZTZA 5F5FA 4NY3A 3FXHA 3H2UA 3O39A 1L3PA 2EPOA 3DJNB 4I3MA 4JZAA 4YJWA 3O55A 3UMHA 1Q0MA 3L1MA 3ZC4A 4JTDB 4KBLA 2AWCA 5CIVA 3RQGA 2I15A 1OW7A 2VC9A 3VYWA 3SXMA 1PD0A 2XLMA 1G4WR 4LDQA 2PX0A 4K0DA 4JRZA 3T6JA 3KPHA 5F5HA 3OWTA 2IM8A 3ECSA 4Q4ZF 2J45A 5T3WA 5JRAA 5JSLA 5L0JA 3G4ZA 1S05A 3ASOC 4JEBA 3RW0A 3ASNC 4ANJA 4G7OF 4NCQA 5DS6A 4N06A 3RYLA 3W4YA 1O3UA 3RH3A 5DS4A 2H7BA 3H65A 1YDIA 2J9UA 1QQ3A 1JPJA 3M4CA 3RVYA 3CEXA 3J06A 1T6QA 3S29A 1V55C 2QLAA 3MFNA 3B9QA 1C03A 4XPXA 3NMIA 3T4RA 1TWHA 4U5CE 1D0XA 1KTMA 4YK5A 2R25A 2ZXWC 3NG1A 4JJGA 3US6A 2TMVP 2QTVA 3QMKA 4XLPF 1JMWA 3IEEA 1VLTA 3FDQA 3NYLA 1CGME 4CIHA 4MVOA 3CZ6A 3KYJA 3M15A 5E33A 3E70C 3X1OA 3FMSA 3AG1C 3JSEO 5L3VA 3U0CA 4ONSA 1NU7D 2BE5F 2HMZA 1YZCA 2L81A 4I44A 4OD4A 4ULVA 1AEPA 3AJMA 2Z15A 1HW1A 2PNOA 4GQHA 3EHMA 5FZTA 3ZQVA 1MMGA 1RKCA 4MVQA 3W8IA 3ABMC 3VAYA 1YA7O 1H9GA 3LS1A 4CS8C 2R7VA 4LACB 1S7ZA 4U5GA 5DS5A 4O6NA 4EBJA 1FMWA 2A0UA 3LEOA 2RD9A 3TULA 4XEKA 3AG4C 1PD1A 1HE1A 3EH2A 1O5HA 2KYHA 4ULWA 4MVMA 4DOZA 2Q9AA 2OOCA 2W4BA 4MVRA 4BEMJ 3V5XA 4CSAC 4OINF 1MMAA 2IXNA 2KJGA 1H9TA 4PFOA 4AE4B 4FAPB 2Y3GA 4GEHA 4JVSA 1A7VA 3SYNA 1A7EA 1FMVA 2YZSA 2PBEA 4KI2A 2LK4A 4DXWA 3NYMA 3S90A 1C02A 1R5ID 2R7RA 1XZPA 1NSGB 2HSBA 5A6BA 1RXQA 1VYIA 2F22A 3K1IC 2P0NA 4E7ZA 3C18A 4P6IC 4RDAA 2PX3A 3PHF2 3M79A 4U9DA 5DQTA 3UGOA 1V74B 5KYWB 3QW1A 4GYTA 1U6HA 3V7OA 5HSWA 2LFFA 2NUPA 1WGWA 3JTLO 1RCPA 5CI9A 5EK0A 3FHDA 3S0XA 1Z5ZA 2H8AA 5DQZA 2P7VA 3POVA 4U5FE 2J9VA 3JRMO 3WAQA 1WOLA 5COFA 1BR2A 1Q0FA 1ST6A 2AWYA 1TR2A 2DYRC 3JYHA 3OEOA 3Q7LA 4MVZA 2ZXRA 1OCOC 2WZGA 4U5EE 3DKAA 5KYXB 1GS9A 2FFHA 2IOQA 2YEVA 3EFOB 4BJ6A 3NDBB 4QDLA 4G78A 3T6BA 5B3SC 3EGDB 1TWCA 3QVZA 2E87A 2XS1A 1OKKD 2AU5A 2J0WA 2OJQA 1OXKA 3DM9B 4JCZA 3EJNA 4FX5A 4PK4A 2B0JA 4XEFA 5DLJA 4E0IA 1I4ZA 2CCYA 3I5PA 5BQIA 2LQGA 1YLMA 3AQBA 2L7AA 3VRCA 3NYJA 2XXAA 3C8GB 1VMAA 3C8GA 256BA 2JX0A 2NSFA 2XLDA 1SR2A 4MVSA 4HE8D 3JZ0A 3NMJA 2HZ8A 3S9OA 4AL1A 3IQTA 1VLSA 1BR4A 1ORJA 4WGZA 5DVWA 4Z9JA 2H7OA 2CGEA 1YYJA 4CS9A 4OIPF 2P61A 1LS1A 1NZEA 3TK0A 3W2VA 4ZLCA 4BJTA 5E2QA 3BRJA 2I8BA 3KYIA 3DAGA 2YLGA 3GEHA 1BR1A 4U5DE 3WG7C 2ASRA 4QI0A 2XSEA 1OW6A 3DZAA 4JURI 4PJMA 2GFHA 4W8KA 1OCRC 3SXZA 1OCZC 1L7CA 3V5YA 4PR9A 2MWQA 2G3KA 5A6BD 2OEVA 2WZLA 5B1AC 1D1CA 2R05A 3DAFA 1RMVA 3LESA 3U2LA 5D92A 2J9WA 2LIGA 2O9XA 2PFDA 1LM3B 1QKRA 4LLEA 1BBHA 1GQAA 1K05A 2G62A 3GM2A 4R32A 3SNHA 4EUKB 4BJ5C 2EINC 4J7YA 3UGPA 1IZMA 4C7OB 3SEOA 3N0TA 2EPLX 2J7PA 2VCCA 2V3CC 1ZHZA 5A6AA 1PV3A 5E3CA 5L0CA 2HS5A 3GM3A 2Q00A 3OA1A 4YL3A 3LEVA 3WHNA 1YZAA 1LVKA 1J8MF 2HMQA 1J8YF 3ZG1A 2YHSA 5BQHA 1Q0KA 3G4XA 1ZHTA 2MYSA 1Z63A 3RQFA 2L6HA 4E0HA 2R7SA 4Q7CA 3ABKC 1FTSA 5FCLA 2ZXPA 1D1AA 2XS8A 3EH1A 3K33A 2NG1A 2EIMC 1NFOA 1OW8A 2VCAA 2IXOA 1LI7A 3AQCA 1E2XA 2HJ3A 3CAXA 1Z7Qc 4FESA 1LPEA 2LD6A 2VASA 3FOPA 3IQ5A 3HTKC 2B0HA 3LNMB 1JOGA 3GEEA 2NPUA 2HFIA 4LDRA 2Y3HA 2OKUA 2YL3A 2KGOA 3KKBA 1JAFA 1H6GA 3RKOF 2QY9A 4WGYA 4Z9IA 2OJED 2BL2A 4JJFA 1T6IA 4FWVA 3QVYA 4PJJA 5KYUB 4AL0A 4DRHB 2XLHA 1I4YA 3GANA 3ZDLA 2KK1A 4IARA 5D91A 3SXYA 1ZVZA 5A6JA 1D0YA 1T5OA 3NKEA 2XL4A 1M56C 4CJOA 3AG2C 2IXPA 4ER9A 3Q7GA 1BDJB 4N6CA 1Q0DA 2R02A 4C3BA 3ZSUA 1E85A 4M63A 3LNRA 4ZLDA 3L8IA 1M2VB 4MS2A 1QVXA 2GA0A 2X0CA 5T1DB 1LS4A 1TQGA 2HSQA 3M1CB 1NU9C 3R2PA 3RF3A 3B0VC 1U0BB 1RJ9B 1K40A 1RJ9A 4IWBA 4O6YA 4DJ9A 3TOMA 2A0BA 2EPNA 1LIHA 2Q3TA 3ZIBA 2VB6A 3UMIA 2EIJC 1RKEB 1RKEA 1JR8A 2NUTB 2R7QA 3PCVA 4YT2A 4OIQF 4OIOF 2PF4E 3FOOA 5COMA 1F1MA 1KNYA 2XLEA 4YL1A 2DYSC 5KYNA 4H54A 4AE4A 1V54C 2L6GA 4U5HA 4IAOA 4QI2A 3IQ6A 1APCA 4OD5A 4JE9A 1Q0GA 4JIOA 3JCUQ 2KNHA 4CS8A 4G0HA 4WABA 4CDAA 3U8PA 2GWWA 4BG0A 2OU6A 3A9CA 2V26A 3ATPA 2Y39A 3HLZA 4YT5A 3VF0A 2P1AA 4BPMA 1ORSC 2X51A 2CNWA 2YL0A 2W45A 5KYYB 2WZFA 3W2WA 1LE4A 2A6HF 3MYIA 4HFKB 4CBEA 1A7DA 5KYWA 3KL4A 3IPMO 2R7TA 2L9JA 3QZCA 5COGA 3JRTA 4DRJB 4JTAB 3RFYA 1GM5A 3NKDA 1M2OA 3LAYA 3B71A 1WWPA 4X0RA 2AP3A 1Z23A 3JT1A 4H4KC 4EBKA 5KYXA 1VK5A 3CQZA 3EFOA 3IHUA 4MVUA 3KH2A 5B1BC 3LJBA 1FFTC 4NTAA 3EGDA 4G7HF 3U9JA 1AUEA 1LE2A 1B68A 3AG3C 4O7GA 2WVOA 2C04A 4AX2A 3PMRA 2ICWG 1PCXA 2R03A 5L0FA 3V5ZA 3L8JA 4YT4A 1YYXA 2FGYA 3QTHA 2XM4A 1DOWA 4N6HA 3S27A 3UNGC 3H2VA 2UUHA 3RVZA 1Y4CA 2Q7RA 3MYFA 4N4WA 3IQCA 1CGOA 3K1HA 3HNJA 5TJ5E 4JEAA 1SYQA 2Q4FA 3CSKA 4KNVA 1FFHA 2ZPAA 1JPNA 3DJUB 4NQFA 3TJ6A 4DVYP 1ORYA 3EG9B 4E17A 5EGYA 1FAPB 2CW0F 2A1DD 2WVQA 1MQVA 1EA8A 1MMDA 2LSEA 1MNEA 1Z6AA 3S28A 4PACA 3LLKA 1LI5A 2YL7A 2Q9CA 3ITFA 4DRIB 3FAPB 1QZXA 2WVNA 2H7VC 5JT4A 1OQCA 3B0UX 2EPMX 3ZQYA 3EGXB 4O79A 4AK9A 1FR0A 4XWJA 1YAUO 2XL6A 2IBFA 4LLCA 1NBBA 1IW7F 3TOLA 2CNWD 3BEHA 5BQGA 4CJGA 5L3QA 1FNTc 2M64A 3S84A 2HJMA 4C3DA 2EIKC 3U3FA 3G50A 2GDCA 3N2ZB 4EHPA 3ZTMA 3VM6A 1ZW2A 4C7OA 5L0HA 2R7UA 2KC3A 3DWWA 1ZZPA 2YWAA 2W9YA 4C3EA 3JSZA 4KC9A 1ZHYA 2J0XA 4MTOA 4YL0A 1TWAA 3A11A 1HY5A 4O6MA 1TWGA 1OXBA 1ZYRF 4YN0B 5L0DA 4XPWA 5A6KA 5AC4A 1MMNA 3L34A 2IYLD 4IGGA 1VTMP 4G7ZF 4IAQA 1A0BA 3T6GB 2JPUA 1ZHXA 4J32B 1NLXA 4CIPA 4MTGA 4F4BA 1SF8A 1W2WA 2RSEB 4YWQA 1ZW3A 3ZWIA 5JVEA 3F46A 1G4US 1OR2A 2XLVA 3RIPA 3UR3C 4DBRA 3DXJF 1XZQA 2DI3A 4EIYA 1XWJA 1YARO 2Y3BA 3TJ5A 5JUAA 1EKYA 1SZIA 2P6VA 3NRHA 2D4UA 3GODA 3Q6NA 2Y69C 4BJ5A 3C8GD 1T9KA 1QPUA 3U8VA
chains in the Genus database with same CATH topology
3T9OA 1LIHA 1WASA 2LIGA 1VLSA 4Z9JA 1JMWA 2D4UA 3ATPA 1VLTA 4Z9IA 2ASRA 4Z9HA 4H54A 1WATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9O A;  1LIH A;  1WAS A;  2LIG A;  1VLS A;  4Z9J A;  1JMW A;  2D4U A;  3ATP A;  1VLT A;  4Z9I A;  2ASR A;  4Z9H A;  4H54 A;  1WAT A; 
#chains in the Genus database with same CATH topology
 4D4N A;  4IB4 A;  1JRA A;  4A4A A;  3TQO A;  4DVZ A;  3K66 A;  5JS5 A;  1EQ1 A;  4EBB A;  2ZXO A;  4YT8 A;  1OCC C;  2LP4 A;  3KMI A;  2ZD9 A;  2KQ9 A;  5KYU A;  1A41 A;  2JD3 A;  4MTF A;  1U89 A;  3MLG A;  1V4A A;  2PP4 A;  3U5S A;  1G5Z A;  5T3T A;  3W8H A;  3WOD F;  4OIR F;  4JW1 A;  3UMK A;  2OQM A;  5HV9 A;  4W8P A;  2R7X A;  4IRU A;  1O87 A;  1MND A;  1NFN A;  4WJ0 A;  1CGN A;  2AVK A;  1YVI A;  2YLI A;  1M2V A;  4K1O A;  1GGQ A;  1YA9 A;  2XL8 A;  5BUO A;  2XLW A;  4LER A;  1QSP A;  5E3A A;  3SZR A;  4XEV A;  2A68 F;  3B0P A;  1HE9 A;  4XQ1 A;  5EHH A;  2CDQ A;  1UFB A;  2Q9B A;  1R4T A;  2J8W A;  2WL8 A;  2C03 A;  3B29 A;  3EQL F;  4A2N B;  3HNI A;  1E83 A;  1E84 A;  3PDM P;  3SXK A;  1LKX A;  2MHR A;  4Q5S F;  1VB5 A;  2DB4 A;  3FAJ A;  2NUT A;  5L0I A;  3K6B A;  2J7P D;  3GOR A;  2R9R B;  5AC5 A;  3MBG A;  4I1O B;  5L0G A;  2OCC C;  3DD7 A;  3GM1 A;  2G3V A;  5AGF A;  4JC7 A;  1OKK A;  3DMD A;  3DE9 A;  3TD7 A;  3AGU A;  1D1B A;  4RBN A;  3T9O A;  3E9V A;  4CDV A;  4EWC A;  4J7T A;  3L0I A;  3DM5 A;  3O10 A;  2IXM A;  3K7D A;  3DI5 A;  3M4B A;  3ABL C;  3FVY A;  1AVO B;  3C7J A;  2ETS A;  5CI8 A;  4KNW A;  5KYY A;  3I5Q A;  4MW8 A;  1ZHW A;  3F47 A;  2HV6 A;  3U3B A;  1C17 M;  1QLE C;  1VYK A;  2HV7 A;  3Q6M A;  4CSA A;  1HMO A;  1N1C A;  1TKN A;  3RQE A;  2YRF A;  2VCB A;  4XTK A;  4P9F A;  2QUP A;  2BC5 A;  1OR3 A;  4NC3 A;  4EKW A;  4MQ9 F;  3HKK A;  4MND A;  3N24 A;  4B6I A;  4PJL A;  4BJ6 C;  4E7S A;  1H7I A;  2CYD A;  4PFP A;  1WN0 A;  2YQY A;  3O6X A;  4CS7 A;  5A69 A;  2FAP B;  1WAT A;  4XLN F;  4CX9 A;  3EPV A;  2LCH A;  4BJ1 A;  4L6R A;  1WAS A;  1ZU5 A;  1KU2 A;  2NSG A;  3AOU A;  3U9M A;  2J46 A;  5GPG B;  3K1I A;  2DGJ A;  3C62 A;  2OEX A;  4U5B E;  3X2Q C;  2VH3 A;  2R7O A;  1I5N A;  3LS0 A;  2OG2 A;  3QW0 A;  1T01 A;  4J30 B;  5B3I A;  4PJN A;  2L6F A;  2HUJ A;  2WB7 A;  2NUP B;  1ZU4 A;  4K7B A;  4RD9 A;  3GWL A;  1SMY F;  2QNL A;  4DBQ A;  4JTC B;  2QE9 A;  4CDY A;  3EZI A;  1CPQ A;  1T6U A;  3C8Z A;  4CS9 C;  2HKV A;  1TFO B;  1VOM A;  4BEJ A;  3EZH A;  2XM0 A;  3EG9 A;  5F28 E;  3ZVR A;  1YJG A;  1BZ4 A;  4JKV A;  2YL1 A;  2M4E A;  3AGT A;  3HNK A;  3JYY A;  1D0Z A;  3GEI A;  2J9B A;  2EPK X;  4HEA J;  1DOV A;  1TFK B;  4U9E A;  1M57 C;  1WTY A;  2GAQ A;  3GWN A;  3HNL A;  1M6T A;  3LUT B;  2KW3 C;  4JCH A;  1NG1 A;  3DE8 A;  1HMD A;  5K0I A;  4XPY A;  2D5R B;  2KSF A;  3EGX A;  3HJC A;  2R7W A;  1CPR A;  2YKZ A;  2YVK A;  2YLD A;  2XXA B;  4NTB A;  1E86 A;  2Y3D A;  4IJJ A;  1G8X A;  1EI7 A;  1UG7 A;  1Y6D A;  4HFF B;  2XRH A;  2LFD A;  3NMK A;  3I4U A;  4NTF A;  4Z9H A;  4P9T A;  3EHN A;  2EIL C;  2UUI A;  3R7C A;  4MW3 A;  3LLI A;  2A6E F;  1HW2 A;  4LDK A;  2XLO A;  4UDV A;  3MX3 A;  1Z3I X;  4I1M A;  2W4M A;  5JP7 A;  1K04 A;  5JLI A;  3C63 A;  3U2M A;  5IY5 C;  2A69 F;  3SP1 A;  4D4X A;  4E18 A;  3ZTZ A;  5F5F A;  4NY3 A;  3FXH A;  3H2U A;  3O39 A;  1L3P A;  2EPO A;  3DJN B;  4I3M A;  4JZA A;  4YJW A;  3O55 A;  3UMH A;  1Q0M A;  3L1M A;  3ZC4 A;  4JTD B;  4KBL A;  2AWC A;  5CIV A;  3RQG A;  2I15 A;  1OW7 A;  2VC9 A;  3VYW A;  3SXM A;  1PD0 A;  2XLM A;  1G4W R;  4LDQ A;  2PX0 A;  4K0D A;  4JRZ A;  3T6J A;  3KPH A;  5F5H A;  3OWT A;  2IM8 A;  3ECS A;  4Q4Z F;  2J45 A;  5T3W A;  5JRA A;  5JSL A;  5L0J A;  3G4Z A;  1S05 A;  3ASO C;  4JEB A;  3RW0 A;  3ASN C;  4ANJ A;  4G7O F;  4NCQ A;  5DS6 A;  4N06 A;  3RYL A;  3W4Y A;  1O3U A;  3RH3 A;  5DS4 A;  2H7B A;  3H65 A;  1YDI A;  2J9U A;  1QQ3 A;  1JPJ A;  3M4C A;  3RVY A;  3CEX A;  3J06 A;  1T6Q A;  3S29 A;  1V55 C;  2QLA A;  3MFN A;  3B9Q A;  1C03 A;  4XPX A;  3NMI A;  3T4R A;  1TWH A;  4U5C E;  1D0X A;  1KTM A;  4YK5 A;  2R25 A;  2ZXW C;  3NG1 A;  4JJG A;  3US6 A;  2TMV P;  2QTV A;  3QMK A;  4XLP F;  1JMW A;  3IEE A;  1VLT A;  3FDQ A;  3NYL A;  1CGM E;  4CIH A;  4MVO A;  3CZ6 A;  3KYJ A;  3M15 A;  5E33 A;  3E70 C;  3X1O A;  3FMS A;  3AG1 C;  3JSE O;  5L3V A;  3U0C A;  4ONS A;  1NU7 D;  2BE5 F;  2HMZ A;  1YZC A;  2L81 A;  4I44 A;  4OD4 A;  4ULV A;  1AEP A;  3AJM A;  2Z15 A;  1HW1 A;  2PNO A;  4GQH A;  3EHM A;  5FZT A;  3ZQV A;  1MMG A;  1RKC A;  4MVQ A;  3W8I A;  3ABM C;  3VAY A;  1YA7 O;  1H9G A;  3LS1 A;  4CS8 C;  2R7V A;  4LAC B;  1S7Z A;  4U5G A;  5DS5 A;  4O6N A;  4EBJ A;  1FMW A;  2A0U A;  3LEO A;  2RD9 A;  3TUL A;  4XEK A;  3AG4 C;  1PD1 A;  1HE1 A;  3EH2 A;  1O5H A;  2KYH A;  4ULW A;  4MVM A;  4DOZ A;  2Q9A A;  2OOC A;  2W4B A;  4MVR A;  4BEM J;  3V5X A;  4CSA C;  4OIN F;  1MMA A;  2IXN A;  2KJG A;  1H9T A;  4PFO A;  4AE4 B;  4FAP B;  2Y3G A;  4GEH A;  4JVS A;  1A7V A;  3SYN A;  1A7E A;  1FMV A;  2YZS A;  2PBE A;  4KI2 A;  2LK4 A;  4DXW A;  3NYM A;  3S90 A;  1C02 A;  1R5I D;  2R7R A;  1XZP A;  1NSG B;  2HSB A;  5A6B A;  1RXQ A;  1VYI A;  2F22 A;  3K1I C;  2P0N A;  4E7Z A;  3C18 A;  4P6I C;  4RDA A;  2PX3 A;  3PHF 2;  3M79 A;  4U9D A;  5DQT A;  3UGO A;  1V74 B;  5KYW B;  3QW1 A;  4GYT A;  1U6H A;  3V7O A;  5HSW A;  2LFF A;  2NUP A;  1WGW A;  3JTL O;  1RCP A;  5CI9 A;  5EK0 A;  3FHD A;  3S0X A;  1Z5Z A;  2H8A A;  5DQZ A;  2P7V A;  3POV A;  4U5F E;  2J9V A;  3JRM O;  3WAQ A;  1WOL A;  5COF A;  1BR2 A;  1Q0F A;  1ST6 A;  2AWY A;  1TR2 A;  2DYR C;  3JYH A;  3OEO A;  3Q7L A;  4MVZ A;  2ZXR A;  1OCO C;  2WZG A;  4U5E E;  3DKA A;  5KYX B;  1GS9 A;  2FFH A;  2IOQ A;  2YEV A;  3EFO B;  4BJ6 A;  3NDB B;  4QDL A;  4G78 A;  3T6B A;  5B3S C;  3EGD B;  1TWC A;  3QVZ A;  2E87 A;  2XS1 A;  1OKK D;  2AU5 A;  2J0W A;  2OJQ A;  1OXK A;  3DM9 B;  4JCZ A;  3EJN A;  4FX5 A;  4PK4 A;  2B0J A;  4XEF A;  5DLJ A;  4E0I A;  1I4Z A;  2CCY A;  3I5P A;  5BQI A;  2LQG A;  1YLM A;  3AQB A;  2L7A A;  3VRC A;  3NYJ A;  2XXA A;  3C8G B;  1VMA A;  3C8G A;  256B A;  2JX0 A;  2NSF A;  2XLD A;  1SR2 A;  4MVS A;  4HE8 D;  3JZ0 A;  3NMJ A;  2HZ8 A;  3S9O A;  4AL1 A;  3IQT A;  1VLS A;  1BR4 A;  1ORJ A;  4WGZ A;  5DVW A;  4Z9J A;  2H7O A;  2CGE A;  1YYJ A;  4CS9 A;  4OIP F;  2P61 A;  1LS1 A;  1NZE A;  3TK0 A;  3W2V A;  4ZLC A;  4BJT A;  5E2Q A;  3BRJ A;  2I8B A;  3KYI A;  3DAG A;  2YLG A;  3GEH A;  1BR1 A;  4U5D E;  3WG7 C;  2ASR A;  4QI0 A;  2XSE A;  1OW6 A;  3DZA A;  4JUR I;  4PJM A;  2GFH A;  4W8K A;  1OCR C;  3SXZ A;  1OCZ C;  1L7C A;  3V5Y A;  4PR9 A;  2MWQ A;  2G3K A;  5A6B D;  2OEV A;  2WZL A;  5B1A C;  1D1C A;  2R05 A;  3DAF A;  1RMV A;  3LES A;  3U2L A;  5D92 A;  2J9W A;  2LIG A;  2O9X A;  2PFD A;  1LM3 B;  1QKR A;  4LLE A;  1BBH A;  1GQA A;  1K05 A;  2G62 A;  3GM2 A;  4R32 A;  3SNH A;  4EUK B;  4BJ5 C;  2EIN C;  4J7Y A;  3UGP A;  1IZM A;  4C7O B;  3SEO A;  3N0T A;  2EPL X;  2J7P A;  2VCC A;  2V3C C;  1ZHZ A;  5A6A A;  1PV3 A;  5E3C A;  5L0C A;  2HS5 A;  3GM3 A;  2Q00 A;  3OA1 A;  4YL3 A;  3LEV A;  3WHN A;  1YZA A;  1LVK A;  1J8M F;  2HMQ A;  1J8Y F;  3ZG1 A;  2YHS A;  5BQH A;  1Q0K A;  3G4X A;  1ZHT A;  2MYS A;  1Z63 A;  3RQF A;  2L6H A;  4E0H A;  2R7S A;  4Q7C A;  3ABK C;  1FTS A;  5FCL A;  2ZXP A;  1D1A A;  2XS8 A;  3EH1 A;  3K33 A;  2NG1 A;  2EIM C;  1NFO A;  1OW8 A;  2VCA A;  2IXO A;  1LI7 A;  3AQC A;  1E2X A;  2HJ3 A;  3CAX A;  1Z7Q c;  4FES A;  1LPE A;  2LD6 A;  2VAS A;  3FOP A;  3IQ5 A;  3HTK C;  2B0H A;  3LNM B;  1JOG A;  3GEE A;  2NPU A;  2HFI A;  4LDR A;  2Y3H A;  2OKU A;  2YL3 A;  2KGO A;  3KKB A;  1JAF A;  1H6G A;  3RKO F;  2QY9 A;  4WGY A;  4Z9I A;  2OJE D;  2BL2 A;  4JJF A;  1T6I A;  4FWV A;  3QVY A;  4PJJ A;  5KYU B;  4AL0 A;  4DRH B;  2XLH A;  1I4Y A;  3GAN A;  3ZDL A;  2KK1 A;  4IAR A;  5D91 A;  3SXY A;  1ZVZ A;  5A6J A;  1D0Y A;  1T5O A;  3NKE A;  2XL4 A;  1M56 C;  4CJO A;  3AG2 C;  2IXP A;  4ER9 A;  3Q7G A;  1BDJ B;  4N6C A;  1Q0D A;  2R02 A;  4C3B A;  3ZSU A;  1E85 A;  4M63 A;  3LNR A;  4ZLD A;  3L8I A;  1M2V B;  4MS2 A;  1QVX A;  2GA0 A;  2X0C A;  5T1D B;  1LS4 A;  1TQG A;  2HSQ A;  3M1C B;  1NU9 C;  3R2P A;  3RF3 A;  3B0V C;  1U0B B;  1RJ9 B;  1K40 A;  1RJ9 A;  4IWB A;  4O6Y A;  4DJ9 A;  3TOM A;  2A0B A;  2EPN A;  1LIH A;  2Q3T A;  3ZIB A;  2VB6 A;  3UMI A;  2EIJ C;  1RKE B;  1RKE A;  1JR8 A;  2NUT B;  2R7Q A;  3PCV A;  4YT2 A;  4OIQ F;  4OIO F;  2PF4 E;  3FOO A;  5COM A;  1F1M A;  1KNY A;  2XLE A;  4YL1 A;  2DYS C;  5KYN A;  4H54 A;  4AE4 A;  1V54 C;  2L6G A;  4U5H A;  4IAO A;  4QI2 A;  3IQ6 A;  1APC A;  4OD5 A;  4JE9 A;  1Q0G A;  4JIO A;  3JCU Q;  2KNH A;  4CS8 A;  4G0H A;  4WAB A;  4CDA A;  3U8P A;  2GWW A;  4BG0 A;  2OU6 A;  3A9C A;  2V26 A;  3ATP A;  2Y39 A;  3HLZ A;  4YT5 A;  3VF0 A;  2P1A A;  4BPM A;  1ORS C;  2X51 A;  2CNW A;  2YL0 A;  2W45 A;  5KYY B;  2WZF A;  3W2W A;  1LE4 A;  2A6H F;  3MYI A;  4HFK B;  4CBE A;  1A7D A;  5KYW A;  3KL4 A;  3IPM O;  2R7T A;  2L9J A;  3QZC A;  5COG A;  3JRT A;  4DRJ B;  4JTA B;  3RFY A;  1GM5 A;  3NKD A;  1M2O A;  3LAY A;  3B71 A;  1WWP A;  4X0R A;  2AP3 A;  1Z23 A;  3JT1 A;  4H4K C;  4EBK A;  5KYX A;  1VK5 A;  3CQZ A;  3EFO A;  3IHU A;  4MVU A;  3KH2 A;  5B1B C;  3LJB A;  1FFT C;  4NTA A;  3EGD A;  4G7H F;  3U9J A;  1AUE A;  1LE2 A;  1B68 A;  3AG3 C;  4O7G A;  2WVO A;  2C04 A;  4AX2 A;  3PMR A;  2ICW G;  1PCX A;  2R03 A;  5L0F A;  3V5Z A;  3L8J A;  4YT4 A;  1YYX A;  2FGY A;  3QTH A;  2XM4 A;  1DOW A;  4N6H A;  3S27 A;  3UNG C;  3H2V A;  2UUH A;  3RVZ A;  1Y4C A;  2Q7R A;  3MYF A;  4N4W A;  3IQC A;  1CGO A;  3K1H A;  3HNJ A;  5TJ5 E;  4JEA A;  1SYQ A;  2Q4F A;  3CSK A;  4KNV A;  1FFH A;  2ZPA A;  1JPN A;  3DJU B;  4NQF A;  3TJ6 A;  4DVY P;  1ORY A;  3EG9 B;  4E17 A;  5EGY A;  1FAP B;  2CW0 F;  2A1D D;  2WVQ A;  1MQV A;  1EA8 A;  1MMD A;  2LSE A;  1MNE A;  1Z6A A;  3S28 A;  4PAC A;  3LLK A;  1LI5 A;  2YL7 A;  2Q9C A;  3ITF A;  4DRI B;  3FAP B;  1QZX A;  2WVN A;  2H7V C;  5JT4 A;  1OQC A;  3B0U X;  2EPM X;  3ZQY A;  3EGX B;  4O79 A;  4AK9 A;  1FR0 A;  4XWJ A;  1YAU O;  2XL6 A;  2IBF A;  4LLC A;  1NBB A;  1IW7 F;  3TOL A;  2CNW D;  3BEH A;  5BQG A;  4CJG A;  5L3Q A;  1FNT c;  2M64 A;  3S84 A;  2HJM A;  4C3D A;  2EIK C;  3U3F A;  3G50 A;  2GDC A;  3N2Z B;  4EHP A;  3ZTM A;  3VM6 A;  1ZW2 A;  4C7O A;  5L0H A;  2R7U A;  2KC3 A;  3DWW A;  1ZZP A;  2YWA A;  2W9Y A;  4C3E A;  3JSZ A;  4KC9 A;  1ZHY A;  2J0X A;  4MTO A;  4YL0 A;  1TWA A;  3A11 A;  1HY5 A;  4O6M A;  1TWG A;  1OXB A;  1ZYR F;  4YN0 B;  5L0D A;  4XPW A;  5A6K A;  5AC4 A;  1MMN A;  3L34 A;  2IYL D;  4IGG A;  1VTM P;  4G7Z F;  4IAQ A;  1A0B A;  3T6G B;  2JPU A;  1ZHX A;  4J32 B;  1NLX A;  4CIP A;  4MTG A;  4F4B A;  1SF8 A;  1W2W A;  2RSE B;  4YWQ A;  1ZW3 A;  3ZWI A;  5JVE A;  3F46 A;  1G4U S;  1OR2 A;  2XLV A;  3RIP A;  3UR3 C;  4DBR A;  3DXJ F;  1XZQ A;  2DI3 A;  4EIY A;  1XWJ A;  1YAR O;  2Y3B A;  3TJ5 A;  5JUA A;  1EKY A;  1SZI A;  2P6V A;  3NRH A;  2D4U A;  3GOD A;  3Q6N A;  2Y69 C;  4BJ5 A;  3C8G D;  1T9K A;  1QPU A;  3U8V A; 
#chains in the Genus database with same CATH homology
 3T9O A;  1LIH A;  1WAS A;  2LIG A;  1VLS A;  4Z9J A;  1JMW A;  2D4U A;  3ATP A;  1VLT A;  4Z9I A;  2ASR A;  4Z9H A;  4H54 A;  1WAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...