1LIHA

Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
160
structure length
160
Chain Sequence
MGGLLFSSLQHCQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTFDQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemotaxis
molecule keywords ASPARTATE RECEPTOR
publication title Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
total genus 66
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1995-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1lihA00
3T9OA 4H54A 2D4UA 1VLTA 4Z9JA 3ATPA 1WASA 1WATA 1VLSA 1JMWA 1LIHA 4Z9IA 2ASRA 4Z9HA 2LIGA
chains in the Genus database with same CATH superfamily
4RD9A 5JRAA 2AU5A 2FGYA 3HNKA 1ZHTA 4Q4ZF 4C7OB 3U3FA 4AL0A 1E85A 4JEBA 4CSAA 2HS5A 3T6GB 1SYQA 3TQOA 3AJMA 3ABLC 3C8GB 3FXHA 1T9KA 2W9YA 1T5OA 4HE8D 4BJ1A 4MVZA 3JZ0A 1VYKA 2YWAA 2WZGA 4J30B 2YQYA 4U5DE 3SXYA 2H8AA 2LP4A 2Y3HA 4EBKA 4OIPF 3ABKC 2NUPB 1YARO 4LACB 4UDVA 3HTKC 4LERA 1YA9A 2R03A 4IWBA 2A6EF 2AWYA 4CIHA 2YZSA 1RCPA 2KNHA 1FMWA 2YHSA 3LEOA 2YLGA 3LLIA 4BJ5C 1NFOA 1WN0A 4OIQF 3TOMA 3SXMA 3S0XA 1IW7F 3LS1A 2YLIA 3AQBA 2IBFA 1LVKA 2JD3A 2NSFA 2XL4A 1WASA 3IPMO 4LLEA 5COMA 3VF0A 2WVNA 5L0IA 2PP4A 4Z9IA 2VCAA 1RMVA 2H7OA 2DYRC 5DS4A 3RVYA 4N6HA 5AC5A 3ITFA 3NRHA 4O6NA 1B68A 5KYUB 2B0HA 5DLJA 1VLSA 4JTCB 3O39A 4B6IA 2XLWA 4JURI 3FDQA 2R7XA 5EK0A 3L0IA 2CW0F 3EZHA 3GANA 1RKEB 5JP7A 4PJNA 3U3BA 1JAFA 2QLAA 3TD7A 2F22A 3T9OA 1F1MA 3KMIA 2Y3DA 1D1CA 3CQZA 3W8HA 1YA7O 3U8PA 1MMDA 1FR0A 1E83A 2CCYA 2VASA 4BJTA 5CIVA 1ZU5A 3TOLA 2L7AA 4IAQA 3NMKA 3VAYA 3L8JA 5JSLA 2PF4E 3JTLO 3LESA 3U9MA 4XPXA 2QUPA 5CI8A 3PHF2 1Z7Qc 1OXBA 1WWPA 1YZCA 2LFDA 2R02A 3SYNA 3K6BA 4MVSA 1MMGA 3SZRA 3T6BA 2XLHA 2HJMA 3DZAA 3EGXB 2PNOA 2Z15A 3KH2A 4C3EA 1U6HA 1OW7A 3JYHA 2J0WA 2NG1A 2WZLA 3K1HA 3O55A 4YN0B 2D4UA 2EINC 3M79A 3A11A 2YL7A 4RBNA 1EQ1A 3I5PA 2VC9A 3OEOA 2HV7A 1T01A 4Z9HA 5F5FA 5JS5A 4YT5A 4G78A 2IXMA 2H7BA 3BEHA 1L3PA 4IARA 4MNDA 1LKXA 2VCCA 4CJOA 2AP3A 5DVWA 5GPGB 5HV9A 1NFNA 2HSBA 4PJJA 3KYIA 3FAPB 3TJ6A 1D0ZA 3B0PA 3DM9B 3W2VA 1G4WR 3LNMB 1PD1A 1QPUA 3RKOF 2JPUA 4A2NB 3ZC4A 4MW8A 1YYJA 3AG3C 3DJNB 2XS8A 3VYWA 4QI2A 2LD6A 1H9TA 1JPJA 3U2MA 3NDBB 3ZG1A 4JW1A 2J9WA 3G4XA 3U9JA 4MQ9F 4CDVA 4G7OF 1OR3A 3S29A 1GGQA 2CNWA 3SXZA 1N1CA 3DD7A 2LK4A 3V7OA 1I4ZA 3TJ5A 2MYSA 4U9EA 5COFA 1Y4CA 1WOLA 2RSEB 3FHDA 3IEEA 3MFNA 3NYLA 3QW1A 3AG4C 3M4BA 4IGGA 1EKYA 2Q00A 4E7ZA 1G5ZA 2DB4A 3N0TA 2R05A 1U0BB 1EA8A 3DWWA 3IQ6A 4I1MA 4EIYA 4NQFA 3JT1A 4E0IA 3C62A 1KU2A 2VCBA 5KYXB 4U5GA 2Q4FA 2LSEA 2P61A 3RFYA 3RIPA 2PX3A 2CDQA 3ZVRA 5E33A 1D0XA 1TWAA 3EZIA 4E18A 4EBBA 4JKVA 3AG1C 3K33A 3LS0A 2OCCC 1RKCA 5T1DB 3EG9B 4CDYA 5E3CA 1Z5ZA 2GAQA 2HKVA 2CYDA 2NSGA 4M63A 1SR2A 3DJUB 4Z9JA 1EI7A 1JMWA 1AVOB 3QW0A 3RH3A 3US6A 4CS8A 3B0VC 4K7BA 2KGOA 3C8ZA 1QLEC 4JTDB 4OINF 4CS9C 5A69A 1VMAA 3B0UX 2YL1A 3G4ZA 3GM2A 4C7OA 3NKEA 1GQAA 3K1IC 4O6MA 2FFHA 3A9CA 3GEHA 1ZYRF 5A6KA 1YLMA 2ICWG 3C8GA 2XL6A 3L8IA 5EHHA 2J7PD 4N06A 3ZTZA 3DXJF 4FAPB 1LI5A 2R7TA 1ST6A 3JRTA 4HEAJ 1BR2A 3AGUA 4YT2A 1A7EA 2NUPA 2VH3A 1YVIA 3C7JA 3NMJA 4N4WA 2MHRA 3FAJA 4DBQA 2KJGA 3ZQVA 3NYJA 2LFFA 3Q6NA 1OQCA 5A6JA 2WZFA 3ASNC 4XEKA 3RF3A 1NU7D 1ZHWA 4EUKB 1LE2A 2ETSA 2YLDA 2R7WA 3E70C 4BG0A 2YL3A 4U9DA 3NG1A 3HNLA 4ULVA 1S7ZA 4LDQA 3HNIA 4NCQA 3RQEA 1O3UA 2TMVP 4MVQA 4D4NA 3MX3A 2NUTA 2NUTB 2ZXWC 2XM0A 3MBGA 1I4YA 2PX0A 1YZAA 2L6GA 5KYUA 3POVA 2W4BA 1HMOA 1SF8A 4MTGA 4K1OA 3UGOA 4CBEA 4NTAA 1Z3IX 5AC4A 2L81A 4L6RA 2KC3A 4YWQA 4O79A 2P0NA 2RD9A 3C18A 5A6AA 1PD0A 1RKEA 4I1OB 3T4RA 4JZAA 3UMKA 2MWQA 4RDAA 2OEVA 4I3MA 3RVZA 2HJ3A 1VB5A 1T6UA 3R7CA 4PFOA 4JEAA 3AOUA 3EJNA 4ZLDA 2L6FA 1CGOA 4MVOA 4PJMA 2DYSC 3S27A 4FESA 4KNWA 4H54A 4XWJA 3SXKA 1A41A 2D5RB 2KYHA 2M64A 3KL4A 1E86A 1V55C 1WGWA 4IAOA 3AQCA 4AE4B 4CJGA 4G7ZF 4CSAC 2HZ8A 1XWJA 2XL8A 3EFOA 3QTHA 1AUEA 1K40A 1Z6AA 3EFOB 3DE9A 2BL2A 3EGXA 4YT8A 4EKWA 4K0DA 3GM1A 4NTBA 3GEEA 4X0RA 1FFHA 3E9VA 3ZIBA 2DI3A 3PDMP 256BA 2GDCA 4G0HA 1E84A 1HE9A 3DMDA 3Q7LA 4JIOA 3U0CA 1HE1A 5DS6A 1RJ9A 1OW8A 1VLTA 2IXOA 4JE9A 1RJ9B 1T6IA 4HFKB 1V54C 2C04A 1WTYA 3IQTA 5T3TA 4OIOF 3L1MA 4KBLA 5JUAA 3CSKA 1BDJB 2XLEA 1L7CA 1PCXA 2KK1A 3ABMC 4ONSA 3SEOA 3U5SA 4JJGA 1Q0DA 2J9BA 4MTOA 2JX0A 3FOPA 3V5XA 3DKAA 4MTFA 3MYFA 2EPKX 4LDRA 1HMDA 3S84A 4O6YA 3JCUQ 1TFKB 2OJED 4N6CA 4J32B 4NTFA 2J9VA 5T3WA 5B3IA 2P6VA 4KNVA 4WGYA 2NPUA 4R32A 1HY5A 2ZD9A 3WAQA 5B3SC 2R7OA 2R7RA 2QNLA 2YEVA 3DAGA 2V3CC 2XXAB 5KYYB 1VTMP 2G3KA 1ORYA 3WG7C 3ZDLA 2XS1A 1BR1A 2FAPB 3VRCA 4DJ9A 2EIMC 1KNYA 1QVXA 3JSZA 5COGA 4J7TA 3EGDB 3ASOC 1D0YA 4PFPA 3H2UA 3IQCA 4YJWA 1ZU4A 4CS9A 2W45A 4E17A 3GM3A 2XLMA 3GEIA 4IRUA 2A1DD 4P9FA 2H7VC 1H7IA 2J8WA 2KW3C 2A0BA 2PFDA 2ZXRA 4C3BA 1C17M 1CGNA 1JOGA 2BC5A 4OD4A 3NKDA 4HFFB 4G7HF 1LIHA 4CS7A 5KYXA 5KYWB 4I44A 3CZ6A 2KQ9A 1G8XA 1VK5A 3LUTB 2OEXA 1A7DA 1NU9C 3X2QC 3M1CB 1HW2A 1LE4A 2L9JA 2GA0A 5HSWA 1H6GA 2XM4A 1LS4A 1K04A 3EG9A 1QKRA 3S9OA 1R4TA 3KKBA 5BUOA 1GS9A 2XRHA 4DRIB 5L0FA 4CDAA 1NLXA 2WVOA 2Q7RA 2IM8A 4BJ5A 1M2VB 4PR9A 4BJ6C 1CGME 3N2ZB 4NC3A 2EPLX 5JLIA 4DRJB 1M6TA 3B29A 3JSEO 1Y6DA 1TKNA 1OCCC 4GQHA 4F4BA 5L0DA 1T6QA 4PACA 4U5BE 2HSQA 2R7QA 2A6HF 4XPWA 3IHUA 1Z23A 3HNJA 4LDKA 2G62A 4XLPF 1OCRC 1XZQA 3GORA 4KC9A 1BZ4A 5K0IA 1ZW3A 3AG2C 2IXPA 3QVZA 4ZLCA 1J8YF 2XSEA 4EHPA 2IOQA 2I8BA 3DM5A 4E0HA 1D1BA 2R9RB 2VB6A 1E2XA 2P1AA 4H4KC 5D91A 4BEMJ 4D4XA 2GWWA 1CPRA 4AL1A 2OG2A 4MS2A 1JR8A 4JVSA 5F28E 1MQVA 1C02A 2ZPAA 3ZTMA 4P9TA 1FNTc 1YYXA 4DVZA 4DRHB 3F46A 1NG1A 5B1AC 3KPHA 3AGTA 4WGZA 1HW1A 3V5ZA 4DOZA 1TWCA 3M4CA 3SP1A 4A4AA 5L0HA 2J7PA 2XLDA 3FMSA 4YL0A 4EBJA 1MMNA 3EPVA 1TR2A 4XQ1A 1IZMA 3CAXA 3GWNA 3RW0A 3NYMA 3S90A 3ECSA 4U5HA 2I15A 4W8PA 3ZSUA 3PCVA 2EPMX 4JTAB 3RYLA 4QI0A 5JT4A 1VYIA 1ZZPA 3LNRA 1QSPA 3DI5A 3RQGA 2R25A 3K66A 1ZHYA 1FTSA 1WATA 4PJLA 1DOWA 4YK5A 3SNHA 3UNGC 5KYNA 1GM5A 2HUJA 5E2QA 1SMYF 3PMRA 3EH1A 1CPQA 4DVYP 1AEPA 2UUIA 3LAYA 4CS8C 1OKKD 2Y3GA 2R7UA 4NY3A 3QVYA 3N24A 1TQGA 2O9XA 5F5HA 5L0JA 2LCHA 4MVMA 1V4AA 4OD5A 4AE4A 4OIRF 4AK9A 3UGPA 2E87A 1QQ3A 4U5FE 2OKUA 3QZCA 3T6JA 5E3AA 4DXWA 3WODF 2YKZA 4MVRA 5L3VA 2QY9A 3LLKA 1SZIA 1JRAA 4WJ0A 2EPOA 5AGFA 4DBRA 4C3DA 2QTVA 3C63A 4JRZA 3B71A 1OW6A 5A6BD 4O7GA 2A69F 2QE9A 1S05A 1U89A 1TWHA 2AVKA 2ZXPA 1J8MF 1BR4A 1OKKA 3IQ5A 2WB7A 3UR3C 2M4EA 3QMKA 2KSFA 2PBEA 1YJGA 1G4US 2A0UA 2B0JA 3FOOA 2YRFA 1Q0FA 4IJJA 5D92A 1OCOC 4P6IC 3GWLA 4BEJA 3J06A 2AWCA 4JJFA 1UFBA 2UUHA 3UMHA 4XEFA 1ORJA 4JC7A 1D1AA 3ZQYA 2Q9AA 5TJ5E 1H9GA 3I5QA 3RQFA 4E7SA 4XLNF 3EQLF 4GYTA 5A6BA 3G50A 1LS1A 3B9QA 5FZTA 1UG7A 1LPEA 1Q0GA 2ZXOA 3V5YA 4CX9A 3U2LA 1LI7A 3UMIA 4AX2A 5L0GA 1FFTC 4Q5SF 3OA1A 4YL1A 2P7VA 1FAPB 1MNDA 2HV6A 3F47A 1MNEA 1I5NA 1QZXA 5DS5A 2X51A 3GODA 2OU6A 3H65A 2R7VA 1MMAA 1ZW2A 2WVQA 3R2PA 2XLOA 2DGJA 4J7YA 4MVUA 4U5CE 2V26A 4XPYA 1C03A 2EILC 2Q9CA 2BE5F 2OQMA 2XXAA 3FVYA 5KYYA 2IXNA 5BQIA 1TWGA 3KYJA 4YT4A 4MW3A 3MYIA 2EIKC 1W2WA 1M57C 1YDIA 1M2OA 2Y69C 3EGDA 4ULWA 4BJ6A 1OCZC 1VOMA 4QDLA 2X0CA 1RXQA 3ZWIA 3S28A 5B1BC 2Y39A 3HJCA 3WHNA 1DOVA 2CNWD 4XTKA 5JVEA 2Q3TA 1NZEA 1PV3A 5DQTA 1YAUO 1M56C 1ZHXA 2HFIA 3K1IA 4JCZA 1FMVA 1V74B 2HMZA 2J45A 4KI2A 4BPMA 1KTMA 4XEVA 3MLGA 1OR2A 1ZHZA 1A7VA 2XLVA 1Q0MA 1ORSC 5CI9A 5IY5C 4ER9A 2LQGA 5L3QA 5KYWA 2W4MA 3JYYA 3HLZA 5BQGA 5EGYA 2WL8A 1APCA 2OJQA 3L34A 4Q7CA 3W4YA 2OOCA 3H2VA 3O10A 1O5HA 1TFOB 2G3VA 4ANJA 1XZPA 3VM6A 2GFHA 3W8IA 4YL3A 2J9UA 1M2VA 4IB4A 2CGEA 2YL0A 4LLCA 4WABA 3OWTA 3O6XA 2Q9BA 3TK0A 1K05A 2EPNA 1NBBA 1Z63A 2J0XA 3M15A 3Q6MA 3W2WA 2YVKA 3TULA 1ZVZA 3U8VA 3Q7GA 5BQHA 4PK4A 3JRMO 3NMIA 4W8KA 5L0CA 4EWCA 1NSGB 1BBHA 3CEXA 2J46A 3DE8A 3EH2A 1OXKA 3HKKA 3K7DA 1O87A 3BRJA 2LIGA 4JCHA 5DQZA 4GEHA 2EIJC 3EHMA 2R7SA 3LEVA 3C8GD 2C03A 1R5ID 3DAFA 1LM3B 2IYLD 3EHNA 2ASRA 3X1OA 2L6HA 3I4UA 5FCLA 3ATPA 2HMQA 1JPNA 3LJBA 4FWVA 1A0BA 1Q0KA 2Y3BA 4U5EE 2A68F 4CIPA 4FX5A
chains in the Genus database with same CATH topology
3T9OA 4H54A 2D4UA 1VLTA 4Z9JA 3ATPA 1WASA 1WATA 1VLSA 1JMWA 1LIHA 4Z9IA 2ASRA 4Z9HA 2LIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9O A;  4H54 A;  2D4U A;  1VLT A;  4Z9J A;  3ATP A;  1WAS A;  1WAT A;  1VLS A;  1JMW A;  1LIH A;  4Z9I A;  2ASR A;  4Z9H A;  2LIG A; 
#chains in the Genus database with same CATH topology
 4RD9 A;  5JRA A;  2AU5 A;  2FGY A;  3HNK A;  1ZHT A;  4Q4Z F;  4C7O B;  3U3F A;  4AL0 A;  1E85 A;  4JEB A;  4CSA A;  2HS5 A;  3T6G B;  1SYQ A;  3TQO A;  3AJM A;  3ABL C;  3C8G B;  3FXH A;  1T9K A;  2W9Y A;  1T5O A;  4HE8 D;  4BJ1 A;  4MVZ A;  3JZ0 A;  1VYK A;  2YWA A;  2WZG A;  4J30 B;  2YQY A;  4U5D E;  3SXY A;  2H8A A;  2LP4 A;  2Y3H A;  4EBK A;  4OIP F;  3ABK C;  2NUP B;  1YAR O;  4LAC B;  4UDV A;  3HTK C;  4LER A;  1YA9 A;  2R03 A;  4IWB A;  2A6E F;  2AWY A;  4CIH A;  2YZS A;  1RCP A;  2KNH A;  1FMW A;  2YHS A;  3LEO A;  2YLG A;  3LLI A;  4BJ5 C;  1NFO A;  1WN0 A;  4OIQ F;  3TOM A;  3SXM A;  3S0X A;  1IW7 F;  3LS1 A;  2YLI A;  3AQB A;  2IBF A;  1LVK A;  2JD3 A;  2NSF A;  2XL4 A;  1WAS A;  3IPM O;  4LLE A;  5COM A;  3VF0 A;  2WVN A;  5L0I A;  2PP4 A;  4Z9I A;  2VCA A;  1RMV A;  2H7O A;  2DYR C;  5DS4 A;  3RVY A;  4N6H A;  5AC5 A;  3ITF A;  3NRH A;  4O6N A;  1B68 A;  5KYU B;  2B0H A;  5DLJ A;  1VLS A;  4JTC B;  3O39 A;  4B6I A;  2XLW A;  4JUR I;  3FDQ A;  2R7X A;  5EK0 A;  3L0I A;  2CW0 F;  3EZH A;  3GAN A;  1RKE B;  5JP7 A;  4PJN A;  3U3B A;  1JAF A;  2QLA A;  3TD7 A;  2F22 A;  3T9O A;  1F1M A;  3KMI A;  2Y3D A;  1D1C A;  3CQZ A;  3W8H A;  1YA7 O;  3U8P A;  1MMD A;  1FR0 A;  1E83 A;  2CCY A;  2VAS A;  4BJT A;  5CIV A;  1ZU5 A;  3TOL A;  2L7A A;  4IAQ A;  3NMK A;  3VAY A;  3L8J A;  5JSL A;  2PF4 E;  3JTL O;  3LES A;  3U9M A;  4XPX A;  2QUP A;  5CI8 A;  3PHF 2;  1Z7Q c;  1OXB A;  1WWP A;  1YZC A;  2LFD A;  2R02 A;  3SYN A;  3K6B A;  4MVS A;  1MMG A;  3SZR A;  3T6B A;  2XLH A;  2HJM A;  3DZA A;  3EGX B;  2PNO A;  2Z15 A;  3KH2 A;  4C3E A;  1U6H A;  1OW7 A;  3JYH A;  2J0W A;  2NG1 A;  2WZL A;  3K1H A;  3O55 A;  4YN0 B;  2D4U A;  2EIN C;  3M79 A;  3A11 A;  2YL7 A;  4RBN A;  1EQ1 A;  3I5P A;  2VC9 A;  3OEO A;  2HV7 A;  1T01 A;  4Z9H A;  5F5F A;  5JS5 A;  4YT5 A;  4G78 A;  2IXM A;  2H7B A;  3BEH A;  1L3P A;  4IAR A;  4MND A;  1LKX A;  2VCC A;  4CJO A;  2AP3 A;  5DVW A;  5GPG B;  5HV9 A;  1NFN A;  2HSB A;  4PJJ A;  3KYI A;  3FAP B;  3TJ6 A;  1D0Z A;  3B0P A;  3DM9 B;  3W2V A;  1G4W R;  3LNM B;  1PD1 A;  1QPU A;  3RKO F;  2JPU A;  4A2N B;  3ZC4 A;  4MW8 A;  1YYJ A;  3AG3 C;  3DJN B;  2XS8 A;  3VYW A;  4QI2 A;  2LD6 A;  1H9T A;  1JPJ A;  3U2M A;  3NDB B;  3ZG1 A;  4JW1 A;  2J9W A;  3G4X A;  3U9J A;  4MQ9 F;  4CDV A;  4G7O F;  1OR3 A;  3S29 A;  1GGQ A;  2CNW A;  3SXZ A;  1N1C A;  3DD7 A;  2LK4 A;  3V7O A;  1I4Z A;  3TJ5 A;  2MYS A;  4U9E A;  5COF A;  1Y4C A;  1WOL A;  2RSE B;  3FHD A;  3IEE A;  3MFN A;  3NYL A;  3QW1 A;  3AG4 C;  3M4B A;  4IGG A;  1EKY A;  2Q00 A;  4E7Z A;  1G5Z A;  2DB4 A;  3N0T A;  2R05 A;  1U0B B;  1EA8 A;  3DWW A;  3IQ6 A;  4I1M A;  4EIY A;  4NQF A;  3JT1 A;  4E0I A;  3C62 A;  1KU2 A;  2VCB A;  5KYX B;  4U5G A;  2Q4F A;  2LSE A;  2P61 A;  3RFY A;  3RIP A;  2PX3 A;  2CDQ A;  3ZVR A;  5E33 A;  1D0X A;  1TWA A;  3EZI A;  4E18 A;  4EBB A;  4JKV A;  3AG1 C;  3K33 A;  3LS0 A;  2OCC C;  1RKC A;  5T1D B;  3EG9 B;  4CDY A;  5E3C A;  1Z5Z A;  2GAQ A;  2HKV A;  2CYD A;  2NSG A;  4M63 A;  1SR2 A;  3DJU B;  4Z9J A;  1EI7 A;  1JMW A;  1AVO B;  3QW0 A;  3RH3 A;  3US6 A;  4CS8 A;  3B0V C;  4K7B A;  2KGO A;  3C8Z A;  1QLE C;  4JTD B;  4OIN F;  4CS9 C;  5A69 A;  1VMA A;  3B0U X;  2YL1 A;  3G4Z A;  3GM2 A;  4C7O A;  3NKE A;  1GQA A;  3K1I C;  4O6M A;  2FFH A;  3A9C A;  3GEH A;  1ZYR F;  5A6K A;  1YLM A;  2ICW G;  3C8G A;  2XL6 A;  3L8I A;  5EHH A;  2J7P D;  4N06 A;  3ZTZ A;  3DXJ F;  4FAP B;  1LI5 A;  2R7T A;  1ST6 A;  3JRT A;  4HEA J;  1BR2 A;  3AGU A;  4YT2 A;  1A7E A;  2NUP A;  2VH3 A;  1YVI A;  3C7J A;  3NMJ A;  4N4W A;  2MHR A;  3FAJ A;  4DBQ A;  2KJG A;  3ZQV A;  3NYJ A;  2LFF A;  3Q6N A;  1OQC A;  5A6J A;  2WZF A;  3ASN C;  4XEK A;  3RF3 A;  1NU7 D;  1ZHW A;  4EUK B;  1LE2 A;  2ETS A;  2YLD A;  2R7W A;  3E70 C;  4BG0 A;  2YL3 A;  4U9D A;  3NG1 A;  3HNL A;  4ULV A;  1S7Z A;  4LDQ A;  3HNI A;  4NCQ A;  3RQE A;  1O3U A;  2TMV P;  4MVQ A;  4D4N A;  3MX3 A;  2NUT A;  2NUT B;  2ZXW C;  2XM0 A;  3MBG A;  1I4Y A;  2PX0 A;  1YZA A;  2L6G A;  5KYU A;  3POV A;  2W4B A;  1HMO A;  1SF8 A;  4MTG A;  4K1O A;  3UGO A;  4CBE A;  4NTA A;  1Z3I X;  5AC4 A;  2L81 A;  4L6R A;  2KC3 A;  4YWQ A;  4O79 A;  2P0N A;  2RD9 A;  3C18 A;  5A6A A;  1PD0 A;  1RKE A;  4I1O B;  3T4R A;  4JZA A;  3UMK A;  2MWQ A;  4RDA A;  2OEV A;  4I3M A;  3RVZ A;  2HJ3 A;  1VB5 A;  1T6U A;  3R7C A;  4PFO A;  4JEA A;  3AOU A;  3EJN A;  4ZLD A;  2L6F A;  1CGO A;  4MVO A;  4PJM A;  2DYS C;  3S27 A;  4FES A;  4KNW A;  4H54 A;  4XWJ A;  3SXK A;  1A41 A;  2D5R B;  2KYH A;  2M64 A;  3KL4 A;  1E86 A;  1V55 C;  1WGW A;  4IAO A;  3AQC A;  4AE4 B;  4CJG A;  4G7Z F;  4CSA C;  2HZ8 A;  1XWJ A;  2XL8 A;  3EFO A;  3QTH A;  1AUE A;  1K40 A;  1Z6A A;  3EFO B;  3DE9 A;  2BL2 A;  3EGX A;  4YT8 A;  4EKW A;  4K0D A;  3GM1 A;  4NTB A;  3GEE A;  4X0R A;  1FFH A;  3E9V A;  3ZIB A;  2DI3 A;  3PDM P;  256B A;  2GDC A;  4G0H A;  1E84 A;  1HE9 A;  3DMD A;  3Q7L A;  4JIO A;  3U0C A;  1HE1 A;  5DS6 A;  1RJ9 A;  1OW8 A;  1VLT A;  2IXO A;  4JE9 A;  1RJ9 B;  1T6I A;  4HFK B;  1V54 C;  2C04 A;  1WTY A;  3IQT A;  5T3T A;  4OIO F;  3L1M A;  4KBL A;  5JUA A;  3CSK A;  1BDJ B;  2XLE A;  1L7C A;  1PCX A;  2KK1 A;  3ABM C;  4ONS A;  3SEO A;  3U5S A;  4JJG A;  1Q0D A;  2J9B A;  4MTO A;  2JX0 A;  3FOP A;  3V5X A;  3DKA A;  4MTF A;  3MYF A;  2EPK X;  4LDR A;  1HMD A;  3S84 A;  4O6Y A;  3JCU Q;  1TFK B;  2OJE D;  4N6C A;  4J32 B;  4NTF A;  2J9V A;  5T3W A;  5B3I A;  2P6V A;  4KNV A;  4WGY A;  2NPU A;  4R32 A;  1HY5 A;  2ZD9 A;  3WAQ A;  5B3S C;  2R7O A;  2R7R A;  2QNL A;  2YEV A;  3DAG A;  2V3C C;  2XXA B;  5KYY B;  1VTM P;  2G3K A;  1ORY A;  3WG7 C;  3ZDL A;  2XS1 A;  1BR1 A;  2FAP B;  3VRC A;  4DJ9 A;  2EIM C;  1KNY A;  1QVX A;  3JSZ A;  5COG A;  4J7T A;  3EGD B;  3ASO C;  1D0Y A;  4PFP A;  3H2U A;  3IQC A;  4YJW A;  1ZU4 A;  4CS9 A;  2W45 A;  4E17 A;  3GM3 A;  2XLM A;  3GEI A;  4IRU A;  2A1D D;  4P9F A;  2H7V C;  1H7I A;  2J8W A;  2KW3 C;  2A0B A;  2PFD A;  2ZXR A;  4C3B A;  1C17 M;  1CGN A;  1JOG A;  2BC5 A;  4OD4 A;  3NKD A;  4HFF B;  4G7H F;  1LIH A;  4CS7 A;  5KYX A;  5KYW B;  4I44 A;  3CZ6 A;  2KQ9 A;  1G8X A;  1VK5 A;  3LUT B;  2OEX A;  1A7D A;  1NU9 C;  3X2Q C;  3M1C B;  1HW2 A;  1LE4 A;  2L9J A;  2GA0 A;  5HSW A;  1H6G A;  2XM4 A;  1LS4 A;  1K04 A;  3EG9 A;  1QKR A;  3S9O A;  1R4T A;  3KKB A;  5BUO A;  1GS9 A;  2XRH A;  4DRI B;  5L0F A;  4CDA A;  1NLX A;  2WVO A;  2Q7R A;  2IM8 A;  4BJ5 A;  1M2V B;  4PR9 A;  4BJ6 C;  1CGM E;  3N2Z B;  4NC3 A;  2EPL X;  5JLI A;  4DRJ B;  1M6T A;  3B29 A;  3JSE O;  1Y6D A;  1TKN A;  1OCC C;  4GQH A;  4F4B A;  5L0D A;  1T6Q A;  4PAC A;  4U5B E;  2HSQ A;  2R7Q A;  2A6H F;  4XPW A;  3IHU A;  1Z23 A;  3HNJ A;  4LDK A;  2G62 A;  4XLP F;  1OCR C;  1XZQ A;  3GOR A;  4KC9 A;  1BZ4 A;  5K0I A;  1ZW3 A;  3AG2 C;  2IXP A;  3QVZ A;  4ZLC A;  1J8Y F;  2XSE A;  4EHP A;  2IOQ A;  2I8B A;  3DM5 A;  4E0H A;  1D1B A;  2R9R B;  2VB6 A;  1E2X A;  2P1A A;  4H4K C;  5D91 A;  4BEM J;  4D4X A;  2GWW A;  1CPR A;  4AL1 A;  2OG2 A;  4MS2 A;  1JR8 A;  4JVS A;  5F28 E;  1MQV A;  1C02 A;  2ZPA A;  3ZTM A;  4P9T A;  1FNT c;  1YYX A;  4DVZ A;  4DRH B;  3F46 A;  1NG1 A;  5B1A C;  3KPH A;  3AGT A;  4WGZ A;  1HW1 A;  3V5Z A;  4DOZ A;  1TWC A;  3M4C A;  3SP1 A;  4A4A A;  5L0H A;  2J7P A;  2XLD A;  3FMS A;  4YL0 A;  4EBJ A;  1MMN A;  3EPV A;  1TR2 A;  4XQ1 A;  1IZM A;  3CAX A;  3GWN A;  3RW0 A;  3NYM A;  3S90 A;  3ECS A;  4U5H A;  2I15 A;  4W8P A;  3ZSU A;  3PCV A;  2EPM X;  4JTA B;  3RYL A;  4QI0 A;  5JT4 A;  1VYI A;  1ZZP A;  3LNR A;  1QSP A;  3DI5 A;  3RQG A;  2R25 A;  3K66 A;  1ZHY A;  1FTS A;  1WAT A;  4PJL A;  1DOW A;  4YK5 A;  3SNH A;  3UNG C;  5KYN A;  1GM5 A;  2HUJ A;  5E2Q A;  1SMY F;  3PMR A;  3EH1 A;  1CPQ A;  4DVY P;  1AEP A;  2UUI A;  3LAY A;  4CS8 C;  1OKK D;  2Y3G A;  2R7U A;  4NY3 A;  3QVY A;  3N24 A;  1TQG A;  2O9X A;  5F5H A;  5L0J A;  2LCH A;  4MVM A;  1V4A A;  4OD5 A;  4AE4 A;  4OIR F;  4AK9 A;  3UGP A;  2E87 A;  1QQ3 A;  4U5F E;  2OKU A;  3QZC A;  3T6J A;  5E3A A;  4DXW A;  3WOD F;  2YKZ A;  4MVR A;  5L3V A;  2QY9 A;  3LLK A;  1SZI A;  1JRA A;  4WJ0 A;  2EPO A;  5AGF A;  4DBR A;  4C3D A;  2QTV A;  3C63 A;  4JRZ A;  3B71 A;  1OW6 A;  5A6B D;  4O7G A;  2A69 F;  2QE9 A;  1S05 A;  1U89 A;  1TWH A;  2AVK A;  2ZXP A;  1J8M F;  1BR4 A;  1OKK A;  3IQ5 A;  2WB7 A;  3UR3 C;  2M4E A;  3QMK A;  2KSF A;  2PBE A;  1YJG A;  1G4U S;  2A0U A;  2B0J A;  3FOO A;  2YRF A;  1Q0F A;  4IJJ A;  5D92 A;  1OCO C;  4P6I C;  3GWL A;  4BEJ A;  3J06 A;  2AWC A;  4JJF A;  1UFB A;  2UUH A;  3UMH A;  4XEF A;  1ORJ A;  4JC7 A;  1D1A A;  3ZQY A;  2Q9A A;  5TJ5 E;  1H9G A;  3I5Q A;  3RQF A;  4E7S A;  4XLN F;  3EQL F;  4GYT A;  5A6B A;  3G50 A;  1LS1 A;  3B9Q A;  5FZT A;  1UG7 A;  1LPE A;  1Q0G A;  2ZXO A;  3V5Y A;  4CX9 A;  3U2L A;  1LI7 A;  3UMI A;  4AX2 A;  5L0G A;  1FFT C;  4Q5S F;  3OA1 A;  4YL1 A;  2P7V A;  1FAP B;  1MND A;  2HV6 A;  3F47 A;  1MNE A;  1I5N A;  1QZX A;  5DS5 A;  2X51 A;  3GOD A;  2OU6 A;  3H65 A;  2R7V A;  1MMA A;  1ZW2 A;  2WVQ A;  3R2P A;  2XLO A;  2DGJ A;  4J7Y A;  4MVU A;  4U5C E;  2V26 A;  4XPY A;  1C03 A;  2EIL C;  2Q9C A;  2BE5 F;  2OQM A;  2XXA A;  3FVY A;  5KYY A;  2IXN A;  5BQI A;  1TWG A;  3KYJ A;  4YT4 A;  4MW3 A;  3MYI A;  2EIK C;  1W2W A;  1M57 C;  1YDI A;  1M2O A;  2Y69 C;  3EGD A;  4ULW A;  4BJ6 A;  1OCZ C;  1VOM A;  4QDL A;  2X0C A;  1RXQ A;  3ZWI A;  3S28 A;  5B1B C;  2Y39 A;  3HJC A;  3WHN A;  1DOV A;  2CNW D;  4XTK A;  5JVE A;  2Q3T A;  1NZE A;  1PV3 A;  5DQT A;  1YAU O;  1M56 C;  1ZHX A;  2HFI A;  3K1I A;  4JCZ A;  1FMV A;  1V74 B;  2HMZ A;  2J45 A;  4KI2 A;  4BPM A;  1KTM A;  4XEV A;  3MLG A;  1OR2 A;  1ZHZ A;  1A7V A;  2XLV A;  1Q0M A;  1ORS C;  5CI9 A;  5IY5 C;  4ER9 A;  2LQG A;  5L3Q A;  5KYW A;  2W4M A;  3JYY A;  3HLZ A;  5BQG A;  5EGY A;  2WL8 A;  1APC A;  2OJQ A;  3L34 A;  4Q7C A;  3W4Y A;  2OOC A;  3H2V A;  3O10 A;  1O5H A;  1TFO B;  2G3V A;  4ANJ A;  1XZP A;  3VM6 A;  2GFH A;  3W8I A;  4YL3 A;  2J9U A;  1M2V A;  4IB4 A;  2CGE A;  2YL0 A;  4LLC A;  4WAB A;  3OWT A;  3O6X A;  2Q9B A;  3TK0 A;  1K05 A;  2EPN A;  1NBB A;  1Z63 A;  2J0X A;  3M15 A;  3Q6M A;  3W2W A;  2YVK A;  3TUL A;  1ZVZ A;  3U8V A;  3Q7G A;  5BQH A;  4PK4 A;  3JRM O;  3NMI A;  4W8K A;  5L0C A;  4EWC A;  1NSG B;  1BBH A;  3CEX A;  2J46 A;  3DE8 A;  3EH2 A;  1OXK A;  3HKK A;  3K7D A;  1O87 A;  3BRJ A;  2LIG A;  4JCH A;  5DQZ A;  4GEH A;  2EIJ C;  3EHM A;  2R7S A;  3LEV A;  3C8G D;  2C03 A;  1R5I D;  3DAF A;  1LM3 B;  2IYL D;  3EHN A;  2ASR A;  3X1O A;  2L6H A;  3I4U A;  5FCL A;  3ATP A;  2HMQ A;  1JPN A;  3LJB A;  4FWV A;  1A0B A;  1Q0K A;  2Y3B A;  4U5E E;  2A68 F;  4CIP A;  4FX5 A; 
#chains in the Genus database with same CATH homology
 3T9O A;  4H54 A;  2D4U A;  1VLT A;  4Z9J A;  3ATP A;  1WAS A;  1WAT A;  1VLS A;  1JMW A;  1LIH A;  4Z9I A;  2ASR A;  4Z9H A;  2LIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...