1LIHA

Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
160
structure length
160
Chain Sequence
MGGLLFSSLQHCQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTFDQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
total genus 66
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1995-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1lihA00
4Z9JA 1VLTA 1VLSA 3T9OA 1WATA 1WASA 4Z9HA 1LIHA 1JMWA 4H54A 3ATPA 4Z9IA 2LIGA 2D4UA 2ASRA
chains in the Genus database with same CATH superfamily
3MBGA 2Y3BA 1JRAA 2LQGA 4AX2A 2YWAA 2J0XA 2FFHA 2L6GA 3DZAA 3M1CB 4J7TA 1TWGA 2NG1A 4GYTA 4JEBA 3RW0A 3JYYA 4ER9A 3UGPA 1NFOA 1Y4CA 4FX5A 4MVOA 1SF8A 2A0UA 3RKOF 5D92A 3T6GB 4JW1A 1KTMA 1NLXA 3W2WA 3IQTA 1J8YF 2J0WA 3AQBA 4HEAJ 4RDAA 4W8KA 4WJ0A 2AVKA 3RQFA 4B6IA 4WGYA 2GDCA 2QNLA 3LEVA 1RJ9B 1A0BA 3ABLC 1C03A 1OCCC 2Y3HA 2YLIA 2XLOA 3ABKC 2YHSA 3B0VC 1RKCA 1HMOA 4XEKA 4Q5SF 2CYDA 1LS4A 1D0XA 2ICWG 3FAPB 4Z9JA 1FMVA 1YZAA 3N24A 1QPUA 3SXKA 3PDMP 4FAPB 3DM5A 3LJBA 3Q7LA 4NTFA 3EGDB 1JR8A 2OJED 2AU5A 3U3BA 2D5RB 1ORYA 4DBRA 4JC7A 4MTFA 2NSFA 4JEAA 1TR2A 2LFFA 4DJ9A 1CGME 1D1AA 3KH2A 3AOUA 3TJ5A 4FESA 1JPJA 2A68F 4U9DA 3F46A 1LE4A 3EZHA 3WHNA 2EIKC 3B0PA 1ZW2A 3SNHA 1PCXA 4K7BA 1LS1A 1ORSC 3DJUB 3SXZA 1JPNA 1ZU4A 2I8BA 4LDQA 1LKXA 3W2VA 2HMQA 3SXMA 4ANJA 4LDKA 4G7OF 2YKZA 4AL1A 1RJ9A 1Y6DA 4P9TA 3DE8A 1MQVA 4J30B 4MW3A 1U0BB 3H2UA 2EIMC 1VYKA 2J9VA 3I5PA 3LEOA 2YVKA 1D1BA 4JZAA 1HY5A 5CI8A 5A69A 4PJMA 3L34A 2LP4A 1L3PA 3ZVRA 4LLCA 3T9OA 1OQCA 1I5NA 4QI2A 2R03A 2VH3A 4QI0A 3L8JA 3EGDA 3DAFA 2WZLA 4J7YA 2JD3A 5BQHA 3PHF2 2HFIA 5B3SC 3A9CA 3MLGA 3DI5A 3HNIA 3X1OA 1YA7O 2XLMA 3JYHA 2L81A 4BJ6A 1HW2A 2I15A 4XTKA 2G3VA 3AGUA 2Q3TA 4ZLCA 5FCLA 3W8IA 2YL0A 4CSAC 3FHDA 3TQOA 1V4AA 1Z3IX 4IB4A 3JZ0A 4KC9A 1AEPA 5L0JA 3GM2A 3V7OA 3W8HA 1LE2A 2KGOA 2QLAA 4XLPF 3FDQA 1O87A 3M15A 4MVZA 1BZ4A 2BL2A 2L6HA 2RSEB 2QUPA 3EHMA 4JJGA 3G4XA 2R7QA 4ONSA 4N6CA 3X2QC 5KYXB 1M56C 2OU6A 2QTVA 3ZC4A 1EA8A 4MVRA 3IHUA 4H54A 2KNHA 4G78A 3LS1A 2LD6A 2IBFA 4R32A 5F5FA 3HLZA 1SYQA 2R25A 1BR4A 2LFDA 2PP4A 3AG3C 3NKDA 2R7XA 3OEOA 4BG0A 1NG1A 1YYXA 3MYIA 4I3MA 1OXKA 2GA0A 2WVQA 2DGJA 1Q0DA 2GWWA 1JMWA 3EZIA 2EPNA 3GWNA 4IAQA 5E33A 1VK5A 1U6HA 4IRUA 1APCA 5AGFA 5EK0A 2XXAB 4O6YA 2ZPAA 3U3FA 3K7DA 4GQHA 2WZFA 5JS5A 3ECSA 1VYIA 1Q0FA 1GS9A 4JE9A 4X0RA 3RVZA 4CS8A 4E17A 1S7ZA 3KPHA 4CDVA 1ZU5A 1SMYF 3LNMB 2KJGA 1TQGA 1HMDA 2ZXOA 3GEIA 1OKKD 3K66A 4XPYA 3U8VA 5E3AA 1T5OA 2C03A 1ST6A 3CZ6A 5KYXA 1ZHZA 3E9VA 2MHRA 4YK5A 1OCRC 2HJMA 4IGGA 2UUIA 4EUKB 2H7VC 4DBQA 3IQ5A 4U5DE 2OOCA 4AE4A 5AC4A 1OW8A 4IWBA 2NUPA 2QY9A 4K0DA 3ZQYA 1EQ1A 3U2MA 3GODA 1G5ZA 4XQ1A 3DWWA 2OG2A 2XS1A 1D1CA 1OW6A 4O6NA 2WVOA 4NCQA 2G62A 5K0IA 1VB5A 3F47A 3V5XA 4HFFB 4CS7A 2PFDA 2Z15A 2XXAA 1ORJA 2Y69C 1M2VA 2Y39A 2P7VA 5D91A 1GM5A 1FMWA 1MMGA 3SEOA 1D0ZA 2J7PD 3QW1A 5L0HA 3ASNC 3HNKA 5A6AA 1XZQA 4XPXA 4E18A 2HV7A 2PF4E 2EINC 3NMKA 4G0HA 3PCVA 1GGQA 1U89A 2Q00A 3NKEA 1BR2A 2OCCC 3S29A 3H65A 3VM6A 3ZTZA 3OWTA 2EPLX 3HNLA 2YL7A 1BDJB 5DS4A 2VC9A 4JTDB 3JSEO 1MNEA 3GANA 4OIRF 2PNOA 1YJGA 3S9OA 5L0IA 3Q6NA 2V26A 2M64A 4EBKA 1WOLA 3SYNA 3PMRA 4HFKB 3G50A 1CPQA 2XL8A 4A2NB 1RXQA 1MMAA 4RBNA 2R7RA 5E2QA 5A6KA 2XL4A 5T3WA 2W4BA 2A1DD 3H2VA 2A6EF 4E7ZA 3OA1A 2ZD9A 3NYMA 1WATA 3EH2A 4MTOA 2AWYA 1TWCA 2XLEA 3LNRA 4U5FE 1A7DA 2XLVA 2LIGA 4NQFA 4U9EA 1OKKA 2OEVA 5HV9A 2YL1A 3G4ZA 5F28E 2BC5A 2PX0A 3GEEA 1TKNA 3RQGA 1Q0MA 4CJGA 4EIYA 3U0CA 4OIQF 4H4KC 4U5CE 1QQ3A 3RH3A 1IZMA 3KYJA 2DB4A 4AL0A 5B3IA 1C02A 1D0YA 4PR9A 3U8PA 1SZIA 4QDLA 5JSLA 3AG2C 3RFYA 2J9WA 5A6BD 1FNTc 4C3EA 1Z7Qc 2P0NA 3S0XA 3AG4C 5L0GA 1NBBA 2LK4A 3C18A 3NG1A 4YL0A 2M4EA 2D4UA 3GM3A 4PJLA 3ATPA 4OINF 4JCHA 1YLMA 3DM9B 1R4TA 1WASA 3KMIA 3C7JA 4ZLDA 3FAJA 3TULA 2P6VA 4BEMJ 1K04A 2XLDA 3KL4A 1ZHYA 1ZVZA 2J7PA 1ZZPA 2NPUA 4C7OA 2Q9BA 3B71A 4I44A 4DXWA 1H7IA 2Y3GA 1RKEA 2FAPB 4XWJA 3B29A 4C3BA 4EHPA 3IQ6A 2UUHA 4YL1A 4U5HA 2XLHA 2J45A 2A0BA 5DLJA 4JRZA 4CDAA 4CS9C 4P9FA 4DRIB 4CIPA 4OD4A 2O9XA 2TMVP 4O7GA 4Q7CA 3EJNA 2Y3DA 3MFNA 2J46A 1JOGA 3RF3A 2V3CC 1I4ZA 2L9JA 2OEXA 3TOLA 1QSPA 3EGXA 3QVYA 4O79A 1BR1A 1VLTA 1RCPA 1WN0A 3EPVA 1XWJA 5DQZA 4N4WA 1TFKB 4EKWA 3EHNA 4JVSA 5A6JA 1ZW3A 3RQEA 4PJJA 2B0JA 1Z23A 3WAQA 3NRHA 1G8XA 1V74B 4DRJB 3B0UX 4NC3A 4G7ZF 1H6GA 2YZSA 3QMKA 2R7UA 4AE4B 3CEXA 4OIOF 2XM4A 2NUPB 4YJWA 4OD5A 1QKRA 1FFTC 1FR0A 3JT1A 4J32B 1BBHA 3ABMC 3U5SA 5T1DB 3AJMA 3NYJA 2YQYA 5DVWA 2JX0A 3C63A 3RIPA 3TOMA 3LAYA 1T6QA 5L3VA 1OR2A 3AG1C 2VCCA 3ZSUA 1M2VB 1N1CA 1M57C 2Q9CA 5A6BA 4BJ1A 1UFBA 3U2LA 4XLNF 1NU7D 3S28A 4PFOA 5JT4A 3RYLA 1EI7A 3K1IC 2H8AA 4IAOA 3ZG1A 1YZCA 3GEHA 3UGOA 2IXPA 4E0IA 3B9QA 5F5HA 1OXBA 1XZPA 2YLGA 5JVEA 4Q4ZF 3DXJF 1T9KA 2VCBA 4NY3A 3FOPA 5HSWA 1LIHA 2ETSA 4JCZA 2EPKX 2QE9A 5EGYA 4CSAA 2GAQA 1F1MA 4GEHA 1HE9A 2X0CA 4NTAA 1TWHA 4CX9A 1PD1A 1RMVA 2XRHA 3GORA 1FTSA 1H9TA 1LPEA 3W4YA 2H7BA 3LLKA 2LCHA 4BJ5C 2A69F 3V5YA 3JRMO 4YWQA 4UDVA 4K1OA 1TWAA 3CAXA 3O6XA 3TD7A 1A7EA 3O39A 4KBLA 4YT5A 2R7VA 4LACB 4MVSA 2HZ8A 4CIHA 2ASRA 2B0HA 4YN0B 1WWPA 5BUOA 2R7SA 2CDQA 2H7OA 3CQZA 4KI2A 1UG7A 2WZGA 3T6BA 1YVIA 1T01A 4BJTA 1DOWA 5KYYB 3V5ZA 5KYWB 4M63A 2YLDA 4IJJA 1I4YA 1AUEA 1PV3A 5COGA 4E0HA 3VAYA 2HSBA 4WABA 2VCAA 3ZIBA 3CSKA 5DS6A 2KYHA 3SP1A 5L0FA 3M79A 4L6RA 1MMDA 1VLSA 4CJOA 3L0IA 4N06A 4PK4A 2IYLD 1NU9C 5L0DA 3MYFA 2EILC 3S27A 3UMIA 1S05A 5JUAA 1NFNA 2Q9AA 3ITFA 2NSGA 4MVUA 3JTLO 1Q0KA 1LI7A 2W4MA 2DYRC 1T6UA 3NDBB 3DJNB 1YAUO 3C62A 2NUTA 4MS2A 5JLIA 2DYSC 3DMDA 3Q7GA 2DI3A 4AK9A 1QZXA 2EPMX 1QLEC 1FAPB 4I1OB 1O5HA 4MTGA 3TK0A 4C7OB 4JTCB 3S90A 2PBEA 3O10A 5DS5A 3BRJA 4MVQA 1LM3B 1RKEB 2JPUA 5KYYA 2ZXPA 3AGTA 3FVYA 1OW7A 5COMA 4W8PA 2L6FA 3VF0A 5KYWA 1KU2A 2YL3A 4LDRA 4P6IC 4F4BA 1YARO 4BJ5A 2HV6A 2E87A 2HKVA 2J9UA 1M6TA 2WVNA 3SXYA 4BJ6C 5JP7A 3ASOC 1LI5A 1L7CA 3FOOA 1GQAA 3N2ZB 4JURI 2MYSA 3JCUQ 4EBJA 1JAFA 2IM8A 1NSGB 2LSEA 3JSZA 5TJ5E 3TJ6A 3EGXB 2ZXRA 3M4CA 2P61A 3HTKC 1Q0GA 3US6A 2OKUA 3R2PA 2XLWA 4N6HA 2W45A 4KNVA 2WB7A 2OQMA 3EQLF 4U5BE 3VYWA 2J9BA 5KYUB 3UMKA 4DOZA 3HKKA 1B68A 4EBBA 4ULVA 1E84A 3J06A 2RD9A 4OIPF 4HE8D 1YA9A 4JJFA 4ULWA 3O55A 3WG7C 2IXOA 5DQTA 2Q7RA 4G7HF 2AWCA 4CDYA 3VRCA 3K33A 4BPMA 4PJNA 1A7VA 1WTYA 4DRHB 2R05A 1SR2A 1VMAA 3HJCA 2R9RB 1E86A 4YT2A 4XPWA 2WL8A 4U5GA 1CGOA 2R7WA 4MVMA 3C8GD 3Q6MA 3NMIA 4LLEA 4U5EE 3QTHA 3UMHA 3LS0A 3UR3C 5L3QA 2YRFA 4YL3A 3DE9A 4IARA 2XSEA 4D4NA 3SZRA 4EWCA 5JRAA 3QW0A 1FFHA 4CS8C 256BA 2VB6A 1YYJA 1WGWA 2L7AA 1V55C 3DD7A 1VOMA 3KYIA 3U9JA 5KYUA 4DVZA 2G3KA 3AQCA 3EG9B 5E3CA 1G4WR 2HS5A 1AVOB 3RVYA 3MX3A 1ZHWA 4CBEA 4A4AA 4D4XA 1E2XA 1HW1A 3HNJA 5KYNA 1T6IA 3S84A 5EHHA 1IW7F 2CGEA 2CNWD 3R7CA 3LUTB 3POVA 2EIJC 3UNGC 5B1BC 1QVXA 2J8WA 3N0TA 1V54C 2XM0A 3L1MA 1A41A 2R7OA 3BEHA 1W2WA 3I4UA 1MNDA 5GPGB 4E7SA 3C8GB 2IXMA 1O3UA 2KSFA 2PX3A 3EFOB 4PFPA 5AC5A 4MQ9F 1G4US 3K6BA 1CPRA 2HSQA 4MNDA 2IXNA 1DOVA 2GFHA 2FGYA 3JRTA 4DVYP 1HE1A 2KC3A 3IQCA 4KNWA 2R7TA 2W9YA 4O6MA 2CW0F 4XEFA 2XL6A 5BQGA 4JKVA 1J8MF 3U9MA 4CS9A 3EG9A 2KW3C 4I1MA 2F22A 4C3DA 1Z5ZA 2IOQA 3K1HA 3ZQVA 3EH1A 2C04A 2ZXWC 2A6HF 3IEEA 3FXHA 4FWVA 5CIVA 2KK1A 2P1AA 1EKYA 2X51A 3IPMO 3KKBA 3QZCA 4PACA 1ZHXA 3GM1A 2NUTB 2CCYA 3NMJA 3L8IA 1R5ID 5COFA 4Z9IA 3GWLA 2Q4FA 1H9GA 2XS8A 1KNYA 1M2OA 1YDIA 2KQ9A 2R02A 4YT4A 2EPOA 1ZHTA 3DKAA 5T3TA 5BQIA 3T6JA 3ZDLA 3ZTMA 3C8GA 3EFOA 1PD0A 3WODF 4YT8A 1LVKA 1MMNA 3A11A 4RD9A 1OCOC 4WGZA 2BE5F 4MW8A 5B1AC 1TFOB 1OCZC 4JIOA 5FZTA 5IY5C 1VTMP 2HMZA 2YEVA 2AP3A 1NZEA 2OJQA 1Z6AA 2HJ3A 2MWQA 3M4BA 4XEVA 1OR3A 1C17M 1CGNA 1K40A 3E70C 4JTAB 4NTBA 2VASA 3ZWIA 3DAGA 1E83A 3QVZA 5CI9A 4Z9HA 1Z63A 3C8ZA 4BEJA 4LERA 2HUJA 3T4RA 2CNWA 3NYLA 3LESA 3LLIA 3FMSA 5L0CA 1K05A 1E85A 1ZYRF 3K1IA 3I5QA
chains in the Genus database with same CATH topology
4Z9JA 1VLTA 1VLSA 3T9OA 1WATA 1WASA 4Z9HA 1LIHA 1JMWA 4H54A 3ATPA 4Z9IA 2LIGA 2D4UA 2ASRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9J A;  1VLT A;  1VLS A;  3T9O A;  1WAT A;  1WAS A;  4Z9H A;  1LIH A;  1JMW A;  4H54 A;  3ATP A;  4Z9I A;  2LIG A;  2D4U A;  2ASR A; 
#chains in the Genus database with same CATH topology
 3MBG A;  2Y3B A;  1JRA A;  2LQG A;  4AX2 A;  2YWA A;  2J0X A;  2FFH A;  2L6G A;  3DZA A;  3M1C B;  4J7T A;  1TWG A;  2NG1 A;  4GYT A;  4JEB A;  3RW0 A;  3JYY A;  4ER9 A;  3UGP A;  1NFO A;  1Y4C A;  4FX5 A;  4MVO A;  1SF8 A;  2A0U A;  3RKO F;  5D92 A;  3T6G B;  4JW1 A;  1KTM A;  1NLX A;  3W2W A;  3IQT A;  1J8Y F;  2J0W A;  3AQB A;  4HEA J;  4RDA A;  4W8K A;  4WJ0 A;  2AVK A;  3RQF A;  4B6I A;  4WGY A;  2GDC A;  2QNL A;  3LEV A;  1RJ9 B;  1A0B A;  3ABL C;  1C03 A;  1OCC C;  2Y3H A;  2YLI A;  2XLO A;  3ABK C;  2YHS A;  3B0V C;  1RKC A;  1HMO A;  4XEK A;  4Q5S F;  2CYD A;  1LS4 A;  1D0X A;  2ICW G;  3FAP B;  4Z9J A;  1FMV A;  1YZA A;  3N24 A;  1QPU A;  3SXK A;  3PDM P;  4FAP B;  3DM5 A;  3LJB A;  3Q7L A;  4NTF A;  3EGD B;  1JR8 A;  2OJE D;  2AU5 A;  3U3B A;  2D5R B;  1ORY A;  4DBR A;  4JC7 A;  4MTF A;  2NSF A;  4JEA A;  1TR2 A;  2LFF A;  4DJ9 A;  1CGM E;  1D1A A;  3KH2 A;  3AOU A;  3TJ5 A;  4FES A;  1JPJ A;  2A68 F;  4U9D A;  3F46 A;  1LE4 A;  3EZH A;  3WHN A;  2EIK C;  3B0P A;  1ZW2 A;  3SNH A;  1PCX A;  4K7B A;  1LS1 A;  1ORS C;  3DJU B;  3SXZ A;  1JPN A;  1ZU4 A;  2I8B A;  4LDQ A;  1LKX A;  3W2V A;  2HMQ A;  3SXM A;  4ANJ A;  4LDK A;  4G7O F;  2YKZ A;  4AL1 A;  1RJ9 A;  1Y6D A;  4P9T A;  3DE8 A;  1MQV A;  4J30 B;  4MW3 A;  1U0B B;  3H2U A;  2EIM C;  1VYK A;  2J9V A;  3I5P A;  3LEO A;  2YVK A;  1D1B A;  4JZA A;  1HY5 A;  5CI8 A;  5A69 A;  4PJM A;  3L34 A;  2LP4 A;  1L3P A;  3ZVR A;  4LLC A;  3T9O A;  1OQC A;  1I5N A;  4QI2 A;  2R03 A;  2VH3 A;  4QI0 A;  3L8J A;  3EGD A;  3DAF A;  2WZL A;  4J7Y A;  2JD3 A;  5BQH A;  3PHF 2;  2HFI A;  5B3S C;  3A9C A;  3MLG A;  3DI5 A;  3HNI A;  3X1O A;  1YA7 O;  2XLM A;  3JYH A;  2L81 A;  4BJ6 A;  1HW2 A;  2I15 A;  4XTK A;  2G3V A;  3AGU A;  2Q3T A;  4ZLC A;  5FCL A;  3W8I A;  2YL0 A;  4CSA C;  3FHD A;  3TQO A;  1V4A A;  1Z3I X;  4IB4 A;  3JZ0 A;  4KC9 A;  1AEP A;  5L0J A;  3GM2 A;  3V7O A;  3W8H A;  1LE2 A;  2KGO A;  2QLA A;  4XLP F;  3FDQ A;  1O87 A;  3M15 A;  4MVZ A;  1BZ4 A;  2BL2 A;  2L6H A;  2RSE B;  2QUP A;  3EHM A;  4JJG A;  3G4X A;  2R7Q A;  4ONS A;  4N6C A;  3X2Q C;  5KYX B;  1M56 C;  2OU6 A;  2QTV A;  3ZC4 A;  1EA8 A;  4MVR A;  3IHU A;  4H54 A;  2KNH A;  4G78 A;  3LS1 A;  2LD6 A;  2IBF A;  4R32 A;  5F5F A;  3HLZ A;  1SYQ A;  2R25 A;  1BR4 A;  2LFD A;  2PP4 A;  3AG3 C;  3NKD A;  2R7X A;  3OEO A;  4BG0 A;  1NG1 A;  1YYX A;  3MYI A;  4I3M A;  1OXK A;  2GA0 A;  2WVQ A;  2DGJ A;  1Q0D A;  2GWW A;  1JMW A;  3EZI A;  2EPN A;  3GWN A;  4IAQ A;  5E33 A;  1VK5 A;  1U6H A;  4IRU A;  1APC A;  5AGF A;  5EK0 A;  2XXA B;  4O6Y A;  2ZPA A;  3U3F A;  3K7D A;  4GQH A;  2WZF A;  5JS5 A;  3ECS A;  1VYI A;  1Q0F A;  1GS9 A;  4JE9 A;  4X0R A;  3RVZ A;  4CS8 A;  4E17 A;  1S7Z A;  3KPH A;  4CDV A;  1ZU5 A;  1SMY F;  3LNM B;  2KJG A;  1TQG A;  1HMD A;  2ZXO A;  3GEI A;  1OKK D;  3K66 A;  4XPY A;  3U8V A;  5E3A A;  1T5O A;  2C03 A;  1ST6 A;  3CZ6 A;  5KYX A;  1ZHZ A;  3E9V A;  2MHR A;  4YK5 A;  1OCR C;  2HJM A;  4IGG A;  2UUI A;  4EUK B;  2H7V C;  4DBQ A;  3IQ5 A;  4U5D E;  2OOC A;  4AE4 A;  5AC4 A;  1OW8 A;  4IWB A;  2NUP A;  2QY9 A;  4K0D A;  3ZQY A;  1EQ1 A;  3U2M A;  3GOD A;  1G5Z A;  4XQ1 A;  3DWW A;  2OG2 A;  2XS1 A;  1D1C A;  1OW6 A;  4O6N A;  2WVO A;  4NCQ A;  2G62 A;  5K0I A;  1VB5 A;  3F47 A;  3V5X A;  4HFF B;  4CS7 A;  2PFD A;  2Z15 A;  2XXA A;  1ORJ A;  2Y69 C;  1M2V A;  2Y39 A;  2P7V A;  5D91 A;  1GM5 A;  1FMW A;  1MMG A;  3SEO A;  1D0Z A;  2J7P D;  3QW1 A;  5L0H A;  3ASN C;  3HNK A;  5A6A A;  1XZQ A;  4XPX A;  4E18 A;  2HV7 A;  2PF4 E;  2EIN C;  3NMK A;  4G0H A;  3PCV A;  1GGQ A;  1U89 A;  2Q00 A;  3NKE A;  1BR2 A;  2OCC C;  3S29 A;  3H65 A;  3VM6 A;  3ZTZ A;  3OWT A;  2EPL X;  3HNL A;  2YL7 A;  1BDJ B;  5DS4 A;  2VC9 A;  4JTD B;  3JSE O;  1MNE A;  3GAN A;  4OIR F;  2PNO A;  1YJG A;  3S9O A;  5L0I A;  3Q6N A;  2V26 A;  2M64 A;  4EBK A;  1WOL A;  3SYN A;  3PMR A;  4HFK B;  3G50 A;  1CPQ A;  2XL8 A;  4A2N B;  1RXQ A;  1MMA A;  4RBN A;  2R7R A;  5E2Q A;  5A6K A;  2XL4 A;  5T3W A;  2W4B A;  2A1D D;  3H2V A;  2A6E F;  4E7Z A;  3OA1 A;  2ZD9 A;  3NYM A;  1WAT A;  3EH2 A;  4MTO A;  2AWY A;  1TWC A;  2XLE A;  3LNR A;  4U5F E;  1A7D A;  2XLV A;  2LIG A;  4NQF A;  4U9E A;  1OKK A;  2OEV A;  5HV9 A;  2YL1 A;  3G4Z A;  5F28 E;  2BC5 A;  2PX0 A;  3GEE A;  1TKN A;  3RQG A;  1Q0M A;  4CJG A;  4EIY A;  3U0C A;  4OIQ F;  4H4K C;  4U5C E;  1QQ3 A;  3RH3 A;  1IZM A;  3KYJ A;  2DB4 A;  4AL0 A;  5B3I A;  1C02 A;  1D0Y A;  4PR9 A;  3U8P A;  1SZI A;  4QDL A;  5JSL A;  3AG2 C;  3RFY A;  2J9W A;  5A6B D;  1FNT c;  4C3E A;  1Z7Q c;  2P0N A;  3S0X A;  3AG4 C;  5L0G A;  1NBB A;  2LK4 A;  3C18 A;  3NG1 A;  4YL0 A;  2M4E A;  2D4U A;  3GM3 A;  4PJL A;  3ATP A;  4OIN F;  4JCH A;  1YLM A;  3DM9 B;  1R4T A;  1WAS A;  3KMI A;  3C7J A;  4ZLD A;  3FAJ A;  3TUL A;  2P6V A;  4BEM J;  1K04 A;  2XLD A;  3KL4 A;  1ZHY A;  1ZVZ A;  2J7P A;  1ZZP A;  2NPU A;  4C7O A;  2Q9B A;  3B71 A;  4I44 A;  4DXW A;  1H7I A;  2Y3G A;  1RKE A;  2FAP B;  4XWJ A;  3B29 A;  4C3B A;  4EHP A;  3IQ6 A;  2UUH A;  4YL1 A;  4U5H A;  2XLH A;  2J45 A;  2A0B A;  5DLJ A;  4JRZ A;  4CDA A;  4CS9 C;  4P9F A;  4DRI B;  4CIP A;  4OD4 A;  2O9X A;  2TMV P;  4O7G A;  4Q7C A;  3EJN A;  2Y3D A;  3MFN A;  2J46 A;  1JOG A;  3RF3 A;  2V3C C;  1I4Z A;  2L9J A;  2OEX A;  3TOL A;  1QSP A;  3EGX A;  3QVY A;  4O79 A;  1BR1 A;  1VLT A;  1RCP A;  1WN0 A;  3EPV A;  1XWJ A;  5DQZ A;  4N4W A;  1TFK B;  4EKW A;  3EHN A;  4JVS A;  5A6J A;  1ZW3 A;  3RQE A;  4PJJ A;  2B0J A;  1Z23 A;  3WAQ A;  3NRH A;  1G8X A;  1V74 B;  4DRJ B;  3B0U X;  4NC3 A;  4G7Z F;  1H6G A;  2YZS A;  3QMK A;  2R7U A;  4AE4 B;  3CEX A;  4OIO F;  2XM4 A;  2NUP B;  4YJW A;  4OD5 A;  1QKR A;  1FFT C;  1FR0 A;  3JT1 A;  4J32 B;  1BBH A;  3ABM C;  3U5S A;  5T1D B;  3AJM A;  3NYJ A;  2YQY A;  5DVW A;  2JX0 A;  3C63 A;  3RIP A;  3TOM A;  3LAY A;  1T6Q A;  5L3V A;  1OR2 A;  3AG1 C;  2VCC A;  3ZSU A;  1M2V B;  1N1C A;  1M57 C;  2Q9C A;  5A6B A;  4BJ1 A;  1UFB A;  3U2L A;  4XLN F;  1NU7 D;  3S28 A;  4PFO A;  5JT4 A;  3RYL A;  1EI7 A;  3K1I C;  2H8A A;  4IAO A;  3ZG1 A;  1YZC A;  3GEH A;  3UGO A;  2IXP A;  4E0I A;  3B9Q A;  5F5H A;  1OXB A;  1XZP A;  2YLG A;  5JVE A;  4Q4Z F;  3DXJ F;  1T9K A;  2VCB A;  4NY3 A;  3FOP A;  5HSW A;  1LIH A;  2ETS A;  4JCZ A;  2EPK X;  2QE9 A;  5EGY A;  4CSA A;  2GAQ A;  1F1M A;  4GEH A;  1HE9 A;  2X0C A;  4NTA A;  1TWH A;  4CX9 A;  1PD1 A;  1RMV A;  2XRH A;  3GOR A;  1FTS A;  1H9T A;  1LPE A;  3W4Y A;  2H7B A;  3LLK A;  2LCH A;  4BJ5 C;  2A69 F;  3V5Y A;  3JRM O;  4YWQ A;  4UDV A;  4K1O A;  1TWA A;  3CAX A;  3O6X A;  3TD7 A;  1A7E A;  3O39 A;  4KBL A;  4YT5 A;  2R7V A;  4LAC B;  4MVS A;  2HZ8 A;  4CIH A;  2ASR A;  2B0H A;  4YN0 B;  1WWP A;  5BUO A;  2R7S A;  2CDQ A;  2H7O A;  3CQZ A;  4KI2 A;  1UG7 A;  2WZG A;  3T6B A;  1YVI A;  1T01 A;  4BJT A;  1DOW A;  5KYY B;  3V5Z A;  5KYW B;  4M63 A;  2YLD A;  4IJJ A;  1I4Y A;  1AUE A;  1PV3 A;  5COG A;  4E0H A;  3VAY A;  2HSB A;  4WAB A;  2VCA A;  3ZIB A;  3CSK A;  5DS6 A;  2KYH A;  3SP1 A;  5L0F A;  3M79 A;  4L6R A;  1MMD A;  1VLS A;  4CJO A;  3L0I A;  4N06 A;  4PK4 A;  2IYL D;  1NU9 C;  5L0D A;  3MYF A;  2EIL C;  3S27 A;  3UMI A;  1S05 A;  5JUA A;  1NFN A;  2Q9A A;  3ITF A;  2NSG A;  4MVU A;  3JTL O;  1Q0K A;  1LI7 A;  2W4M A;  2DYR C;  1T6U A;  3NDB B;  3DJN B;  1YAU O;  3C62 A;  2NUT A;  4MS2 A;  5JLI A;  2DYS C;  3DMD A;  3Q7G A;  2DI3 A;  4AK9 A;  1QZX A;  2EPM X;  1QLE C;  1FAP B;  4I1O B;  1O5H A;  4MTG A;  3TK0 A;  4C7O B;  4JTC B;  3S90 A;  2PBE A;  3O10 A;  5DS5 A;  3BRJ A;  4MVQ A;  1LM3 B;  1RKE B;  2JPU A;  5KYY A;  2ZXP A;  3AGT A;  3FVY A;  1OW7 A;  5COM A;  4W8P A;  2L6F A;  3VF0 A;  5KYW A;  1KU2 A;  2YL3 A;  4LDR A;  4P6I C;  4F4B A;  1YAR O;  4BJ5 A;  2HV6 A;  2E87 A;  2HKV A;  2J9U A;  1M6T A;  2WVN A;  3SXY A;  4BJ6 C;  5JP7 A;  3ASO C;  1LI5 A;  1L7C A;  3FOO A;  1GQA A;  3N2Z B;  4JUR I;  2MYS A;  3JCU Q;  4EBJ A;  1JAF A;  2IM8 A;  1NSG B;  2LSE A;  3JSZ A;  5TJ5 E;  3TJ6 A;  3EGX B;  2ZXR A;  3M4C A;  2P61 A;  3HTK C;  1Q0G A;  3US6 A;  2OKU A;  3R2P A;  2XLW A;  4N6H A;  2W45 A;  4KNV A;  2WB7 A;  2OQM A;  3EQL F;  4U5B E;  3VYW A;  2J9B A;  5KYU B;  3UMK A;  4DOZ A;  3HKK A;  1B68 A;  4EBB A;  4ULV A;  1E84 A;  3J06 A;  2RD9 A;  4OIP F;  4HE8 D;  1YA9 A;  4JJF A;  4ULW A;  3O55 A;  3WG7 C;  2IXO A;  5DQT A;  2Q7R A;  4G7H F;  2AWC A;  4CDY A;  3VRC A;  3K33 A;  4BPM A;  4PJN A;  1A7V A;  1WTY A;  4DRH B;  2R05 A;  1SR2 A;  1VMA A;  3HJC A;  2R9R B;  1E86 A;  4YT2 A;  4XPW A;  2WL8 A;  4U5G A;  1CGO A;  2R7W A;  4MVM A;  3C8G D;  3Q6M A;  3NMI A;  4LLE A;  4U5E E;  3QTH A;  3UMH A;  3LS0 A;  3UR3 C;  5L3Q A;  2YRF A;  4YL3 A;  3DE9 A;  4IAR A;  2XSE A;  4D4N A;  3SZR A;  4EWC A;  5JRA A;  3QW0 A;  1FFH A;  4CS8 C;  256B A;  2VB6 A;  1YYJ A;  1WGW A;  2L7A A;  1V55 C;  3DD7 A;  1VOM A;  3KYI A;  3U9J A;  5KYU A;  4DVZ A;  2G3K A;  3AQC A;  3EG9 B;  5E3C A;  1G4W R;  2HS5 A;  1AVO B;  3RVY A;  3MX3 A;  1ZHW A;  4CBE A;  4A4A A;  4D4X A;  1E2X A;  1HW1 A;  3HNJ A;  5KYN A;  1T6I A;  3S84 A;  5EHH A;  1IW7 F;  2CGE A;  2CNW D;  3R7C A;  3LUT B;  3POV A;  2EIJ C;  3UNG C;  5B1B C;  1QVX A;  2J8W A;  3N0T A;  1V54 C;  2XM0 A;  3L1M A;  1A41 A;  2R7O A;  3BEH A;  1W2W A;  3I4U A;  1MND A;  5GPG B;  4E7S A;  3C8G B;  2IXM A;  1O3U A;  2KSF A;  2PX3 A;  3EFO B;  4PFP A;  5AC5 A;  4MQ9 F;  1G4U S;  3K6B A;  1CPR A;  2HSQ A;  4MND A;  2IXN A;  1DOV A;  2GFH A;  2FGY A;  3JRT A;  4DVY P;  1HE1 A;  2KC3 A;  3IQC A;  4KNW A;  2R7T A;  2W9Y A;  4O6M A;  2CW0 F;  4XEF A;  2XL6 A;  5BQG A;  4JKV A;  1J8M F;  3U9M A;  4CS9 A;  3EG9 A;  2KW3 C;  4I1M A;  2F22 A;  4C3D A;  1Z5Z A;  2IOQ A;  3K1H A;  3ZQV A;  3EH1 A;  2C04 A;  2ZXW C;  2A6H F;  3IEE A;  3FXH A;  4FWV A;  5CIV A;  2KK1 A;  2P1A A;  1EKY A;  2X51 A;  3IPM O;  3KKB A;  3QZC A;  4PAC A;  1ZHX A;  3GM1 A;  2NUT B;  2CCY A;  3NMJ A;  3L8I A;  1R5I D;  5COF A;  4Z9I A;  3GWL A;  2Q4F A;  1H9G A;  2XS8 A;  1KNY A;  1M2O A;  1YDI A;  2KQ9 A;  2R02 A;  4YT4 A;  2EPO A;  1ZHT A;  3DKA A;  5T3T A;  5BQI A;  3T6J A;  3ZDL A;  3ZTM A;  3C8G A;  3EFO A;  1PD0 A;  3WOD F;  4YT8 A;  1LVK A;  1MMN A;  3A11 A;  4RD9 A;  1OCO C;  4WGZ A;  2BE5 F;  4MW8 A;  5B1A C;  1TFO B;  1OCZ C;  4JIO A;  5FZT A;  5IY5 C;  1VTM P;  2HMZ A;  2YEV A;  2AP3 A;  1NZE A;  2OJQ A;  1Z6A A;  2HJ3 A;  2MWQ A;  3M4B A;  4XEV A;  1OR3 A;  1C17 M;  1CGN A;  1K40 A;  3E70 C;  4JTA B;  4NTB A;  2VAS A;  3ZWI A;  3DAG A;  1E83 A;  3QVZ A;  5CI9 A;  4Z9H A;  1Z63 A;  3C8Z A;  4BEJ A;  4LER A;  2HUJ A;  3T4R A;  2CNW A;  3NYL A;  3LES A;  3LLI A;  3FMS A;  5L0C A;  1K05 A;  1E85 A;  1ZYR F;  3K1I A;  3I5Q A; 
#chains in the Genus database with same CATH homology
 4Z9J A;  1VLT A;  1VLS A;  3T9O A;  1WAT A;  1WAS A;  4Z9H A;  1LIH A;  1JMW A;  4H54 A;  3ATP A;  4Z9I A;  2LIG A;  2D4U A;  2ASR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...