1LIHA

Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
160
structure length
160
Chain Sequence
b'MGGLLFSSLQHCQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTFDQSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
total genus 66
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1995-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1lihA00
2D4UA 1WASA 2LIGA 1JMWA 4Z9IA 2ASRA 1LIHA 4Z9HA 4Z9JA 3T9OA 1WATA 1VLTA 3ATPA 4H54A 1VLSA
chains in the Genus database with same CATH superfamily
2W4MA 1VB5A 2GDCA 5E3CA 5T3WA 4D4XA 4O7GA 3GEIA 2BL2A 2IOQA 2J9UA 2NSGA 3EJNA 3EGDB 3LNRA 4FX5A 1OXBA 1WATA 3PCVA 4JVSA 4MVMA 4CIHA 3RQFA 1BR1A 2H7OA 2W4BA 3RQGA 4QDLA 3EG9B 1JPJA 5B1BC 3RH3A 1YZCA 3ZIBA 2EIJC 4PFPA 2XL6A 2J45A 2ZXOA 5F5HA 1ZW2A 3FXHA 3ITFA 5KYYB 3MYFA 4WGYA 4XQ1A 2LFFA 2IXOA 4XEKA 3M15A 3SXYA 2L7AA 2HJMA 1K05A 2J0XA 2LP4A 4C7OB 3FVYA 5FCLA 2OOCA 1YARO 2KC3A 4ZLDA 3JRTA 1VK5A 4CDVA 4J7YA 2QY9A 2OEXA 3K66A 3M79A 5COGA 2CDQA 1AEPA 3ZTMA 1NBBA 1M2VA 1HW2A 1YA9A 4MW8A 1DOVA 3JYHA 2J7PA 2YRFA 1A41A 3OA1A 3ABKC 4BEJA 3J06A 1E86A 3OWTA 3C8GB 4XWJA 2Y3GA 4JTAB 3B0VC 3CAXA 3TJ5A 3U5SA 3EPVA 5TJ5E 1Z63A 4KNWA 3EGXB 3LEVA 4Q5SF 5T1DB 1GQAA 1TWGA 1OKKD 2KNHA 2WVNA 4U5DE 4XLNF 3R7CA 4FAPB 2OU6A 3H2UA 3U2LA 1UG7A 1LE2A 2A68F 2D4UA 1NFOA 4PACA 1S7ZA 2LQGA 5CI9A 2XLEA 2AWYA 3G4XA 3GORA 2YQYA 2HS5A 1FAPB 3M4BA 3MBGA 1MNDA 4UDVA 2KYHA 3DE8A 3AG2C 3DZAA 3H65A 3HNLA 3QMKA 2V26A 4WABA 3U8PA 4G7OF 2JPUA 3M4CA 2H7VC 1MMGA 2R9RB 1KNYA 3UMKA 2L81A 3NKDA 4RDAA 2CYDA 5JP7A 4P6IC 1S05A 2KJGA 3EGDA 3JRMO 5DS5A 2JD3A 2YL0A 2AP3A 1FNTc 2NSFA 1V54C 2J9BA 2W9YA 3C63A 3HNJA 2HMZA 3L0IA 4KI2A 3DXJF 3EG9A 3W8IA 1H6GA 3IPMO 4EKWA 1TWAA 4AL1A 4NY3A 4YL0A 4E18A 5HSWA 1ORJA 3ECSA 5KYYA 1JAFA 3RIPA 4XPXA 2C04A 1JRAA 3IHUA 2IM8A 4PJLA 2NUPB 3SXMA 3R2PA 4N6HA 3UR3C 3VRCA 5A6BA 3AG4C 1MMNA 2RD9A 3ZSUA 3NMKA 4E0IA 4EIYA 1O3UA 4C7OA 1VTMP 4K7BA 3FHDA 4NQFA 5JS5A 3B0UX 3LEOA 2IBFA 2P0NA 1OXKA 2ZXPA 4DOZA 1PCXA 4WJ0A 4E7ZA 4NTFA 1FMVA 1Q0KA 1RKCA 4D4NA 1E84A 1QQ3A 1V55C 4MW3A 3NYMA 3ZQVA 4OIOF 2HV6A 2Y39A 3JYYA 1C03A 4G0HA 1A7VA 4DRJB 4ER9A 4C3DA 2OKUA 5JLIA 1JOGA 3C8GA 3MFNA 3S27A 1VMAA 2A1DD 4MTFA 1MQVA 2IXNA 3GANA 4ANJA 1D0YA 2YEVA 4PK4A 2XS8A 1ORSC 1KTMA 3U0CA 256BA 1H7IA 3IQTA 4H4KC 4C3BA 2GAQA 4JJGA 2AWCA 1I4YA 4JCZA 1TFKB 3WODF 2R02A 4MS2A 1WGWA 2XLMA 2ASRA 3AG1C 3B9QA 3V5YA 3UMHA 2YLDA 2PP4A 4CSAA 1NLXA 2EINC 1OW8A 4I3MA 1ZHXA 5A69A 4CBEA 5KYWB 3FDQA 4U5EE 5DS6A 3C7JA 2X0CA 3U8VA 4BPMA 5L0HA 2XLWA 3T4RA 1M2OA 4CS9A 3MLGA 1EA8A 2B0HA 4H54A 4AL0A 1O87A 5KYUB 3AG3C 4I1MA 2PBEA 2QUPA 1T6UA 3RW0A 4MTGA 2CGEA 1TR2A 3CSKA 5F28E 3EZIA 2R7RA 3VM6A 2ZD9A 3JTLO 1VLSA 1ZW3A 4U5HA 4CDYA 3RVYA 4DRIB 5BUOA 2H7BA 3O55A 2PNOA 4IGGA 5COFA 4E0HA 1R5ID 4EHPA 1Q0GA 1OW6A 1J8YF 1F1MA 3AGUA 2G3VA 3E9VA 2XM0A 2R7XA 4BG0A 1MMAA 1APCA 4CSAC 5BQHA 3U3BA 2J7PD 2FFHA 2YWAA 3H2VA 1O5HA 1Z6AA 2KSFA 2NUPA 3F47A 4E17A 1QLEC 3NG1A 4F4BA 2ZXRA 3IQCA 2HKVA 4IAOA 2VCCA 2R05A 2YZSA 3S0XA 1V4AA 2Q9BA 5KYXB 4QI2A 2R7VA 2FGYA 4IRUA 3GEEA 3KKBA 5DVWA 1RKEB 1D1CA 4OD4A 2EPLX 3SYNA 1OCZC 3TQOA 3JZ0A 2J8WA 4RD9A 2GA0A 3IQ5A 2DGJA 3EFOA 2ZXWC 2XLHA 1L7CA 3GWNA 3VF0A 4A4AA 1FFHA 5BQIA 2XL8A 3U9MA 2RSEB 2A0BA 2L9JA 4PJMA 4CS8A 2H8AA 2WZGA 3QW1A 2DYRC 3QZCA 4IWBA 3ZVRA 5DLJA 4BJTA 5L3QA 3FAJA 4CIPA 1BR2A 1YVIA 1YYXA 3B0PA 3HNKA 1RJ9B 2Y3DA 3V7OA 2LCHA 3AOUA 3TJ6A 3UMIA 1PD0A 3RQEA 4AE4B 1CPQA 1Q0DA 4CS7A 2R7TA 2VC9A 1NFNA 1Q0FA 1T6IA 4Z9IA 1G4US 3O6XA 5KYWA 3C18A 2D5RB 4MVSA 3US6A 3F46A 2TMVP 1YJGA 2MWQA 2MHRA 2QLAA 4U5FE 1LS4A 2PFDA 3IQ6A 3Q7GA 4DJ9A 3DD7A 5KYUA 3DJNB 4YT5A 2ETSA 3W2WA 4DRHB 4OD5A 3U3FA 1U89A 4IB4A 5JSLA 1LS1A 5BQGA 3LJBA 4CS8C 4YT8A 4LDRA 3KYJA 4JW1A 4U5CE 1TFOB 2ZPAA 2GWWA 2OG2A 3KYIA 1BBHA 2YVKA 2L6HA 2P6VA 4XLPF 3LLKA 1SMYF 4C3EA 2E87A 3FOOA 2HFIA 1HW1A 2IXPA 1WWPA 5GPGB 5L0CA 4L6RA 3UNGC 1G4WR 2NG1A 4JE9A 3WAQA 2W45A 3C8GD 4NTAA 2HUJA 3SZRA 1GM5A 1N1CA 2Z15A 3SP1A 1EKYA 2PX0A 2KW3C 2HJ3A 1OCRC 1ORYA 4RBNA 5KYXA 1U0BB 4XEVA 1Z5ZA 2XLOA 2L6GA 3DM5A 5E3AA 5B3SC 2XM4A 4J7TA 4P9FA 2CW0F 1RKEA 2Q00A 3RFYA 4JEBA 4MTOA 4MVRA 3T6BA 1TKNA 1U6HA 1D1BA 2WZLA 4JC7A 3ASNC 4YN0B 1D0XA 2WL8A 4OINF 3RVZA 3LUTB 3LNMB 3KMIA 1OCOC 4P9TA 5JRAA 5JUAA 4PJJA 3NDBB 1OR2A 2R7UA 3LAYA 3ZWIA 4MVZA 2EPMX 3O39A 3ASOC 3WG7C 1AUEA 4JZAA 1SR2A 1VOMA 2A6EF 4K1OA 3TK0A 5EHHA 2V3CC 2CCYA 3DI5A 2NUTB 3V5ZA 4BJ5A 4E7SA 3TD7A 3K1IA 4MVOA 1RJ9A 1HE9A 3EFOB 1UFBA 3JCUQ 3M1CB 2XS1A 5AC4A 3EZHA 4AE4A 4I1OB 4YJWA 3UGOA 3U2MA 3TOLA 3FMSA 4DXWA 4DVYP 1HMDA 4JRZA 1WN0A 1FTSA 3K7DA 3JT1A 2Q7RA 1EQ1A 4MVUA 4QI0A 4U9EA 2X51A 1FR0A 4YL3A 2A6HF 2HMQA 1T9KA 1WTYA 1YYJA 2J9WA 4HEAJ 4EUKB 4MVQA 2MYSA 3S28A 1NU7D 1OCCC 2J46A 2Q9AA 2LD6A 4KC9A 5COMA 5E2QA 3GEHA 3NMIA 4Z9HA 3U9JA 3X1OA 4EBKA 1A7EA 2YLIA 3A11A 3GODA 4YK5A 1GS9A 2IYLD 4G78A 4BJ5C 3GM2A 1CPRA 3GWLA 5B3IA 2KQ9A 3GM1A 3K1IC 3Q7LA 1IZMA 4LDQA 1I4ZA 3EQLF 2AU5A 1QZXA 1L3PA 3AQCA 4LACB 4ULVA 5AGFA 1D0ZA 3TULA 1K40A 2UUIA 3DKAA 1D1AA 1ZU5A 2EILC 2R7QA 2B0JA 4BEMJ 3S90A 2XXAA 5FZTA 3S9OA 1Y6DA 2R7SA 5F5FA 1MMDA 4M63A 4XPWA 4U9DA 3B71A 3HKKA 2DB4A 2YLGA 5D91A 2BE5F 4CX9A 2Q9CA 3T9OA 5A6JA 5DQTA 1BZ4A 2EIMC 5IY5C 3BEHA 3DAGA 1ZYRF 3ZC4A 3DWWA 1Z23A 3SNHA 2EPNA 4N6CA 1M56C 3L8IA 4O79A 3QTHA 1LE4A 1PV3A 4HFKB 3VYWA 5A6AA 2WZFA 3T6GB 4R32A 2A0UA 1W2WA 4AK9A 1LVKA 4PJNA 2VB6A 5A6KA 2NUTA 2HSQA 3JSEO 4NCQA 1OR3A 2M4EA 1NZEA 2P1AA 1NU9C 3RKOF 3KH2A 1CGOA 1LKXA 1AVOB 1A0BA 2Y69C 4XEFA 1RMVA 1K04A 2M64A 1SYQA 1ZVZA 2F22A 2ICWG 2Y3HA 3NMJA 3QVYA 4FWVA 4GQHA 4OIQF 1JR8A 2WVOA 2J9VA 2VCAA 1E2XA 3G4ZA 4N06A 2L6FA 3JSZA 4JJFA 3S29A 4NC3A 3K33A 1FMWA 1LM3B 1ZHTA 3O10A 4MQ9F 4PR9A 3SXKA 3B29A 4J32B 3EH1A 4EBJA 2CNWA 3HTKC 4EBBA 3L1MA 1Z3IX 5DS4A 4CJOA 1LI5A 2PF4E 1EI7A 3NKEA 3I5PA 1Z7Qc 5L0FA 3DE9A 4U5GA 1E83A 4J30B 5JVEA 1B68A 1TQGA 3G50A 2R7OA 1E85A 1QVXA 4DBRA 2QTVA 3NYJA 2G62A 2Q4FA 3QVZA 1G5ZA 2LSEA 2Q3TA 4XPYA 3DJUB 2OQMA 1XZQA 3VAYA 2OJED 1JPNA 1I5NA 3BRJA 2R7WA 1KU2A 1DOWA 4G7HF 1HE1A 1ZHYA 2EPKX 4G7ZF 3LLIA 3FOPA 3RF3A 4CS9C 1YAUO 4U5BE 1XWJA 3V5XA 1H9TA 5DQZA 2P7VA 3OEOA 1M57C 1ZZPA 2I8BA 1YA7O 3L8JA 4Q7CA 4YL1A 3I4UA 1J8MF 2I15A 2XRHA 3X2QC 1IW7F 4YWQA 3ZTZA 1C02A 5AC5A 4O6NA 3AQBA 1NSGB 1YDIA 3CEXA 3AGTA 3HLZA 5D92A 3TOMA 2PX3A 1WOLA 4YT2A 1WASA 1T5OA 4LLCA 1CGNA 3AJMA 3MX3A 3W2VA 5E33A 4JIOA 4AX2A 1M6TA 3K1HA 3ABMC 1V74B 4HFFB 2OEVA 2FAPB 1YZAA 2O9XA 5EGYA 2XLVA 4I44A 2XXAB 2JX0A 3PDMP 1HMOA 2KK1A 3C62A 1H9GA 1LPEA 3SEOA 1RXQA 4ULWA 4Q4ZF 4JKVA 3QW0A 4YT4A 1OKKA 4JEAA 2EIKC 1BDJB 5L3VA 2Y3BA 1ZHWA 1SZIA 3S84A 3CQZA 4EWCA 1G8XA 3ABLC 2AVKA 3EHMA 4BJ6A 5L0IA 1T6QA 1YLMA 4O6MA 4WGZA 3DM9B 3LS0A 1HY5A 5B1AC 2R03A 3EHNA 4XTKA 4FESA 2J0WA 4K0DA 3Q6NA 2GFHA 3NYLA 3ZG1A 3L34A 2DI3A 1RCPA 2HV7A 2R25A 2A69F 1MNEA 1OW7A 2IXMA 2KGOA 2XSEA 4NTBA 3HNIA 2LK4A 2G3KA 3ZDLA 4DVZA 3Q6MA 3N0TA 3KL4A 4IARA 3LESA 2YL7A 4LDKA 1C17M 4B6IA 5L0JA 5K0IA 3IEEA 2LFDA 2HZ8A 2YL1A 1ZU4A 3I5QA 3K6BA 4ONSA 5HV9A 4X0RA 4DBQA 1PD1A 2VH3A 3POVA 1FFTC 3CZ6A 5L0DA 2QNLA 4LERA 2VASA 2OJQA 2DYSC 3EGXA 5CIVA 1A7DA 3GM3A 1M2VB 4W8KA 4GEHA 4OIRF 4O6YA 1Y4CA 2XLDA 2YHSA 1QPUA 4W8PA 4A2NB 4BJ6C 2WVQA 3FAPB 2C03A 1XZPA 2NPUA 3A9CA 4IJJA 4Z9JA 4ZLCA 1QSPA 1NG1A 5EK0A 1R4TA 1VYIA 2LIGA 3E70C 3MYIA 4PFOA 2XL4A 1TWHA 1VYKA 3DMDA 3T6JA 3HJCA 1OQCA 3W4YA 2WB7A 4GYTA 5JT4A 1Q0MA 1QKRA 1LIHA 2HSBA 2OCCC 2YKZA 4KBLA 1LI7A 3WHNA 5A6BD 3ATPA 3DAFA 4IAQA 3LS1A 3C8ZA 1SF8A 2YL3A 3N2ZB 1ST6A 4CDAA 1JMWA 2CNWD 4JCHA 1ZHZA 4KNVA 4OIPF 2BC5A 5L0GA 3EH2A 2UUHA 4HE8D 4JTCB 4JURI 2VCBA 1VLTA 4JTDB 5CI8A 4MNDA 5T3TA 3N24A 4BJ1A 1T01A 4CJGA 5KYNA 3UGPA 2P61A 1TWCA 1BR4A 1GGQA 3KPHA 3NRHA 1CGME 3W8HA 3PMRA 2EPOA 4LLEA 3RYLA 3SXZA 4N4WA 3ZQYA 3PHF2 2QE9A
chains in the Genus database with same CATH topology
2D4UA 1WASA 2LIGA 1JMWA 4Z9IA 2ASRA 1LIHA 4Z9HA 4Z9JA 3T9OA 1WATA 1VLTA 3ATPA 4H54A 1VLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4U A;  1WAS A;  2LIG A;  1JMW A;  4Z9I A;  2ASR A;  1LIH A;  4Z9H A;  4Z9J A;  3T9O A;  1WAT A;  1VLT A;  3ATP A;  4H54 A;  1VLS A; 
#chains in the Genus database with same CATH topology
 2W4M A;  1VB5 A;  2GDC A;  5E3C A;  5T3W A;  4D4X A;  4O7G A;  3GEI A;  2BL2 A;  2IOQ A;  2J9U A;  2NSG A;  3EJN A;  3EGD B;  3LNR A;  4FX5 A;  1OXB A;  1WAT A;  3PCV A;  4JVS A;  4MVM A;  4CIH A;  3RQF A;  1BR1 A;  2H7O A;  2W4B A;  3RQG A;  4QDL A;  3EG9 B;  1JPJ A;  5B1B C;  3RH3 A;  1YZC A;  3ZIB A;  2EIJ C;  4PFP A;  2XL6 A;  2J45 A;  2ZXO A;  5F5H A;  1ZW2 A;  3FXH A;  3ITF A;  5KYY B;  3MYF A;  4WGY A;  4XQ1 A;  2LFF A;  2IXO A;  4XEK A;  3M15 A;  3SXY A;  2L7A A;  2HJM A;  1K05 A;  2J0X A;  2LP4 A;  4C7O B;  3FVY A;  5FCL A;  2OOC A;  1YAR O;  2KC3 A;  4ZLD A;  3JRT A;  1VK5 A;  4CDV A;  4J7Y A;  2QY9 A;  2OEX A;  3K66 A;  3M79 A;  5COG A;  2CDQ A;  1AEP A;  3ZTM A;  1NBB A;  1M2V A;  1HW2 A;  1YA9 A;  4MW8 A;  1DOV A;  3JYH A;  2J7P A;  2YRF A;  1A41 A;  3OA1 A;  3ABK C;  4BEJ A;  3J06 A;  1E86 A;  3OWT A;  3C8G B;  4XWJ A;  2Y3G A;  4JTA B;  3B0V C;  3CAX A;  3TJ5 A;  3U5S A;  3EPV A;  5TJ5 E;  1Z63 A;  4KNW A;  3EGX B;  3LEV A;  4Q5S F;  5T1D B;  1GQA A;  1TWG A;  1OKK D;  2KNH A;  2WVN A;  4U5D E;  4XLN F;  3R7C A;  4FAP B;  2OU6 A;  3H2U A;  3U2L A;  1UG7 A;  1LE2 A;  2A68 F;  2D4U A;  1NFO A;  4PAC A;  1S7Z A;  2LQG A;  5CI9 A;  2XLE A;  2AWY A;  3G4X A;  3GOR A;  2YQY A;  2HS5 A;  1FAP B;  3M4B A;  3MBG A;  1MND A;  4UDV A;  2KYH A;  3DE8 A;  3AG2 C;  3DZA A;  3H65 A;  3HNL A;  3QMK A;  2V26 A;  4WAB A;  3U8P A;  4G7O F;  2JPU A;  3M4C A;  2H7V C;  1MMG A;  2R9R B;  1KNY A;  3UMK A;  2L81 A;  3NKD A;  4RDA A;  2CYD A;  5JP7 A;  4P6I C;  1S05 A;  2KJG A;  3EGD A;  3JRM O;  5DS5 A;  2JD3 A;  2YL0 A;  2AP3 A;  1FNT c;  2NSF A;  1V54 C;  2J9B A;  2W9Y A;  3C63 A;  3HNJ A;  2HMZ A;  3L0I A;  4KI2 A;  3DXJ F;  3EG9 A;  3W8I A;  1H6G A;  3IPM O;  4EKW A;  1TWA A;  4AL1 A;  4NY3 A;  4YL0 A;  4E18 A;  5HSW A;  1ORJ A;  3ECS A;  5KYY A;  1JAF A;  3RIP A;  4XPX A;  2C04 A;  1JRA A;  3IHU A;  2IM8 A;  4PJL A;  2NUP B;  3SXM A;  3R2P A;  4N6H A;  3UR3 C;  3VRC A;  5A6B A;  3AG4 C;  1MMN A;  2RD9 A;  3ZSU A;  3NMK A;  4E0I A;  4EIY A;  1O3U A;  4C7O A;  1VTM P;  4K7B A;  3FHD A;  4NQF A;  5JS5 A;  3B0U X;  3LEO A;  2IBF A;  2P0N A;  1OXK A;  2ZXP A;  4DOZ A;  1PCX A;  4WJ0 A;  4E7Z A;  4NTF A;  1FMV A;  1Q0K A;  1RKC A;  4D4N A;  1E84 A;  1QQ3 A;  1V55 C;  4MW3 A;  3NYM A;  3ZQV A;  4OIO F;  2HV6 A;  2Y39 A;  3JYY A;  1C03 A;  4G0H A;  1A7V A;  4DRJ B;  4ER9 A;  4C3D A;  2OKU A;  5JLI A;  1JOG A;  3C8G A;  3MFN A;  3S27 A;  1VMA A;  2A1D D;  4MTF A;  1MQV A;  2IXN A;  3GAN A;  4ANJ A;  1D0Y A;  2YEV A;  4PK4 A;  2XS8 A;  1ORS C;  1KTM A;  3U0C A;  256B A;  1H7I A;  3IQT A;  4H4K C;  4C3B A;  2GAQ A;  4JJG A;  2AWC A;  1I4Y A;  4JCZ A;  1TFK B;  3WOD F;  2R02 A;  4MS2 A;  1WGW A;  2XLM A;  2ASR A;  3AG1 C;  3B9Q A;  3V5Y A;  3UMH A;  2YLD A;  2PP4 A;  4CSA A;  1NLX A;  2EIN C;  1OW8 A;  4I3M A;  1ZHX A;  5A69 A;  4CBE A;  5KYW B;  3FDQ A;  4U5E E;  5DS6 A;  3C7J A;  2X0C A;  3U8V A;  4BPM A;  5L0H A;  2XLW A;  3T4R A;  1M2O A;  4CS9 A;  3MLG A;  1EA8 A;  2B0H A;  4H54 A;  4AL0 A;  1O87 A;  5KYU B;  3AG3 C;  4I1M A;  2PBE A;  2QUP A;  1T6U A;  3RW0 A;  4MTG A;  2CGE A;  1TR2 A;  3CSK A;  5F28 E;  3EZI A;  2R7R A;  3VM6 A;  2ZD9 A;  3JTL O;  1VLS A;  1ZW3 A;  4U5H A;  4CDY A;  3RVY A;  4DRI B;  5BUO A;  2H7B A;  3O55 A;  2PNO A;  4IGG A;  5COF A;  4E0H A;  1R5I D;  4EHP A;  1Q0G A;  1OW6 A;  1J8Y F;  1F1M A;  3AGU A;  2G3V A;  3E9V A;  2XM0 A;  2R7X A;  4BG0 A;  1MMA A;  1APC A;  4CSA C;  5BQH A;  3U3B A;  2J7P D;  2FFH A;  2YWA A;  3H2V A;  1O5H A;  1Z6A A;  2KSF A;  2NUP A;  3F47 A;  4E17 A;  1QLE C;  3NG1 A;  4F4B A;  2ZXR A;  3IQC A;  2HKV A;  4IAO A;  2VCC A;  2R05 A;  2YZS A;  3S0X A;  1V4A A;  2Q9B A;  5KYX B;  4QI2 A;  2R7V A;  2FGY A;  4IRU A;  3GEE A;  3KKB A;  5DVW A;  1RKE B;  1D1C A;  4OD4 A;  2EPL X;  3SYN A;  1OCZ C;  3TQO A;  3JZ0 A;  2J8W A;  4RD9 A;  2GA0 A;  3IQ5 A;  2DGJ A;  3EFO A;  2ZXW C;  2XLH A;  1L7C A;  3GWN A;  3VF0 A;  4A4A A;  1FFH A;  5BQI A;  2XL8 A;  3U9M A;  2RSE B;  2A0B A;  2L9J A;  4PJM A;  4CS8 A;  2H8A A;  2WZG A;  3QW1 A;  2DYR C;  3QZC A;  4IWB A;  3ZVR A;  5DLJ A;  4BJT A;  5L3Q A;  3FAJ A;  4CIP A;  1BR2 A;  1YVI A;  1YYX A;  3B0P A;  3HNK A;  1RJ9 B;  2Y3D A;  3V7O A;  2LCH A;  3AOU A;  3TJ6 A;  3UMI A;  1PD0 A;  3RQE A;  4AE4 B;  1CPQ A;  1Q0D A;  4CS7 A;  2R7T A;  2VC9 A;  1NFN A;  1Q0F A;  1T6I A;  4Z9I A;  1G4U S;  3O6X A;  5KYW A;  3C18 A;  2D5R B;  4MVS A;  3US6 A;  3F46 A;  2TMV P;  1YJG A;  2MWQ A;  2MHR A;  2QLA A;  4U5F E;  1LS4 A;  2PFD A;  3IQ6 A;  3Q7G A;  4DJ9 A;  3DD7 A;  5KYU A;  3DJN B;  4YT5 A;  2ETS A;  3W2W A;  4DRH B;  4OD5 A;  3U3F A;  1U89 A;  4IB4 A;  5JSL A;  1LS1 A;  5BQG A;  3LJB A;  4CS8 C;  4YT8 A;  4LDR A;  3KYJ A;  4JW1 A;  4U5C E;  1TFO B;  2ZPA A;  2GWW A;  2OG2 A;  3KYI A;  1BBH A;  2YVK A;  2L6H A;  2P6V A;  4XLP F;  3LLK A;  1SMY F;  4C3E A;  2E87 A;  3FOO A;  2HFI A;  1HW1 A;  2IXP A;  1WWP A;  5GPG B;  5L0C A;  4L6R A;  3UNG C;  1G4W R;  2NG1 A;  4JE9 A;  3WAQ A;  2W45 A;  3C8G D;  4NTA A;  2HUJ A;  3SZR A;  1GM5 A;  1N1C A;  2Z15 A;  3SP1 A;  1EKY A;  2PX0 A;  2KW3 C;  2HJ3 A;  1OCR C;  1ORY A;  4RBN A;  5KYX A;  1U0B B;  4XEV A;  1Z5Z A;  2XLO A;  2L6G A;  3DM5 A;  5E3A A;  5B3S C;  2XM4 A;  4J7T A;  4P9F A;  2CW0 F;  1RKE A;  2Q00 A;  3RFY A;  4JEB A;  4MTO A;  4MVR A;  3T6B A;  1TKN A;  1U6H A;  1D1B A;  2WZL A;  4JC7 A;  3ASN C;  4YN0 B;  1D0X A;  2WL8 A;  4OIN F;  3RVZ A;  3LUT B;  3LNM B;  3KMI A;  1OCO C;  4P9T A;  5JRA A;  5JUA A;  4PJJ A;  3NDB B;  1OR2 A;  2R7U A;  3LAY A;  3ZWI A;  4MVZ A;  2EPM X;  3O39 A;  3ASO C;  3WG7 C;  1AUE A;  4JZA A;  1SR2 A;  1VOM A;  2A6E F;  4K1O A;  3TK0 A;  5EHH A;  2V3C C;  2CCY A;  3DI5 A;  2NUT B;  3V5Z A;  4BJ5 A;  4E7S A;  3TD7 A;  3K1I A;  4MVO A;  1RJ9 A;  1HE9 A;  3EFO B;  1UFB A;  3JCU Q;  3M1C B;  2XS1 A;  5AC4 A;  3EZH A;  4AE4 A;  4I1O B;  4YJW A;  3UGO A;  3U2M A;  3TOL A;  3FMS A;  4DXW A;  4DVY P;  1HMD A;  4JRZ A;  1WN0 A;  1FTS A;  3K7D A;  3JT1 A;  2Q7R A;  1EQ1 A;  4MVU A;  4QI0 A;  4U9E A;  2X51 A;  1FR0 A;  4YL3 A;  2A6H F;  2HMQ A;  1T9K A;  1WTY A;  1YYJ A;  2J9W A;  4HEA J;  4EUK B;  4MVQ A;  2MYS A;  3S28 A;  1NU7 D;  1OCC C;  2J46 A;  2Q9A A;  2LD6 A;  4KC9 A;  5COM A;  5E2Q A;  3GEH A;  3NMI A;  4Z9H A;  3U9J A;  3X1O A;  4EBK A;  1A7E A;  2YLI A;  3A11 A;  3GOD A;  4YK5 A;  1GS9 A;  2IYL D;  4G78 A;  4BJ5 C;  3GM2 A;  1CPR A;  3GWL A;  5B3I A;  2KQ9 A;  3GM1 A;  3K1I C;  3Q7L A;  1IZM A;  4LDQ A;  1I4Z A;  3EQL F;  2AU5 A;  1QZX A;  1L3P A;  3AQC A;  4LAC B;  4ULV A;  5AGF A;  1D0Z A;  3TUL A;  1K40 A;  2UUI A;  3DKA A;  1D1A A;  1ZU5 A;  2EIL C;  2R7Q A;  2B0J A;  4BEM J;  3S90 A;  2XXA A;  5FZT A;  3S9O A;  1Y6D A;  2R7S A;  5F5F A;  1MMD A;  4M63 A;  4XPW A;  4U9D A;  3B71 A;  3HKK A;  2DB4 A;  2YLG A;  5D91 A;  2BE5 F;  4CX9 A;  2Q9C A;  3T9O A;  5A6J A;  5DQT A;  1BZ4 A;  2EIM C;  5IY5 C;  3BEH A;  3DAG A;  1ZYR F;  3ZC4 A;  3DWW A;  1Z23 A;  3SNH A;  2EPN A;  4N6C A;  1M56 C;  3L8I A;  4O79 A;  3QTH A;  1LE4 A;  1PV3 A;  4HFK B;  3VYW A;  5A6A A;  2WZF A;  3T6G B;  4R32 A;  2A0U A;  1W2W A;  4AK9 A;  1LVK A;  4PJN A;  2VB6 A;  5A6K A;  2NUT A;  2HSQ A;  3JSE O;  4NCQ A;  1OR3 A;  2M4E A;  1NZE A;  2P1A A;  1NU9 C;  3RKO F;  3KH2 A;  1CGO A;  1LKX A;  1AVO B;  1A0B A;  2Y69 C;  4XEF A;  1RMV A;  1K04 A;  2M64 A;  1SYQ A;  1ZVZ A;  2F22 A;  2ICW G;  2Y3H A;  3NMJ A;  3QVY A;  4FWV A;  4GQH A;  4OIQ F;  1JR8 A;  2WVO A;  2J9V A;  2VCA A;  1E2X A;  3G4Z A;  4N06 A;  2L6F A;  3JSZ A;  4JJF A;  3S29 A;  4NC3 A;  3K33 A;  1FMW A;  1LM3 B;  1ZHT A;  3O10 A;  4MQ9 F;  4PR9 A;  3SXK A;  3B29 A;  4J32 B;  3EH1 A;  4EBJ A;  2CNW A;  3HTK C;  4EBB A;  3L1M A;  1Z3I X;  5DS4 A;  4CJO A;  1LI5 A;  2PF4 E;  1EI7 A;  3NKE A;  3I5P A;  1Z7Q c;  5L0F A;  3DE9 A;  4U5G A;  1E83 A;  4J30 B;  5JVE A;  1B68 A;  1TQG A;  3G50 A;  2R7O A;  1E85 A;  1QVX A;  4DBR A;  2QTV A;  3NYJ A;  2G62 A;  2Q4F A;  3QVZ A;  1G5Z A;  2LSE A;  2Q3T A;  4XPY A;  3DJU B;  2OQM A;  1XZQ A;  3VAY A;  2OJE D;  1JPN A;  1I5N A;  3BRJ A;  2R7W A;  1KU2 A;  1DOW A;  4G7H F;  1HE1 A;  1ZHY A;  2EPK X;  4G7Z F;  3LLI A;  3FOP A;  3RF3 A;  4CS9 C;  1YAU O;  4U5B E;  1XWJ A;  3V5X A;  1H9T A;  5DQZ A;  2P7V A;  3OEO A;  1M57 C;  1ZZP A;  2I8B A;  1YA7 O;  3L8J A;  4Q7C A;  4YL1 A;  3I4U A;  1J8M F;  2I15 A;  2XRH A;  3X2Q C;  1IW7 F;  4YWQ A;  3ZTZ A;  1C02 A;  5AC5 A;  4O6N A;  3AQB A;  1NSG B;  1YDI A;  3CEX A;  3AGT A;  3HLZ A;  5D92 A;  3TOM A;  2PX3 A;  1WOL A;  4YT2 A;  1WAS A;  1T5O A;  4LLC A;  1CGN A;  3AJM A;  3MX3 A;  3W2V A;  5E33 A;  4JIO A;  4AX2 A;  1M6T A;  3K1H A;  3ABM C;  1V74 B;  4HFF B;  2OEV A;  2FAP B;  1YZA A;  2O9X A;  5EGY A;  2XLV A;  4I44 A;  2XXA B;  2JX0 A;  3PDM P;  1HMO A;  2KK1 A;  3C62 A;  1H9G A;  1LPE A;  3SEO A;  1RXQ A;  4ULW A;  4Q4Z F;  4JKV A;  3QW0 A;  4YT4 A;  1OKK A;  4JEA A;  2EIK C;  1BDJ B;  5L3V A;  2Y3B A;  1ZHW A;  1SZI A;  3S84 A;  3CQZ A;  4EWC A;  1G8X A;  3ABL C;  2AVK A;  3EHM A;  4BJ6 A;  5L0I A;  1T6Q A;  1YLM A;  4O6M A;  4WGZ A;  3DM9 B;  3LS0 A;  1HY5 A;  5B1A C;  2R03 A;  3EHN A;  4XTK A;  4FES A;  2J0W A;  4K0D A;  3Q6N A;  2GFH A;  3NYL A;  3ZG1 A;  3L34 A;  2DI3 A;  1RCP A;  2HV7 A;  2R25 A;  2A69 F;  1MNE A;  1OW7 A;  2IXM A;  2KGO A;  2XSE A;  4NTB A;  3HNI A;  2LK4 A;  2G3K A;  3ZDL A;  4DVZ A;  3Q6M A;  3N0T A;  3KL4 A;  4IAR A;  3LES A;  2YL7 A;  4LDK A;  1C17 M;  4B6I A;  5L0J A;  5K0I A;  3IEE A;  2LFD A;  2HZ8 A;  2YL1 A;  1ZU4 A;  3I5Q A;  3K6B A;  4ONS A;  5HV9 A;  4X0R A;  4DBQ A;  1PD1 A;  2VH3 A;  3POV A;  1FFT C;  3CZ6 A;  5L0D A;  2QNL A;  4LER A;  2VAS A;  2OJQ A;  2DYS C;  3EGX A;  5CIV A;  1A7D A;  3GM3 A;  1M2V B;  4W8K A;  4GEH A;  4OIR F;  4O6Y A;  1Y4C A;  2XLD A;  2YHS A;  1QPU A;  4W8P A;  4A2N B;  4BJ6 C;  2WVQ A;  3FAP B;  2C03 A;  1XZP A;  2NPU A;  3A9C A;  4IJJ A;  4Z9J A;  4ZLC A;  1QSP A;  1NG1 A;  5EK0 A;  1R4T A;  1VYI A;  2LIG A;  3E70 C;  3MYI A;  4PFO A;  2XL4 A;  1TWH A;  1VYK A;  3DMD A;  3T6J A;  3HJC A;  1OQC A;  3W4Y A;  2WB7 A;  4GYT A;  5JT4 A;  1Q0M A;  1QKR A;  1LIH A;  2HSB A;  2OCC C;  2YKZ A;  4KBL A;  1LI7 A;  3WHN A;  5A6B D;  3ATP A;  3DAF A;  4IAQ A;  3LS1 A;  3C8Z A;  1SF8 A;  2YL3 A;  3N2Z B;  1ST6 A;  4CDA A;  1JMW A;  2CNW D;  4JCH A;  1ZHZ A;  4KNV A;  4OIP F;  2BC5 A;  5L0G A;  3EH2 A;  2UUH A;  4HE8 D;  4JTC B;  4JUR I;  2VCB A;  1VLT A;  4JTD B;  5CI8 A;  4MND A;  5T3T A;  3N24 A;  4BJ1 A;  1T01 A;  4CJG A;  5KYN A;  3UGP A;  2P61 A;  1TWC A;  1BR4 A;  1GGQ A;  3KPH A;  3NRH A;  1CGM E;  3W8H A;  3PMR A;  2EPO A;  4LLE A;  3RYL A;  3SXZ A;  4N4W A;  3ZQY A;  3PHF 2;  2QE9 A; 
#chains in the Genus database with same CATH homology
 2D4U A;  1WAS A;  2LIG A;  1JMW A;  4Z9I A;  2ASR A;  1LIH A;  4Z9H A;  4Z9J A;  3T9O A;  1WAT A;  1VLT A;  3ATP A;  4H54 A;  1VLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...