1ORSC

X-ray structure of the kvap potassium channel voltage sensor in complex with an fab
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
DVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIILWADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKFLSAIADAADKLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords 33H1 Fab light chain
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 53
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 1orsC00
4DXWA 4MVSA 4MVRA 3RVZA 3LUTB 4MTGA 4MVMA 3RVYA 2R9RB 4MVZA 4MTOA 4MTFA 3LNMB 4JTAB 5EK0A 4MW3A 2KYHA 4MS2A 4JTDB 4MVQA 4MW8A 1ORSC 3RW0A 4EKWA 4MVUA 4MVOA 4JTCB
chains in the Genus database with same CATH superfamily
1B68A 1APCA 1OXKA 2GWWA 3L0IA 3JCUQ 2OEVA 1F1MA 1I4ZA 1LE2A 2J0WA 5D91A 5T3TA 4ZLDA 4NTAA 2AWCA 2WZLA 2Y3BA 4RDAA 4ZLCA 4JJFA 4CS9C 3B0UX 3O10A 3EH1A 1ZHTA 3EG9B 4AE4A 5EK0A 2YRFA 4O6MA 5A6KA 2LFDA 1ZW3A 2NPUA 2KW3C 1MMDA 4U5FE 2J9WA 1NBBA 1JOGA 3LEVA 2HMQA 1NFOA 4IAQA 3M4BA 3V5YA 2YQYA 2A0UA 4XPWA 2GDCA 3FOPA 3DE8A 4MVQA 1Z5ZA 2FGYA 3C8GA 3VM6A 1ZHYA 5BUOA 3U0CA 4XLNF 2MHRA 3F47A 1A7DA 2KGOA 4PFOA 2J9UA 4XEFA 4LACB 1G8XA 1D0YA 2P0NA 2YLDA 4ULVA 2A6EF 4E17A 1V4AA 1YVIA 1DOVA 3C62A 4KNVA 3WAQA 4ONSA 3WG7C 4OIOF 1BR4A 3G4ZA 2W4MA 4MVMA 4I1OB 2YWAA 3ZDLA 5F28E 5HSWA 4JEBA 2HMZA 2Q3TA 4CS9A 5CI8A 1V55C 2CGEA 4JTAB 4YL3A 2UUIA 5D92A 5COMA 4YN0B 4BJ6C 3DWWA 1VYIA 3O55A 1Z63A 2XLEA 4PFPA 5F5FA 3LESA 1YA9A 4XPXA 1CPQA 2PNOA 3LEOA 1L7CA 4M63A 2WZGA 3T6BA 3DD7A 3E9VA 3FXHA 3AQCA 4JC7A 3MFNA 3TD7A 3N24A 3ZSUA 4MNDA 2LD6A 1K04A 2XLHA 2XS8A 1GGQA 1GQAA 1Z23A 1RCPA 3B29A 4BEJA 2O9XA 2P1AA 3ECSA 5GPGB 3RFYA 3RF3A 2IYLD 1WN0A 3M4CA 1L3PA 4GEHA 2ZXWC 1NLXA 4LDQA 2PF4E 3ABKC 1OCCC 1QZXA 1YLMA 2PX3A 3Q6NA 2QY9A 5EHHA 4E18A 1CPRA 3LUTB 3T6JA 2OU6A 3DJUB 2YKZA 4RBNA 4OINF 4XEVA 1ZHZA 4JW1A 3SNHA 4OIPF 1SZIA 1T9KA 4P9FA 4DRJB 2EPNA 1NU9C 5L0DA 4XWJA 2Y3GA 3SP1A 4G7ZF 1HY5A 1ST6A 3AG1C 3R2PA 1JMWA 2ZD9A 4LLEA 1MQVA 1V74B 4N6CA 3S0XA 1CGOA 4NY3A 4OIRF 3RQGA 3SXZA 4YT4A 1XZPA 2QLAA 3SXMA 2EINC 1UFBA 4AX2A 5CI9A 5BQIA 1S05A 2R7XA 3KYJA 1R5ID 3AG4C 2Q9CA 5EGYA 4KI2A 1HMDA 2DYSC 3F46A 1NSGB 2Q00A 1IZMA 4AE4B 2VCCA 2RD9A 1OCRC 3SEOA 3NKEA 4CSAA 3NMIA 4NC3A 3QMKA 2VC9A 4JCHA 1RKCA 2LP4A 1WGWA 2WB7A 5L0FA 4Q4ZF 3W8HA 3CZ6A 3FVYA 3JRMO 1T01A 3ABLC 5JT4A 3SZRA 1TFKB 1JR8A 4HFFB 5E2QA 3C8GB 3W2VA 4F4BA 3B0PA 4CS8C 2JD3A 2XM4A 3T6GB 4G78A 1I4YA 1T5OA 2DB4A 2R25A 3MYIA 4I1MA 5E33A 1UG7A 5IY5C 4L6RA 2HZ8A 4BPMA 3RQEA 3S28A 3DKAA 1YDIA 3EGDA 1XWJA 4MW3A 1RJ9A 2TMVP 4QI0A 1VOMA 2PFDA 2XL8A 4XLPF 1OW7A 2HSBA 2V26A 4GYTA 1FFTC 2XLVA 2XLMA 2EIMC 2W4BA 2Y3HA 4MW8A 3K6BA 4HEAJ 2R7WA 1ORSC 3HNJA 4ER9A 2JPUA 4CDVA 4JTCB 3ZWIA 3US6A 5BQHA 5B1BC 4YWQA 1OR3A 1O87A 2EPKX 4U9DA 4LLCA 2NUTB 1LI5A 1BZ4A 2EIJC 2KNHA 2ICWG 4DVZA 4FX5A 4OD4A 3WHNA 4DBQA 2B0HA 1OKKD 3CQZA 1PD0A 3H2VA 2R7QA 3ZQYA 4B6IA 4IB4A 1AVOB 1H6GA 3TULA 5A6AA 2PP4A 2DYRC 2QE9A 3TQOA 2AP3A 3KH2A 5B1AC 2LCHA 5T1DB 4D4XA 1E83A 2L6GA 3U8PA 5COGA 2GA0A 3DAGA 1JPJA 5A6BD 1V54C 1H7IA 4PJNA 5DS6A 3JSZA 4NCQA 5CIVA 2VH3A 5KYNA 3IPMO 3AGTA 4E7SA 4YT8A 3U5SA 3KPHA 2PX0A 3ASNC 4PJJA 1VK5A 4E0HA 3ZG1A 5L0GA 1A7EA 2YLIA 2OOCA 1EI7A 1KNYA 2KQ9A 2XSEA 3DAFA 4Z9JA 1WOLA 2AVKA 2KC3A 3L1MA 3MLGA 3AG3C 1RMVA 3HNKA 3GM2A 3WODF 4EBJA 1Y4CA 1HW1A 2HV7A 1BDJB 4JCZA 3HNLA 1FMWA 2ZXPA 2OCCC 1HE9A 2G3VA 3U3FA 4EHPA 3EZIA 3B9QA 2ASRA 2NG1A 4CIPA 5FCLA 3S9OA 1MMAA 3FMSA 4QI2A 1Z6AA 1G4US 3EQLF 3IQTA 1WATA 1CGME 5B3IA 4PR9A 2J8WA 1A41A 1A0BA 1Q0DA 4GQHA 1FTSA 4W8PA 2CCYA 4Z9HA 2HFIA 3EGDB 1RJ9B 2EIKC 2R05A 4D4NA 2YHSA 1TWCA 2CDQA 2VB6A 3NYJA 2YEVA 4Q7CA 4BG0A 2GFHA 1OW8A 2BE5F 1TWAA 1NFNA 2D4UA 2V3CC 4U5GA 3SYNA 2BL2A 3JTLO 4LERA 1WASA 1ZZPA 2MYSA 4P6IC 4U5HA 2EPOA 1C02A 1XZQA 2J46A 2YLGA 3VF0A 3X1OA 1H9GA 2YL1A 2AU5A 4E0IA 3LLIA 2WL8A 3C18A 4HE8D 3JYHA 4FESA 3RIPA 3KYIA 2OJED 1YA7O 2NUTA 3W4YA 5TJ5E 3ZQVA 2QUPA 3BEHA 4P9TA 2A69F 1VTMP 3NG1A 1JAFA 2Z15A 3RW0A 3C8ZA 3EPVA 3OEOA 3ZC4A 2HJMA 3GM3A 3S27A 3ASOC 3LAYA 3UMKA 4UDVA 2G3KA 4J32B 1EQ1A 1M56C 2L9JA 2XLOA 4JVSA 2XRHA 3UMIA 4IGGA 1YAUO 3ZVRA 1E2XA 2J7PD 4MTGA 4O6NA 4Z9IA 2IM8A 3I5PA 4K7BA 4BEMJ 4JE9A 4EBBA 2Q9AA 1OXBA 3CAXA 4JJGA 4WGZA 4MTFA 4DOZA 3LNMB 3M15A 3QVYA 3TJ6A 1TR2A 3EHNA 2A0BA 1KU2A 3DM5A 1SYQA 1OW6A 5AC5A 3EZHA 3V7OA 3IHUA 3FHDA 3RKOF 2YL7A 4MQ9F 5JRAA 1MMGA 2ZPAA 3UR3C 3HJCA 3JT1A 2IXPA 2C03A 1LKXA 1ZHWA 1AEPA 3UGOA 1D1CA 1T6QA 3KKBA 2L6HA 3RQFA 3K1IC 3R7CA 3JRTA 4WABA 4EUKB 1ZU4A 5BQGA 4N4WA 2R7OA 5E3AA 2G62A 2B0JA 3GODA 4CSAC 1OQCA 2HKVA 3PMRA 1E84A 1Q0FA 1TFOB 4U5EE 2VASA 5DS4A 1LI7A 4LDKA 1D1BA 1WWPA 3ATPA 3NRHA 1ZU5A 1FAPB 4YL1A 3EHMA 2GAQA 2L81A 5JS5A 3HLZA 2IXMA 1M2OA 3LS0A 1J8YF 4I3MA 3ABMC 1A7VA 2Q4FA 2CNWA 2LK4A 1VMAA 4XPYA 4XQ1A 2Q7RA 5JUAA 5L0JA 2Y69C 1EKYA 1K40A 1VYKA 3J06A 3M1CB 1VLTA 4XTKA 3GWLA 1YYJA 4HFKB 3TOMA 1JRAA 4YK5A 3GWNA 3TJ5A 2I8BA 3C7JA 3N0TA 1R4TA 1QVXA 3K1IA 3UNGC 4PJLA 2R7SA 3B71A 4KC9A 4CDYA 1SR2A 2H7OA 3K66A 2P6VA 2HV6A 1LS4A 4WGYA 1LM3B 3AQBA 4A2NB 4DVYP 3G50A 1T6UA 4CBEA 2RSEB 2WVQA 3LLKA 3NMJA 5HV9A 3EJNA 2W9YA 3HTKC 1ZYRF 4EIYA 1N1CA 1NZEA 3W2WA 4FAPB 1LS1A 2HSQA 3MBGA 3FAPB 2X51A 3ZIBA 2XS1A 3NDBB 1RKEA 5A6JA 4C7OA 4CS7A 3AG2C 4W8KA 4AL1A 1BR1A 3PDMP 2BC5A 3MYFA 1MMNA 4OIQF 5L3QA 1OCOC 2R7UA 4A4AA 5DQTA 3L34A 4E7ZA 3C8GD 4U5CE 1EA8A 3T4RA 3C63A 2YZSA 3TK0A 5B3SC 3FAJA 5DQZA 2CW0F 2OQMA 1IW7F 1PCXA 3O6XA 4BJ1A 1D0XA 3NYLA 1C17M 4MVZA 3HNIA 3IEEA 4X0RA 1TWGA 3GEHA 4IARA 1O5HA 2AWYA 3KMIA 4G7HF 4PACA 2A68F 2D5RB 3SXYA 2CYDA 2IBFA 2KYHA 4LDRA 3U3BA 3GORA 1Z3IX 4KNWA 1HW2A 2UUHA 3EGXA 5KYUA 5L0IA 3DZAA 3S90A 2H8AA 4K1OA 4G7OF 1W2WA 4YJWA 2L6FA 2OKUA 5F5HA 2P7VA 3IQ6A 3W8IA 3LNRA 3S84A 2W45A 2YVKA 1KTMA 2EPMX 1JPNA 1YZAA 4K0DA 1YZCA 3FOOA 1M57C 1OKKA 5KYYA 2I15A 1NG1A 4C3DA 2A1DD 4O7GA 1Q0KA 4WJ0A 3V5XA 3POVA 4DBRA 2R03A 2XM0A 4R32A 4I44A 1H9TA 1CGNA 3DM9B 2R9RB 4C3BA 1MNDA 5JSLA 3LS1A 3IQ5A 4CJGA 4BJ5C 1QLEC 3PCVA 2OG2A 2XL6A 4NTBA 3LJBA 3SXKA 2ETSA 1AUEA 5A69A 2IXOA 5A6BA 3H2UA 4YL0A 3U2MA 3CEXA 3B0VC 1ZW2A 4NQFA 2J9BA 3JSEO 2Y39A 3EFOA 3U9JA 4CIHA 2IOQA 5L3VA 3PHF2 3U8VA 2DI3A 1MNEA 3IQCA 4O6YA 3E70C 3U2LA 4MVSA 4JIOA 2J9VA 3UMHA 1RKEB 2HJ3A 4IJJA 1G5ZA 2WVOA 2XXAA 4C7OB 5JVEA 5K0IA 1PD1A 1J8MF 3A11A 3ZTZA 2J0XA 4BJ5A 4JURI 4MTOA 4H4KC 5KYWB 2PBEA 2LQGA 2LFFA 2NUPA 4IAOA 1G4WR 1S7ZA 1WTYA 4U5BE 3DXJF 3M79A 3U9MA 3A9CA 1D1AA 3VAYA 4XEKA 2X0CA 5T3WA 3FDQA 3GEEA 3DI5A 2YL3A 3RH3A 5KYXA 2CNWD 1QPUA 1BR2A 3BRJA 3TOLA 3GANA 3QW0A 3CSKA 1M2VA 1U89A 3I5QA 4J7TA 4MVOA 4QDLA 4BJTA 3O39A 4EBKA 2R7RA 2XLDA 3JZ0A 1SMYF 3OWTA 1SF8A 3VYWA 3AOUA 4DXWA 2J45A 1C03A 2L7AA 4JKVA 3L8JA 1TWHA 2OEXA 3EGXB 5KYUB 1LPEA 3N2ZB 1TQGA 3K1HA 4IRUA 2R7VA 3RVYA 1HMOA 5E3CA 4AK9A 2XLWA 3K7DA 4CX9A 1FMVA 1BBHA 1FFHA 3AGUA 3NMKA 2KSFA 4BJ6A 1FNTc 2FAPB 1YYXA 2LSEA 4DRHB 5KYYB 1Q0MA 1YARO 3GM1A 1QKRA 2LIGA 3GEIA 3K33A 5JP7A 5DLJA 2VCAA 2FFHA 4YT2A 1LVKA 1Y6DA 1ZVZA 5L0CA 2KK1A 3QTHA 4JRZA 1GM5A 2MWQA 3DE9A 1VB5A 4RD9A 4JTDB 1D0ZA 1M6TA 5DS5A 3Q7LA 4J30B 5DVWA 1LE4A 4N6HA 4OD5A 5FZTA 3T9OA 3QW1A 4DJ9A 4EKWA 2R7TA 3JYYA 1PV3A 3EG9A 4EWCA 1YJGA 2J7PA 1OR2A 2YL0A 1E86A 1QQ3A 4H54A 2A6HF 2EPLX 2H7VC 3L8IA 2VCBA 3RVZA 2WVNA 2C04A 1ORJA 3EFOB 2HUJA 5JLIA 3NKDA 3AJMA 1E85A 4KBLA 1GS9A 2R02A 3VRCA 2JX0A 1NU7D 1T6IA 1QSPA 3MX3A 4YT5A 4CJOA 2IXNA 1DOWA 2NSGA 1ORYA 2M64A 1O3UA 2QTVA 2ZXRA 3HKKA 4IWBA 4PJMA 3RYLA 2XXAB 256BA 4U5DE 1LIHA 2P61A 4CDAA 1VLSA 4ANJA 2Q9BA 3OA1A 2WZFA 3EH2A 3I4UA 2EILC 3ZTMA 2NUPB 1U0BB 5AC4A 5KYWA 1OCZC 3G4XA 4PK4A 1Z7Qc 2OJQA 5COFA 5L0HA 3H65A 4MVRA 5KYXB 3Q6MA 4G0HA 4CS8A 1FR0A 3QVZA 4N06A 1U6HA 2DGJA 1M2VB 2F22A 2HS5A 3KL4A 1HE1A 2H7BA 4FWVA 1TKNA 4JZAA 2E87A 4AL0A 3UGPA 4Q5SF 1ZHXA 2XL4A 1K05A 2Y3DA 3QZCA 2QNLA 4U9EA 4ULWA 3V5ZA 3X2QC 2M4EA 3Q7GA 2NSFA 4J7YA 4JEAA 3ITFA 4MS2A 4DRIB 4O79A 5AGFA 3DJNB 3NYMA 1Q0GA 4C3EA 4NTFA 2ZXOA 1I5NA 2KJGA 4MVUA 3S29A 3DMDA 1RXQA
chains in the Genus database with same CATH topology
4DXWA 4MVSA 4MVRA 3RVZA 3LUTB 4MTGA 4MVMA 3RVYA 2R9RB 4MVZA 4MTOA 4MTFA 3LNMB 4JTAB 5EK0A 4MW3A 2KYHA 4MS2A 4JTDB 4MVQA 4MW8A 1ORSC 3RW0A 4EKWA 4MVUA 4MVOA 4JTCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXW A;  4MVS A;  4MVR A;  3RVZ A;  3LUT B;  4MTG A;  4MVM A;  3RVY A;  2R9R B;  4MVZ A;  4MTO A;  4MTF A;  3LNM B;  4JTA B;  5EK0 A;  4MW3 A;  2KYH A;  4MS2 A;  4JTD B;  4MVQ A;  4MW8 A;  1ORS C;  3RW0 A;  4EKW A;  4MVU A;  4MVO A;  4JTC B; 
#chains in the Genus database with same CATH topology
 1B68 A;  1APC A;  1OXK A;  2GWW A;  3L0I A;  3JCU Q;  2OEV A;  1F1M A;  1I4Z A;  1LE2 A;  2J0W A;  5D91 A;  5T3T A;  4ZLD A;  4NTA A;  2AWC A;  2WZL A;  2Y3B A;  4RDA A;  4ZLC A;  4JJF A;  4CS9 C;  3B0U X;  3O10 A;  3EH1 A;  1ZHT A;  3EG9 B;  4AE4 A;  5EK0 A;  2YRF A;  4O6M A;  5A6K A;  2LFD A;  1ZW3 A;  2NPU A;  2KW3 C;  1MMD A;  4U5F E;  2J9W A;  1NBB A;  1JOG A;  3LEV A;  2HMQ A;  1NFO A;  4IAQ A;  3M4B A;  3V5Y A;  2YQY A;  2A0U A;  4XPW A;  2GDC A;  3FOP A;  3DE8 A;  4MVQ A;  1Z5Z A;  2FGY A;  3C8G A;  3VM6 A;  1ZHY A;  5BUO A;  3U0C A;  4XLN F;  2MHR A;  3F47 A;  1A7D A;  2KGO A;  4PFO A;  2J9U A;  4XEF A;  4LAC B;  1G8X A;  1D0Y A;  2P0N A;  2YLD A;  4ULV A;  2A6E F;  4E17 A;  1V4A A;  1YVI A;  1DOV A;  3C62 A;  4KNV A;  3WAQ A;  4ONS A;  3WG7 C;  4OIO F;  1BR4 A;  3G4Z A;  2W4M A;  4MVM A;  4I1O B;  2YWA A;  3ZDL A;  5F28 E;  5HSW A;  4JEB A;  2HMZ A;  2Q3T A;  4CS9 A;  5CI8 A;  1V55 C;  2CGE A;  4JTA B;  4YL3 A;  2UUI A;  5D92 A;  5COM A;  4YN0 B;  4BJ6 C;  3DWW A;  1VYI A;  3O55 A;  1Z63 A;  2XLE A;  4PFP A;  5F5F A;  3LES A;  1YA9 A;  4XPX A;  1CPQ A;  2PNO A;  3LEO A;  1L7C A;  4M63 A;  2WZG A;  3T6B A;  3DD7 A;  3E9V A;  3FXH A;  3AQC A;  4JC7 A;  3MFN A;  3TD7 A;  3N24 A;  3ZSU A;  4MND A;  2LD6 A;  1K04 A;  2XLH A;  2XS8 A;  1GGQ A;  1GQA A;  1Z23 A;  1RCP A;  3B29 A;  4BEJ A;  2O9X A;  2P1A A;  3ECS A;  5GPG B;  3RFY A;  3RF3 A;  2IYL D;  1WN0 A;  3M4C A;  1L3P A;  4GEH A;  2ZXW C;  1NLX A;  4LDQ A;  2PF4 E;  3ABK C;  1OCC C;  1QZX A;  1YLM A;  2PX3 A;  3Q6N A;  2QY9 A;  5EHH A;  4E18 A;  1CPR A;  3LUT B;  3T6J A;  2OU6 A;  3DJU B;  2YKZ A;  4RBN A;  4OIN F;  4XEV A;  1ZHZ A;  4JW1 A;  3SNH A;  4OIP F;  1SZI A;  1T9K A;  4P9F A;  4DRJ B;  2EPN A;  1NU9 C;  5L0D A;  4XWJ A;  2Y3G A;  3SP1 A;  4G7Z F;  1HY5 A;  1ST6 A;  3AG1 C;  3R2P A;  1JMW A;  2ZD9 A;  4LLE A;  1MQV A;  1V74 B;  4N6C A;  3S0X A;  1CGO A;  4NY3 A;  4OIR F;  3RQG A;  3SXZ A;  4YT4 A;  1XZP A;  2QLA A;  3SXM A;  2EIN C;  1UFB A;  4AX2 A;  5CI9 A;  5BQI A;  1S05 A;  2R7X A;  3KYJ A;  1R5I D;  3AG4 C;  2Q9C A;  5EGY A;  4KI2 A;  1HMD A;  2DYS C;  3F46 A;  1NSG B;  2Q00 A;  1IZM A;  4AE4 B;  2VCC A;  2RD9 A;  1OCR C;  3SEO A;  3NKE A;  4CSA A;  3NMI A;  4NC3 A;  3QMK A;  2VC9 A;  4JCH A;  1RKC A;  2LP4 A;  1WGW A;  2WB7 A;  5L0F A;  4Q4Z F;  3W8H A;  3CZ6 A;  3FVY A;  3JRM O;  1T01 A;  3ABL C;  5JT4 A;  3SZR A;  1TFK B;  1JR8 A;  4HFF B;  5E2Q A;  3C8G B;  3W2V A;  4F4B A;  3B0P A;  4CS8 C;  2JD3 A;  2XM4 A;  3T6G B;  4G78 A;  1I4Y A;  1T5O A;  2DB4 A;  2R25 A;  3MYI A;  4I1M A;  5E33 A;  1UG7 A;  5IY5 C;  4L6R A;  2HZ8 A;  4BPM A;  3RQE A;  3S28 A;  3DKA A;  1YDI A;  3EGD A;  1XWJ A;  4MW3 A;  1RJ9 A;  2TMV P;  4QI0 A;  1VOM A;  2PFD A;  2XL8 A;  4XLP F;  1OW7 A;  2HSB A;  2V26 A;  4GYT A;  1FFT C;  2XLV A;  2XLM A;  2EIM C;  2W4B A;  2Y3H A;  4MW8 A;  3K6B A;  4HEA J;  2R7W A;  1ORS C;  3HNJ A;  4ER9 A;  2JPU A;  4CDV A;  4JTC B;  3ZWI A;  3US6 A;  5BQH A;  5B1B C;  4YWQ A;  1OR3 A;  1O87 A;  2EPK X;  4U9D A;  4LLC A;  2NUT B;  1LI5 A;  1BZ4 A;  2EIJ C;  2KNH A;  2ICW G;  4DVZ A;  4FX5 A;  4OD4 A;  3WHN A;  4DBQ A;  2B0H A;  1OKK D;  3CQZ A;  1PD0 A;  3H2V A;  2R7Q A;  3ZQY A;  4B6I A;  4IB4 A;  1AVO B;  1H6G A;  3TUL A;  5A6A A;  2PP4 A;  2DYR C;  2QE9 A;  3TQO A;  2AP3 A;  3KH2 A;  5B1A C;  2LCH A;  5T1D B;  4D4X A;  1E83 A;  2L6G A;  3U8P A;  5COG A;  2GA0 A;  3DAG A;  1JPJ A;  5A6B D;  1V54 C;  1H7I A;  4PJN A;  5DS6 A;  3JSZ A;  4NCQ A;  5CIV A;  2VH3 A;  5KYN A;  3IPM O;  3AGT A;  4E7S A;  4YT8 A;  3U5S A;  3KPH A;  2PX0 A;  3ASN C;  4PJJ A;  1VK5 A;  4E0H A;  3ZG1 A;  5L0G A;  1A7E A;  2YLI A;  2OOC A;  1EI7 A;  1KNY A;  2KQ9 A;  2XSE A;  3DAF A;  4Z9J A;  1WOL A;  2AVK A;  2KC3 A;  3L1M A;  3MLG A;  3AG3 C;  1RMV A;  3HNK A;  3GM2 A;  3WOD F;  4EBJ A;  1Y4C A;  1HW1 A;  2HV7 A;  1BDJ B;  4JCZ A;  3HNL A;  1FMW A;  2ZXP A;  2OCC C;  1HE9 A;  2G3V A;  3U3F A;  4EHP A;  3EZI A;  3B9Q A;  2ASR A;  2NG1 A;  4CIP A;  5FCL A;  3S9O A;  1MMA A;  3FMS A;  4QI2 A;  1Z6A A;  1G4U S;  3EQL F;  3IQT A;  1WAT A;  1CGM E;  5B3I A;  4PR9 A;  2J8W A;  1A41 A;  1A0B A;  1Q0D A;  4GQH A;  1FTS A;  4W8P A;  2CCY A;  4Z9H A;  2HFI A;  3EGD B;  1RJ9 B;  2EIK C;  2R05 A;  4D4N A;  2YHS A;  1TWC A;  2CDQ A;  2VB6 A;  3NYJ A;  2YEV A;  4Q7C A;  4BG0 A;  2GFH A;  1OW8 A;  2BE5 F;  1TWA A;  1NFN A;  2D4U A;  2V3C C;  4U5G A;  3SYN A;  2BL2 A;  3JTL O;  4LER A;  1WAS A;  1ZZP A;  2MYS A;  4P6I C;  4U5H A;  2EPO A;  1C02 A;  1XZQ A;  2J46 A;  2YLG A;  3VF0 A;  3X1O A;  1H9G A;  2YL1 A;  2AU5 A;  4E0I A;  3LLI A;  2WL8 A;  3C18 A;  4HE8 D;  3JYH A;  4FES A;  3RIP A;  3KYI A;  2OJE D;  1YA7 O;  2NUT A;  3W4Y A;  5TJ5 E;  3ZQV A;  2QUP A;  3BEH A;  4P9T A;  2A69 F;  1VTM P;  3NG1 A;  1JAF A;  2Z15 A;  3RW0 A;  3C8Z A;  3EPV A;  3OEO A;  3ZC4 A;  2HJM A;  3GM3 A;  3S27 A;  3ASO C;  3LAY A;  3UMK A;  4UDV A;  2G3K A;  4J32 B;  1EQ1 A;  1M56 C;  2L9J A;  2XLO A;  4JVS A;  2XRH A;  3UMI A;  4IGG A;  1YAU O;  3ZVR A;  1E2X A;  2J7P D;  4MTG A;  4O6N A;  4Z9I A;  2IM8 A;  3I5P A;  4K7B A;  4BEM J;  4JE9 A;  4EBB A;  2Q9A A;  1OXB A;  3CAX A;  4JJG A;  4WGZ A;  4MTF A;  4DOZ A;  3LNM B;  3M15 A;  3QVY A;  3TJ6 A;  1TR2 A;  3EHN A;  2A0B A;  1KU2 A;  3DM5 A;  1SYQ A;  1OW6 A;  5AC5 A;  3EZH A;  3V7O A;  3IHU A;  3FHD A;  3RKO F;  2YL7 A;  4MQ9 F;  5JRA A;  1MMG A;  2ZPA A;  3UR3 C;  3HJC A;  3JT1 A;  2IXP A;  2C03 A;  1LKX A;  1ZHW A;  1AEP A;  3UGO A;  1D1C A;  1T6Q A;  3KKB A;  2L6H A;  3RQF A;  3K1I C;  3R7C A;  3JRT A;  4WAB A;  4EUK B;  1ZU4 A;  5BQG A;  4N4W A;  2R7O A;  5E3A A;  2G62 A;  2B0J A;  3GOD A;  4CSA C;  1OQC A;  2HKV A;  3PMR A;  1E84 A;  1Q0F A;  1TFO B;  4U5E E;  2VAS A;  5DS4 A;  1LI7 A;  4LDK A;  1D1B A;  1WWP A;  3ATP A;  3NRH A;  1ZU5 A;  1FAP B;  4YL1 A;  3EHM A;  2GAQ A;  2L81 A;  5JS5 A;  3HLZ A;  2IXM A;  1M2O A;  3LS0 A;  1J8Y F;  4I3M A;  3ABM C;  1A7V A;  2Q4F A;  2CNW A;  2LK4 A;  1VMA A;  4XPY A;  4XQ1 A;  2Q7R A;  5JUA A;  5L0J A;  2Y69 C;  1EKY A;  1K40 A;  1VYK A;  3J06 A;  3M1C B;  1VLT A;  4XTK A;  3GWL A;  1YYJ A;  4HFK B;  3TOM A;  1JRA A;  4YK5 A;  3GWN A;  3TJ5 A;  2I8B A;  3C7J A;  3N0T A;  1R4T A;  1QVX A;  3K1I A;  3UNG C;  4PJL A;  2R7S A;  3B71 A;  4KC9 A;  4CDY A;  1SR2 A;  2H7O A;  3K66 A;  2P6V A;  2HV6 A;  1LS4 A;  4WGY A;  1LM3 B;  3AQB A;  4A2N B;  4DVY P;  3G50 A;  1T6U A;  4CBE A;  2RSE B;  2WVQ A;  3LLK A;  3NMJ A;  5HV9 A;  3EJN A;  2W9Y A;  3HTK C;  1ZYR F;  4EIY A;  1N1C A;  1NZE A;  3W2W A;  4FAP B;  1LS1 A;  2HSQ A;  3MBG A;  3FAP B;  2X51 A;  3ZIB A;  2XS1 A;  3NDB B;  1RKE A;  5A6J A;  4C7O A;  4CS7 A;  3AG2 C;  4W8K A;  4AL1 A;  1BR1 A;  3PDM P;  2BC5 A;  3MYF A;  1MMN A;  4OIQ F;  5L3Q A;  1OCO C;  2R7U A;  4A4A A;  5DQT A;  3L34 A;  4E7Z A;  3C8G D;  4U5C E;  1EA8 A;  3T4R A;  3C63 A;  2YZS A;  3TK0 A;  5B3S C;  3FAJ A;  5DQZ A;  2CW0 F;  2OQM A;  1IW7 F;  1PCX A;  3O6X A;  4BJ1 A;  1D0X A;  3NYL A;  1C17 M;  4MVZ A;  3HNI A;  3IEE A;  4X0R A;  1TWG A;  3GEH A;  4IAR A;  1O5H A;  2AWY A;  3KMI A;  4G7H F;  4PAC A;  2A68 F;  2D5R B;  3SXY A;  2CYD A;  2IBF A;  2KYH A;  4LDR A;  3U3B A;  3GOR A;  1Z3I X;  4KNW A;  1HW2 A;  2UUH A;  3EGX A;  5KYU A;  5L0I A;  3DZA A;  3S90 A;  2H8A A;  4K1O A;  4G7O F;  1W2W A;  4YJW A;  2L6F A;  2OKU A;  5F5H A;  2P7V A;  3IQ6 A;  3W8I A;  3LNR A;  3S84 A;  2W45 A;  2YVK A;  1KTM A;  2EPM X;  1JPN A;  1YZA A;  4K0D A;  1YZC A;  3FOO A;  1M57 C;  1OKK A;  5KYY A;  2I15 A;  1NG1 A;  4C3D A;  2A1D D;  4O7G A;  1Q0K A;  4WJ0 A;  3V5X A;  3POV A;  4DBR A;  2R03 A;  2XM0 A;  4R32 A;  4I44 A;  1H9T A;  1CGN A;  3DM9 B;  2R9R B;  4C3B A;  1MND A;  5JSL A;  3LS1 A;  3IQ5 A;  4CJG A;  4BJ5 C;  1QLE C;  3PCV A;  2OG2 A;  2XL6 A;  4NTB A;  3LJB A;  3SXK A;  2ETS A;  1AUE A;  5A69 A;  2IXO A;  5A6B A;  3H2U A;  4YL0 A;  3U2M A;  3CEX A;  3B0V C;  1ZW2 A;  4NQF A;  2J9B A;  3JSE O;  2Y39 A;  3EFO A;  3U9J A;  4CIH A;  2IOQ A;  5L3V A;  3PHF 2;  3U8V A;  2DI3 A;  1MNE A;  3IQC A;  4O6Y A;  3E70 C;  3U2L A;  4MVS A;  4JIO A;  2J9V A;  3UMH A;  1RKE B;  2HJ3 A;  4IJJ A;  1G5Z A;  2WVO A;  2XXA A;  4C7O B;  5JVE A;  5K0I A;  1PD1 A;  1J8M F;  3A11 A;  3ZTZ A;  2J0X A;  4BJ5 A;  4JUR I;  4MTO A;  4H4K C;  5KYW B;  2PBE A;  2LQG A;  2LFF A;  2NUP A;  4IAO A;  1G4W R;  1S7Z A;  1WTY A;  4U5B E;  3DXJ F;  3M79 A;  3U9M A;  3A9C A;  1D1A A;  3VAY A;  4XEK A;  2X0C A;  5T3W A;  3FDQ A;  3GEE A;  3DI5 A;  2YL3 A;  3RH3 A;  5KYX A;  2CNW D;  1QPU A;  1BR2 A;  3BRJ A;  3TOL A;  3GAN A;  3QW0 A;  3CSK A;  1M2V A;  1U89 A;  3I5Q A;  4J7T A;  4MVO A;  4QDL A;  4BJT A;  3O39 A;  4EBK A;  2R7R A;  2XLD A;  3JZ0 A;  1SMY F;  3OWT A;  1SF8 A;  3VYW A;  3AOU A;  4DXW A;  2J45 A;  1C03 A;  2L7A A;  4JKV A;  3L8J A;  1TWH A;  2OEX A;  3EGX B;  5KYU B;  1LPE A;  3N2Z B;  1TQG A;  3K1H A;  4IRU A;  2R7V A;  3RVY A;  1HMO A;  5E3C A;  4AK9 A;  2XLW A;  3K7D A;  4CX9 A;  1FMV A;  1BBH A;  1FFH A;  3AGU A;  3NMK A;  2KSF A;  4BJ6 A;  1FNT c;  2FAP B;  1YYX A;  2LSE A;  4DRH B;  5KYY B;  1Q0M A;  1YAR O;  3GM1 A;  1QKR A;  2LIG A;  3GEI A;  3K33 A;  5JP7 A;  5DLJ A;  2VCA A;  2FFH A;  4YT2 A;  1LVK A;  1Y6D A;  1ZVZ A;  5L0C A;  2KK1 A;  3QTH A;  4JRZ A;  1GM5 A;  2MWQ A;  3DE9 A;  1VB5 A;  4RD9 A;  4JTD B;  1D0Z A;  1M6T A;  5DS5 A;  3Q7L A;  4J30 B;  5DVW A;  1LE4 A;  4N6H A;  4OD5 A;  5FZT A;  3T9O A;  3QW1 A;  4DJ9 A;  4EKW A;  2R7T A;  3JYY A;  1PV3 A;  3EG9 A;  4EWC A;  1YJG A;  2J7P A;  1OR2 A;  2YL0 A;  1E86 A;  1QQ3 A;  4H54 A;  2A6H F;  2EPL X;  2H7V C;  3L8I A;  2VCB A;  3RVZ A;  2WVN A;  2C04 A;  1ORJ A;  3EFO B;  2HUJ A;  5JLI A;  3NKD A;  3AJM A;  1E85 A;  4KBL A;  1GS9 A;  2R02 A;  3VRC A;  2JX0 A;  1NU7 D;  1T6I A;  1QSP A;  3MX3 A;  4YT5 A;  4CJO A;  2IXN A;  1DOW A;  2NSG A;  1ORY A;  2M64 A;  1O3U A;  2QTV A;  2ZXR A;  3HKK A;  4IWB A;  4PJM A;  3RYL A;  2XXA B;  256B A;  4U5D E;  1LIH A;  2P61 A;  4CDA A;  1VLS A;  4ANJ A;  2Q9B A;  3OA1 A;  2WZF A;  3EH2 A;  3I4U A;  2EIL C;  3ZTM A;  2NUP B;  1U0B B;  5AC4 A;  5KYW A;  1OCZ C;  3G4X A;  4PK4 A;  1Z7Q c;  2OJQ A;  5COF A;  5L0H A;  3H65 A;  4MVR A;  5KYX B;  3Q6M A;  4G0H A;  4CS8 A;  1FR0 A;  3QVZ A;  4N06 A;  1U6H A;  2DGJ A;  1M2V B;  2F22 A;  2HS5 A;  3KL4 A;  1HE1 A;  2H7B A;  4FWV A;  1TKN A;  4JZA A;  2E87 A;  4AL0 A;  3UGP A;  4Q5S F;  1ZHX A;  2XL4 A;  1K05 A;  2Y3D A;  3QZC A;  2QNL A;  4U9E A;  4ULW A;  3V5Z A;  3X2Q C;  2M4E A;  3Q7G A;  2NSF A;  4J7Y A;  4JEA A;  3ITF A;  4MS2 A;  4DRI B;  4O79 A;  5AGF A;  3DJN B;  3NYM A;  1Q0G A;  4C3E A;  4NTF A;  2ZXO A;  1I5N A;  2KJG A;  4MVU A;  3S29 A;  3DMD A;  1RXQ A; 
#chains in the Genus database with same CATH homology
 4DXW A;  4MVS A;  4MVR A;  3RVZ A;  3LUT B;  4MTG A;  4MVM A;  3RVY A;  2R9R B;  4MVZ A;  4MTO A;  4MTF A;  3LNM B;  4JTA B;  5EK0 A;  4MW3 A;  2KYH A;  4MS2 A;  4JTD B;  4MVQ A;  4MW8 A;  1ORS C;  3RW0 A;  4EKW A;  4MVU A;  4MVO A;  4JTC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...