1ORSC

X-ray structure of the kvap potassium channel voltage sensor in complex with an fab
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
DVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIILWADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKFLSAIADAADKLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 33H1 Fab light chain
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
total genus 53
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 1orsC00
4MVUA 2KYHA 4MTOA 1ORSC 4JTDB 4EKWA 4MTGA 4MS2A 4DXWA 4JTAB 3RVYA 4MVSA 4MTFA 4MVZA 4MVMA 4MW3A 4MVOA 4MVRA 3RVZA 3LNMB 5EK0A 2R9RB 3LUTB 3RW0A 4MVQA 4JTCB 4MW8A
chains in the Genus database with same CATH superfamily
2W45A 1Q0MA 2NUTB 4XLNF 1OXKA 1O5HA 1A7VA 4PJLA 3O55A 1T6UA 4LERA 1NBBA 1WASA 1UFBA 1LE4A 2A6HF 5DQTA 2YLIA 5KYYB 4JTDB 3SP1A 3T6BA 2R7WA 2L6GA 2QTVA 1FR0A 1HMDA 1UG7A 2VCAA 2YKZA 1B68A 1GGQA 1HW2A 4U5GA 3DE9A 2BC5A 2E87A 4MVMA 2XXAB 2Q9AA 3W8HA 4JZAA 3BEHA 3IEEA 5E3CA 4OIPF 2NSFA 1NG1A 3NKEA 3ASNC 1YZCA 3U5SA 4OIRF 1DOWA 2LD6A 2Q3TA 3EGXB 3G50A 2A68F 2WVQA 4BJTA 1NZEA 3UGPA 3EH2A 3QVYA 3S28A 2LIGA 5L0FA 3MYFA 4E0IA 1OKKA 3ABKC 3HNLA 4AK9A 3B0PA 5HV9A 1V4AA 1YYXA 3IQCA 1A0BA 1YYJA 2HKVA 2WL8A 1T01A 3W2WA 3S0XA 2TMVP 1MNEA 2D4UA 2YL1A 4O79A 2IXMA 2P0NA 3JZ0A 1MNDA 4MTGA 4NC3A 1BR2A 3QW1A 4PACA 5CI9A 2ETSA 1E85A 5K0IA 3NYJA 5E33A 4O6YA 2HFIA 4Z9IA 5JP7A 3VAYA 5AC4A 1JPNA 2H7BA 2KQ9A 2JD3A 2NPUA 2VH3A 3HJCA 4U9DA 4U5HA 4XWJA 3RH3A 3OWTA 1TQGA 2BL2A 3C62A 4HEAJ 1WTYA 2DYRC 2CGEA 3C63A 2J7PA 4GYTA 5IY5C 3ABMC 3EH1A 2A1DD 1RMVA 1G4US 1Q0KA 3HNIA 3WODF 2VCCA 3AG3C 4BEMJ 2D5RB 2VASA 2ZPAA 3SXMA 3HKKA 4CS8A 3RFYA 4MVQA 4IRUA 3ZTZA 1MMAA 4E7ZA 5FCLA 3U9JA 3L8IA 2OG2A 3U2LA 4U5FE 2PP4A 4BJ5A 2LFFA 2CNWD 3BRJA 1WOLA 4EIYA 2KW3C 4KI2A 4MS2A 4JEAA 1Z5ZA 4IARA 2XL8A 2W9YA 1ZW2A 2EPMX 3I5QA 2YVKA 4J32B 5AGFA 3TD7A 4H54A 4J7YA 2YZSA 5KYXB 1Z63A 5JRAA 2J0XA 2P6VA 3AGTA 4MQ9F 4MVRA 2L6FA 4ZLDA 1AUEA 1LS4A 3SXYA 2YLGA 3EGDB 2YQYA 3H65A 5B1BC 3WAQA 3ABLC 1OCZC 1YAUO 2VB6A 4K7BA 2YEVA 3DJUB 3RQGA 1YARO 1YLMA 2OCCC 3PHF2 3HTKC 4XPWA 1KNYA 1R4TA 2PX3A 4KNVA 2J45A 1O87A 4WGYA 3EG9B 4YT4A 3C8GA 4RD9A 2QLAA 3W2VA 4CDVA 4D4XA 1OR3A 5D91A 2OEVA 5FZTA 4DXWA 5JSLA 4CIHA 2AWYA 3Q6NA 2HJ3A 1ZHTA 4MVSA 4MTFA 3GM2A 1Q0DA 1M57C 1APCA 4U5DE 4U9EA 1KTMA 3LLIA 3KKBA 2HMQA 2EPKX 2PFDA 2F22A 5KYUA 1CGNA 1W2WA 4I44A 2J9WA 3U3FA 3V7OA 4XEVA 2YL7A 4NQFA 3TOLA 1FFTC 1N1CA 3V5YA 1CPRA 3LS1A 3EFOB 2ZD9A 4AL0A 4C3DA 5DS6A 3AOUA 5E3AA 1VLTA 4C7OB 3FOOA 3DWWA 3LEOA 3AG4C 2OEXA 5T3TA 3AGUA 3DZAA 1FMWA 2Q4FA 3N24A 2ZXPA 2YWAA 5E2QA 1AVOB 3QVZA 4IB4A 3MFNA 4JVSA 2Y39A 3GWNA 3WHNA 2KJGA 3ZVRA 4C3EA 4DVYP 5B3IA 4BJ6A 4G0HA 4YN0B 1ZHXA 2L81A 2B0JA 1ZU5A 4PR9A 2R25A 3DD7A 2HSQA 1MMDA 3Q7LA 4G78A 3DE8A 1TWGA 2XLWA 4MVOA 5A6JA 1ZVZA 3F47A 3KL4A 1V55C 2YL0A 3G4XA 1FMVA 1LIHA 3M1CB 3US6A 1VMAA 3NRHA 4JW1A 4E7SA 2W4BA 1QSPA 1VYKA 2WZLA 3ATPA 4G7ZF 4DRHB 1C17M 5JS5A 2R7VA 2IM8A 1BR4A 3HLZA 3O39A 1ZZPA 4L6RA 4YT2A 5L0HA 2G62A 2GWWA 5L0IA 3AG1C 3LAYA 2DYSC 2A69F 3KMIA 4W8KA 3TQOA 1YA9A 2Y3HA 2NUPB 4ONSA 3F46A 4JIOA 2HSBA 3LLKA 1QKRA 3H2VA 4U5CE 1H6GA 2MHRA 3KPHA 2FGYA 1HY5A 3DKAA 3GM3A 1LM3B 2EPLX 3NG1A 1XZPA 3RYLA 4OINF 2HUJA 2MYSA 3TULA 1BZ4A 5BQGA 4CS9A 3AJMA 3LNMB 1T6QA 4LDKA 1D1BA 3MYIA 1OW8A 4XLPF 1WWPA 5AC5A 3QZCA 2DB4A 4J30B 1NU7D 3GEHA 2PNOA 3ZIBA 2OOCA 3SXZA 4CDAA 1M2VB 2W4MA 1T9KA 2L6HA 2O9XA 3IHUA 2R7TA 5A6KA 4QI2A 4Q5SF 4IGGA 4GEHA 3QW0A 1YZAA 3KYJA 5COGA 2NUTA 3I4UA 3TJ5A 2C04A 4R32A 5DVWA 2WB7A 4EUKB 1ORJA 1H9GA 1LI5A 2QY9A 5A69A 3DAGA 2YRFA 3SXKA 2Q7RA 4E17A 4YK5A 4W8PA 4KBLA 5KYWB 2R7RA 4RDAA 3IQ5A 2XLMA 2H8AA 3CQZA 3ZQYA 3A9CA 4G7HF 1H7IA 1OW6A 2AP3A 2IXOA 3KYIA 3NMJA 1ZHWA 1QZXA 2NG1A 3MLGA 2KK1A 4KC9A 4RBNA 1SR2A 4XQ1A 3JSZA 2XXAA 2OU6A 1BDJB 5A6BD 3B0VC 2VC9A 2XSEA 2XS1A 4DVZA 1G5ZA 3E9VA 2J9BA 2M64A 3FAPB 3K1HA 3RF3A 4CIPA 3TK0A 1WN0A 2CW0F 4E18A 3EGXA 1VTMP 1SZIA 2LSEA 1V74B 2YHSA 3ZQVA 2OQMA 1E84A 4Q7CA 4UDVA 2JPUA 3EQLF 4N4WA 1I5NA 1NFOA 3IPMO 3ASOC 1TWCA 4N06A 4EWCA 1LKXA 1ZW3A 3RQEA 4FAPB 1JR8A 1J8MF 3U8PA 3FOPA 1HE9A 3GEEA 4JCZA 3NYLA 4K1OA 3EZHA 2XM0A 2XLDA 1WGWA 3WG7C 3DI5A 3ZSUA 3LJBA 1NFNA 5A6AA 3A11A 3DJNB 3VRCA 4CSAC 2WVOA 1BR1A 4IAQA 1Z7Qc 1E86A 1U89A 2XLEA 4QI0A 3K7DA 3FHDA 3JRMO 1ZYRF 3B9QA 3G4ZA 2RSEB 3RW0A 2X51A 2J46A 1OCCC 3DM5A 2GAQA 2P1AA 4WGZA 1CGME 3HNKA 2R03A 4MNDA 2C03A 2EINC 1J8YF 1LI7A 2GA0A 4JC7A 2LFDA 4NCQA 3UMKA 4OD5A 2A6EF 1PV3A 1RKEB 4DRJB 4JTAB 1VOMA 4O6NA 5KYUB 2JX0A 4OD4A 4N6CA 4EHPA 5D92A 4PFOA 5COFA 1D1AA 3JYYA 3TOMA 3UGOA 3W8IA 4YL1A 5CI8A 1R5ID 3S90A 1IW7F 4DJ9A 1GM5A 2I8BA 4M63A 1I4YA 1G4WR 1RJ9B 4CS7A 1TWHA 3ZC4A 3M4BA 4O6MA 2I15A 4JJFA 4CBEA 5KYXA 1YJGA 3ZTMA 4AE4B 5DS5A 2G3KA 2J0WA 3C8ZA 3QMKA 4GQHA 2Y3DA 4XPYA 1ZU4A 1C03A 2OKUA 3Q6MA 2HV6A 1RKCA 2IXPA 2AVKA 2KNHA 4CSAA 4AX2A 3X2QC 3B71A 1OCRC 2LK4A 1D0YA 2XLVA 3EG9A 3AQBA 1EKYA 4ZLCA 2H7OA 4JEBA 1TKNA 1LVKA 2ICWG 2OJQA 2A0UA 3VM6A 5BQHA 2XS8A 4HE8D 4HFFB 2KC3A 5JT4A 4JURI 3RQFA 3Q7GA 4LDRA 4I3MA 4P6IC 4JJGA 4FWVA 2XL6A 2LCHA 4PJMA 3UMIA 2EPNA 2KSFA 3LUTB 1OXBA 3M4CA 4JRZA 2X0CA 1JOGA 2DGJA 3L0IA 3SYNA 2WVNA 3M15A 1ST6A 2XLHA 3U0CA 1E83A 4E0HA 1VK5A 1QQ3A 3CSKA 4C7OA 2IBFA 3R7CA 1FFHA 4YT8A 2R02A 3U3BA 4Z9JA 4WJ0A 3ECSA 1ZHZA 4YWQA 3RVYA 3ZWIA 2QNLA 4CDYA 1JRAA 2CCYA 1S7ZA 5JVEA 2EILC 1RCPA 2L9JA 2J8WA 4DBQA 2QE9A 2V3CC 2NSGA 3CAXA 3M79A 4OIOF 1LS1A 1CGOA 3TJ6A 5L0GA 3K6BA 1Z23A 1ZHYA 2EIKC 1TR2A 3L1MA 3FDQA 2HJMA 3DXJF 4X0RA 4ULWA 1EA8A 5F5HA 4XEKA 4Z9HA 4DOZA 1SF8A 2HS5A 4JTCB 4KNWA 2HMZA 2FAPB 4C3BA 4CS8C 3EZIA 1RXQA 3N0TA 5T1DB 2R05A 2RD9A 1D0ZA 2IOQA 5L0DA 1OKKD 2VCBA 4DRIB 5L0CA 2XLOA 2BE5F 2IXNA 1I4ZA 3EPVA 4PJNA 2PBEA 3U9MA 3JYHA 2CDQA 1NLXA 1NU9C 1OW7A 2EIJC 4LDQA 4OIQF 3JCUQ 4JKVA 3S29A 5F5FA 2CYDA 4U5BE 4G7OF 2HZ8A 2R7UA 4K0DA 1C02A 2NUPA 1GS9A 1G8XA 1HMOA 1L7CA 1O3UA 1OR2A 3NMIA 4QDLA 5CIVA 4MW3A 5KYYA 2IYLD 3DM9B 3K33A 1EI7A 1QVXA 2MWQA 1VYIA 3L34A 3MX3A 1Z3IX 3ZG1A 4BJ5C 3O6XA 3GODA 5L3QA 2J7PD 1DOVA 1Q0GA 3NKDA 1HW1A 3C7JA 5COMA 2V26A 2WZFA 1Y4CA 3T9OA 4U5EE 1FTSA 4XPXA 3RKOF 1Z6AA 4EBJA 256BA 3ZDLA 3JT1A 4IWBA 5DLJA 3VYWA 5L0JA 5DS4A 3SZRA 3S84A 1U6HA 4WABA 5EGYA 1YDIA 1K40A 1M2VA 4IAOA 2GFHA 4YT5A 2YL3A 2OJED 4P9FA 4D4NA 1Q0FA 4H4KC 4ULVA 3E70C 2ZXOA 3FAJA 5BQIA 3AQCA 1CPQA 4ER9A 3S9OA 1GQAA 1PCXA 3K1IC 2L7AA 1KU2A 1L3PA 1T5OA 4BJ1A 3T4RA 3EHMA 3HNJA 1Y6DA 1WATA 3W4YA 5A6BA 3K66A 5KYWA 2QUPA 1SYQA 2R9RB 2XM4A 4CJOA 2R7XA 4XEFA 5T3WA 1JAFA 4PK4A 4CJGA 1XWJA 1QLEC 1PD1A 3FVYA 3SNHA 3VF0A 1JMWA 3C8GB 3GEIA 3B29A 1QPUA 2KYHA 3OEOA 4JCHA 3GORA 4MW8A 2J9UA 4YL0A 3RIPA 5GPGB 3S27A 3PDMP 1ORSC 3GWLA 3KH2A 4Q4ZF 2CNWA 2Q9CA 4NTBA 3T6GB 1EQ1A 4A2NB 2GDCA 3C8GD 2Q9BA 3J06A 4DBRA 2Y69C 1K04A 3R2PA 4YJWA 2UUHA 3UMHA 3NDBB 3X1OA 1V54C 1A7EA 3V5ZA 2Y3BA 3PMRA 4I1MA 3CZ6A 3T6JA 3PCVA 1D1CA 5EK0A 5KYNA 1IZMA 1E2XA 1JPJA 2R7OA 4ANJA 5JUAA 5DQZA 4BJ6C 5B3SC 1TWAA 4IJJA 3B0UX 3IQTA 5B1AC 4YL3A 1BBHA 2ZXRA 3ITFA 3K1IA 4MVUA 5HSWA 3EGDA 4N6HA 2XRHA 1FNTc 2DI3A 4I1OB 1OCOC 1YVIA 1AEPA 1OQCA 1LE2A 1SMYF 3NYMA 4LLCA 4BPMA 1H9TA 1U0BB 2R7SA 3L8JA 2P61A 2YLDA 2Z15A 3N2ZB 3CEXA 3EHNA 3GM1A 4FESA 3FXHA 4HFKB 2EPOA 2H7VC 3MBGA 3JSEO 3LESA 4LACB 2PF4E 3AG2C 4LLEA 4O7GA 1RKEA 1K05A 4P9TA 1MMGA 3GANA 3OA1A 5JLIA 1M6TA 2UUIA 3JTLO 3LNRA 4J7TA 1VLSA 1YA7O 4AL1A 3EJNA 2R7QA 1MQVA 2XL4A 2LQGA 3LEVA 3QTHA 4NTAA 5TJ5E 4EBKA 1M2OA 4PFPA 4A4AA 3POVA 1RJ9A 2HV7A 5F28E 2FFHA 1F1MA 3O10A 2EIMC 2J9VA 3JRTA 4JE9A 4EBBA 1D0XA 2Y3GA 3NMKA 3C18A 1A41A 4BG0A 1LPEA 4MTOA 3EFOA 3U2MA 4CS9C 4AE4A 4FX5A 4NY3A 4PJJA 4CX9A 2M4EA 2ZXWC 3FMSA 3DMDA 2AWCA 4EKWA 1PD0A 3LS0A 3SEOA 2WZGA 2ASRA 2A0BA 1HE1A 3U8VA 3H2UA 1MMNA 2B0HA 4MVZA 2P7VA 1FAPB 1ORYA 2Q00A 1M56C 2KGOA 3DAFA 3IQ6A 4XTKA 1S05A 4F4BA 4B6IA 3RVZA 4NTFA 3UR3C 5BUOA 1VB5A 5EHHA 1A7DA 2PX0A 1TFKB 2G3VA 5L3VA 1T6IA 3UNGC 1XZQA 3V5XA 1NSGB 4BEJA 1TFOB 2LP4A 2AU5A 3I5PA
chains in the Genus database with same CATH topology
4MVUA 2KYHA 4MTOA 1ORSC 4JTDB 4EKWA 4MTGA 4MS2A 4DXWA 4JTAB 3RVYA 4MVSA 4MTFA 4MVZA 4MVMA 4MW3A 4MVOA 4MVRA 3RVZA 3LNMB 5EK0A 2R9RB 3LUTB 3RW0A 4MVQA 4JTCB 4MW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVU A;  2KYH A;  4MTO A;  1ORS C;  4JTD B;  4EKW A;  4MTG A;  4MS2 A;  4DXW A;  4JTA B;  3RVY A;  4MVS A;  4MTF A;  4MVZ A;  4MVM A;  4MW3 A;  4MVO A;  4MVR A;  3RVZ A;  3LNM B;  5EK0 A;  2R9R B;  3LUT B;  3RW0 A;  4MVQ A;  4JTC B;  4MW8 A; 
#chains in the Genus database with same CATH topology
 2W45 A;  1Q0M A;  2NUT B;  4XLN F;  1OXK A;  1O5H A;  1A7V A;  4PJL A;  3O55 A;  1T6U A;  4LER A;  1NBB A;  1WAS A;  1UFB A;  1LE4 A;  2A6H F;  5DQT A;  2YLI A;  5KYY B;  4JTD B;  3SP1 A;  3T6B A;  2R7W A;  2L6G A;  2QTV A;  1FR0 A;  1HMD A;  1UG7 A;  2VCA A;  2YKZ A;  1B68 A;  1GGQ A;  1HW2 A;  4U5G A;  3DE9 A;  2BC5 A;  2E87 A;  4MVM A;  2XXA B;  2Q9A A;  3W8H A;  4JZA A;  3BEH A;  3IEE A;  5E3C A;  4OIP F;  2NSF A;  1NG1 A;  3NKE A;  3ASN C;  1YZC A;  3U5S A;  4OIR F;  1DOW A;  2LD6 A;  2Q3T A;  3EGX B;  3G50 A;  2A68 F;  2WVQ A;  4BJT A;  1NZE A;  3UGP A;  3EH2 A;  3QVY A;  3S28 A;  2LIG A;  5L0F A;  3MYF A;  4E0I A;  1OKK A;  3ABK C;  3HNL A;  4AK9 A;  3B0P A;  5HV9 A;  1V4A A;  1YYX A;  3IQC A;  1A0B A;  1YYJ A;  2HKV A;  2WL8 A;  1T01 A;  3W2W A;  3S0X A;  2TMV P;  1MNE A;  2D4U A;  2YL1 A;  4O79 A;  2IXM A;  2P0N A;  3JZ0 A;  1MND A;  4MTG A;  4NC3 A;  1BR2 A;  3QW1 A;  4PAC A;  5CI9 A;  2ETS A;  1E85 A;  5K0I A;  3NYJ A;  5E33 A;  4O6Y A;  2HFI A;  4Z9I A;  5JP7 A;  3VAY A;  5AC4 A;  1JPN A;  2H7B A;  2KQ9 A;  2JD3 A;  2NPU A;  2VH3 A;  3HJC A;  4U9D A;  4U5H A;  4XWJ A;  3RH3 A;  3OWT A;  1TQG A;  2BL2 A;  3C62 A;  4HEA J;  1WTY A;  2DYR C;  2CGE A;  3C63 A;  2J7P A;  4GYT A;  5IY5 C;  3ABM C;  3EH1 A;  2A1D D;  1RMV A;  1G4U S;  1Q0K A;  3HNI A;  3WOD F;  2VCC A;  3AG3 C;  4BEM J;  2D5R B;  2VAS A;  2ZPA A;  3SXM A;  3HKK A;  4CS8 A;  3RFY A;  4MVQ A;  4IRU A;  3ZTZ A;  1MMA A;  4E7Z A;  5FCL A;  3U9J A;  3L8I A;  2OG2 A;  3U2L A;  4U5F E;  2PP4 A;  4BJ5 A;  2LFF A;  2CNW D;  3BRJ A;  1WOL A;  4EIY A;  2KW3 C;  4KI2 A;  4MS2 A;  4JEA A;  1Z5Z A;  4IAR A;  2XL8 A;  2W9Y A;  1ZW2 A;  2EPM X;  3I5Q A;  2YVK A;  4J32 B;  5AGF A;  3TD7 A;  4H54 A;  4J7Y A;  2YZS A;  5KYX B;  1Z63 A;  5JRA A;  2J0X A;  2P6V A;  3AGT A;  4MQ9 F;  4MVR A;  2L6F A;  4ZLD A;  1AUE A;  1LS4 A;  3SXY A;  2YLG A;  3EGD B;  2YQY A;  3H65 A;  5B1B C;  3WAQ A;  3ABL C;  1OCZ C;  1YAU O;  2VB6 A;  4K7B A;  2YEV A;  3DJU B;  3RQG A;  1YAR O;  1YLM A;  2OCC C;  3PHF 2;  3HTK C;  4XPW A;  1KNY A;  1R4T A;  2PX3 A;  4KNV A;  2J45 A;  1O87 A;  4WGY A;  3EG9 B;  4YT4 A;  3C8G A;  4RD9 A;  2QLA A;  3W2V A;  4CDV A;  4D4X A;  1OR3 A;  5D91 A;  2OEV A;  5FZT A;  4DXW A;  5JSL A;  4CIH A;  2AWY A;  3Q6N A;  2HJ3 A;  1ZHT A;  4MVS A;  4MTF A;  3GM2 A;  1Q0D A;  1M57 C;  1APC A;  4U5D E;  4U9E A;  1KTM A;  3LLI A;  3KKB A;  2HMQ A;  2EPK X;  2PFD A;  2F22 A;  5KYU A;  1CGN A;  1W2W A;  4I44 A;  2J9W A;  3U3F A;  3V7O A;  4XEV A;  2YL7 A;  4NQF A;  3TOL A;  1FFT C;  1N1C A;  3V5Y A;  1CPR A;  3LS1 A;  3EFO B;  2ZD9 A;  4AL0 A;  4C3D A;  5DS6 A;  3AOU A;  5E3A A;  1VLT A;  4C7O B;  3FOO A;  3DWW A;  3LEO A;  3AG4 C;  2OEX A;  5T3T A;  3AGU A;  3DZA A;  1FMW A;  2Q4F A;  3N24 A;  2ZXP A;  2YWA A;  5E2Q A;  1AVO B;  3QVZ A;  4IB4 A;  3MFN A;  4JVS A;  2Y39 A;  3GWN A;  3WHN A;  2KJG A;  3ZVR A;  4C3E A;  4DVY P;  5B3I A;  4BJ6 A;  4G0H A;  4YN0 B;  1ZHX A;  2L81 A;  2B0J A;  1ZU5 A;  4PR9 A;  2R25 A;  3DD7 A;  2HSQ A;  1MMD A;  3Q7L A;  4G78 A;  3DE8 A;  1TWG A;  2XLW A;  4MVO A;  5A6J A;  1ZVZ A;  3F47 A;  3KL4 A;  1V55 C;  2YL0 A;  3G4X A;  1FMV A;  1LIH A;  3M1C B;  3US6 A;  1VMA A;  3NRH A;  4JW1 A;  4E7S A;  2W4B A;  1QSP A;  1VYK A;  2WZL A;  3ATP A;  4G7Z F;  4DRH B;  1C17 M;  5JS5 A;  2R7V A;  2IM8 A;  1BR4 A;  3HLZ A;  3O39 A;  1ZZP A;  4L6R A;  4YT2 A;  5L0H A;  2G62 A;  2GWW A;  5L0I A;  3AG1 C;  3LAY A;  2DYS C;  2A69 F;  3KMI A;  4W8K A;  3TQO A;  1YA9 A;  2Y3H A;  2NUP B;  4ONS A;  3F46 A;  4JIO A;  2HSB A;  3LLK A;  1QKR A;  3H2V A;  4U5C E;  1H6G A;  2MHR A;  3KPH A;  2FGY A;  1HY5 A;  3DKA A;  3GM3 A;  1LM3 B;  2EPL X;  3NG1 A;  1XZP A;  3RYL A;  4OIN F;  2HUJ A;  2MYS A;  3TUL A;  1BZ4 A;  5BQG A;  4CS9 A;  3AJM A;  3LNM B;  1T6Q A;  4LDK A;  1D1B A;  3MYI A;  1OW8 A;  4XLP F;  1WWP A;  5AC5 A;  3QZC A;  2DB4 A;  4J30 B;  1NU7 D;  3GEH A;  2PNO A;  3ZIB A;  2OOC A;  3SXZ A;  4CDA A;  1M2V B;  2W4M A;  1T9K A;  2L6H A;  2O9X A;  3IHU A;  2R7T A;  5A6K A;  4QI2 A;  4Q5S F;  4IGG A;  4GEH A;  3QW0 A;  1YZA A;  3KYJ A;  5COG A;  2NUT A;  3I4U A;  3TJ5 A;  2C04 A;  4R32 A;  5DVW A;  2WB7 A;  4EUK B;  1ORJ A;  1H9G A;  1LI5 A;  2QY9 A;  5A69 A;  3DAG A;  2YRF A;  3SXK A;  2Q7R A;  4E17 A;  4YK5 A;  4W8P A;  4KBL A;  5KYW B;  2R7R A;  4RDA A;  3IQ5 A;  2XLM A;  2H8A A;  3CQZ A;  3ZQY A;  3A9C A;  4G7H F;  1H7I A;  1OW6 A;  2AP3 A;  2IXO A;  3KYI A;  3NMJ A;  1ZHW A;  1QZX A;  2NG1 A;  3MLG A;  2KK1 A;  4KC9 A;  4RBN A;  1SR2 A;  4XQ1 A;  3JSZ A;  2XXA A;  2OU6 A;  1BDJ B;  5A6B D;  3B0V C;  2VC9 A;  2XSE A;  2XS1 A;  4DVZ A;  1G5Z A;  3E9V A;  2J9B A;  2M64 A;  3FAP B;  3K1H A;  3RF3 A;  4CIP A;  3TK0 A;  1WN0 A;  2CW0 F;  4E18 A;  3EGX A;  1VTM P;  1SZI A;  2LSE A;  1V74 B;  2YHS A;  3ZQV A;  2OQM A;  1E84 A;  4Q7C A;  4UDV A;  2JPU A;  3EQL F;  4N4W A;  1I5N A;  1NFO A;  3IPM O;  3ASO C;  1TWC A;  4N06 A;  4EWC A;  1LKX A;  1ZW3 A;  3RQE A;  4FAP B;  1JR8 A;  1J8M F;  3U8P A;  3FOP A;  1HE9 A;  3GEE A;  4JCZ A;  3NYL A;  4K1O A;  3EZH A;  2XM0 A;  2XLD A;  1WGW A;  3WG7 C;  3DI5 A;  3ZSU A;  3LJB A;  1NFN A;  5A6A A;  3A11 A;  3DJN B;  3VRC A;  4CSA C;  2WVO A;  1BR1 A;  4IAQ A;  1Z7Q c;  1E86 A;  1U89 A;  2XLE A;  4QI0 A;  3K7D A;  3FHD A;  3JRM O;  1ZYR F;  3B9Q A;  3G4Z A;  2RSE B;  3RW0 A;  2X51 A;  2J46 A;  1OCC C;  3DM5 A;  2GAQ A;  2P1A A;  4WGZ A;  1CGM E;  3HNK A;  2R03 A;  4MND A;  2C03 A;  2EIN C;  1J8Y F;  1LI7 A;  2GA0 A;  4JC7 A;  2LFD A;  4NCQ A;  3UMK A;  4OD5 A;  2A6E F;  1PV3 A;  1RKE B;  4DRJ B;  4JTA B;  1VOM A;  4O6N A;  5KYU B;  2JX0 A;  4OD4 A;  4N6C A;  4EHP A;  5D92 A;  4PFO A;  5COF A;  1D1A A;  3JYY A;  3TOM A;  3UGO A;  3W8I A;  4YL1 A;  5CI8 A;  1R5I D;  3S90 A;  1IW7 F;  4DJ9 A;  1GM5 A;  2I8B A;  4M63 A;  1I4Y A;  1G4W R;  1RJ9 B;  4CS7 A;  1TWH A;  3ZC4 A;  3M4B A;  4O6M A;  2I15 A;  4JJF A;  4CBE A;  5KYX A;  1YJG A;  3ZTM A;  4AE4 B;  5DS5 A;  2G3K A;  2J0W A;  3C8Z A;  3QMK A;  4GQH A;  2Y3D A;  4XPY A;  1ZU4 A;  1C03 A;  2OKU A;  3Q6M A;  2HV6 A;  1RKC A;  2IXP A;  2AVK A;  2KNH A;  4CSA A;  4AX2 A;  3X2Q C;  3B71 A;  1OCR C;  2LK4 A;  1D0Y A;  2XLV A;  3EG9 A;  3AQB A;  1EKY A;  4ZLC A;  2H7O A;  4JEB A;  1TKN A;  1LVK A;  2ICW G;  2OJQ A;  2A0U A;  3VM6 A;  5BQH A;  2XS8 A;  4HE8 D;  4HFF B;  2KC3 A;  5JT4 A;  4JUR I;  3RQF A;  3Q7G A;  4LDR A;  4I3M A;  4P6I C;  4JJG A;  4FWV A;  2XL6 A;  2LCH A;  4PJM A;  3UMI A;  2EPN A;  2KSF A;  3LUT B;  1OXB A;  3M4C A;  4JRZ A;  2X0C A;  1JOG A;  2DGJ A;  3L0I A;  3SYN A;  2WVN A;  3M15 A;  1ST6 A;  2XLH A;  3U0C A;  1E83 A;  4E0H A;  1VK5 A;  1QQ3 A;  3CSK A;  4C7O A;  2IBF A;  3R7C A;  1FFH A;  4YT8 A;  2R02 A;  3U3B A;  4Z9J A;  4WJ0 A;  3ECS A;  1ZHZ A;  4YWQ A;  3RVY A;  3ZWI A;  2QNL A;  4CDY A;  1JRA A;  2CCY A;  1S7Z A;  5JVE A;  2EIL C;  1RCP A;  2L9J A;  2J8W A;  4DBQ A;  2QE9 A;  2V3C C;  2NSG A;  3CAX A;  3M79 A;  4OIO F;  1LS1 A;  1CGO A;  3TJ6 A;  5L0G A;  3K6B A;  1Z23 A;  1ZHY A;  2EIK C;  1TR2 A;  3L1M A;  3FDQ A;  2HJM A;  3DXJ F;  4X0R A;  4ULW A;  1EA8 A;  5F5H A;  4XEK A;  4Z9H A;  4DOZ A;  1SF8 A;  2HS5 A;  4JTC B;  4KNW A;  2HMZ A;  2FAP B;  4C3B A;  4CS8 C;  3EZI A;  1RXQ A;  3N0T A;  5T1D B;  2R05 A;  2RD9 A;  1D0Z A;  2IOQ A;  5L0D A;  1OKK D;  2VCB A;  4DRI B;  5L0C A;  2XLO A;  2BE5 F;  2IXN A;  1I4Z A;  3EPV A;  4PJN A;  2PBE A;  3U9M A;  3JYH A;  2CDQ A;  1NLX A;  1NU9 C;  1OW7 A;  2EIJ C;  4LDQ A;  4OIQ F;  3JCU Q;  4JKV A;  3S29 A;  5F5F A;  2CYD A;  4U5B E;  4G7O F;  2HZ8 A;  2R7U A;  4K0D A;  1C02 A;  2NUP A;  1GS9 A;  1G8X A;  1HMO A;  1L7C A;  1O3U A;  1OR2 A;  3NMI A;  4QDL A;  5CIV A;  4MW3 A;  5KYY A;  2IYL D;  3DM9 B;  3K33 A;  1EI7 A;  1QVX A;  2MWQ A;  1VYI A;  3L34 A;  3MX3 A;  1Z3I X;  3ZG1 A;  4BJ5 C;  3O6X A;  3GOD A;  5L3Q A;  2J7P D;  1DOV A;  1Q0G A;  3NKD A;  1HW1 A;  3C7J A;  5COM A;  2V26 A;  2WZF A;  1Y4C A;  3T9O A;  4U5E E;  1FTS A;  4XPX A;  3RKO F;  1Z6A A;  4EBJ A;  256B A;  3ZDL A;  3JT1 A;  4IWB A;  5DLJ A;  3VYW A;  5L0J A;  5DS4 A;  3SZR A;  3S84 A;  1U6H A;  4WAB A;  5EGY A;  1YDI A;  1K40 A;  1M2V A;  4IAO A;  2GFH A;  4YT5 A;  2YL3 A;  2OJE D;  4P9F A;  4D4N A;  1Q0F A;  4H4K C;  4ULV A;  3E70 C;  2ZXO A;  3FAJ A;  5BQI A;  3AQC A;  1CPQ A;  4ER9 A;  3S9O A;  1GQA A;  1PCX A;  3K1I C;  2L7A A;  1KU2 A;  1L3P A;  1T5O A;  4BJ1 A;  3T4R A;  3EHM A;  3HNJ A;  1Y6D A;  1WAT A;  3W4Y A;  5A6B A;  3K66 A;  5KYW A;  2QUP A;  1SYQ A;  2R9R B;  2XM4 A;  4CJO A;  2R7X A;  4XEF A;  5T3W A;  1JAF A;  4PK4 A;  4CJG A;  1XWJ A;  1QLE C;  1PD1 A;  3FVY A;  3SNH A;  3VF0 A;  1JMW A;  3C8G B;  3GEI A;  3B29 A;  1QPU A;  2KYH A;  3OEO A;  4JCH A;  3GOR A;  4MW8 A;  2J9U A;  4YL0 A;  3RIP A;  5GPG B;  3S27 A;  3PDM P;  1ORS C;  3GWL A;  3KH2 A;  4Q4Z F;  2CNW A;  2Q9C A;  4NTB A;  3T6G B;  1EQ1 A;  4A2N B;  2GDC A;  3C8G D;  2Q9B A;  3J06 A;  4DBR A;  2Y69 C;  1K04 A;  3R2P A;  4YJW A;  2UUH A;  3UMH A;  3NDB B;  3X1O A;  1V54 C;  1A7E A;  3V5Z A;  2Y3B A;  3PMR A;  4I1M A;  3CZ6 A;  3T6J A;  3PCV A;  1D1C A;  5EK0 A;  5KYN A;  1IZM A;  1E2X A;  1JPJ A;  2R7O A;  4ANJ A;  5JUA A;  5DQZ A;  4BJ6 C;  5B3S C;  1TWA A;  4IJJ A;  3B0U X;  3IQT A;  5B1A C;  4YL3 A;  1BBH A;  2ZXR A;  3ITF A;  3K1I A;  4MVU A;  5HSW A;  3EGD A;  4N6H A;  2XRH A;  1FNT c;  2DI3 A;  4I1O B;  1OCO C;  1YVI A;  1AEP A;  1OQC A;  1LE2 A;  1SMY F;  3NYM A;  4LLC A;  4BPM A;  1H9T A;  1U0B B;  2R7S A;  3L8J A;  2P61 A;  2YLD A;  2Z15 A;  3N2Z B;  3CEX A;  3EHN A;  3GM1 A;  4FES A;  3FXH A;  4HFK B;  2EPO A;  2H7V C;  3MBG A;  3JSE O;  3LES A;  4LAC B;  2PF4 E;  3AG2 C;  4LLE A;  4O7G A;  1RKE A;  1K05 A;  4P9T A;  1MMG A;  3GAN A;  3OA1 A;  5JLI A;  1M6T A;  2UUI A;  3JTL O;  3LNR A;  4J7T A;  1VLS A;  1YA7 O;  4AL1 A;  3EJN A;  2R7Q A;  1MQV A;  2XL4 A;  2LQG A;  3LEV A;  3QTH A;  4NTA A;  5TJ5 E;  4EBK A;  1M2O A;  4PFP A;  4A4A A;  3POV A;  1RJ9 A;  2HV7 A;  5F28 E;  2FFH A;  1F1M A;  3O10 A;  2EIM C;  2J9V A;  3JRT A;  4JE9 A;  4EBB A;  1D0X A;  2Y3G A;  3NMK A;  3C18 A;  1A41 A;  4BG0 A;  1LPE A;  4MTO A;  3EFO A;  3U2M A;  4CS9 C;  4AE4 A;  4FX5 A;  4NY3 A;  4PJJ A;  4CX9 A;  2M4E A;  2ZXW C;  3FMS A;  3DMD A;  2AWC A;  4EKW A;  1PD0 A;  3LS0 A;  3SEO A;  2WZG A;  2ASR A;  2A0B A;  1HE1 A;  3U8V A;  3H2U A;  1MMN A;  2B0H A;  4MVZ A;  2P7V A;  1FAP B;  1ORY A;  2Q00 A;  1M56 C;  2KGO A;  3DAF A;  3IQ6 A;  4XTK A;  1S05 A;  4F4B A;  4B6I A;  3RVZ A;  4NTF A;  3UR3 C;  5BUO A;  1VB5 A;  5EHH A;  1A7D A;  2PX0 A;  1TFK B;  2G3V A;  5L3V A;  1T6I A;  3UNG C;  1XZQ A;  3V5X A;  1NSG B;  4BEJ A;  1TFO B;  2LP4 A;  2AU5 A;  3I5P A; 
#chains in the Genus database with same CATH homology
 4MVU A;  2KYH A;  4MTO A;  1ORS C;  4JTD B;  4EKW A;  4MTG A;  4MS2 A;  4DXW A;  4JTA B;  3RVY A;  4MVS A;  4MTF A;  4MVZ A;  4MVM A;  4MW3 A;  4MVO A;  4MVR A;  3RVZ A;  3LNM B;  5EK0 A;  2R9R B;  3LUT B;  3RW0 A;  4MVQ A;  4JTC B;  4MW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...