1ORSC

X-ray structure of the kvap potassium channel voltage sensor in complex with an fab
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
b'DVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIILWADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKFLSAIADAADKLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 33H1 Fab light chain
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
total genus 53
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 1orsC00
3RVZA 4EKWA 4JTAB 4MVQA 3RW0A 1ORSC 3LNMB 2KYHA 2R9RB 4MVZA 4MTFA 4MW3A 3LUTB 4MVSA 4DXWA 3RVYA 4MW8A 5EK0A 4MS2A 4MTOA 4MVMA 4MVRA 4MTGA 4JTDB 4MVUA 4JTCB 4MVOA
chains in the Genus database with same CATH superfamily
1O5HA 1OQCA 2L81A 2X0CA 1PV3A 2EPOA 4Q4ZF 2J9WA 4EIYA 3FAJA 3AG3C 4EBBA 1ZVZA 4BJTA 5CI9A 4QDLA 3SZRA 3NG1A 3R2PA 4YJWA 3U0CA 5HSWA 1F1MA 2VCBA 3FOOA 2IYLD 4YL3A 3SXZA 2J46A 5HV9A 3QW0A 1RKCA 4K0DA 2P7VA 3DAFA 4J32B 1ZU4A 4W8PA 3IHUA 2XLEA 3C7JA 3B0PA 3NYJA 3AG1C 3UGOA 1AEPA 1K05A 1M57C 4B6IA 3LESA 1GQAA 1APCA 2OCCC 2VC9A 4JE9A 2CDQA 5F5HA 5L3VA 1DOWA 4OIPF 2J7PA 4PFPA 2XM0A 4CIHA 3IEEA 2JX0A 1TFOB 2GA0A 4J7YA 4JEAA 4CS9C 1Z63A 3F46A 4JTCB 3ZVRA 2NSFA 4JJFA 4I3MA 2R7TA 1KTMA 1Y4CA 4EWCA 2Q9CA 2LFDA 4DJ9A 1LIHA 1ZHTA 3LS0A 5KYUA 3S27A 1Z6AA 2ZXWC 3VYWA 2R7VA 5KYWB 3B71A 3NMKA 2KSFA 1HW2A 4IARA 2Q7RA 2DYRC 1A7DA 4FAPB 4W8KA 3DWWA 1TWGA 5BUOA 1RCPA 4PK4A 3B0VC 1U0BB 2G3VA 2VH3A 1MNEA 1VB5A 1VYKA 3N24A 1J8MF 2IOQA 1ZYRF 2AP3A 5B1BC 3HNLA 2QTVA 4IGGA 4NTFA 3X1OA 1KU2A 1TKNA 1OW7A 3RIPA 1MMNA 3DMDA 4I44A 2KGOA 2LP4A 3UMIA 1NFOA 1RKEA 4Z9IA 1NBBA 1M2VB 1ORJA 2QY9A 3IQTA 4JURI 4XPYA 4CDVA 1EQ1A 3VRCA 3ZTMA 2GWWA 1QLEC 2MWQA 5DS5A 2XLDA 1PD1A 2YRFA 3C18A 3KPHA 1QSPA 1SMYF 4KNVA 1MNDA 3U8VA 3ZIBA 5EGYA 2L6FA 3AQCA 2HUJA 1LS4A 3LNMB 3M79A 4X0RA 2EIJC 3GODA 4KC9A 4ZLDA 1T9KA 2LIGA 3MYFA 2IM8A 2J9VA 4MVZA 2YZSA 4WABA 5E3CA 4CX9A 4LACB 4YT5A 3L8JA 1D1AA 3B0UX 3G4XA 1FTSA 1I4YA 1TWAA 2G3KA 2UUHA 2XLOA 3MYIA 4WGYA 2PX3A 4DXWA 1FR0A 2XLHA 5AC4A 3MX3A 3TOMA 2Q3TA 4J30B 2I15A 5F5FA 5L0DA 1G5ZA 3FXHA 3EGXB 2QLAA 3ITFA 3MLGA 5A6BD 2CW0F 3X2QC 3HNJA 4E0IA 3U3BA 4PJMA 3ECSA 4CBEA 2JPUA 4BEJA 3HJCA 256BA 2XS1A 1YA7O 3QTHA 4MVQA 1HMDA 1M6TA 1CPQA 2NUPB 5COFA 3UNGC 5DVWA 1SF8A 3EFOA 1D0ZA 2YVKA 2GAQA 1W2WA 3K1HA 5JT4A 2PBEA 2RSEB 2Y3DA 4EUKB 2ETSA 3M4CA 1L3PA 1EI7A 2WVQA 3IQCA 4U5DE 2D4UA 1V55C 1VK5A 4P9TA 5BQGA 4MVRA 3LLIA 3NDBB 3KL4A 3N2ZB 5A6AA 1I5NA 2HV6A 1E85A 2Y3GA 4JRZA 2LK4A 3HNKA 3SP1A 5DLJA 3PMRA 2XL8A 1CGME 3CZ6A 5F28E 4JCZA 2R7QA 5KYUB 1OCRC 1ORSC 3T4RA 3I5PA 5L0CA 4XQ1A 5T1DB 3WG7C 1H6GA 2WB7A 1B68A 2R9RB 3OEOA 4N6CA 4BEMJ 2IXOA 3JRMO 3RKOF 3JCUQ 2IXNA 5COMA 4D4NA 4PACA 3ASNC 3GM1A 4DBRA 5L0IA 4KI2A 3DJNB 3RFYA 1Q0KA 4YWQA 1ST6A 4R32A 4N06A 1OXBA 2VCAA 1IW7F 2PP4A 5JS5A 4CSAC 1LI7A 2HSBA 3DE8A 3DM9B 4PFOA 1T5OA 2LD6A 4MVOA 2LCHA 2VCCA 2CNWA 2ZXRA 3JYHA 5TJ5E 1A7EA 3K7DA 3SXKA 4LERA 4C3EA 2V3CC 2WVOA 1OCCC 5E33A 5B1AC 3FOPA 4AL0A 4XLPF 2NUPA 3EPVA 3JYYA 1FMWA 1YYJA 1H9TA 2R7RA 2A1DD 2HMQA 3HKKA 3LUTB 3O10A 2KQ9A 4Z9HA 4A4AA 5KYNA 1YAUO 3T6GB 2R25A 4IAOA 1T01A 1O87A 2BL2A 3RVYA 1E84A 3DZAA 3DJUB 3RH3A 1NG1A 1HE1A 1NFNA 1L7CA 3FHDA 2YLGA 1OCZC 1OR2A 4NTAA 1BR1A 2EPNA 3UR3C 1NZEA 1CGNA 2J9BA 2AWCA 2L7AA 3ABKC 4KNWA 2W45A 5JP7A 5JSLA 2BE5F 1XWJA 1WGWA 3FVYA 1OKKD 3LLKA 4YL0A 3RYLA 4NY3A 1TWHA 5B3SC 4PJLA 4OD4A 2R7OA 3FAPB 3EG9A 1JRAA 4XTKA 5L0JA 2XS8A 4ULVA 2CGEA 2WL8A 3LNRA 1T6UA 2XSEA 1A41A 1ZZPA 4LDKA 5D92A 3U3FA 1A0BA 1JPNA 2G62A 4KBLA 3S9OA 3EFOB 3L8IA 3TULA 1VTMP 3QVYA 2Q4FA 4N4WA 2YL0A 4IWBA 3V5XA 1FAPB 1T6QA 3Q7LA 1MMAA 3C63A 4D4XA 4EHPA 4YT8A 3U5SA 4IJJA 2OKUA 3DD7A 2A69F 3IPMO 4MVSA 4OINF 3FDQA 2Y69C 2R7XA 3G50A 3LAYA 1TQGA 2J45A 5B3IA 1DOVA 2NSGA 4MTOA 4XLNF 1C02A 4U5FE 4L6RA 4I1MA 4PJNA 3NMJA 2R05A 4DOZA 2YQYA 1PD0A 2C04A 3AG4C 2B0HA 4YL1A 3U9JA 2P61A 1HE9A 1T6IA 1WN0A 1H9GA 2J8WA 3BEHA 1XZQA 1QPUA 1C03A 1LPEA 3JT1A 4EBKA 2EIMC 2OQMA 4NTBA 4XPXA 2UUIA 4DRJB 3GWLA 1K40A 3EH2A 4U5CE 2EPMX 2OG2A 4IAQA 2A68F 1VYIA 1NLXA 1YYXA 1K04A 2OEVA 3GANA 4K1OA 4ULWA 3CEXA 3L1MA 1LVKA 1YA9A 4LDRA 1C17M 4DRIB 2WVNA 2XLVA 1YJGA 5BQIA 3S90A 1D0XA 4GQHA 4MW8A 1EA8A 3IQ6A 1Z5ZA 4PJJA 4JZAA 3ZDLA 3POVA 2CCYA 1OKKA 1RJ9A 1Z3IX 2AWYA 4P9FA 5A6JA 2ZPAA 3QVZA 3LS1A 4RD9A 4MVUA 1V74B 2OEXA 3V5ZA 1J8YF 5T3WA 3WHNA 4O6NA 1UG7A 4XPWA 4OIQF 3AGTA 2GDCA 1KNYA 4FESA 2Y3HA 4JJGA 2DGJA 3NMIA 2CYDA 1OXKA 3V7OA 2W4MA 4IRUA 3GEIA 2CNWD 1XZPA 3DM5A 1VMAA 4AE4A 4U5EE 3DKAA 3W2VA 5L0HA 2OJED 3AG2C 5DQTA 1LS1A 4YK5A 4OD5A 2KK1A 1U89A 2L6HA 2HV7A 4JW1A 3EZIA 3NYMA 1ZW2A 3DXJF 1BZ4A 1ORYA 2R7WA 2HZ8A 4E0HA 1QVXA 5JRAA 2ASRA 4ZLCA 1Z23A 1BBHA 4CJOA 4YN0B 3M15A 1WTYA 4LLCA 2H7OA 1JPJA 2XM4A 1D1CA 1FFTC 1Q0DA 3EG9B 3LJBA 3RW0A 1YLMA 4CDAA 5KYXA 3PCVA 2YEVA 4HE8D 3WODF 3AQBA 3Q7GA 3B9QA 1G4US 1O3UA 1OR3A 1ZW3A 2YLIA 4LLEA 2Y39A 3SNHA 1AUEA 4JCHA 1S05A 2NPUA 3UGPA 2YKZA 2NG1A 3RQEA 1V4AA 3W8HA 1JR8A 2D5RB 2XL4A 2A6HF 5IY5C 1YARO 3DI5A 1RMVA 4XEKA 1U6HA 1AVOB 2EPKX 2Q9BA 5A69A 2VB6A 2KC3A 1ZU5A 2X51A 2A0UA 2IXPA 4YT4A 2L9JA 2P0NA 3RVZA 4BJ6A 4GYTA 2HSQA 3SXYA 5D91A 2HS5A 1OW8A 3KMIA 1ZHZA 3A11A 4GEHA 4RDAA 3GEEA 4H54A 3TK0A 2XLMA 1MQVA 1R4TA 2A0BA 4U5BE 4C3BA 4DVYP 2DI3A 1FMVA 2H8AA 2P6VA 3K6BA 3ZWIA 1WATA 1Q0MA 3LEVA 2YLDA 3K1IA 4U5HA 4DRHB 3EZHA 1S7ZA 4U9EA 4FX5A 4BJ1A 1SZIA 4RBNA 2DYSC 2W9YA 2EPLX 3M1CB 3SXMA 1E2XA 3T9OA 1G4WR 5JVEA 3AJMA 4NCQA 3O6XA 3S29A 3G4ZA 3SYNA 2ZD9A 1G8XA 3EH1A 1RJ9B 4XEVA 1Y6DA 2LQGA 1Q0GA 3RQFA 1JMWA 4HFKB 4U5GA 4YT2A 1V54C 3W2WA 1GM5A 4HFFB 1LE2A 3O39A 4O79A 3TJ5A 3TQOA 1MMGA 3TOLA 3UMKA 3W8IA 1BDJB 4G7HF 4G7ZF 1MMDA 2YL1A 2JD3A 1VOMA 4DVZA 5DS4A 1HY5A 3W4YA 3S0XA 2R7SA 3PDMP 5COGA 4ER9A 2KYHA 2J9UA 3JSZA 4E17A 5E3AA 3IQ5A 2QNLA 4AE4B 2KJGA 4MQ9F 2EILC 4CS8C 4E18A 4XWJA 3ZC4A 4Q5SF 5EHHA 2XXAB 3SEOA 3QW1A 2ICWG 4BJ5C 1JAFA 1M56C 4A2NB 4PR9A 2EIKC 1SYQA 3AOUA 1YVIA 2OU6A 4H4KC 1I4ZA 4NQFA 4G0HA 3QZCA 4MVMA 3OA1A 2HJ3A 5KYYB 2LFFA 2H7VC 3EGDB 3ASOC 4CS7A 5E2QA 2YWAA 2MHRA 3H2VA 5JLIA 4BPMA 1H7IA 3GM3A 3CAXA 1JOGA 1M2OA 1ZHWA 4O7GA 2J0WA 5BQHA 1YZAA 4P6IC 1OCOC 3R7CA 4AK9A 3VM6A 5KYXB 4UDVA 2MYSA 1Z7Qc 2F22A 1GGQA 3A9CA 3K33A 3NKDA 3NKEA 4CSAA 2Z15A 5DS6A 3N0TA 4O6YA 5GPGB 4G78A 2PNOA 2AVKA 1FFHA 1WOLA 1A7VA 4F4BA 2IBFA 2O9XA 1TR2A 2RD9A 2V26A 3I4UA 2R7UA 3EQLF 1LE4A 1VLSA 3AGUA 4NC3A 2NUTB 2OOCA 2P1AA 1R5ID 3OWTA 1E86A 4AL1A 5JUAA 3KKBA 3T6JA 4BJ6C 2EINC 5DQZA 1BR2A 2PX0A 4C3DA 4ONSA 1OW6A 3DE9A 4M63A 1N1CA 3FMSA 2KW3C 2Q00A 3T6BA 2J0XA 3CSKA 3S28A 4EKWA 2QUPA 2HFIA 3C8GB 3ABLC 5FCLA 4OIOF 2H7BA 4JTAB 1HW1A 5FZTA 3K1IC 4CIPA 4E7ZA 1WASA 2W4BA 3KYJA 2QE9A 4JEBA 5CIVA 3Q6NA 1ZHYA 3ATPA 3BRJA 2OJQA 3JSEO 3K66A 5AC5A 3PHF2 3C8GD 4JC7A 2KNHA 3ZQVA 4CDYA 3S84A 2L6GA 4MTFA 1QKRA 3HTKC 1LI5A 1TFKB 2XL6A 1HMOA 3O55A 1GS9A 3MFNA 4MW3A 1D0YA 2XXAA 2YHSA 3U2LA 1E83A 4JIOA 3JRTA 1IZMA 3EHNA 5EK0A 4CS8A 3I5QA 4JKVA 3GEHA 5L0FA 3GORA 2R03A 4BJ5A 4C7OB 1YZCA 4Q7CA 2LSEA 1PCXA 3RQGA 5KYYA 3EGDA 3TD7A 1YDIA 2PFDA 3M4BA 2XRHA 2M64A 3C62A 3B29A 5T3TA 4QI2A 1NSGB 2VASA 2R02A 3RF3A 4CS9A 1CGOA 1ZHXA 3HLZA 4ANJA 4FWVA 4CJGA 5KYWA 3LEOA 4DBQA 3E70C 1WWPA 3TJ6A 2M4EA 2XLWA 3CQZA 3E9VA 3KYIA 4Z9JA 3ZG1A 3QMKA 3H2UA 4BG0A 3JZ0A 2TMVP 2ZXPA 4JVSA 3ABMC 3UMHA 1QQ3A 2C03A 2A6EF 3WAQA 5CI8A 2YL7A 4QI0A 2Y3BA 1NU9C 4LDQA 2NUTA 1LKXA 1BR4A 2DB4A 2ZXOA 3V5YA 3EHMA 2WZFA 1Q0FA 3C8ZA 3Q6MA 4MTGA 5K0IA 2HKVA 1CPRA 1D1BA 1M2VA 1SR2A 2PF4E 3GWNA 3DAGA 4JTDB 4EBJA 1NU7D 3GM2A 3MBGA 2B0JA 3L34A 4IB4A 3L0IA 4AX2A 4O6MA 2J7PD 3C8GA 4XEFA 2GFHA 2WZGA 2IXMA 4WJ0A 3NRHA 4MNDA 4G7OF 3U9MA 2E87A 3VAYA 4J7TA 4U9DA 3U2MA 2FGYA 5AGFA 3ZTZA 3F47A 2FFHA 2HJMA 1VLTA 3H65A 2AU5A 1FNTc 1UFBA 1TWCA 5A6BA 1LM3B 3EJNA 3KH2A 1EKYA 4K7BA 4E7SA 2BC5A 1QZXA 4HEAJ 3U8PA 5L0GA 5A6KA 4MS2A 2FAPB 2Q9AA 3HNIA 4OIRF 3ZQYA 5L3QA 2I8BA 2HMZA 3VF0A 4I1OB 3ZSUA 1RXQA 3EGXA 3NYLA 4N6HA 4WGZA 4C7OA 1RKEB 3J06A 2WZLA 3US6A 2YL3A 3JTLO
chains in the Genus database with same CATH topology
3RVZA 4EKWA 4JTAB 4MVQA 3RW0A 1ORSC 3LNMB 2KYHA 2R9RB 4MVZA 4MTFA 4MW3A 3LUTB 4MVSA 4DXWA 3RVYA 4MW8A 5EK0A 4MS2A 4MTOA 4MVMA 4MVRA 4MTGA 4JTDB 4MVUA 4JTCB 4MVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVZ A;  4EKW A;  4JTA B;  4MVQ A;  3RW0 A;  1ORS C;  3LNM B;  2KYH A;  2R9R B;  4MVZ A;  4MTF A;  4MW3 A;  3LUT B;  4MVS A;  4DXW A;  3RVY A;  4MW8 A;  5EK0 A;  4MS2 A;  4MTO A;  4MVM A;  4MVR A;  4MTG A;  4JTD B;  4MVU A;  4JTC B;  4MVO A; 
#chains in the Genus database with same CATH topology
 1O5H A;  1OQC A;  2L81 A;  2X0C A;  1PV3 A;  2EPO A;  4Q4Z F;  2J9W A;  4EIY A;  3FAJ A;  3AG3 C;  4EBB A;  1ZVZ A;  4BJT A;  5CI9 A;  4QDL A;  3SZR A;  3NG1 A;  3R2P A;  4YJW A;  3U0C A;  5HSW A;  1F1M A;  2VCB A;  3FOO A;  2IYL D;  4YL3 A;  3SXZ A;  2J46 A;  5HV9 A;  3QW0 A;  1RKC A;  4K0D A;  2P7V A;  3DAF A;  4J32 B;  1ZU4 A;  4W8P A;  3IHU A;  2XLE A;  3C7J A;  3B0P A;  3NYJ A;  3AG1 C;  3UGO A;  1AEP A;  1K05 A;  1M57 C;  4B6I A;  3LES A;  1GQA A;  1APC A;  2OCC C;  2VC9 A;  4JE9 A;  2CDQ A;  5F5H A;  5L3V A;  1DOW A;  4OIP F;  2J7P A;  4PFP A;  2XM0 A;  4CIH A;  3IEE A;  2JX0 A;  1TFO B;  2GA0 A;  4J7Y A;  4JEA A;  4CS9 C;  1Z63 A;  3F46 A;  4JTC B;  3ZVR A;  2NSF A;  4JJF A;  4I3M A;  2R7T A;  1KTM A;  1Y4C A;  4EWC A;  2Q9C A;  2LFD A;  4DJ9 A;  1LIH A;  1ZHT A;  3LS0 A;  5KYU A;  3S27 A;  1Z6A A;  2ZXW C;  3VYW A;  2R7V A;  5KYW B;  3B71 A;  3NMK A;  2KSF A;  1HW2 A;  4IAR A;  2Q7R A;  2DYR C;  1A7D A;  4FAP B;  4W8K A;  3DWW A;  1TWG A;  5BUO A;  1RCP A;  4PK4 A;  3B0V C;  1U0B B;  2G3V A;  2VH3 A;  1MNE A;  1VB5 A;  1VYK A;  3N24 A;  1J8M F;  2IOQ A;  1ZYR F;  2AP3 A;  5B1B C;  3HNL A;  2QTV A;  4IGG A;  4NTF A;  3X1O A;  1KU2 A;  1TKN A;  1OW7 A;  3RIP A;  1MMN A;  3DMD A;  4I44 A;  2KGO A;  2LP4 A;  3UMI A;  1NFO A;  1RKE A;  4Z9I A;  1NBB A;  1M2V B;  1ORJ A;  2QY9 A;  3IQT A;  4JUR I;  4XPY A;  4CDV A;  1EQ1 A;  3VRC A;  3ZTM A;  2GWW A;  1QLE C;  2MWQ A;  5DS5 A;  2XLD A;  1PD1 A;  2YRF A;  3C18 A;  3KPH A;  1QSP A;  1SMY F;  4KNV A;  1MND A;  3U8V A;  3ZIB A;  5EGY A;  2L6F A;  3AQC A;  2HUJ A;  1LS4 A;  3LNM B;  3M79 A;  4X0R A;  2EIJ C;  3GOD A;  4KC9 A;  4ZLD A;  1T9K A;  2LIG A;  3MYF A;  2IM8 A;  2J9V A;  4MVZ A;  2YZS A;  4WAB A;  5E3C A;  4CX9 A;  4LAC B;  4YT5 A;  3L8J A;  1D1A A;  3B0U X;  3G4X A;  1FTS A;  1I4Y A;  1TWA A;  2G3K A;  2UUH A;  2XLO A;  3MYI A;  4WGY A;  2PX3 A;  4DXW A;  1FR0 A;  2XLH A;  5AC4 A;  3MX3 A;  3TOM A;  2Q3T A;  4J30 B;  2I15 A;  5F5F A;  5L0D A;  1G5Z A;  3FXH A;  3EGX B;  2QLA A;  3ITF A;  3MLG A;  5A6B D;  2CW0 F;  3X2Q C;  3HNJ A;  4E0I A;  3U3B A;  4PJM A;  3ECS A;  4CBE A;  2JPU A;  4BEJ A;  3HJC A;  256B A;  2XS1 A;  1YA7 O;  3QTH A;  4MVQ A;  1HMD A;  1M6T A;  1CPQ A;  2NUP B;  5COF A;  3UNG C;  5DVW A;  1SF8 A;  3EFO A;  1D0Z A;  2YVK A;  2GAQ A;  1W2W A;  3K1H A;  5JT4 A;  2PBE A;  2RSE B;  2Y3D A;  4EUK B;  2ETS A;  3M4C A;  1L3P A;  1EI7 A;  2WVQ A;  3IQC A;  4U5D E;  2D4U A;  1V55 C;  1VK5 A;  4P9T A;  5BQG A;  4MVR A;  3LLI A;  3NDB B;  3KL4 A;  3N2Z B;  5A6A A;  1I5N A;  2HV6 A;  1E85 A;  2Y3G A;  4JRZ A;  2LK4 A;  3HNK A;  3SP1 A;  5DLJ A;  3PMR A;  2XL8 A;  1CGM E;  3CZ6 A;  5F28 E;  4JCZ A;  2R7Q A;  5KYU B;  1OCR C;  1ORS C;  3T4R A;  3I5P A;  5L0C A;  4XQ1 A;  5T1D B;  3WG7 C;  1H6G A;  2WB7 A;  1B68 A;  2R9R B;  3OEO A;  4N6C A;  4BEM J;  2IXO A;  3JRM O;  3RKO F;  3JCU Q;  2IXN A;  5COM A;  4D4N A;  4PAC A;  3ASN C;  3GM1 A;  4DBR A;  5L0I A;  4KI2 A;  3DJN B;  3RFY A;  1Q0K A;  4YWQ A;  1ST6 A;  4R32 A;  4N06 A;  1OXB A;  2VCA A;  1IW7 F;  2PP4 A;  5JS5 A;  4CSA C;  1LI7 A;  2HSB A;  3DE8 A;  3DM9 B;  4PFO A;  1T5O A;  2LD6 A;  4MVO A;  2LCH A;  2VCC A;  2CNW A;  2ZXR A;  3JYH A;  5TJ5 E;  1A7E A;  3K7D A;  3SXK A;  4LER A;  4C3E A;  2V3C C;  2WVO A;  1OCC C;  5E33 A;  5B1A C;  3FOP A;  4AL0 A;  4XLP F;  2NUP A;  3EPV A;  3JYY A;  1FMW A;  1YYJ A;  1H9T A;  2R7R A;  2A1D D;  2HMQ A;  3HKK A;  3LUT B;  3O10 A;  2KQ9 A;  4Z9H A;  4A4A A;  5KYN A;  1YAU O;  3T6G B;  2R25 A;  4IAO A;  1T01 A;  1O87 A;  2BL2 A;  3RVY A;  1E84 A;  3DZA A;  3DJU B;  3RH3 A;  1NG1 A;  1HE1 A;  1NFN A;  1L7C A;  3FHD A;  2YLG A;  1OCZ C;  1OR2 A;  4NTA A;  1BR1 A;  2EPN A;  3UR3 C;  1NZE A;  1CGN A;  2J9B A;  2AWC A;  2L7A A;  3ABK C;  4KNW A;  2W45 A;  5JP7 A;  5JSL A;  2BE5 F;  1XWJ A;  1WGW A;  3FVY A;  1OKK D;  3LLK A;  4YL0 A;  3RYL A;  4NY3 A;  1TWH A;  5B3S C;  4PJL A;  4OD4 A;  2R7O A;  3FAP B;  3EG9 A;  1JRA A;  4XTK A;  5L0J A;  2XS8 A;  4ULV A;  2CGE A;  2WL8 A;  3LNR A;  1T6U A;  2XSE A;  1A41 A;  1ZZP A;  4LDK A;  5D92 A;  3U3F A;  1A0B A;  1JPN A;  2G62 A;  4KBL A;  3S9O A;  3EFO B;  3L8I A;  3TUL A;  1VTM P;  3QVY A;  2Q4F A;  4N4W A;  2YL0 A;  4IWB A;  3V5X A;  1FAP B;  1T6Q A;  3Q7L A;  1MMA A;  3C63 A;  4D4X A;  4EHP A;  4YT8 A;  3U5S A;  4IJJ A;  2OKU A;  3DD7 A;  2A69 F;  3IPM O;  4MVS A;  4OIN F;  3FDQ A;  2Y69 C;  2R7X A;  3G50 A;  3LAY A;  1TQG A;  2J45 A;  5B3I A;  1DOV A;  2NSG A;  4MTO A;  4XLN F;  1C02 A;  4U5F E;  4L6R A;  4I1M A;  4PJN A;  3NMJ A;  2R05 A;  4DOZ A;  2YQY A;  1PD0 A;  2C04 A;  3AG4 C;  2B0H A;  4YL1 A;  3U9J A;  2P61 A;  1HE9 A;  1T6I A;  1WN0 A;  1H9G A;  2J8W A;  3BEH A;  1XZQ A;  1QPU A;  1C03 A;  1LPE A;  3JT1 A;  4EBK A;  2EIM C;  2OQM A;  4NTB A;  4XPX A;  2UUI A;  4DRJ B;  3GWL A;  1K40 A;  3EH2 A;  4U5C E;  2EPM X;  2OG2 A;  4IAQ A;  2A68 F;  1VYI A;  1NLX A;  1YYX A;  1K04 A;  2OEV A;  3GAN A;  4K1O A;  4ULW A;  3CEX A;  3L1M A;  1LVK A;  1YA9 A;  4LDR A;  1C17 M;  4DRI B;  2WVN A;  2XLV A;  1YJG A;  5BQI A;  3S90 A;  1D0X A;  4GQH A;  4MW8 A;  1EA8 A;  3IQ6 A;  1Z5Z A;  4PJJ A;  4JZA A;  3ZDL A;  3POV A;  2CCY A;  1OKK A;  1RJ9 A;  1Z3I X;  2AWY A;  4P9F A;  5A6J A;  2ZPA A;  3QVZ A;  3LS1 A;  4RD9 A;  4MVU A;  1V74 B;  2OEX A;  3V5Z A;  1J8Y F;  5T3W A;  3WHN A;  4O6N A;  1UG7 A;  4XPW A;  4OIQ F;  3AGT A;  2GDC A;  1KNY A;  4FES A;  2Y3H A;  4JJG A;  2DGJ A;  3NMI A;  2CYD A;  1OXK A;  3V7O A;  2W4M A;  4IRU A;  3GEI A;  2CNW D;  1XZP A;  3DM5 A;  1VMA A;  4AE4 A;  4U5E E;  3DKA A;  3W2V A;  5L0H A;  2OJE D;  3AG2 C;  5DQT A;  1LS1 A;  4YK5 A;  4OD5 A;  2KK1 A;  1U89 A;  2L6H A;  2HV7 A;  4JW1 A;  3EZI A;  3NYM A;  1ZW2 A;  3DXJ F;  1BZ4 A;  1ORY A;  2R7W A;  2HZ8 A;  4E0H A;  1QVX A;  5JRA A;  2ASR A;  4ZLC A;  1Z23 A;  1BBH A;  4CJO A;  4YN0 B;  3M15 A;  1WTY A;  4LLC A;  2H7O A;  1JPJ A;  2XM4 A;  1D1C A;  1FFT C;  1Q0D A;  3EG9 B;  3LJB A;  3RW0 A;  1YLM A;  4CDA A;  5KYX A;  3PCV A;  2YEV A;  4HE8 D;  3WOD F;  3AQB A;  3Q7G A;  3B9Q A;  1G4U S;  1O3U A;  1OR3 A;  1ZW3 A;  2YLI A;  4LLE A;  2Y39 A;  3SNH A;  1AUE A;  4JCH A;  1S05 A;  2NPU A;  3UGP A;  2YKZ A;  2NG1 A;  3RQE A;  1V4A A;  3W8H A;  1JR8 A;  2D5R B;  2XL4 A;  2A6H F;  5IY5 C;  1YAR O;  3DI5 A;  1RMV A;  4XEK A;  1U6H A;  1AVO B;  2EPK X;  2Q9B A;  5A69 A;  2VB6 A;  2KC3 A;  1ZU5 A;  2X51 A;  2A0U A;  2IXP A;  4YT4 A;  2L9J A;  2P0N A;  3RVZ A;  4BJ6 A;  4GYT A;  2HSQ A;  3SXY A;  5D91 A;  2HS5 A;  1OW8 A;  3KMI A;  1ZHZ A;  3A11 A;  4GEH A;  4RDA A;  3GEE A;  4H54 A;  3TK0 A;  2XLM A;  1MQV A;  1R4T A;  2A0B A;  4U5B E;  4C3B A;  4DVY P;  2DI3 A;  1FMV A;  2H8A A;  2P6V A;  3K6B A;  3ZWI A;  1WAT A;  1Q0M A;  3LEV A;  2YLD A;  3K1I A;  4U5H A;  4DRH B;  3EZH A;  1S7Z A;  4U9E A;  4FX5 A;  4BJ1 A;  1SZI A;  4RBN A;  2DYS C;  2W9Y A;  2EPL X;  3M1C B;  3SXM A;  1E2X A;  3T9O A;  1G4W R;  5JVE A;  3AJM A;  4NCQ A;  3O6X A;  3S29 A;  3G4Z A;  3SYN A;  2ZD9 A;  1G8X A;  3EH1 A;  1RJ9 B;  4XEV A;  1Y6D A;  2LQG A;  1Q0G A;  3RQF A;  1JMW A;  4HFK B;  4U5G A;  4YT2 A;  1V54 C;  3W2W A;  1GM5 A;  4HFF B;  1LE2 A;  3O39 A;  4O79 A;  3TJ5 A;  3TQO A;  1MMG A;  3TOL A;  3UMK A;  3W8I A;  1BDJ B;  4G7H F;  4G7Z F;  1MMD A;  2YL1 A;  2JD3 A;  1VOM A;  4DVZ A;  5DS4 A;  1HY5 A;  3W4Y A;  3S0X A;  2R7S A;  3PDM P;  5COG A;  4ER9 A;  2KYH A;  2J9U A;  3JSZ A;  4E17 A;  5E3A A;  3IQ5 A;  2QNL A;  4AE4 B;  2KJG A;  4MQ9 F;  2EIL C;  4CS8 C;  4E18 A;  4XWJ A;  3ZC4 A;  4Q5S F;  5EHH A;  2XXA B;  3SEO A;  3QW1 A;  2ICW G;  4BJ5 C;  1JAF A;  1M56 C;  4A2N B;  4PR9 A;  2EIK C;  1SYQ A;  3AOU A;  1YVI A;  2OU6 A;  4H4K C;  1I4Z A;  4NQF A;  4G0H A;  3QZC A;  4MVM A;  3OA1 A;  2HJ3 A;  5KYY B;  2LFF A;  2H7V C;  3EGD B;  3ASO C;  4CS7 A;  5E2Q A;  2YWA A;  2MHR A;  3H2V A;  5JLI A;  4BPM A;  1H7I A;  3GM3 A;  3CAX A;  1JOG A;  1M2O A;  1ZHW A;  4O7G A;  2J0W A;  5BQH A;  1YZA A;  4P6I C;  1OCO C;  3R7C A;  4AK9 A;  3VM6 A;  5KYX B;  4UDV A;  2MYS A;  1Z7Q c;  2F22 A;  1GGQ A;  3A9C A;  3K33 A;  3NKD A;  3NKE A;  4CSA A;  2Z15 A;  5DS6 A;  3N0T A;  4O6Y A;  5GPG B;  4G78 A;  2PNO A;  2AVK A;  1FFH A;  1WOL A;  1A7V A;  4F4B A;  2IBF A;  2O9X A;  1TR2 A;  2RD9 A;  2V26 A;  3I4U A;  2R7U A;  3EQL F;  1LE4 A;  1VLS A;  3AGU A;  4NC3 A;  2NUT B;  2OOC A;  2P1A A;  1R5I D;  3OWT A;  1E86 A;  4AL1 A;  5JUA A;  3KKB A;  3T6J A;  4BJ6 C;  2EIN C;  5DQZ A;  1BR2 A;  2PX0 A;  4C3D A;  4ONS A;  1OW6 A;  3DE9 A;  4M63 A;  1N1C A;  3FMS A;  2KW3 C;  2Q00 A;  3T6B A;  2J0X A;  3CSK A;  3S28 A;  4EKW A;  2QUP A;  2HFI A;  3C8G B;  3ABL C;  5FCL A;  4OIO F;  2H7B A;  4JTA B;  1HW1 A;  5FZT A;  3K1I C;  4CIP A;  4E7Z A;  1WAS A;  2W4B A;  3KYJ A;  2QE9 A;  4JEB A;  5CIV A;  3Q6N A;  1ZHY A;  3ATP A;  3BRJ A;  2OJQ A;  3JSE O;  3K66 A;  5AC5 A;  3PHF 2;  3C8G D;  4JC7 A;  2KNH A;  3ZQV A;  4CDY A;  3S84 A;  2L6G A;  4MTF A;  1QKR A;  3HTK C;  1LI5 A;  1TFK B;  2XL6 A;  1HMO A;  3O55 A;  1GS9 A;  3MFN A;  4MW3 A;  1D0Y A;  2XXA A;  2YHS A;  3U2L A;  1E83 A;  4JIO A;  3JRT A;  1IZM A;  3EHN A;  5EK0 A;  4CS8 A;  3I5Q A;  4JKV A;  3GEH A;  5L0F A;  3GOR A;  2R03 A;  4BJ5 A;  4C7O B;  1YZC A;  4Q7C A;  2LSE A;  1PCX A;  3RQG A;  5KYY A;  3EGD A;  3TD7 A;  1YDI A;  2PFD A;  3M4B A;  2XRH A;  2M64 A;  3C62 A;  3B29 A;  5T3T A;  4QI2 A;  1NSG B;  2VAS A;  2R02 A;  3RF3 A;  4CS9 A;  1CGO A;  1ZHX A;  3HLZ A;  4ANJ A;  4FWV A;  4CJG A;  5KYW A;  3LEO A;  4DBQ A;  3E70 C;  1WWP A;  3TJ6 A;  2M4E A;  2XLW A;  3CQZ A;  3E9V A;  3KYI A;  4Z9J A;  3ZG1 A;  3QMK A;  3H2U A;  4BG0 A;  3JZ0 A;  2TMV P;  2ZXP A;  4JVS A;  3ABM C;  3UMH A;  1QQ3 A;  2C03 A;  2A6E F;  3WAQ A;  5CI8 A;  2YL7 A;  4QI0 A;  2Y3B A;  1NU9 C;  4LDQ A;  2NUT A;  1LKX A;  1BR4 A;  2DB4 A;  2ZXO A;  3V5Y A;  3EHM A;  2WZF A;  1Q0F A;  3C8Z A;  3Q6M A;  4MTG A;  5K0I A;  2HKV A;  1CPR A;  1D1B A;  1M2V A;  1SR2 A;  2PF4 E;  3GWN A;  3DAG A;  4JTD B;  4EBJ A;  1NU7 D;  3GM2 A;  3MBG A;  2B0J A;  3L34 A;  4IB4 A;  3L0I A;  4AX2 A;  4O6M A;  2J7P D;  3C8G A;  4XEF A;  2GFH A;  2WZG A;  2IXM A;  4WJ0 A;  3NRH A;  4MND A;  4G7O F;  3U9M A;  2E87 A;  3VAY A;  4J7T A;  4U9D A;  3U2M A;  2FGY A;  5AGF A;  3ZTZ A;  3F47 A;  2FFH A;  2HJM A;  1VLT A;  3H65 A;  2AU5 A;  1FNT c;  1UFB A;  1TWC A;  5A6B A;  1LM3 B;  3EJN A;  3KH2 A;  1EKY A;  4K7B A;  4E7S A;  2BC5 A;  1QZX A;  4HEA J;  3U8P A;  5L0G A;  5A6K A;  4MS2 A;  2FAP B;  2Q9A A;  3HNI A;  4OIR F;  3ZQY A;  5L3Q A;  2I8B A;  2HMZ A;  3VF0 A;  4I1O B;  3ZSU A;  1RXQ A;  3EGX A;  3NYL A;  4N6H A;  4WGZ A;  4C7O A;  1RKE B;  3J06 A;  2WZL A;  3US6 A;  2YL3 A;  3JTL O; 
#chains in the Genus database with same CATH homology
 3RVZ A;  4EKW A;  4JTA B;  4MVQ A;  3RW0 A;  1ORS C;  3LNM B;  2KYH A;  2R9R B;  4MVZ A;  4MTF A;  4MW3 A;  3LUT B;  4MVS A;  4DXW A;  3RVY A;  4MW8 A;  5EK0 A;  4MS2 A;  4MTO A;  4MVM A;  4MVR A;  4MTG A;  4JTD B;  4MVU A;  4JTC B;  4MVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...