1ORSC

X-ray structure of the kvap potassium channel voltage sensor in complex with an fab
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
DVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIILWADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKFLSAIADAADKLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 33H1 Fab light chain
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
total genus 53
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 1orsC00
1ORSC 4MTFA 4MVOA 3LUTB 4MVUA 3RVZA 4JTAB 4EKWA 2R9RB 3RVYA 5EK0A 4MW8A 4MTGA 3RW0A 4JTCB 4MVQA 2KYHA 4MVRA 4DXWA 4MVZA 4MVMA 4MVSA 4MS2A 4JTDB 4MTOA 3LNMB 4MW3A
chains in the Genus database with same CATH superfamily
2XLDA 2BL2A 4C3DA 2QTVA 4U5GA 2GAQA 3KKBA 1IW7F 1A41A 1NZEA 2VCAA 3HNIA 3PDMP 3RH3A 5B1AC 4YWQA 4ER9A 2BE5F 2EPMX 1FFTC 2Z15A 3RQFA 1R5ID 1BDJB 3HNKA 2WVOA 3IQTA 5JS5A 5L0DA 4K7BA 1LPEA 3PMRA 2YRFA 2E87A 1ST6A 2Q7RA 1UG7A 2LCHA 1M2VA 3EHMA 1TKNA 1EI7A 5L0FA 5BQHA 1SMYF 2R03A 2XLWA 4Z9HA 4EBJA 4Q5SF 1NU7D 3GM3A 1D1BA 1RJ9B 1TWAA 1J8MF 3PHF2 4ULWA 3S9OA 1SF8A 2RD9A 1LM3B 4KC9A 2G3KA 4RBNA 5A6BD 3NYLA 4JCHA 4PR9A 3TD7A 3ZIBA 3JRMO 4XLPF 4Z9IA 5T1DB 4RDAA 2IM8A 3L8IA 5GPGB 3DJNB 3IHUA 4OINF 5JVEA 4JURI 3C8ZA 2HUJA 4K0DA 3TJ6A 4N6HA 5A6BA 1OR3A 2NUTB 3CSKA 4YK5A 3T6BA 5DQTA 3N24A 1QSPA 4KBLA 2OEVA 3CAXA 1H7IA 2J9UA 2WB7A 2LFDA 2WZGA 1WATA 2YVKA 2ZD9A 3QVZA 4G7ZF 2G62A 3B0UX 3IQ6A 1LI7A 4O79A 3ZSUA 2MYSA 2VH3A 4JTCB 3DZAA 4Q4ZF 2GA0A 2H7VC 2KYHA 1A7DA 2L6GA 1SR2A 1YA7O 1LI5A 4WABA 5FZTA 3LESA 1ORYA 4HFFB 3U8VA 4DVZA 1ZHTA 1HE9A 2WZLA 3GM1A 2D4UA 4MTOA 1I5NA 2VB6A 1O3UA 4EBBA 4AE4A 2L6FA 3GWLA 3ZQVA 2AVKA 2NUPB 3DE8A 5B1BC 1BR4A 3W8HA 1VK5A 1DOWA 2P1AA 4NY3A 3SXYA 3HTKC 3K7DA 1PCXA 3EGXB 3K1HA 5DS5A 1L3PA 4XPXA 3ZVRA 3Q6MA 1OXBA 4JTAB 1A0BA 3HJCA 5KYWA 1T9KA 4BJTA 5L0GA 3JSZA 2ETSA 2J7PD 3NG1A 4IWBA 4MTGA 1QKRA 2HSQA 2EINC 1VTMP 2IYLD 4YT5A 5JP7A 2Q00A 3C8GD 3A9CA 4MVRA 1GM5A 4OD4A 3NMJA 1S7ZA 2J7PA 4OD5A 2A6HF 5E3CA 4JEBA 1Z6AA 2O9XA 2FFHA 1Z5ZA 2CNWD 2HV7A 1O87A 3C8GA 3N0TA 1VB5A 5D92A 1YAUO 4NQFA 3KPHA 2OOCA 4MW3A 256BA 4BG0A 5CI8A 1C17M 1E84A 2NSGA 2LD6A 2KNHA 3F46A 4JW1A 3IPMO 4LERA 4EWCA 3K1IA 1ZYRF 4XEKA 4AK9A 1A7VA 3U0CA 1FFHA 3ZG1A 3K66A 5KYXB 3ABKC 3EH1A 2YWAA 1ZVZA 3QMKA 4MW8A 2B0HA 2P7VA 4FWVA 1NFNA 1CGOA 3LEVA 2HJ3A 3ITFA 4J32B 2ZXOA 3UMKA 3US6A 2R7QA 1ZU5A 3DAFA 3U9JA 3WODF 4EUKB 1FR0A 1JR8A 3S0XA 2EPNA 2XLMA 2Q9BA 1V54C 2C03A 4EHPA 3ABMC 3T6GB 4AX2A 3OEOA 4O6NA 4PJMA 1I4ZA 3B71A 3NYMA 5E2QA 4IGGA 1M6TA 2DI3A 4JVSA 2A0UA 3KH2A 2HV6A 4CIPA 3AGTA 3T6JA 1NLXA 2PX0A 4N4WA 2R7VA 3AG1C 2Q4FA 3C62A 2YLGA 3KYJA 2XL4A 4CJGA 4WJ0A 1JPNA 2PX3A 3UMHA 3ZTMA 2KK1A 1QLEC 3DMDA 2YHSA 3DI5A 4PACA 5AGFA 1TWHA 2H8AA 5E33A 3SXKA 2D5RB 5A69A 1CPQA 5COFA 3EFOA 3H65A 2OCCC 2Q9AA 4C3BA 3LS0A 4YT8A 4R32A 5K0IA 1T01A 4H4KC 4DRJB 4CS9A 2R7WA 3I4UA 3AG3C 1XZPA 3B0VC 2ICWG 1SYQA 1JRAA 3AG2C 1V74B 4HEAJ 4I3MA 1TQGA 2XM4A 4XWJA 2VCBA 3CEXA 4IAOA 2EIMC 1Z23A 2CYDA 3LS1A 2A1DD 3ZTZA 4JEAA 1HY5A 1MMAA 2NUTA 3GANA 5BUOA 3W4YA 1H9TA 5JRAA 1LKXA 1WTYA 2J8WA 5B3SC 3NMKA 2PF4E 2RSEB 4MTFA 4BJ6A 2TMVP 1FAPB 2VASA 4JCZA 4LLEA 2ZXWC 2HMQA 3L34A 3RKOF 4EKWA 2JD3A 4XEVA 4DJ9A 2YL0A 5AC5A 1GS9A 2ZPAA 1ZZPA 1YA9A 2DYSC 2J46A 4JZAA 4QI0A 1K05A 3LJBA 2XS8A 4U5FE 1JPJA 5L0CA 1VMAA 5L3QA 1APCA 4G7OF 4D4XA 2CCYA 4LDQA 1E85A 4U5DE 3AQCA 4FX5A 1NFOA 1D1AA 1OW8A 3O55A 1FMWA 3E70C 1ZHYA 4JKVA 2XRHA 1IZMA 1ZHWA 2R7SA 2LFFA 3AGUA 1CGNA 4E0HA 3V7OA 4CS8C 2NUPA 2W4BA 1C02A 1OCRC 2OJED 3CZ6A 3FMSA 3AOUA 3EPVA 4HFKB 4CDAA 5F5HA 2Q3TA 2HZ8A 4IRUA 2I8BA 1M2OA 1RKEB 3EGXA 4XLNF 3KYIA 1L7CA 2YL1A 2ZXPA 4XPWA 4DRIB 1AUEA 2Y3DA 3G50A 1YYJA 2JPUA 3B0PA 3TJ5A 1BR2A 5CIVA 1MNDA 4MVUA 2Y3HA 3N2ZB 5B3IA 3DJUB 4LACB 3RIPA 4QDLA 2XS1A 1OW7A 1NBBA 5TJ5E 2NG1A 1LIHA 4CDVA 4AL0A 2P0NA 2QLAA 2WVNA 2A0BA 3SYNA 4C7OA 4IARA 3FXHA 3BRJA 4O7GA 4P9FA 4CSAA 2FAPB 2OJQA 3VAYA 1KNYA 3LEOA 4JTDB 4WGZA 4U9EA 3S90A 1ZU4A 3IEEA 1LVKA 3LUTB 4EIYA 4JC7A 4JJGA 2W4MA 3JT1A 3U3FA 1XWJA 3WAQA 1BZ4A 1U0BB 2R7TA 2OEXA 3OWTA 1G5ZA 1QPUA 3WHNA 3M79A 3VF0A 2J0WA 1AEPA 4U5BE 4HE8D 2XXAA 3W8IA 3M1CB 4OIOF 1NU9C 1G4WR 3HNJA 4N6CA 4NTBA 2NPUA 3TK0A 1OCOC 1VOMA 4BJ1A 1AVOB 2AWYA 5JT4A 3QZCA 2AU5A 2YKZA 3KMIA 4N06A 3EHNA 1OQCA 2WVQA 2XM0A 4FESA 2Y3BA 4J7TA 4P6IC 4E0IA 1Q0GA 3I5QA 2VCCA 4ONSA 3V5XA 2EIJC 4O6YA 1ZHZA 2KW3C 3X2QC 3FVYA 3L0IA 3NKEA 3JZ0A 4J30B 4YN0B 2YEVA 1VLTA 3LNMB 1FNTc 4F4BA 3JCUQ 1Q0KA 2X51A 4WGYA 4YJWA 2J9WA 3EG9B 1WOLA 1VYIA 3M4BA 4XTKA 3RVZA 3R2PA 4U5EE 3F47A 4BJ5A 1ORJA 3MYFA 4A4AA 1RXQA 3JYHA 3AG4C 4ZLCA 3K6BA 3M15A 1F1MA 3O10A 4I1OB 2HS5A 4MQ9F 4NCQA 2XL8A 3UNGC 2WZFA 1OXKA 3DM9B 3UR3C 5DS6A 3K33A 1YZCA 2VC9A 3ZC4A 4NTFA 3M4CA 1HMDA 4H54A 4EBKA 3GODA 1TWGA 1RKCA 5L0JA 3VYWA 4G7HF 2EILC 4PK4A 1C03A 4DBQA 2W9YA 3SZRA 3ASOC 1R4TA 3PCVA 2XLEA 2GFHA 2JX0A 2KQ9A 3DD7A 3JTLO 1T6QA 1LE2A 3QW0A 4O6MA 2IXOA 2YLIA 1J8YF 3EZHA 3G4ZA 1GQAA 3HNLA 4JE9A 4YL3A 3S27A 3U8PA 2IXPA 2L9JA 1RCPA 4DOZA 1KU2A 3LLIA 5JSLA 1E2XA 3NYJA 4U5CE 3NKDA 3ZDLA 4CJOA 2R9RB 5L0IA 2L81A 3ATPA 4LDKA 5EK0A 3ABLC 5DQZA 1MNEA 3DM5A 1I4YA 1RJ9A 4I44A 2XL6A 4RD9A 5T3WA 1MMNA 4B6IA 1OKKA 1ZW2A 4MVZA 2XLOA 2DB4A 2J9VA 4MVSA 2NSFA 4MVMA 4YL0A 2L6HA 3LLKA 4P9TA 3UGOA 4PJLA 3MFNA 5DS4A 2LP4A 3K1IC 1N1CA 1W2WA 1E83A 3ZWIA 2BC5A 2OG2A 1FTSA 1ORSC 2P6VA 3W2VA 1M56C 3X1OA 5BQGA 3NDBB 1QVXA 1TFOB 1V4AA 5BQIA 3HLZA 3GEHA 3Q6NA 2J0XA 3SP1A 1YDIA 1LE4A 3MLGA 3DAGA 5COGA 1YJGA 2A6EF 2ASRA 2R05A 3LAYA 4E18A 2M64A 2W45A 1LS4A 4K1OA 1G4US 3Q7LA 1OCZC 1T6UA 1KTMA 4BPMA 3FHDA 3RW0A 3TOLA 4ULVA 4E7ZA 3GEEA 1LS1A 1OR2A 1QQ3A 1G8XA 1U6HA 2QE9A 2QUPA 3RQGA 2LIGA 3AJMA 3JYYA 5COMA 5KYNA 3ZQYA 2OU6A 3EGDB 3CQZA 4E7SA 5AC4A 2YL7A 3EQLF 1SZIA 3C63A 2A68F 4GEHA 3U5SA 1NSGB 4G0HA 5F5FA 1HW2A 1Y6DA 2H7OA 1T6IA 2IXMA 1B68A 3BEHA 2XSEA 1EA8A 2IXNA 2PBEA 3FAPB 3IQ5A 3JRTA 1YARO 4NTAA 4W8KA 4D4NA 2PFDA 2OKUA 4MVOA 4CBEA 3U9MA 5HV9A 2KJGA 3ECSA 3WG7C 1CGME 2EPLX 3RQEA 2HKVA 4I1MA 4CS9C 2EPOA 5DVWA 4XPYA 2J45A 3KL4A 3E9VA 1Q0FA 1CPRA 1D0XA 1Z3IX 3S28A 4IJJA 3EFOB 4LLCA 5CI9A 5EGYA 2G3VA 2Y3GA 3MBGA 5KYUB 1JMWA 3W2WA 2F22A 5A6KA 3L1MA 1Y4CA 3SXZA 1YVIA 4MS2A 3B9QA 4FAPB 3DXJF 4W8PA 3UGPA 3DE9A 1Q0MA 1S05A 4BJ6C 4E17A 5T3TA 3EG9A 1V55C 4PJJA 4KI2A 1K04A 3R7CA 5JLIA 2GDCA 4U5HA 2V3CC 1PV3A 1WGWA 1WWPA 1TR2A 1YLMA 3QW1A 4J7YA 3LNRA 2AWCA 4MNDA 4DRHB 5KYXA 1MQVA 1DOVA 3S84A 4CDYA 1VLSA 2WL8A 4CIHA 2DGJA 4JIOA 4KNVA 2QY9A 3RF3A 3VM6A 2DYRC 3SEOA 1RMVA 2HMZA 2MWQA 4LDRA 3GWNA 4U9DA 1XZQA 2KC3A 1D0ZA 3GORA 1H9GA 2PP4A 2YZSA 3RFYA 3V5YA 1TFKB 4X0RA 4OIRF 3O6XA 2ZXRA 1M2VB 2FGYA 2LK4A 5IY5C 1EQ1A 1JAFA 3H2VA 2XLHA 1D1CA 4IB4A 1HW1A 4CS7A 1JOGA 3ASNC 3SNHA 1HMOA 2KGOA 1QZXA 3FOOA 2V26A 2CGEA 2PNOA 3TOMA 4DVYP 2J9BA 4PFOA 1UFBA 4GYTA 5A6JA 2M4EA 5E3AA 4PJNA 4BEJA 3U3BA 1FMVA 5EHHA 4ANJA 2Y69C 4CX9A 3POVA 4BEMJ 3G4XA 4GQHA 1BBHA 3EJNA 4CSAC 5L3VA 3NMIA 3C7JA 4MVQA 1WASA 2LQGA 2AP3A 4YL1A 5KYYB 5F28E 3RYLA 4OIQF 3MX3A 4Z9JA 3OA1A 1WN0A 1YYXA 2R7RA 1HE1A 2H7BA 4L6RA 2P61A 2A69F 1MMGA 1OCCC 4AL1A 1GGQA 1O5HA 3AQBA 2CDQA 2HJMA 1EKYA 2R25A 1TWCA 3C18A 5A6AA 2CW0F 3H2UA 5FCLA 4ZLDA 2CNWA 4AE4B 3FDQA 2YQYA 1PD0A 4YT2A 3FAJA 5KYYA 1VYKA 2OQMA 4NC3A 1K40A 2B0JA 2R7OA 3V5ZA 3QTHA 5L0HA 2XXAB 1OKKD 4IAQA 5KYWB 1U89A 1Q0DA 4PFPA 3SXMA 1M57C 2R02A 2EPKX 3EGDA 3MYIA 3TQOA 3DWWA 2QNLA 3I5PA 3UMIA 4KNWA 4C7OB 3IQCA 3L8JA 3Q7GA 3S29A 2HFIA 5DLJA 3TULA 2R7XA 3DKAA 1RKEA 2UUIA 4C3EA 1H6GA 4DBRA 1MMDA 2XLVA 4G78A 4A2NB 5D91A 4CS8A 4BJ5C 3C8GB 1YZAA 1A7EA 4QI2A 2Q9CA 5JUAA 1E86A 3U2MA 2LSEA 2L7AA 2MHRA 3EZIA 3U2LA 4OIPF 4JJFA 2KSFA 2IBFA 1ZW3A 3GEIA 2I15A 4JRZA 5HSWA 3QVYA 4YT4A 1BR1A 2GWWA 3HKKA 3RVYA 5KYUA 1ZHXA 4XEFA 2Y39A 1OW6A 2EIKC 3T9OA 1D0YA 4Q7CA 3GM2A 2UUHA 4DXWA 1Z7Qc 3J06A 1Z63A 3T4RA 3EH2A 4XQ1A 2X0CA 1NG1A 3A11A 2YL3A 2HSBA 3B29A 3NRHA 3JSEO 3O39A 4UDVA 3VRCA 2IOQA 3FOPA 2R7UA 1PD1A 2YLDA 1T5OA 4M63A 2C04A
chains in the Genus database with same CATH topology
1ORSC 4MTFA 4MVOA 3LUTB 4MVUA 3RVZA 4JTAB 4EKWA 2R9RB 3RVYA 5EK0A 4MW8A 4MTGA 3RW0A 4JTCB 4MVQA 2KYHA 4MVRA 4DXWA 4MVZA 4MVMA 4MVSA 4MS2A 4JTDB 4MTOA 3LNMB 4MW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORS C;  4MTF A;  4MVO A;  3LUT B;  4MVU A;  3RVZ A;  4JTA B;  4EKW A;  2R9R B;  3RVY A;  5EK0 A;  4MW8 A;  4MTG A;  3RW0 A;  4JTC B;  4MVQ A;  2KYH A;  4MVR A;  4DXW A;  4MVZ A;  4MVM A;  4MVS A;  4MS2 A;  4JTD B;  4MTO A;  3LNM B;  4MW3 A; 
#chains in the Genus database with same CATH topology
 2XLD A;  2BL2 A;  4C3D A;  2QTV A;  4U5G A;  2GAQ A;  3KKB A;  1IW7 F;  1A41 A;  1NZE A;  2VCA A;  3HNI A;  3PDM P;  3RH3 A;  5B1A C;  4YWQ A;  4ER9 A;  2BE5 F;  2EPM X;  1FFT C;  2Z15 A;  3RQF A;  1R5I D;  1BDJ B;  3HNK A;  2WVO A;  3IQT A;  5JS5 A;  5L0D A;  4K7B A;  1LPE A;  3PMR A;  2YRF A;  2E87 A;  1ST6 A;  2Q7R A;  1UG7 A;  2LCH A;  1M2V A;  3EHM A;  1TKN A;  1EI7 A;  5L0F A;  5BQH A;  1SMY F;  2R03 A;  2XLW A;  4Z9H A;  4EBJ A;  4Q5S F;  1NU7 D;  3GM3 A;  1D1B A;  1RJ9 B;  1TWA A;  1J8M F;  3PHF 2;  4ULW A;  3S9O A;  1SF8 A;  2RD9 A;  1LM3 B;  4KC9 A;  2G3K A;  4RBN A;  5A6B D;  3NYL A;  4JCH A;  4PR9 A;  3TD7 A;  3ZIB A;  3JRM O;  4XLP F;  4Z9I A;  5T1D B;  4RDA A;  2IM8 A;  3L8I A;  5GPG B;  3DJN B;  3IHU A;  4OIN F;  5JVE A;  4JUR I;  3C8Z A;  2HUJ A;  4K0D A;  3TJ6 A;  4N6H A;  5A6B A;  1OR3 A;  2NUT B;  3CSK A;  4YK5 A;  3T6B A;  5DQT A;  3N24 A;  1QSP A;  4KBL A;  2OEV A;  3CAX A;  1H7I A;  2J9U A;  2WB7 A;  2LFD A;  2WZG A;  1WAT A;  2YVK A;  2ZD9 A;  3QVZ A;  4G7Z F;  2G62 A;  3B0U X;  3IQ6 A;  1LI7 A;  4O79 A;  3ZSU A;  2MYS A;  2VH3 A;  4JTC B;  3DZA A;  4Q4Z F;  2GA0 A;  2H7V C;  2KYH A;  1A7D A;  2L6G A;  1SR2 A;  1YA7 O;  1LI5 A;  4WAB A;  5FZT A;  3LES A;  1ORY A;  4HFF B;  3U8V A;  4DVZ A;  1ZHT A;  1HE9 A;  2WZL A;  3GM1 A;  2D4U A;  4MTO A;  1I5N A;  2VB6 A;  1O3U A;  4EBB A;  4AE4 A;  2L6F A;  3GWL A;  3ZQV A;  2AVK A;  2NUP B;  3DE8 A;  5B1B C;  1BR4 A;  3W8H A;  1VK5 A;  1DOW A;  2P1A A;  4NY3 A;  3SXY A;  3HTK C;  3K7D A;  1PCX A;  3EGX B;  3K1H A;  5DS5 A;  1L3P A;  4XPX A;  3ZVR A;  3Q6M A;  1OXB A;  4JTA B;  1A0B A;  3HJC A;  5KYW A;  1T9K A;  4BJT A;  5L0G A;  3JSZ A;  2ETS A;  2J7P D;  3NG1 A;  4IWB A;  4MTG A;  1QKR A;  2HSQ A;  2EIN C;  1VTM P;  2IYL D;  4YT5 A;  5JP7 A;  2Q00 A;  3C8G D;  3A9C A;  4MVR A;  1GM5 A;  4OD4 A;  3NMJ A;  1S7Z A;  2J7P A;  4OD5 A;  2A6H F;  5E3C A;  4JEB A;  1Z6A A;  2O9X A;  2FFH A;  1Z5Z A;  2CNW D;  2HV7 A;  1O87 A;  3C8G A;  3N0T A;  1VB5 A;  5D92 A;  1YAU O;  4NQF A;  3KPH A;  2OOC A;  4MW3 A;  256B A;  4BG0 A;  5CI8 A;  1C17 M;  1E84 A;  2NSG A;  2LD6 A;  2KNH A;  3F46 A;  4JW1 A;  3IPM O;  4LER A;  4EWC A;  3K1I A;  1ZYR F;  4XEK A;  4AK9 A;  1A7V A;  3U0C A;  1FFH A;  3ZG1 A;  3K66 A;  5KYX B;  3ABK C;  3EH1 A;  2YWA A;  1ZVZ A;  3QMK A;  4MW8 A;  2B0H A;  2P7V A;  4FWV A;  1NFN A;  1CGO A;  3LEV A;  2HJ3 A;  3ITF A;  4J32 B;  2ZXO A;  3UMK A;  3US6 A;  2R7Q A;  1ZU5 A;  3DAF A;  3U9J A;  3WOD F;  4EUK B;  1FR0 A;  1JR8 A;  3S0X A;  2EPN A;  2XLM A;  2Q9B A;  1V54 C;  2C03 A;  4EHP A;  3ABM C;  3T6G B;  4AX2 A;  3OEO A;  4O6N A;  4PJM A;  1I4Z A;  3B71 A;  3NYM A;  5E2Q A;  4IGG A;  1M6T A;  2DI3 A;  4JVS A;  2A0U A;  3KH2 A;  2HV6 A;  4CIP A;  3AGT A;  3T6J A;  1NLX A;  2PX0 A;  4N4W A;  2R7V A;  3AG1 C;  2Q4F A;  3C62 A;  2YLG A;  3KYJ A;  2XL4 A;  4CJG A;  4WJ0 A;  1JPN A;  2PX3 A;  3UMH A;  3ZTM A;  2KK1 A;  1QLE C;  3DMD A;  2YHS A;  3DI5 A;  4PAC A;  5AGF A;  1TWH A;  2H8A A;  5E33 A;  3SXK A;  2D5R B;  5A69 A;  1CPQ A;  5COF A;  3EFO A;  3H65 A;  2OCC C;  2Q9A A;  4C3B A;  3LS0 A;  4YT8 A;  4R32 A;  5K0I A;  1T01 A;  4H4K C;  4DRJ B;  4CS9 A;  2R7W A;  3I4U A;  3AG3 C;  1XZP A;  3B0V C;  2ICW G;  1SYQ A;  1JRA A;  3AG2 C;  1V74 B;  4HEA J;  4I3M A;  1TQG A;  2XM4 A;  4XWJ A;  2VCB A;  3CEX A;  4IAO A;  2EIM C;  1Z23 A;  2CYD A;  3LS1 A;  2A1D D;  3ZTZ A;  4JEA A;  1HY5 A;  1MMA A;  2NUT A;  3GAN A;  5BUO A;  3W4Y A;  1H9T A;  5JRA A;  1LKX A;  1WTY A;  2J8W A;  5B3S C;  3NMK A;  2PF4 E;  2RSE B;  4MTF A;  4BJ6 A;  2TMV P;  1FAP B;  2VAS A;  4JCZ A;  4LLE A;  2ZXW C;  2HMQ A;  3L34 A;  3RKO F;  4EKW A;  2JD3 A;  4XEV A;  4DJ9 A;  2YL0 A;  5AC5 A;  1GS9 A;  2ZPA A;  1ZZP A;  1YA9 A;  2DYS C;  2J46 A;  4JZA A;  4QI0 A;  1K05 A;  3LJB A;  2XS8 A;  4U5F E;  1JPJ A;  5L0C A;  1VMA A;  5L3Q A;  1APC A;  4G7O F;  4D4X A;  2CCY A;  4LDQ A;  1E85 A;  4U5D E;  3AQC A;  4FX5 A;  1NFO A;  1D1A A;  1OW8 A;  3O55 A;  1FMW A;  3E70 C;  1ZHY A;  4JKV A;  2XRH A;  1IZM A;  1ZHW A;  2R7S A;  2LFF A;  3AGU A;  1CGN A;  4E0H A;  3V7O A;  4CS8 C;  2NUP A;  2W4B A;  1C02 A;  1OCR C;  2OJE D;  3CZ6 A;  3FMS A;  3AOU A;  3EPV A;  4HFK B;  4CDA A;  5F5H A;  2Q3T A;  2HZ8 A;  4IRU A;  2I8B A;  1M2O A;  1RKE B;  3EGX A;  4XLN F;  3KYI A;  1L7C A;  2YL1 A;  2ZXP A;  4XPW A;  4DRI B;  1AUE A;  2Y3D A;  3G50 A;  1YYJ A;  2JPU A;  3B0P A;  3TJ5 A;  1BR2 A;  5CIV A;  1MND A;  4MVU A;  2Y3H A;  3N2Z B;  5B3I A;  3DJU B;  4LAC B;  3RIP A;  4QDL A;  2XS1 A;  1OW7 A;  1NBB A;  5TJ5 E;  2NG1 A;  1LIH A;  4CDV A;  4AL0 A;  2P0N A;  2QLA A;  2WVN A;  2A0B A;  3SYN A;  4C7O A;  4IAR A;  3FXH A;  3BRJ A;  4O7G A;  4P9F A;  4CSA A;  2FAP B;  2OJQ A;  3VAY A;  1KNY A;  3LEO A;  4JTD B;  4WGZ A;  4U9E A;  3S90 A;  1ZU4 A;  3IEE A;  1LVK A;  3LUT B;  4EIY A;  4JC7 A;  4JJG A;  2W4M A;  3JT1 A;  3U3F A;  1XWJ A;  3WAQ A;  1BZ4 A;  1U0B B;  2R7T A;  2OEX A;  3OWT A;  1G5Z A;  1QPU A;  3WHN A;  3M79 A;  3VF0 A;  2J0W A;  1AEP A;  4U5B E;  4HE8 D;  2XXA A;  3W8I A;  3M1C B;  4OIO F;  1NU9 C;  1G4W R;  3HNJ A;  4N6C A;  4NTB A;  2NPU A;  3TK0 A;  1OCO C;  1VOM A;  4BJ1 A;  1AVO B;  2AWY A;  5JT4 A;  3QZC A;  2AU5 A;  2YKZ A;  3KMI A;  4N06 A;  3EHN A;  1OQC A;  2WVQ A;  2XM0 A;  4FES A;  2Y3B A;  4J7T A;  4P6I C;  4E0I A;  1Q0G A;  3I5Q A;  2VCC A;  4ONS A;  3V5X A;  2EIJ C;  4O6Y A;  1ZHZ A;  2KW3 C;  3X2Q C;  3FVY A;  3L0I A;  3NKE A;  3JZ0 A;  4J30 B;  4YN0 B;  2YEV A;  1VLT A;  3LNM B;  1FNT c;  4F4B A;  3JCU Q;  1Q0K A;  2X51 A;  4WGY A;  4YJW A;  2J9W A;  3EG9 B;  1WOL A;  1VYI A;  3M4B A;  4XTK A;  3RVZ A;  3R2P A;  4U5E E;  3F47 A;  4BJ5 A;  1ORJ A;  3MYF A;  4A4A A;  1RXQ A;  3JYH A;  3AG4 C;  4ZLC A;  3K6B A;  3M15 A;  1F1M A;  3O10 A;  4I1O B;  2HS5 A;  4MQ9 F;  4NCQ A;  2XL8 A;  3UNG C;  2WZF A;  1OXK A;  3DM9 B;  3UR3 C;  5DS6 A;  3K33 A;  1YZC A;  2VC9 A;  3ZC4 A;  4NTF A;  3M4C A;  1HMD A;  4H54 A;  4EBK A;  3GOD A;  1TWG A;  1RKC A;  5L0J A;  3VYW A;  4G7H F;  2EIL C;  4PK4 A;  1C03 A;  4DBQ A;  2W9Y A;  3SZR A;  3ASO C;  1R4T A;  3PCV A;  2XLE A;  2GFH A;  2JX0 A;  2KQ9 A;  3DD7 A;  3JTL O;  1T6Q A;  1LE2 A;  3QW0 A;  4O6M A;  2IXO A;  2YLI A;  1J8Y F;  3EZH A;  3G4Z A;  1GQA A;  3HNL A;  4JE9 A;  4YL3 A;  3S27 A;  3U8P A;  2IXP A;  2L9J A;  1RCP A;  4DOZ A;  1KU2 A;  3LLI A;  5JSL A;  1E2X A;  3NYJ A;  4U5C E;  3NKD A;  3ZDL A;  4CJO A;  2R9R B;  5L0I A;  2L81 A;  3ATP A;  4LDK A;  5EK0 A;  3ABL C;  5DQZ A;  1MNE A;  3DM5 A;  1I4Y A;  1RJ9 A;  4I44 A;  2XL6 A;  4RD9 A;  5T3W A;  1MMN A;  4B6I A;  1OKK A;  1ZW2 A;  4MVZ A;  2XLO A;  2DB4 A;  2J9V A;  4MVS A;  2NSF A;  4MVM A;  4YL0 A;  2L6H A;  3LLK A;  4P9T A;  3UGO A;  4PJL A;  3MFN A;  5DS4 A;  2LP4 A;  3K1I C;  1N1C A;  1W2W A;  1E83 A;  3ZWI A;  2BC5 A;  2OG2 A;  1FTS A;  1ORS C;  2P6V A;  3W2V A;  1M56 C;  3X1O A;  5BQG A;  3NDB B;  1QVX A;  1TFO B;  1V4A A;  5BQI A;  3HLZ A;  3GEH A;  3Q6N A;  2J0X A;  3SP1 A;  1YDI A;  1LE4 A;  3MLG A;  3DAG A;  5COG A;  1YJG A;  2A6E F;  2ASR A;  2R05 A;  3LAY A;  4E18 A;  2M64 A;  2W45 A;  1LS4 A;  4K1O A;  1G4U S;  3Q7L A;  1OCZ C;  1T6U A;  1KTM A;  4BPM A;  3FHD A;  3RW0 A;  3TOL A;  4ULV A;  4E7Z A;  3GEE A;  1LS1 A;  1OR2 A;  1QQ3 A;  1G8X A;  1U6H A;  2QE9 A;  2QUP A;  3RQG A;  2LIG A;  3AJM A;  3JYY A;  5COM A;  5KYN A;  3ZQY A;  2OU6 A;  3EGD B;  3CQZ A;  4E7S A;  5AC4 A;  2YL7 A;  3EQL F;  1SZI A;  3C63 A;  2A68 F;  4GEH A;  3U5S A;  1NSG B;  4G0H A;  5F5F A;  1HW2 A;  1Y6D A;  2H7O A;  1T6I A;  2IXM A;  1B68 A;  3BEH A;  2XSE A;  1EA8 A;  2IXN A;  2PBE A;  3FAP B;  3IQ5 A;  3JRT A;  1YAR O;  4NTA A;  4W8K A;  4D4N A;  2PFD A;  2OKU A;  4MVO A;  4CBE A;  3U9M A;  5HV9 A;  2KJG A;  3ECS A;  3WG7 C;  1CGM E;  2EPL X;  3RQE A;  2HKV A;  4I1M A;  4CS9 C;  2EPO A;  5DVW A;  4XPY A;  2J45 A;  3KL4 A;  3E9V A;  1Q0F A;  1CPR A;  1D0X A;  1Z3I X;  3S28 A;  4IJJ A;  3EFO B;  4LLC A;  5CI9 A;  5EGY A;  2G3V A;  2Y3G A;  3MBG A;  5KYU B;  1JMW A;  3W2W A;  2F22 A;  5A6K A;  3L1M A;  1Y4C A;  3SXZ A;  1YVI A;  4MS2 A;  3B9Q A;  4FAP B;  3DXJ F;  4W8P A;  3UGP A;  3DE9 A;  1Q0M A;  1S05 A;  4BJ6 C;  4E17 A;  5T3T A;  3EG9 A;  1V55 C;  4PJJ A;  4KI2 A;  1K04 A;  3R7C A;  5JLI A;  2GDC A;  4U5H A;  2V3C C;  1PV3 A;  1WGW A;  1WWP A;  1TR2 A;  1YLM A;  3QW1 A;  4J7Y A;  3LNR A;  2AWC A;  4MND A;  4DRH B;  5KYX A;  1MQV A;  1DOV A;  3S84 A;  4CDY A;  1VLS A;  2WL8 A;  4CIH A;  2DGJ A;  4JIO A;  4KNV A;  2QY9 A;  3RF3 A;  3VM6 A;  2DYR C;  3SEO A;  1RMV A;  2HMZ A;  2MWQ A;  4LDR A;  3GWN A;  4U9D A;  1XZQ A;  2KC3 A;  1D0Z A;  3GOR A;  1H9G A;  2PP4 A;  2YZS A;  3RFY A;  3V5Y A;  1TFK B;  4X0R A;  4OIR F;  3O6X A;  2ZXR A;  1M2V B;  2FGY A;  2LK4 A;  5IY5 C;  1EQ1 A;  1JAF A;  3H2V A;  2XLH A;  1D1C A;  4IB4 A;  1HW1 A;  4CS7 A;  1JOG A;  3ASN C;  3SNH A;  1HMO A;  2KGO A;  1QZX A;  3FOO A;  2V26 A;  2CGE A;  2PNO A;  3TOM A;  4DVY P;  2J9B A;  4PFO A;  1UFB A;  4GYT A;  5A6J A;  2M4E A;  5E3A A;  4PJN A;  4BEJ A;  3U3B A;  1FMV A;  5EHH A;  4ANJ A;  2Y69 C;  4CX9 A;  3POV A;  4BEM J;  3G4X A;  4GQH A;  1BBH A;  3EJN A;  4CSA C;  5L3V A;  3NMI A;  3C7J A;  4MVQ A;  1WAS A;  2LQG A;  2AP3 A;  4YL1 A;  5KYY B;  5F28 E;  3RYL A;  4OIQ F;  3MX3 A;  4Z9J A;  3OA1 A;  1WN0 A;  1YYX A;  2R7R A;  1HE1 A;  2H7B A;  4L6R A;  2P61 A;  2A69 F;  1MMG A;  1OCC C;  4AL1 A;  1GGQ A;  1O5H A;  3AQB A;  2CDQ A;  2HJM A;  1EKY A;  2R25 A;  1TWC A;  3C18 A;  5A6A A;  2CW0 F;  3H2U A;  5FCL A;  4ZLD A;  2CNW A;  4AE4 B;  3FDQ A;  2YQY A;  1PD0 A;  4YT2 A;  3FAJ A;  5KYY A;  1VYK A;  2OQM A;  4NC3 A;  1K40 A;  2B0J A;  2R7O A;  3V5Z A;  3QTH A;  5L0H A;  2XXA B;  1OKK D;  4IAQ A;  5KYW B;  1U89 A;  1Q0D A;  4PFP A;  3SXM A;  1M57 C;  2R02 A;  2EPK X;  3EGD A;  3MYI A;  3TQO A;  3DWW A;  2QNL A;  3I5P A;  3UMI A;  4KNW A;  4C7O B;  3IQC A;  3L8J A;  3Q7G A;  3S29 A;  2HFI A;  5DLJ A;  3TUL A;  2R7X A;  3DKA A;  1RKE A;  2UUI A;  4C3E A;  1H6G A;  4DBR A;  1MMD A;  2XLV A;  4G78 A;  4A2N B;  5D91 A;  4CS8 A;  4BJ5 C;  3C8G B;  1YZA A;  1A7E A;  4QI2 A;  2Q9C A;  5JUA A;  1E86 A;  3U2M A;  2LSE A;  2L7A A;  2MHR A;  3EZI A;  3U2L A;  4OIP F;  4JJF A;  2KSF A;  2IBF A;  1ZW3 A;  3GEI A;  2I15 A;  4JRZ A;  5HSW A;  3QVY A;  4YT4 A;  1BR1 A;  2GWW A;  3HKK A;  3RVY A;  5KYU A;  1ZHX A;  4XEF A;  2Y39 A;  1OW6 A;  2EIK C;  3T9O A;  1D0Y A;  4Q7C A;  3GM2 A;  2UUH A;  4DXW A;  1Z7Q c;  3J06 A;  1Z63 A;  3T4R A;  3EH2 A;  4XQ1 A;  2X0C A;  1NG1 A;  3A11 A;  2YL3 A;  2HSB A;  3B29 A;  3NRH A;  3JSE O;  3O39 A;  4UDV A;  3VRC A;  2IOQ A;  3FOP A;  2R7U A;  1PD1 A;  2YLD A;  1T5O A;  4M63 A;  2C04 A; 
#chains in the Genus database with same CATH homology
 1ORS C;  4MTF A;  4MVO A;  3LUT B;  4MVU A;  3RVZ A;  4JTA B;  4EKW A;  2R9R B;  3RVY A;  5EK0 A;  4MW8 A;  4MTG A;  3RW0 A;  4JTC B;  4MVQ A;  2KYH A;  4MVR A;  4DXW A;  4MVZ A;  4MVM A;  4MVS A;  4MS2 A;  4JTD B;  4MTO A;  3LNM B;  4MW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...