2QUPA

Crystal structure of uncharacterized protein bh1478 from bacillus halodurans
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
122
structure length
119
Chain Sequence
GVSFSEVMGKQRDEKAYERLQALMSKIDDQGKLLSETRTIEELRKYKELVKEFVGDAVELGLRLEERNRRGRTKIYKIVKEVDRKLLDLTDAVLAKEKKGLDILNMVGEIKGLLINIYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH1478 protein
publication title Crystal Structure of Uncharacterized Protein Bh1478 from Bacillus Halodurans.
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 55
structure length 119
sequence length 122
ec nomenclature
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03885 DUF327 Protein of unknown function (DUF327)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hypothetical protein TM1646-like domain 2qupA00
2QUPA 2P61A
chains in the Genus database with same CATH superfamily
4IWBA 1L7CA 1OXKA 3W2WA 5F5HA 2YHSA 3GM3A 4ANJA 4EUKB 4Q5SF 3KL4A 4I1MA 3B0VC 3AQBA 3ZQVA 2AU5A 2YWAA 2Y69C 3EFOB 2EPKX 1OKKA 3HLZA 4GQHA 2ETSA 3W2VA 4AX2A 4B6IA 2LCHA 1OW7A 2HMZA 2EIKC 1WATA 2ZXOA 3EG9B 4CS7A 4JIOA 5EHHA 2WZLA 3VRCA 4DRHB 5T1DB 1D0YA 4NC3A 4NY3A 1F1MA 3MYIA 3SXKA 3AG1C 1OW8A 5A6KA 4QI0A 2IXNA 1MMDA 3RQEA 3S28A 4BJ6A 2XLWA 4E7SA 2WL8A 4CS8C 2OCCC 3LS0A 3BRJA 2H7VC 2NSFA 2YLDA 1TWAA 1E84A 1V55C 4MNDA 2QTVA 1WTYA 1LI5A 4LLEA 1RCPA 1JOGA 1O87A 2HV7A 1QQ3A 2NUTA 3I5QA 1O3UA 2H7OA 4XQ1A 3K33A 1OQCA 3B9QA 1FAPB 4MVMA 3V5XA 2WVNA 1NSGB 1T01A 3EHNA 3LEOA 2VCCA 3EHMA 1XZQA 3L8JA 1I4ZA 2AWYA 2W4BA 3F46A 3QVYA 3TOLA 4D4XA 4QDLA 3L0IA 3PDMP 1LM3B 3UGPA 2ASRA 1WASA 2CNWA 3M1CB 4Z9IA 3RVYA 3T6JA 3U8VA 5K0IA 5KYXB 4JCZA 1V54C 3ABLC 2L6FA 5IY5C 1VK5A 2DGJA 2VCAA 3O55A 3W8IA 2R7WA 3QW1A 3E70C 1GGQA 3C7JA 2KNHA 3GEIA 3A9CA 3KH2A 2L7AA 4YK5A 2LP4A 5FZTA 2KW3C 1AEPA 4CJGA 5BQHA 4XLNF 3BEHA 1H6GA 3VYWA 4A2NB 2YL3A 2OJQA 3EQLF 3RIPA 1H9GA 1ST6A 2X0CA 2R02A 2NUPB 3UMIA 1KU2A 2M4EA 2XL6A 3WODF 3B71A 1XZPA 1SF8A 4J7YA 1M2VA 3FOOA 2P1AA 1O5HA 3H65A 4J32B 4DXWA 2EINC 4NQFA 4JTDB 4OIQF 4HEAJ 4U5GA 5CI8A 1T9KA 2J45A 2XS8A 3EFOA 1B68A 2PX0A 1VLTA 4LDKA 5DLJA 2V26A 2R7UA 1NFOA 3DD7A 1DOVA 1HW2A 3U2LA 4L6RA 5A6JA 3KKBA 2EIMC 2A0UA 3R7CA 1ZHXA 3FOPA 3X1OA 4AE4B 2J8WA 4R32A 2QNLA 1LKXA 3ZDLA 4YT8A 1NU7D 1G5ZA 2OEVA 4C3EA 1IW7F 2XXAA 1FTSA 4UDVA 4CDYA 4EBKA 4OIOF 1JR8A 2Q00A 3C62A 4MVOA 3X2QC 1Z5ZA 2J9WA 3EZHA 3W8HA 2FAPB 5DS5A 1OR3A 2B0JA 2OQMA 4JKVA 1GQAA 3GEHA 3LNRA 4PACA 4D4NA 4WGZA 3DI5A 3JZ0A 3RF3A 1YVIA 2OKUA 4A4AA 4U5EE 5F28E 2NPUA 1ZHZA 4KI2A 3M79A 3B29A 2IXOA 2VCBA 3K7DA 1GS9A 2YZSA 5KYXA 3IHUA 1MQVA 3AG4C 5L3VA 2A68F 3ECSA 2LFDA 4OD4A 3TJ5A 3POVA 1Q0DA 2JD3A 1MMNA 2QLAA 5L3QA 1UG7A 2Y39A 2IXPA 3NYMA 4MTOA 3AG3C 2Q4FA 2Y3GA 2ZXPA 1LVKA 3EGXA 4E0HA 5DS4A 3US6A 3OA1A 1Z6AA 4CDVA 4CIPA 3Q7LA 2ICWG 1KTMA 5L0DA 2R7TA 1MMGA 3C8GA 3DMDA 2J0XA 4AL1A 1QPUA 3G4XA 3H2UA 4CIHA 5A6BD 5KYWB 2P6VA 1T6QA 3LS1A 3AGUA 2IOQA 4LERA 2LK4A 2Q3TA 3EGDB 3NKEA 5CI9A 5E3CA 1CGNA 3N2ZB 4XEFA 4DVYP 5L0GA 2XL4A 4JJGA 5AGFA 3F47A 4XEVA 3O6XA 4LACB 3U3FA 1U89A 2Y3HA 4RD9A 4IJJA 5HV9A 4CDAA 5FCLA 2G62A 3HNKA 2OEXA 1JRAA 4OINF 3RFYA 5B3SC 3QW0A 3ABMC 2PF4E 1J8YF 2PP4A 2Y3BA 4PK4A 4RDAA 3LLKA 4Z9JA 4HFFB 1D0XA 2J0WA 3U9MA 1ZVZA 2H8AA 4JJFA 5DQZA 2XSEA 4IAQA 2OJED 3VF0A 3ZSUA 4J30B 2R7VA 3G4ZA 1MNDA 1I5NA 1C03A 4HE8D 4J7TA 3W4YA 3ZQYA 1CGME 3M4BA 2VASA 2PNOA 1RXQA 2YKZA 1S05A 1AUEA 3LUTB 3MBGA 2L6HA 4CS9C 1MNEA 3U9JA 1FMWA 1Z3IX 1NU9C 4N6CA 1GM5A 4YT4A 4C3DA 5JVEA 4WJ0A 2A1DD 4G78A 1VTMP 3AG2C 5L0FA 4O7GA 3Q6MA 2XLVA 3GWLA 4K1OA 4MVRA 4DRJB 2EIJC 3U8PA 2P61A 1T5OA 4I3MA 1M6TA 3JCUQ 4PJJA 3U0CA 5COGA 3SP1A 2HSQA 1EA8A 5KYUB 5JSLA 3UGOA 2KQ9A 1JAFA 2YEVA 3SXMA 2YQYA 3MFNA 2L6GA 3C63A 4MVZA 3ZVRA 4FESA 1FMVA 4EIYA 3JYYA 5HSWA 4GYTA 3V7OA 4ULVA 1NLXA 3AJMA 3FDQA 1KNYA 2R7RA 1TKNA 3RW0A 1WWPA 1CPQA 2R7OA 4JTAB 3H2VA 3NYLA 3DJUB 3KYIA 2XLMA 2Q9BA 4JZAA 4K7BA 3ZTZA 4OIPF 3GM1A 2KC3A 4IGGA 3LJBA 4CX9A 2XLHA 1Y4CA 3HNJA 2GWWA 3K6BA 3JRMO 2R03A 3SZRA 3K1IA 3KPHA 4JEAA 3ZG1A 5KYWA 1RKEA 1YARO 4IARA 2J7PD 4I1OB 1U0BB 1OCCC 2CW0F 2CGEA 2YVKA 4XPYA 4W8PA 1OCOC 5AC4A 2YLGA 5JLIA 2BC5A 1E85A 2G3VA 2ZD9A 4XTKA 1HMDA 4DJ9A 4YN0B 3DM9B 5JT4A 3M4CA 3PMRA 1Z7Qc 2IYLD 4PFOA 1S7ZA 1APCA 3HNIA 3MX3A 4ZLCA 2I15A 2JX0A 5JRAA 5JS5A 3C18A 3AGTA 2EPNA 2HSBA 1TWGA 3N0TA 4KNVA 1OKKD 4XPXA 4CJOA 1G4US 2AP3A 3GODA 4Z9HA 5L0IA 2W45A 4U5CE 2J9VA 2WVQA 3GEEA 2XLEA 3K1HA 3RVZA 5L0CA 3CAXA 4XEKA 3EG9A 4YWQA 1RJ9B 4P9TA 2AVKA 2RSEB 1HY5A 1JPNA 4MVUA 4CSAC 5A6BA 2WZFA 4BPMA 1VMAA 4N4WA 4U5HA 2B0HA 4JW1A 1LI7A 2ZXWC 4E17A 4P6IC 3HJCA 4JRZA 2Z15A 4YL0A 2CDQA 2LD6A 3QTHA 3UMKA 3UNGC 3PHF2 3GWNA 1ZW2A 2HKVA 4G7HF 1QVXA 2YRFA 4PJLA 1T6IA 1YZCA 4DVZA 3K1IC 4FX5A 1E83A 1E86A 3LESA 3S9OA 2JPUA 4U5FE 1IZMA 4CBEA 2HUJA 4MTFA 4YJWA 4BEJA 3S84A 1LS4A 3QVZA 1FFHA 4W8KA 1OR2A 4MVSA 3IPMO 2CNWD 1HW1A 2YL0A 3LLIA 4Q7CA 4C7OB 2C04A 1HE1A 1A7DA 2HJ3A 4MW3A 5E3AA 5T3WA 2W9YA 5CIVA 4O6NA 4DBQA 2XLDA 3S0XA 4CS9A 3N24A 3ASNC 2LIGA 3GM2A 1A7VA 5DVWA 4MVQA 2HMQA 2XS1A 1CPRA 2VH3A 1EKYA 3V5ZA 2FFHA 3S90A 1YZAA 3HTKC 3ZWIA 1K05A 4N6HA 3SXZA 2CYDA 3SXYA 1W2WA 2PX3A 2LQGA 1YA7O 3O39A 1CGOA 4OIRF 4P9FA 1WN0A 5L0HA 1XWJA 4XPWA 2NUPA 5F5FA 4IRUA 1SMYF 3DKAA 3L8IA 3WHNA 1ZHTA 3ITFA 3JYHA 3NRHA 1FNTc 4XWJA 3NDBB 1BBHA 1FFTC 4LDQA 2MWQA 2XM0A 1AVOB 1ZU5A 1ZHYA 4JTCB 5L0JA 1H9TA 1D1BA 2G3KA 4ZLDA 1TFKB 1HE9A 1N1CA 4MS2A 256BA 2P7VA 3AOUA 3U5SA 3B0UX 2XL8A 1TWCA 2DYSC 3FXHA 3WG7C 4PFPA 3ZC4A 3DWWA 2HZ8A 1LIHA 5E33A 3ZIBA 4EHPA 4OD5A 1A0BA 1M57C 2MHRA 5COMA 3DE9A 3FAPB 3MYFA 1K04A 4MTGA 1NG1A 3LAYA 4AE4A 3J06A 1A41A 1YDIA 4EWCA 3WAQA 3NKDA 3RKOF 4E18A 2EILC 3FAJA 1V74B 1ZZPA 4NTBA 4ONSA 1E2XA 1NFNA 2R25A 1Q0MA 1M2VB 4O6YA 3UMHA 1YA9A 3JTLO 5KYNA 5BUOA 1YAUO 4K0DA 3EH2A 1R4TA 1Q0KA 3IQ6A 2QUPA 2GFHA 3SEOA 2A69F 3U3BA 3DJNB 4WABA 1A7EA 1ORJA 2A0BA 1I4YA 3TOMA 1DOWA 3AQCA 1ZHWA 3V5YA 4H54A 3RYLA 4C3BA 4NTAA 2J9UA 2YL1A 2WB7A 1Q0FA 3KYJA 3OEOA 4ER9A 2V3CC 3SYNA 1NZEA 2MYSA 1PCXA 3MLGA 1ORSC 1V4AA 2OU6A 2LSEA 5BQIA 3FMSA 1YYJA 3OWTA 4Q4ZF 4CSAA 4C7OA 2R7XA 4G7OF 3JSZA 3FVYA 4U5BE 3QMKA 2XXAB 4NCQA 2A6EF 3A11A 3ZTMA 1ZU4A 1NBBA 3ASOC 3EZIA 4O6MA 5GPGB 1BZ4A 3C8GD 5COFA 4BG0A 1TR2A 4HFKB 2PFDA 3QZCA 2F22A 1FR0A 1LS1A 5JP7A 1WOLA 2D5RB 3NMKA 4M63A 3T4RA 1SZIA 3EGDA 3DZAA 3GORA 1PV3A 2LFFA 4U9EA 4BEMJ 4FAPB 2EPLX 4YL1A 1R5ID 2NSGA 1ORYA 1YJGA 1VB5A 3L1MA 1H7IA 2A6HF 2RD9A 3ATPA 4BJTA 1D1CA 4KNWA 4U5DE 3RH3A 3Q6NA 2HJMA 4N06A 2GA0A 3C8ZA 3TD7A 1QZXA 3R2PA 2Q9AA 1OW6A 4U9DA 2KYHA 3K66A 1M2OA 2HFIA 4JVSA 4EBJA 4E7ZA 4X0RA 4JURI 4O79A 3JSEO 4KC9A 3EGXB 1ZW3A 4E0IA 1EI7A 1EQ1A 1YYXA 4DOZA 2UUIA 4H4KC 1J8MF 3S27A 5KYYB 2UUHA 3IQCA 2IXMA 3C8GB 3GANA 4JC7A 1G4WR 4MW8A 4JCHA 1YLMA 5E2QA 3CQZA 4I44A 3TJ6A 2IBFA 3DAFA 4PR9A 2XM4A 4IAOA 3DXJF 3HKKA 1TWHA 2OOCA 1BR4A 4BJ6C 5A6AA 3JT1A 4NTFA 3NYJA 4JE9A 2L9JA 1RMVA 3NMJA 1ZYRF 4LDRA 3JRTA 5BQGA 3TK0A 3VAYA 4BJ5A 4QI2A 1VOMA 1C02A 3Q7GA 2DYRC 4AL0A 3G50A 3U2MA 3NMIA 3DM5A 1C17M 1BR2A 1PD0A 5JUAA 5TJ5E 5AC5A 2O9XA 2R9RB 1Q0GA 3RQFA 1LE2A 5KYUA 1OCRC 3EJNA 3L34A 3M15A 5B1AC 1LE4A 2C03A 4G7ZF 1JPJA 3DAGA 4JEBA 2H7BA 2R7SA 3VM6A 2BE5F 3IQTA 1TFOB 4FWVA 5B3IA 2I8BA 2EPMX 2E87A 4KBLA 5DQTA 2XLOA 3CEXA 3T6BA 1UFBA 2KSFA 4RBNA 2Q7RA 3IQ5A 3CSKA 3B0PA 3NG1A 1MMAA 5B1BC 1HMOA 1Y6DA 1D1AA 3LNMB 1JMWA 1RKCA 4EBBA 1OCZC 1TQGA 2D4UA 5A69A 1U6HA 4WGYA 1Z63A 2CCYA 2W4MA 2NG1A 2NUTB 1VYIA 2BL2A 2QY9A 3EH1A 2P0NA 4IB4A 2VB6A 2FGYA 3T9OA 1VLSA 2QE9A 2R7QA 1M56C 3CZ6A 5T3TA 4YL3A 4YT2A 2Q9CA 2VC9A 2HV6A 3ABKC 3TULA 3DE8A 4PJMA 4AK9A 4BJ5C 2DB4A 1T6UA 2J9BA 1QKRA 1QSPA 2WVOA 3EPVA 3SNHA 2KJGA 1K40A 5DS6A 2J46A 1BDJB 2TMVP 4MQ9F 2M64A 5D91A 4GEHA 2ZPAA 4G0HA 1SR2A 2L81A 3T6GB 4DBRA 4CS8A 2AWCA 3S29A 1SYQA 4ULWA 3UR3C 1VYKA 1L3PA 5EK0A 4F4BA 2EPOA 2YLIA 5KYYA 1LPEA 3HNLA 2KK1A 2PBEA 1BR1A 3IEEA 2XRHA 2Y3DA 2ZXRA 3LEVA 3PCVA 4EKWA 5EGYA 1D0ZA 1RJ9A 2WZGA 4YT5A 5D92A 4BJ1A 3I5PA 4LLCA 2X51A 3O10A 1RKEB 2DI3A 3KMIA 4DRIB 3I4UA 2IM8A 2KGOA 3FHDA 2J7PA 1QLEC 2OG2A 4PJNA 3RQGA 2GAQA 2YL7A 1Z23A 2HS5A 4XLPF 3E9VA 2GDCA 1G8XA 2R05A 3TQOA 1OXBA 1PD1A 1WGWA
chains in the Genus database with same CATH topology
2QUPA 2P61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QUP A;  2P61 A; 
#chains in the Genus database with same CATH topology
 4IWB A;  1L7C A;  1OXK A;  3W2W A;  5F5H A;  2YHS A;  3GM3 A;  4ANJ A;  4EUK B;  4Q5S F;  3KL4 A;  4I1M A;  3B0V C;  3AQB A;  3ZQV A;  2AU5 A;  2YWA A;  2Y69 C;  3EFO B;  2EPK X;  1OKK A;  3HLZ A;  4GQH A;  2ETS A;  3W2V A;  4AX2 A;  4B6I A;  2LCH A;  1OW7 A;  2HMZ A;  2EIK C;  1WAT A;  2ZXO A;  3EG9 B;  4CS7 A;  4JIO A;  5EHH A;  2WZL A;  3VRC A;  4DRH B;  5T1D B;  1D0Y A;  4NC3 A;  4NY3 A;  1F1M A;  3MYI A;  3SXK A;  3AG1 C;  1OW8 A;  5A6K A;  4QI0 A;  2IXN A;  1MMD A;  3RQE A;  3S28 A;  4BJ6 A;  2XLW A;  4E7S A;  2WL8 A;  4CS8 C;  2OCC C;  3LS0 A;  3BRJ A;  2H7V C;  2NSF A;  2YLD A;  1TWA A;  1E84 A;  1V55 C;  4MND A;  2QTV A;  1WTY A;  1LI5 A;  4LLE A;  1RCP A;  1JOG A;  1O87 A;  2HV7 A;  1QQ3 A;  2NUT A;  3I5Q A;  1O3U A;  2H7O A;  4XQ1 A;  3K33 A;  1OQC A;  3B9Q A;  1FAP B;  4MVM A;  3V5X A;  2WVN A;  1NSG B;  1T01 A;  3EHN A;  3LEO A;  2VCC A;  3EHM A;  1XZQ A;  3L8J A;  1I4Z A;  2AWY A;  2W4B A;  3F46 A;  3QVY A;  3TOL A;  4D4X A;  4QDL A;  3L0I A;  3PDM P;  1LM3 B;  3UGP A;  2ASR A;  1WAS A;  2CNW A;  3M1C B;  4Z9I A;  3RVY A;  3T6J A;  3U8V A;  5K0I A;  5KYX B;  4JCZ A;  1V54 C;  3ABL C;  2L6F A;  5IY5 C;  1VK5 A;  2DGJ A;  2VCA A;  3O55 A;  3W8I A;  2R7W A;  3QW1 A;  3E70 C;  1GGQ A;  3C7J A;  2KNH A;  3GEI A;  3A9C A;  3KH2 A;  2L7A A;  4YK5 A;  2LP4 A;  5FZT A;  2KW3 C;  1AEP A;  4CJG A;  5BQH A;  4XLN F;  3BEH A;  1H6G A;  3VYW A;  4A2N B;  2YL3 A;  2OJQ A;  3EQL F;  3RIP A;  1H9G A;  1ST6 A;  2X0C A;  2R02 A;  2NUP B;  3UMI A;  1KU2 A;  2M4E A;  2XL6 A;  3WOD F;  3B71 A;  1XZP A;  1SF8 A;  4J7Y A;  1M2V A;  3FOO A;  2P1A A;  1O5H A;  3H65 A;  4J32 B;  4DXW A;  2EIN C;  4NQF A;  4JTD B;  4OIQ F;  4HEA J;  4U5G A;  5CI8 A;  1T9K A;  2J45 A;  2XS8 A;  3EFO A;  1B68 A;  2PX0 A;  1VLT A;  4LDK A;  5DLJ A;  2V26 A;  2R7U A;  1NFO A;  3DD7 A;  1DOV A;  1HW2 A;  3U2L A;  4L6R A;  5A6J A;  3KKB A;  2EIM C;  2A0U A;  3R7C A;  1ZHX A;  3FOP A;  3X1O A;  4AE4 B;  2J8W A;  4R32 A;  2QNL A;  1LKX A;  3ZDL A;  4YT8 A;  1NU7 D;  1G5Z A;  2OEV A;  4C3E A;  1IW7 F;  2XXA A;  1FTS A;  4UDV A;  4CDY A;  4EBK A;  4OIO F;  1JR8 A;  2Q00 A;  3C62 A;  4MVO A;  3X2Q C;  1Z5Z A;  2J9W A;  3EZH A;  3W8H A;  2FAP B;  5DS5 A;  1OR3 A;  2B0J A;  2OQM A;  4JKV A;  1GQA A;  3GEH A;  3LNR A;  4PAC A;  4D4N A;  4WGZ A;  3DI5 A;  3JZ0 A;  3RF3 A;  1YVI A;  2OKU A;  4A4A A;  4U5E E;  5F28 E;  2NPU A;  1ZHZ A;  4KI2 A;  3M79 A;  3B29 A;  2IXO A;  2VCB A;  3K7D A;  1GS9 A;  2YZS A;  5KYX A;  3IHU A;  1MQV A;  3AG4 C;  5L3V A;  2A68 F;  3ECS A;  2LFD A;  4OD4 A;  3TJ5 A;  3POV A;  1Q0D A;  2JD3 A;  1MMN A;  2QLA A;  5L3Q A;  1UG7 A;  2Y39 A;  2IXP A;  3NYM A;  4MTO A;  3AG3 C;  2Q4F A;  2Y3G A;  2ZXP A;  1LVK A;  3EGX A;  4E0H A;  5DS4 A;  3US6 A;  3OA1 A;  1Z6A A;  4CDV A;  4CIP A;  3Q7L A;  2ICW G;  1KTM A;  5L0D A;  2R7T A;  1MMG A;  3C8G A;  3DMD A;  2J0X A;  4AL1 A;  1QPU A;  3G4X A;  3H2U A;  4CIH A;  5A6B D;  5KYW B;  2P6V A;  1T6Q A;  3LS1 A;  3AGU A;  2IOQ A;  4LER A;  2LK4 A;  2Q3T A;  3EGD B;  3NKE A;  5CI9 A;  5E3C A;  1CGN A;  3N2Z B;  4XEF A;  4DVY P;  5L0G A;  2XL4 A;  4JJG A;  5AGF A;  3F47 A;  4XEV A;  3O6X A;  4LAC B;  3U3F A;  1U89 A;  2Y3H A;  4RD9 A;  4IJJ A;  5HV9 A;  4CDA A;  5FCL A;  2G62 A;  3HNK A;  2OEX A;  1JRA A;  4OIN F;  3RFY A;  5B3S C;  3QW0 A;  3ABM C;  2PF4 E;  1J8Y F;  2PP4 A;  2Y3B A;  4PK4 A;  4RDA A;  3LLK A;  4Z9J A;  4HFF B;  1D0X A;  2J0W A;  3U9M A;  1ZVZ A;  2H8A A;  4JJF A;  5DQZ A;  2XSE A;  4IAQ A;  2OJE D;  3VF0 A;  3ZSU A;  4J30 B;  2R7V A;  3G4Z A;  1MND A;  1I5N A;  1C03 A;  4HE8 D;  4J7T A;  3W4Y A;  3ZQY A;  1CGM E;  3M4B A;  2VAS A;  2PNO A;  1RXQ A;  2YKZ A;  1S05 A;  1AUE A;  3LUT B;  3MBG A;  2L6H A;  4CS9 C;  1MNE A;  3U9J A;  1FMW A;  1Z3I X;  1NU9 C;  4N6C A;  1GM5 A;  4YT4 A;  4C3D A;  5JVE A;  4WJ0 A;  2A1D D;  4G78 A;  1VTM P;  3AG2 C;  5L0F A;  4O7G A;  3Q6M A;  2XLV A;  3GWL A;  4K1O A;  4MVR A;  4DRJ B;  2EIJ C;  3U8P A;  2P61 A;  1T5O A;  4I3M A;  1M6T A;  3JCU Q;  4PJJ A;  3U0C A;  5COG A;  3SP1 A;  2HSQ A;  1EA8 A;  5KYU B;  5JSL A;  3UGO A;  2KQ9 A;  1JAF A;  2YEV A;  3SXM A;  2YQY A;  3MFN A;  2L6G A;  3C63 A;  4MVZ A;  3ZVR A;  4FES A;  1FMV A;  4EIY A;  3JYY A;  5HSW A;  4GYT A;  3V7O A;  4ULV A;  1NLX A;  3AJM A;  3FDQ A;  1KNY A;  2R7R A;  1TKN A;  3RW0 A;  1WWP A;  1CPQ A;  2R7O A;  4JTA B;  3H2V A;  3NYL A;  3DJU B;  3KYI A;  2XLM A;  2Q9B A;  4JZA A;  4K7B A;  3ZTZ A;  4OIP F;  3GM1 A;  2KC3 A;  4IGG A;  3LJB A;  4CX9 A;  2XLH A;  1Y4C A;  3HNJ A;  2GWW A;  3K6B A;  3JRM O;  2R03 A;  3SZR A;  3K1I A;  3KPH A;  4JEA A;  3ZG1 A;  5KYW A;  1RKE A;  1YAR O;  4IAR A;  2J7P D;  4I1O B;  1U0B B;  1OCC C;  2CW0 F;  2CGE A;  2YVK A;  4XPY A;  4W8P A;  1OCO C;  5AC4 A;  2YLG A;  5JLI A;  2BC5 A;  1E85 A;  2G3V A;  2ZD9 A;  4XTK A;  1HMD A;  4DJ9 A;  4YN0 B;  3DM9 B;  5JT4 A;  3M4C A;  3PMR A;  1Z7Q c;  2IYL D;  4PFO A;  1S7Z A;  1APC A;  3HNI A;  3MX3 A;  4ZLC A;  2I15 A;  2JX0 A;  5JRA A;  5JS5 A;  3C18 A;  3AGT A;  2EPN A;  2HSB A;  1TWG A;  3N0T A;  4KNV A;  1OKK D;  4XPX A;  4CJO A;  1G4U S;  2AP3 A;  3GOD A;  4Z9H A;  5L0I A;  2W45 A;  4U5C E;  2J9V A;  2WVQ A;  3GEE A;  2XLE A;  3K1H A;  3RVZ A;  5L0C A;  3CAX A;  4XEK A;  3EG9 A;  4YWQ A;  1RJ9 B;  4P9T A;  2AVK A;  2RSE B;  1HY5 A;  1JPN A;  4MVU A;  4CSA C;  5A6B A;  2WZF A;  4BPM A;  1VMA A;  4N4W A;  4U5H A;  2B0H A;  4JW1 A;  1LI7 A;  2ZXW C;  4E17 A;  4P6I C;  3HJC A;  4JRZ A;  2Z15 A;  4YL0 A;  2CDQ A;  2LD6 A;  3QTH A;  3UMK A;  3UNG C;  3PHF 2;  3GWN A;  1ZW2 A;  2HKV A;  4G7H F;  1QVX A;  2YRF A;  4PJL A;  1T6I A;  1YZC A;  4DVZ A;  3K1I C;  4FX5 A;  1E83 A;  1E86 A;  3LES A;  3S9O A;  2JPU A;  4U5F E;  1IZM A;  4CBE A;  2HUJ A;  4MTF A;  4YJW A;  4BEJ A;  3S84 A;  1LS4 A;  3QVZ A;  1FFH A;  4W8K A;  1OR2 A;  4MVS A;  3IPM O;  2CNW D;  1HW1 A;  2YL0 A;  3LLI A;  4Q7C A;  4C7O B;  2C04 A;  1HE1 A;  1A7D A;  2HJ3 A;  4MW3 A;  5E3A A;  5T3W A;  2W9Y A;  5CIV A;  4O6N A;  4DBQ A;  2XLD A;  3S0X A;  4CS9 A;  3N24 A;  3ASN C;  2LIG A;  3GM2 A;  1A7V A;  5DVW A;  4MVQ A;  2HMQ A;  2XS1 A;  1CPR A;  2VH3 A;  1EKY A;  3V5Z A;  2FFH A;  3S90 A;  1YZA A;  3HTK C;  3ZWI A;  1K05 A;  4N6H A;  3SXZ A;  2CYD A;  3SXY A;  1W2W A;  2PX3 A;  2LQG A;  1YA7 O;  3O39 A;  1CGO A;  4OIR F;  4P9F A;  1WN0 A;  5L0H A;  1XWJ A;  4XPW A;  2NUP A;  5F5F A;  4IRU A;  1SMY F;  3DKA A;  3L8I A;  3WHN A;  1ZHT A;  3ITF A;  3JYH A;  3NRH A;  1FNT c;  4XWJ A;  3NDB B;  1BBH A;  1FFT C;  4LDQ A;  2MWQ A;  2XM0 A;  1AVO B;  1ZU5 A;  1ZHY A;  4JTC B;  5L0J A;  1H9T A;  1D1B A;  2G3K A;  4ZLD A;  1TFK B;  1HE9 A;  1N1C A;  4MS2 A;  256B A;  2P7V A;  3AOU A;  3U5S A;  3B0U X;  2XL8 A;  1TWC A;  2DYS C;  3FXH A;  3WG7 C;  4PFP A;  3ZC4 A;  3DWW A;  2HZ8 A;  1LIH A;  5E33 A;  3ZIB A;  4EHP A;  4OD5 A;  1A0B A;  1M57 C;  2MHR A;  5COM A;  3DE9 A;  3FAP B;  3MYF A;  1K04 A;  4MTG A;  1NG1 A;  3LAY A;  4AE4 A;  3J06 A;  1A41 A;  1YDI A;  4EWC A;  3WAQ A;  3NKD A;  3RKO F;  4E18 A;  2EIL C;  3FAJ A;  1V74 B;  1ZZP A;  4NTB A;  4ONS A;  1E2X A;  1NFN A;  2R25 A;  1Q0M A;  1M2V B;  4O6Y A;  3UMH A;  1YA9 A;  3JTL O;  5KYN A;  5BUO A;  1YAU O;  4K0D A;  3EH2 A;  1R4T A;  1Q0K A;  3IQ6 A;  2QUP A;  2GFH A;  3SEO A;  2A69 F;  3U3B A;  3DJN B;  4WAB A;  1A7E A;  1ORJ A;  2A0B A;  1I4Y A;  3TOM A;  1DOW A;  3AQC A;  1ZHW A;  3V5Y A;  4H54 A;  3RYL A;  4C3B A;  4NTA A;  2J9U A;  2YL1 A;  2WB7 A;  1Q0F A;  3KYJ A;  3OEO A;  4ER9 A;  2V3C C;  3SYN A;  1NZE A;  2MYS A;  1PCX A;  3MLG A;  1ORS C;  1V4A A;  2OU6 A;  2LSE A;  5BQI A;  3FMS A;  1YYJ A;  3OWT A;  4Q4Z F;  4CSA A;  4C7O A;  2R7X A;  4G7O F;  3JSZ A;  3FVY A;  4U5B E;  3QMK A;  2XXA B;  4NCQ A;  2A6E F;  3A11 A;  3ZTM A;  1ZU4 A;  1NBB A;  3ASO C;  3EZI A;  4O6M A;  5GPG B;  1BZ4 A;  3C8G D;  5COF A;  4BG0 A;  1TR2 A;  4HFK B;  2PFD A;  3QZC A;  2F22 A;  1FR0 A;  1LS1 A;  5JP7 A;  1WOL A;  2D5R B;  3NMK A;  4M63 A;  3T4R A;  1SZI A;  3EGD A;  3DZA A;  3GOR A;  1PV3 A;  2LFF A;  4U9E A;  4BEM J;  4FAP B;  2EPL X;  4YL1 A;  1R5I D;  2NSG A;  1ORY A;  1YJG A;  1VB5 A;  3L1M A;  1H7I A;  2A6H F;  2RD9 A;  3ATP A;  4BJT A;  1D1C A;  4KNW A;  4U5D E;  3RH3 A;  3Q6N A;  2HJM A;  4N06 A;  2GA0 A;  3C8Z A;  3TD7 A;  1QZX A;  3R2P A;  2Q9A A;  1OW6 A;  4U9D A;  2KYH A;  3K66 A;  1M2O A;  2HFI A;  4JVS A;  4EBJ A;  4E7Z A;  4X0R A;  4JUR I;  4O79 A;  3JSE O;  4KC9 A;  3EGX B;  1ZW3 A;  4E0I A;  1EI7 A;  1EQ1 A;  1YYX A;  4DOZ A;  2UUI A;  4H4K C;  1J8M F;  3S27 A;  5KYY B;  2UUH A;  3IQC A;  2IXM A;  3C8G B;  3GAN A;  4JC7 A;  1G4W R;  4MW8 A;  4JCH A;  1YLM A;  5E2Q A;  3CQZ A;  4I44 A;  3TJ6 A;  2IBF A;  3DAF A;  4PR9 A;  2XM4 A;  4IAO A;  3DXJ F;  3HKK A;  1TWH A;  2OOC A;  1BR4 A;  4BJ6 C;  5A6A A;  3JT1 A;  4NTF A;  3NYJ A;  4JE9 A;  2L9J A;  1RMV A;  3NMJ A;  1ZYR F;  4LDR A;  3JRT A;  5BQG A;  3TK0 A;  3VAY A;  4BJ5 A;  4QI2 A;  1VOM A;  1C02 A;  3Q7G A;  2DYR C;  4AL0 A;  3G50 A;  3U2M A;  3NMI A;  3DM5 A;  1C17 M;  1BR2 A;  1PD0 A;  5JUA A;  5TJ5 E;  5AC5 A;  2O9X A;  2R9R B;  1Q0G A;  3RQF A;  1LE2 A;  5KYU A;  1OCR C;  3EJN A;  3L34 A;  3M15 A;  5B1A C;  1LE4 A;  2C03 A;  4G7Z F;  1JPJ A;  3DAG A;  4JEB A;  2H7B A;  2R7S A;  3VM6 A;  2BE5 F;  3IQT A;  1TFO B;  4FWV A;  5B3I A;  2I8B A;  2EPM X;  2E87 A;  4KBL A;  5DQT A;  2XLO A;  3CEX A;  3T6B A;  1UFB A;  2KSF A;  4RBN A;  2Q7R A;  3IQ5 A;  3CSK A;  3B0P A;  3NG1 A;  1MMA A;  5B1B C;  1HMO A;  1Y6D A;  1D1A A;  3LNM B;  1JMW A;  1RKC A;  4EBB A;  1OCZ C;  1TQG A;  2D4U A;  5A69 A;  1U6H A;  4WGY A;  1Z63 A;  2CCY A;  2W4M A;  2NG1 A;  2NUT B;  1VYI A;  2BL2 A;  2QY9 A;  3EH1 A;  2P0N A;  4IB4 A;  2VB6 A;  2FGY A;  3T9O A;  1VLS A;  2QE9 A;  2R7Q A;  1M56 C;  3CZ6 A;  5T3T A;  4YL3 A;  4YT2 A;  2Q9C A;  2VC9 A;  2HV6 A;  3ABK C;  3TUL A;  3DE8 A;  4PJM A;  4AK9 A;  4BJ5 C;  2DB4 A;  1T6U A;  2J9B A;  1QKR A;  1QSP A;  2WVO A;  3EPV A;  3SNH A;  2KJG A;  1K40 A;  5DS6 A;  2J46 A;  1BDJ B;  2TMV P;  4MQ9 F;  2M64 A;  5D91 A;  4GEH A;  2ZPA A;  4G0H A;  1SR2 A;  2L81 A;  3T6G B;  4DBR A;  4CS8 A;  2AWC A;  3S29 A;  1SYQ A;  4ULW A;  3UR3 C;  1VYK A;  1L3P A;  5EK0 A;  4F4B A;  2EPO A;  2YLI A;  5KYY A;  1LPE A;  3HNL A;  2KK1 A;  2PBE A;  1BR1 A;  3IEE A;  2XRH A;  2Y3D A;  2ZXR A;  3LEV A;  3PCV A;  4EKW A;  5EGY A;  1D0Z A;  1RJ9 A;  2WZG A;  4YT5 A;  5D92 A;  4BJ1 A;  3I5P A;  4LLC A;  2X51 A;  3O10 A;  1RKE B;  2DI3 A;  3KMI A;  4DRI B;  3I4U A;  2IM8 A;  2KGO A;  3FHD A;  2J7P A;  1QLE C;  2OG2 A;  4PJN A;  3RQG A;  2GAQ A;  2YL7 A;  1Z23 A;  2HS5 A;  4XLP F;  3E9V A;  2GDC A;  1G8X A;  2R05 A;  3TQO A;  1OXB A;  1PD1 A;  1WGW A; 
#chains in the Genus database with same CATH homology
 2QUP A;  2P61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...