2QUPA

Crystal structure of uncharacterized protein bh1478 from bacillus halodurans
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
122
structure length
119
Chain Sequence
GVSFSEVMGKQRDEKAYERLQALMSKIDDQGKLLSETRTIEELRKYKELVKEFVGDAVELGLRLEERNRRGRTKIYKIVKEVDRKLLDLTDAVLAKEKKGLDILNMVGEIKGLLINIYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uncharacterized Protein Bh1478 from Bacillus Halodurans.
rcsb
molecule keywords BH1478 protein
molecule tags Structural genomics, unknown function
source organism Bacillus halodurans
total genus 55
structure length 119
sequence length 122
ec nomenclature
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03885 DUF327 Protein of unknown function (DUF327)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hypothetical protein TM1646-like domain 2qupA00
2QUPA 2P61A
chains in the Genus database with same CATH superfamily
2XLWA 2R7OA 3Q6NA 2H7BA 3QTHA 3LS0A 2C04A 2H7OA 4ULVA 4CDVA 1D1AA 5DVWA 4ZLCA 4XPYA 3JRMO 1S7ZA 4QDLA 2J0XA 1TWAA 4IGGA 3S28A 3UMHA 3O55A 2EINC 3EHNA 2GDCA 4GYTA 4U5EE 1D1CA 3RIPA 1SZIA 2QUPA 3Q7GA 1A7DA 1U89A 2YL7A 1RJ9A 4BJ5C 4XEVA 1JPNA 4BJ5A 1SF8A 1R5ID 2FGYA 2P61A 3IQCA 2JD3A 2NSGA 4JZAA 4JJGA 4AE4B 3GM3A 1BR1A 1E2XA 3EG9A 3M4BA 3O39A 4PK4A 3JYYA 2W9YA 1YLMA 3U2MA 4N06A 5L0DA 4MVQA 5F5HA 3GWNA 1RJ9B 1MMDA 4YL1A 3SYNA 2YLDA 1O3UA 3SXKA 4LLEA 3LS1A 4BEJA 2R7WA 1PD0A 3EG9B 1ST6A 2CNWD 2H8AA 1LI7A 1QZXA 3AGUA 4LDKA 4W8PA 3NKEA 3RH3A 2L81A 4QI2A 1XZQA 3GM2A 3EZHA 3B9QA 5D91A 4AK9A 2VCBA 3F47A 2Y3BA 1LS4A 1PCXA 2R7TA 3RW0A 4EKWA 2G62A 2WB7A 2XM4A 4OIQF 2XLOA 3K7DA 3AG4C 3U5SA 2GAQA 3UGPA 2AVKA 2EIMC 1HMDA 3EJNA 4D4NA 1JRAA 4DOZA 2OG2A 1KTMA 4D4XA 4ZLDA 3ZC4A 3EZIA 3TULA 3O6XA 3FAJA 1VLSA 2W4MA 4J7TA 3POVA 2J9UA 4DJ9A 4RD9A 4E0HA 3SP1A 2HV7A 4GQHA 5E2QA 2Q4FA 3PDMP 3IHUA 2TMVP 5B3IA 5EK0A 1XWJA 2XL6A 3TD7A 4MVUA 5HV9A 1V74B 3GEHA 4C3BA 5L0FA 1WTYA 1WWPA 1L7CA 1EI7A 2G3VA 2HJ3A 4YT4A 3NYLA 3H65A 4XEKA 3U2LA 1EKYA 4MW8A 4MVOA 4G7OF 2J9VA 2ETSA 4PR9A 5E3CA 1K05A 1GS9A 1FFHA 3JYHA 2YLGA 3QZCA 5JS5A 5JSLA 3K1IC 3K1IA 3FOOA 1YDIA 1NFOA 1YA9A 3M1CB 4J7YA 2OEVA 4WJ0A 1HY5A 3H2UA 2DYSC 2CW0F 3K1HA 1GM5A 5T3TA 2A0BA 4I1OB 1JOGA 3SEOA 5B3SC 2YQYA 1YZAA 2HFIA 2LIGA 4P9TA 3KMIA 1ZZPA 3QMKA 3AQCA 2WVOA 3N24A 3AJMA 1OW8A 1AEPA 1Q0GA 3RVYA 2OCCC 4U9EA 1I4YA 3R2PA 4DXWA 4EBKA 4DRHB 5L3VA 1FMWA 4FWVA 1TWGA 1Z3IX 4U5FE 2DYRC 2BL2A 4GEHA 1OCCC 2B0JA 2KK1A 2WZFA 4YN0B 1TWCA 4FESA 4CS7A 4G7HF 5JRAA 1M56C 1Q0FA 2A6HF 2QTVA 1FAPB 1YA7O 3C18A 5CIVA 3MYFA 1Z63A 4LERA 4CS9A 4PFOA 3HNJA 1NG1A 3SXMA 1ZHXA 4XLNF 1ZHZA 2EPNA 3FHDA 4Z9HA 1B68A 2LCHA 2WZLA 2G3KA 3ZQYA 2OKUA 2XLDA 2V26A 5EGYA 3FAPB 4BJTA 2J45A 5B1BC 3PHF2 3NYMA 1HE9A 5KYYA 2VH3A 2XXAA 4R32A 2IXOA 4EBBA 3DXJF 1I4ZA 4U5HA 3NRHA 2ZPAA 4XPXA 4YK5A 3OEOA 5COMA 3RQEA 3NMKA 1OKKA 4CJGA 4CDAA 2H7VC 4PJLA 3ZIBA 5CI8A 4YJWA 2P1AA 4F4BA 1LE2A 5F28E 4C3DA 1TR2A 1YVIA 2J8WA 3LAYA 4XWJA 1U6HA 1Y4CA 5BUOA 4X0RA 4EBJA 3HLZA 5KYYB 3N0TA 2XXAB 5DS6A 1A41A 2PX3A 5A6AA 1PD1A 1ORYA 1R4TA 1CPQA 2IXPA 4NQFA 3H2VA 4BPMA 2HMZA 2RSEB 3M79A 3X2QC 3HNIA 2R05A 4CIHA 1G8XA 1J8MF 1AUEA 3EH1A 3FOPA 3NYJA 4A4AA 3GWLA 2IXNA 1HW1A 3DMDA 3G4XA 1RXQA 4UDVA 1T9KA 1GQAA 3C8GD 1G4US 5DS5A 1WATA 4K7BA 1JAFA 3FDQA 1QVXA 1JPJA 2AU5A 2R03A 3DKAA 4DBQA 2EPOA 4G7ZF 4I1MA 4PFPA 2R9RB 2X51A 4XEFA 2KW3C 2Z15A 4AE4A 1Q0KA 3VRCA 5L0JA 2ZXWC 5GPGB 2YL3A 2IYLD 1QLEC 2PBEA 5KYXB 3WODF 1C17M 3JRTA 4MS2A 4MVMA 5E3AA 4YWQA 3WHNA 5COGA 3M4CA 2Y3HA 2LP4A 2MWQA 1Y6DA 3CZ6A 4NC3A 4E7SA 4Q4ZF 3DE9A 3PMRA 1YARO 4Q7CA 1EQ1A 4NY3A 4FAPB 3MBGA 3S84A 1BZ4A 1T6IA 3UMIA 3AOUA 4XPWA 3QW0A 4YT5A 4XTKA 5A69A 3W8IA 4NCQA 5E33A 1NFNA 3GANA 3DAGA 2P7VA 2EPMX 3C62A 4O79A 4W8KA 4DRIB 2YHSA 1BR2A 3U0CA 2Y39A 5K0IA 4IARA 1NLXA 4LACB 1EA8A 4J30B 3T9OA 4HEAJ 4BEMJ 1DOWA 1E85A 1H9TA 1W2WA 1CPRA 1VMAA 1RCPA 4HFFB 3GEIA 3W8HA 4RDAA 5AGFA 3B0VC 1APCA 4CDYA 2NSFA 4OD4A 3LEOA 4LDRA 2VCCA 2KSFA 3U9JA 1QPUA 3JSZA 2L7AA 3Q7LA 4E7ZA 1QQ3A 1ZU5A 1U0BB 1J8YF 2J0WA 2R7XA 1D1BA 2YRFA 3W2VA 3TJ5A 2J46A 2Y3GA 1LPEA 1ZU4A 2BE5F 3B0PA 1I5NA 3EH2A 1VYKA 2WVQA 4XLPF 2W4BA 4KNWA 4XQ1A 2DGJA 1D0ZA 2Q3TA 3LUTB 3E70C 2LK4A 5A6BD 1LVKA 3BEHA 2UUIA 3CQZA 2J7PD 3IQ5A 2FAPB 1L3PA 3ZSUA 3X1OA 5A6KA 2ASRA 3L1MA 3CEXA 3NG1A 4U5DE 1NU7D 2EIKC 3FVYA 4ONSA 5COFA 4A2NB 2I8BA 2Y3DA 1VLTA 2LQGA 3BRJA 5B1AC 1RMVA 2XSEA 4DVYP 2LD6A 1JR8A 5AC5A 1TFOB 3C8GA 3EQLF 4PACA 2HZ8A 4BG0A 4MTFA 5AC4A 1DOVA 2OJED 2XS8A 3ATPA 2GA0A 2PFDA 5DQTA 3T4RA 1NZEA 4CSAA 4CSAC 1MQVA 2UUHA 3DD7A 2EILC 1OR2A 3EPVA 3L34A 5D92A 3C8GB 3SXYA 4JURI 5KYUA 1FNTc 1LM3B 3KH2A 3SZRA 4MVSA 4E0IA 5L3QA 2Q7RA 4JC7A 4EUKB 1LKXA 2YEVA 3B71A 3TK0A 4ER9A 1ORSC 1OW6A 1T01A 2E87A 2HUJA 3HTKC 5CI9A 3U3FA 4E18A 3VYWA 2HSBA 3TOMA 2AWCA 5KYUB 2A6EF 1LIHA 5HSWA 1K40A 2OOCA 2HS5A 2XLVA 2ZXPA 4KNVA 3V5ZA 3DE8A 3W4YA 2PF4E 4CS9C 3ZDLA 1OCZC 5L0CA 2R7SA 1MMNA 3AG3C 1M57C 4K1OA 2HKVA 3V5XA 1QSPA 4I44A 1XZPA 3JT1A 2CNWA 1NSGB 3EGXA 4YT8A 3AG2C 4NTFA 3L0IA 4IRUA 4JRZA 1TQGA 4OINF 1HW2A 2P6VA 3I5QA 4CX9A 3ZWIA 4WABA 1D0YA 2VC9A 2IXMA 1ZHTA 1HE1A 3LEVA 4BJ1A 3EGXB 4M63A 5DS4A 2LFFA 3AGTA 3WAQA 3A9CA 3FMSA 4O6YA 3RQGA 2ZXRA 2XL4A 3GODA 1M2VA 2A0UA 3LLKA 5JUAA 1FR0A 256BA 3IEEA 2M4EA 2YWAA 1VOMA 3HNKA 4JW1A 4PJNA 2MHRA 4CIPA 2I15A 3ABKC 4DBRA 4DRJB 3NMJA 4C7OB 5JLIA 1M2VB 2PNOA 4EIYA 1WOLA 2OJQA 4BJ6A 4BJ6C 1CGME 3RF3A 1FFTC 2AP3A 1AVOB 1MNEA 2M64A 4FX5A 4U5CE 3ECSA 2L9JA 4WGYA 5A6BA 3QVYA 1RKEA 2J7PA 2PX0A 2IBFA 5L0HA 3E9VA 2XLHA 4JEBA 3K66A 4MQ9F 1MMGA 3ZQVA 4CJOA 4CBEA 4I3MA 1RKEB 4JJFA 4KC9A 3LLIA 4LLCA 4YT2A 5L0GA 3QW1A 4U5BE 4KI2A 2AWYA 2QNLA 2KNHA 2MYSA 3KKBA 3IQTA 4L6RA 1OXBA 1F1MA 2WL8A 3PCVA 1E83A 2CCYA 1C02A 1BDJB 4U9DA 1ZVZA 4C3EA 4K0DA 2Q9BA 5T1DB 3TOLA 3JTLO 1UFBA 3IPMO 4ANJA 1C03A 4DVZA 5BQHA 1YAUO 2FFHA 2ZD9A 1Q0MA 3ASOC 1D0XA 3TJ6A 3ZVRA 3T6GB 3O10A 4IB4A 5FZTA 5BQGA 3S9OA 1A7VA 2A68F 3N2ZB 2OEXA 4Q5SF 4JTCB 1YYJA 4JKVA 1Z7Qc 4MTOA 1ZYRF 1H9GA 1MMAA 4HE8D 1OQCA 2F22A 2LFDA 1SR2A 2VB6A 2R7QA 2OU6A 1QKRA 2XLEA 3A11A 4O6MA 3V5YA 1BBHA 2NUPA 1RKCA 2IM8A 4JTAB 3J06A 2A1DD 4N4WA 3R7CA 3RFYA 3MFNA 1K04A 3ZG1A 1Z5ZA 2XS1A 5TJ5E 2JPUA 2B0HA 4LDQA 3T6JA 2ICWG 2IOQA 2NUPB 3EGDA 3MYIA 3Q6MA 3RVZA 3ZTMA 1H7IA 4MVZA 2L6FA 3MLGA 1BR4A 3AG1C 3UNGC 1VYIA 1Z6AA 4E17A 1T5OA 2YLIA 4IAOA 5JT4A 4JE9A 5FCLA 3F46A 3DWWA 1A0BA 1TKNA 3EGDB 3JZ0A 2RD9A 2CYDA 1YZCA 2ZXOA 2BC5A 4J32B 3WG7C 1E84A 1WGWA 2XL8A 1FMVA 1CGNA 3DM9B 2R7UA 1MNDA 2C03A 1OCOC 2L6HA 3C63A 1LE4A 3EHMA 3LESA 3IQ6A 1OKKD 4MTGA 4OIOF 3HJCA 3HKKA 3ITFA 1IW7F 3VM6A 1ZHWA 2HSQA 2GFHA 1O5HA 4AL1A 1T6UA 3ABMC 2EPKX 3KPHA 4IWBA 1G4WR 3UMKA 3ZTZA 1O87A 4G0HA 2XRHA 1YYXA 3CAXA 1G5ZA 3DM5A 1TFKB 3G4ZA 1ZW3A 3SXZA 5KYNA 1OW7A 4JTDB 1TWHA 3NKDA 4H54A 3U9MA 2J9WA 1M6TA 5DQZA 2OQMA 2W45A 5KYWA 3S29A 1H6GA 4AX2A 5BQIA 2WZGA 2KQ9A 3DJNB 2DB4A 3RQFA 5IY5C 3RKOF 2KC3A 3GM1A 4MW3A 2NUTA 4YL3A 2HJMA 3L8JA 2CDQA 3US6A 5KYWB 2QY9A 3OA1A 1HMOA 3U8VA 1PV3A 1A7EA 2GWWA 3KYJA 4EHPA 1SMYF 3MX3A 1OR3A 1VTMP 2HV6A 1CGOA 2NUTB 2P0NA 3ABLC 4JEAA 1GGQA 2EPLX 2NG1A 4P9FA 2VCAA 1FTSA 3DJUB 4OIPF 3I5PA 4N6HA 3GEEA 3LNMB 4O6NA 2V3CC 3SNHA 2YZSA 2HMQA 2XLMA 2EIJC 2QLAA 4B6IA 3ASNC 3FXHA 3S0XA 1S05A 3QVZA 4YL0A 5JVEA 4QI0A 2NPUA 3DI5A 3U8PA 3I4UA 3U3BA 1OXKA 2O9XA 3EFOA 2D4UA 3LJBA 2YL0A 3JCUQ 2YKZA 1OCRC 1VB5A 2Y69C 2Q00A 1V54C 3K33A 3LNRA 4MNDA 4NTBA 4U5GA 1WN0A 1YJGA 3DAFA 4C7OA 2R02A 3JSEO 3B0UX 4KBLA 2KJGA 3EFOB 4MVRA 4JCZA 1KNYA 2Q9AA 5EHHA 4IJJA 4O7GA 3CSKA 3VF0A 1LS1A 2PP4A 3S27A 2A69F 5A6JA 4P6IC 2LSEA 3GORA 4N6CA 2CGEA 2YL1A 3C8ZA 1T6QA 4NTAA 1NBBA 4IAQA 2L6GA 2YVKA 4CS8C 3TQOA 4CS8A 1VK5A 2DI3A 3AQBA 4JIOA 1ZHYA 1UG7A 2VASA 3HNLA 4H4KC 4OD5A 4ULWA 1V55C 4WGZA 4Z9JA 3NDBB 1ORJA 4HFKB 4Z9IA 4EWCA 3DZAA 3KL4A 1M2OA 1N1CA 3K6BA 2J9BA 2X0CA 2XM0A 3M15A 3VAYA 2R25A 2KGOA 3V7OA 5F5FA 1WASA 4PJJA 3T6BA 3L8IA 1V4AA 3OWTA 1LI5A 1Q0DA 3G50A 2R7VA 3KYIA 4AL0A 4RBNA 4PJMA 4JVSA 3UR3C 5KYXA 2WVNA 5T3WA 4OIRF 2KYHA 2Q9CA 2QE9A 2D5RB 3B29A 1SYQA 1ZW2A 1NU9C 3UGOA 1Z23A 1KU2A 1JMWA 5DLJA 4G78A 5L0IA 1E86A 1IZMA 3C7JA 5JP7A 2JX0A 3RYLA 2R7RA 3NMIA 4JCHA 3S90A 3W2WA
chains in the Genus database with same CATH topology
2QUPA 2P61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QUP A;  2P61 A; 
#chains in the Genus database with same CATH topology
 2XLW A;  2R7O A;  3Q6N A;  2H7B A;  3QTH A;  3LS0 A;  2C04 A;  2H7O A;  4ULV A;  4CDV A;  1D1A A;  5DVW A;  4ZLC A;  4XPY A;  3JRM O;  1S7Z A;  4QDL A;  2J0X A;  1TWA A;  4IGG A;  3S28 A;  3UMH A;  3O55 A;  2EIN C;  3EHN A;  2GDC A;  4GYT A;  4U5E E;  1D1C A;  3RIP A;  1SZI A;  2QUP A;  3Q7G A;  1A7D A;  1U89 A;  2YL7 A;  1RJ9 A;  4BJ5 C;  4XEV A;  1JPN A;  4BJ5 A;  1SF8 A;  1R5I D;  2FGY A;  2P61 A;  3IQC A;  2JD3 A;  2NSG A;  4JZA A;  4JJG A;  4AE4 B;  3GM3 A;  1BR1 A;  1E2X A;  3EG9 A;  3M4B A;  3O39 A;  4PK4 A;  3JYY A;  2W9Y A;  1YLM A;  3U2M A;  4N06 A;  5L0D A;  4MVQ A;  5F5H A;  3GWN A;  1RJ9 B;  1MMD A;  4YL1 A;  3SYN A;  2YLD A;  1O3U A;  3SXK A;  4LLE A;  3LS1 A;  4BEJ A;  2R7W A;  1PD0 A;  3EG9 B;  1ST6 A;  2CNW D;  2H8A A;  1LI7 A;  1QZX A;  3AGU A;  4LDK A;  4W8P A;  3NKE A;  3RH3 A;  2L81 A;  4QI2 A;  1XZQ A;  3GM2 A;  3EZH A;  3B9Q A;  5D91 A;  4AK9 A;  2VCB A;  3F47 A;  2Y3B A;  1LS4 A;  1PCX A;  2R7T A;  3RW0 A;  4EKW A;  2G62 A;  2WB7 A;  2XM4 A;  4OIQ F;  2XLO A;  3K7D A;  3AG4 C;  3U5S A;  2GAQ A;  3UGP A;  2AVK A;  2EIM C;  1HMD A;  3EJN A;  4D4N A;  1JRA A;  4DOZ A;  2OG2 A;  1KTM A;  4D4X A;  4ZLD A;  3ZC4 A;  3EZI A;  3TUL A;  3O6X A;  3FAJ A;  1VLS A;  2W4M A;  4J7T A;  3POV A;  2J9U A;  4DJ9 A;  4RD9 A;  4E0H A;  3SP1 A;  2HV7 A;  4GQH A;  5E2Q A;  2Q4F A;  3PDM P;  3IHU A;  2TMV P;  5B3I A;  5EK0 A;  1XWJ A;  2XL6 A;  3TD7 A;  4MVU A;  5HV9 A;  1V74 B;  3GEH A;  4C3B A;  5L0F A;  1WTY A;  1WWP A;  1L7C A;  1EI7 A;  2G3V A;  2HJ3 A;  4YT4 A;  3NYL A;  3H65 A;  4XEK A;  3U2L A;  1EKY A;  4MW8 A;  4MVO A;  4G7O F;  2J9V A;  2ETS A;  4PR9 A;  5E3C A;  1K05 A;  1GS9 A;  1FFH A;  3JYH A;  2YLG A;  3QZC A;  5JS5 A;  5JSL A;  3K1I C;  3K1I A;  3FOO A;  1YDI A;  1NFO A;  1YA9 A;  3M1C B;  4J7Y A;  2OEV A;  4WJ0 A;  1HY5 A;  3H2U A;  2DYS C;  2CW0 F;  3K1H A;  1GM5 A;  5T3T A;  2A0B A;  4I1O B;  1JOG A;  3SEO A;  5B3S C;  2YQY A;  1YZA A;  2HFI A;  2LIG A;  4P9T A;  3KMI A;  1ZZP A;  3QMK A;  3AQC A;  2WVO A;  3N24 A;  3AJM A;  1OW8 A;  1AEP A;  1Q0G A;  3RVY A;  2OCC C;  4U9E A;  1I4Y A;  3R2P A;  4DXW A;  4EBK A;  4DRH B;  5L3V A;  1FMW A;  4FWV A;  1TWG A;  1Z3I X;  4U5F E;  2DYR C;  2BL2 A;  4GEH A;  1OCC C;  2B0J A;  2KK1 A;  2WZF A;  4YN0 B;  1TWC A;  4FES A;  4CS7 A;  4G7H F;  5JRA A;  1M56 C;  1Q0F A;  2A6H F;  2QTV A;  1FAP B;  1YA7 O;  3C18 A;  5CIV A;  3MYF A;  1Z63 A;  4LER A;  4CS9 A;  4PFO A;  3HNJ A;  1NG1 A;  3SXM A;  1ZHX A;  4XLN F;  1ZHZ A;  2EPN A;  3FHD A;  4Z9H A;  1B68 A;  2LCH A;  2WZL A;  2G3K A;  3ZQY A;  2OKU A;  2XLD A;  2V26 A;  5EGY A;  3FAP B;  4BJT A;  2J45 A;  5B1B C;  3PHF 2;  3NYM A;  1HE9 A;  5KYY A;  2VH3 A;  2XXA A;  4R32 A;  2IXO A;  4EBB A;  3DXJ F;  1I4Z A;  4U5H A;  3NRH A;  2ZPA A;  4XPX A;  4YK5 A;  3OEO A;  5COM A;  3RQE A;  3NMK A;  1OKK A;  4CJG A;  4CDA A;  2H7V C;  4PJL A;  3ZIB A;  5CI8 A;  4YJW A;  2P1A A;  4F4B A;  1LE2 A;  5F28 E;  4C3D A;  1TR2 A;  1YVI A;  2J8W A;  3LAY A;  4XWJ A;  1U6H A;  1Y4C A;  5BUO A;  4X0R A;  4EBJ A;  3HLZ A;  5KYY B;  3N0T A;  2XXA B;  5DS6 A;  1A41 A;  2PX3 A;  5A6A A;  1PD1 A;  1ORY A;  1R4T A;  1CPQ A;  2IXP A;  4NQF A;  3H2V A;  4BPM A;  2HMZ A;  2RSE B;  3M79 A;  3X2Q C;  3HNI A;  2R05 A;  4CIH A;  1G8X A;  1J8M F;  1AUE A;  3EH1 A;  3FOP A;  3NYJ A;  4A4A A;  3GWL A;  2IXN A;  1HW1 A;  3DMD A;  3G4X A;  1RXQ A;  4UDV A;  1T9K A;  1GQA A;  3C8G D;  1G4U S;  5DS5 A;  1WAT A;  4K7B A;  1JAF A;  3FDQ A;  1QVX A;  1JPJ A;  2AU5 A;  2R03 A;  3DKA A;  4DBQ A;  2EPO A;  4G7Z F;  4I1M A;  4PFP A;  2R9R B;  2X51 A;  4XEF A;  2KW3 C;  2Z15 A;  4AE4 A;  1Q0K A;  3VRC A;  5L0J A;  2ZXW C;  5GPG B;  2YL3 A;  2IYL D;  1QLE C;  2PBE A;  5KYX B;  3WOD F;  1C17 M;  3JRT A;  4MS2 A;  4MVM A;  5E3A A;  4YWQ A;  3WHN A;  5COG A;  3M4C A;  2Y3H A;  2LP4 A;  2MWQ A;  1Y6D A;  3CZ6 A;  4NC3 A;  4E7S A;  4Q4Z F;  3DE9 A;  3PMR A;  1YAR O;  4Q7C A;  1EQ1 A;  4NY3 A;  4FAP B;  3MBG A;  3S84 A;  1BZ4 A;  1T6I A;  3UMI A;  3AOU A;  4XPW A;  3QW0 A;  4YT5 A;  4XTK A;  5A69 A;  3W8I A;  4NCQ A;  5E33 A;  1NFN A;  3GAN A;  3DAG A;  2P7V A;  2EPM X;  3C62 A;  4O79 A;  4W8K A;  4DRI B;  2YHS A;  1BR2 A;  3U0C A;  2Y39 A;  5K0I A;  4IAR A;  1NLX A;  4LAC B;  1EA8 A;  4J30 B;  3T9O A;  4HEA J;  4BEM J;  1DOW A;  1E85 A;  1H9T A;  1W2W A;  1CPR A;  1VMA A;  1RCP A;  4HFF B;  3GEI A;  3W8H A;  4RDA A;  5AGF A;  3B0V C;  1APC A;  4CDY A;  2NSF A;  4OD4 A;  3LEO A;  4LDR A;  2VCC A;  2KSF A;  3U9J A;  1QPU A;  3JSZ A;  2L7A A;  3Q7L A;  4E7Z A;  1QQ3 A;  1ZU5 A;  1U0B B;  1J8Y F;  2J0W A;  2R7X A;  1D1B A;  2YRF A;  3W2V A;  3TJ5 A;  2J46 A;  2Y3G A;  1LPE A;  1ZU4 A;  2BE5 F;  3B0P A;  1I5N A;  3EH2 A;  1VYK A;  2WVQ A;  4XLP F;  2W4B A;  4KNW A;  4XQ1 A;  2DGJ A;  1D0Z A;  2Q3T A;  3LUT B;  3E70 C;  2LK4 A;  5A6B D;  1LVK A;  3BEH A;  2UUI A;  3CQZ A;  2J7P D;  3IQ5 A;  2FAP B;  1L3P A;  3ZSU A;  3X1O A;  5A6K A;  2ASR A;  3L1M A;  3CEX A;  3NG1 A;  4U5D E;  1NU7 D;  2EIK C;  3FVY A;  4ONS A;  5COF A;  4A2N B;  2I8B A;  2Y3D A;  1VLT A;  2LQG A;  3BRJ A;  5B1A C;  1RMV A;  2XSE A;  4DVY P;  2LD6 A;  1JR8 A;  5AC5 A;  1TFO B;  3C8G A;  3EQL F;  4PAC A;  2HZ8 A;  4BG0 A;  4MTF A;  5AC4 A;  1DOV A;  2OJE D;  2XS8 A;  3ATP A;  2GA0 A;  2PFD A;  5DQT A;  3T4R A;  1NZE A;  4CSA A;  4CSA C;  1MQV A;  2UUH A;  3DD7 A;  2EIL C;  1OR2 A;  3EPV A;  3L34 A;  5D92 A;  3C8G B;  3SXY A;  4JUR I;  5KYU A;  1FNT c;  1LM3 B;  3KH2 A;  3SZR A;  4MVS A;  4E0I A;  5L3Q A;  2Q7R A;  4JC7 A;  4EUK B;  1LKX A;  2YEV A;  3B71 A;  3TK0 A;  4ER9 A;  1ORS C;  1OW6 A;  1T01 A;  2E87 A;  2HUJ A;  3HTK C;  5CI9 A;  3U3F A;  4E18 A;  3VYW A;  2HSB A;  3TOM A;  2AWC A;  5KYU B;  2A6E F;  1LIH A;  5HSW A;  1K40 A;  2OOC A;  2HS5 A;  2XLV A;  2ZXP A;  4KNV A;  3V5Z A;  3DE8 A;  3W4Y A;  2PF4 E;  4CS9 C;  3ZDL A;  1OCZ C;  5L0C A;  2R7S A;  1MMN A;  3AG3 C;  1M57 C;  4K1O A;  2HKV A;  3V5X A;  1QSP A;  4I44 A;  1XZP A;  3JT1 A;  2CNW A;  1NSG B;  3EGX A;  4YT8 A;  3AG2 C;  4NTF A;  3L0I A;  4IRU A;  4JRZ A;  1TQG A;  4OIN F;  1HW2 A;  2P6V A;  3I5Q A;  4CX9 A;  3ZWI A;  4WAB A;  1D0Y A;  2VC9 A;  2IXM A;  1ZHT A;  1HE1 A;  3LEV A;  4BJ1 A;  3EGX B;  4M63 A;  5DS4 A;  2LFF A;  3AGT A;  3WAQ A;  3A9C A;  3FMS A;  4O6Y A;  3RQG A;  2ZXR A;  2XL4 A;  3GOD A;  1M2V A;  2A0U A;  3LLK A;  5JUA A;  1FR0 A;  256B A;  3IEE A;  2M4E A;  2YWA A;  1VOM A;  3HNK A;  4JW1 A;  4PJN A;  2MHR A;  4CIP A;  2I15 A;  3ABK C;  4DBR A;  4DRJ B;  3NMJ A;  4C7O B;  5JLI A;  1M2V B;  2PNO A;  4EIY A;  1WOL A;  2OJQ A;  4BJ6 A;  4BJ6 C;  1CGM E;  3RF3 A;  1FFT C;  2AP3 A;  1AVO B;  1MNE A;  2M64 A;  4FX5 A;  4U5C E;  3ECS A;  2L9J A;  4WGY A;  5A6B A;  3QVY A;  1RKE A;  2J7P A;  2PX0 A;  2IBF A;  5L0H A;  3E9V A;  2XLH A;  4JEB A;  3K66 A;  4MQ9 F;  1MMG A;  3ZQV A;  4CJO A;  4CBE A;  4I3M A;  1RKE B;  4JJF A;  4KC9 A;  3LLI A;  4LLC A;  4YT2 A;  5L0G A;  3QW1 A;  4U5B E;  4KI2 A;  2AWY A;  2QNL A;  2KNH A;  2MYS A;  3KKB A;  3IQT A;  4L6R A;  1OXB A;  1F1M A;  2WL8 A;  3PCV A;  1E83 A;  2CCY A;  1C02 A;  1BDJ B;  4U9D A;  1ZVZ A;  4C3E A;  4K0D A;  2Q9B A;  5T1D B;  3TOL A;  3JTL O;  1UFB A;  3IPM O;  4ANJ A;  1C03 A;  4DVZ A;  5BQH A;  1YAU O;  2FFH A;  2ZD9 A;  1Q0M A;  3ASO C;  1D0X A;  3TJ6 A;  3ZVR A;  3T6G B;  3O10 A;  4IB4 A;  5FZT A;  5BQG A;  3S9O A;  1A7V A;  2A68 F;  3N2Z B;  2OEX A;  4Q5S F;  4JTC B;  1YYJ A;  4JKV A;  1Z7Q c;  4MTO A;  1ZYR F;  1H9G A;  1MMA A;  4HE8 D;  1OQC A;  2F22 A;  2LFD A;  1SR2 A;  2VB6 A;  2R7Q A;  2OU6 A;  1QKR A;  2XLE A;  3A11 A;  4O6M A;  3V5Y A;  1BBH A;  2NUP A;  1RKC A;  2IM8 A;  4JTA B;  3J06 A;  2A1D D;  4N4W A;  3R7C A;  3RFY A;  3MFN A;  1K04 A;  3ZG1 A;  1Z5Z A;  2XS1 A;  5TJ5 E;  2JPU A;  2B0H A;  4LDQ A;  3T6J A;  2ICW G;  2IOQ A;  2NUP B;  3EGD A;  3MYI A;  3Q6M A;  3RVZ A;  3ZTM A;  1H7I A;  4MVZ A;  2L6F A;  3MLG A;  1BR4 A;  3AG1 C;  3UNG C;  1VYI A;  1Z6A A;  4E17 A;  1T5O A;  2YLI A;  4IAO A;  5JT4 A;  4JE9 A;  5FCL A;  3F46 A;  3DWW A;  1A0B A;  1TKN A;  3EGD B;  3JZ0 A;  2RD9 A;  2CYD A;  1YZC A;  2ZXO A;  2BC5 A;  4J32 B;  3WG7 C;  1E84 A;  1WGW A;  2XL8 A;  1FMV A;  1CGN A;  3DM9 B;  2R7U A;  1MND A;  2C03 A;  1OCO C;  2L6H A;  3C63 A;  1LE4 A;  3EHM A;  3LES A;  3IQ6 A;  1OKK D;  4MTG A;  4OIO F;  3HJC A;  3HKK A;  3ITF A;  1IW7 F;  3VM6 A;  1ZHW A;  2HSQ A;  2GFH A;  1O5H A;  4AL1 A;  1T6U A;  3ABM C;  2EPK X;  3KPH A;  4IWB A;  1G4W R;  3UMK A;  3ZTZ A;  1O87 A;  4G0H A;  2XRH A;  1YYX A;  3CAX A;  1G5Z A;  3DM5 A;  1TFK B;  3G4Z A;  1ZW3 A;  3SXZ A;  5KYN A;  1OW7 A;  4JTD B;  1TWH A;  3NKD A;  4H54 A;  3U9M A;  2J9W A;  1M6T A;  5DQZ A;  2OQM A;  2W45 A;  5KYW A;  3S29 A;  1H6G A;  4AX2 A;  5BQI A;  2WZG A;  2KQ9 A;  3DJN B;  2DB4 A;  3RQF A;  5IY5 C;  3RKO F;  2KC3 A;  3GM1 A;  4MW3 A;  2NUT A;  4YL3 A;  2HJM A;  3L8J A;  2CDQ A;  3US6 A;  5KYW B;  2QY9 A;  3OA1 A;  1HMO A;  3U8V A;  1PV3 A;  1A7E A;  2GWW A;  3KYJ A;  4EHP A;  1SMY F;  3MX3 A;  1OR3 A;  1VTM P;  2HV6 A;  1CGO A;  2NUT B;  2P0N A;  3ABL C;  4JEA A;  1GGQ A;  2EPL X;  2NG1 A;  4P9F A;  2VCA A;  1FTS A;  3DJU B;  4OIP F;  3I5P A;  4N6H A;  3GEE A;  3LNM B;  4O6N A;  2V3C C;  3SNH A;  2YZS A;  2HMQ A;  2XLM A;  2EIJ C;  2QLA A;  4B6I A;  3ASN C;  3FXH A;  3S0X A;  1S05 A;  3QVZ A;  4YL0 A;  5JVE A;  4QI0 A;  2NPU A;  3DI5 A;  3U8P A;  3I4U A;  3U3B A;  1OXK A;  2O9X A;  3EFO A;  2D4U A;  3LJB A;  2YL0 A;  3JCU Q;  2YKZ A;  1OCR C;  1VB5 A;  2Y69 C;  2Q00 A;  1V54 C;  3K33 A;  3LNR A;  4MND A;  4NTB A;  4U5G A;  1WN0 A;  1YJG A;  3DAF A;  4C7O A;  2R02 A;  3JSE O;  3B0U X;  4KBL A;  2KJG A;  3EFO B;  4MVR A;  4JCZ A;  1KNY A;  2Q9A A;  5EHH A;  4IJJ A;  4O7G A;  3CSK A;  3VF0 A;  1LS1 A;  2PP4 A;  3S27 A;  2A69 F;  5A6J A;  4P6I C;  2LSE A;  3GOR A;  4N6C A;  2CGE A;  2YL1 A;  3C8Z A;  1T6Q A;  4NTA A;  1NBB A;  4IAQ A;  2L6G A;  2YVK A;  4CS8 C;  3TQO A;  4CS8 A;  1VK5 A;  2DI3 A;  3AQB A;  4JIO A;  1ZHY A;  1UG7 A;  2VAS A;  3HNL A;  4H4K C;  4OD5 A;  4ULW A;  1V55 C;  4WGZ A;  4Z9J A;  3NDB B;  1ORJ A;  4HFK B;  4Z9I A;  4EWC A;  3DZA A;  3KL4 A;  1M2O A;  1N1C A;  3K6B A;  2J9B A;  2X0C A;  2XM0 A;  3M15 A;  3VAY A;  2R25 A;  2KGO A;  3V7O A;  5F5F A;  1WAS A;  4PJJ A;  3T6B A;  3L8I A;  1V4A A;  3OWT A;  1LI5 A;  1Q0D A;  3G50 A;  2R7V A;  3KYI A;  4AL0 A;  4RBN A;  4PJM A;  4JVS A;  3UR3 C;  5KYX A;  2WVN A;  5T3W A;  4OIR F;  2KYH A;  2Q9C A;  2QE9 A;  2D5R B;  3B29 A;  1SYQ A;  1ZW2 A;  1NU9 C;  3UGO A;  1Z23 A;  1KU2 A;  1JMW A;  5DLJ A;  4G78 A;  5L0I A;  1E86 A;  1IZM A;  3C7J A;  5JP7 A;  2JX0 A;  3RYL A;  2R7R A;  3NMI A;  4JCH A;  3S90 A;  3W2W A; 
#chains in the Genus database with same CATH homology
 2QUP A;  2P61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...