1LE4A

Structural basis for altered function in the common mutants of human apolipoprotein-e
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
139
structure length
139
Chain Sequence
QRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human apolipoprotein E. Role of arginine 61 in mediating the lipoprotein preferences of the E3 and E4 isoforms.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipoprotein
molecule keywords APOLIPOPROTEIN E4
total genus 61
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1991-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1le4A00
1EA8A 1LS4A 1OR2A 2KC3A 3R2PA 1LE2A 1BZ4A 1LPEA 1LE4A 1EQ1A 1NFOA 3S84A 1GS9A 1AEPA 1B68A 1OR3A 1NFNA 1H7IA 1YA9A
chains in the Genus database with same CATH superfamily
5DQTA 1PD1A 1FNTc 3FVYA 4P9FA 4WGZA 1CGOA 4WJ0A 1Q0KA 3DAFA 3T6GB 5B1BC 1RKEB 2WVOA 2P1AA 3NYLA 5KYWA 2H7VC 2QUPA 4CS7A 1J8YF 1R4TA 3HNIA 4CS8C 1VYIA 3LESA 1K05A 3MYFA 4XLPF 1H9GA 3AG2C 3EG9B 3HLZA 1PV3A 1LVKA 3AG4C 3JRMO 4U5GA 5E3CA 2ZXWC 4EIYA 3I4UA 1OCZC 2JD3A 3OEOA 2HFIA 3N2ZB 4N6CA 1MMDA 3S84A 4CIPA 2HMQA 2YLDA 3GWNA 4NQFA 1BDJB 3G4XA 1QQ3A 4XEKA 4I3MA 4Z9HA 3TD7A 1Z6AA 2BE5F 2J9UA 3O55A 2QTVA 3GEHA 2CCYA 4AK9A 1RKEA 4YK5A 2HZ8A 1VMAA 1JPNA 2VB6A 1WGWA 2J8WA 1HE9A 1MMAA 3C8ZA 4HEAJ 4H54A 4JTAB 2C03A 3ZWIA 3T6JA 3EG9A 4JTCB 1B68A 2ZXPA 3GWLA 1GM5A 2OEVA 3LJBA 3QVZA 1ZHTA 4EUKB 1C03A 3W2WA 1NU7D 1EI7A 4CDAA 2HUJA 4CDYA 1YZAA 4U5HA 3NMIA 3E9VA 5D91A 4CS8A 2KQ9A 3NG1A 2VC9A 1HY5A 1TWHA 2WL8A 3DZAA 1BZ4A 1FMWA 1LE4A 3K1IA 1UFBA 3JZ0A 3RVZA 2W4MA 3RH3A 2XL6A 1TFOB 1ZU5A 3B29A 1ZZPA 3EGXB 4PR9A 3C62A 2OJED 2EIJC 1PCXA 5E33A 4BJ6C 1WOLA 3SYNA 2CDQA 1NBBA 3V5ZA 3WAQA 4I44A 4BJ5A 4UDVA 4BEMJ 3TOMA 5B3SC 1OR2A 3VYWA 3FOOA 1GQAA 4JJFA 3MBGA 3ZQVA 3OWTA 1A0BA 1SR2A 1Z63A 2R25A 5EGYA 2KW3C 1HE1A 2NUTB 4Z9JA 3CSKA 3RQFA 3C63A 3W2VA 4QI2A 2XLOA 4K7BA 1R5ID 3R2PA 3ABMC 2YHSA 1NG1A 1M6TA 4W8KA 3M15A 3GEEA 1H9TA 1MMNA 1T9KA 4JJGA 4MTGA 3ABLC 3DAGA 5L3QA 2GFHA 5JUAA 2DYRC 2ZXOA 2NSFA 2X0CA 3UGOA 3EJNA 5DS6A 3CQZA 2BL2A 3L1MA 3JT1A 4EKWA 3IQTA 1D0XA 1BR1A 3HJCA 1XZQA 4I1MA 4NTAA 4NCQA 3K7DA 1E2XA 2PP4A 3TQOA 5BQIA 3PDMP 4ZLDA 1LIHA 4XLNF 1CPRA 4LERA 3VRCA 3B71A 4YT2A 1GS9A 2HSBA 1OXKA 2Y3DA 2YEVA 4O6YA 3UNGC 4KI2A 4JKVA 4U5FE 3EHNA 1OCOC 256BA 4LLCA 3DXJF 4NTBA 4Z9IA 3ZC4A 3ZSUA 4JW1A 1O5HA 3X2QC 4N06A 2YWAA 4G7ZF 1Q0MA 1HMOA 2B0JA 2DGJA 3ZDLA 1APCA 4IAOA 2OCCC 2J0WA 2L6GA 3AGTA 3PMRA 5E2QA 4ZLCA 2KYHA 3SXMA 4KC9A 4AE4A 4B6IA 1S05A 1MNDA 4MTOA 4J7TA 5HV9A 5A6KA 1OCRC 5DLJA 1V74B 3AQBA 3CAXA 3GM3A 4YT5A 2AP3A 5F5HA 4XWJA 4MW8A 5AC5A 2I15A 1FTSA 1IZMA 1LI5A 4ER9A 4XPYA 1EQ1A 1RKCA 4J30B 4IB4A 1JAFA 2FFHA 4JE9A 1T6QA 3I5PA 1WWPA 2XS1A 4HFFB 3M79A 4CS9C 3KPHA 5KYWB 2J9WA 3IQCA 2XLVA 4MTFA 3ATPA 2QE9A 2EPLX 3A11A 3EGDB 3GM2A 2YQYA 4ULWA 4AL1A 4DBRA 2PFDA 3U2LA 3GANA 1K04A 2LD6A 4IAQA 4E0HA 4D4XA 1D1BA 4AL0A 4IJJA 4PJNA 3DM9B 4YJWA 2LP4A 5COFA 2OJQA 4CJOA 4DVZA 4A2NB 2A69F 1VB5A 4J7YA 4KNVA 1NSGB 2C04A 1Q0DA 2OQMA 1RXQA 2LSEA 1W2WA 2R7SA 2I8BA 1SMYF 1D1AA 2IXMA 3NKEA 3U9MA 2D4UA 3IQ5A 4PJLA 1LI7A 2R02A 2XLDA 1KNYA 3NYJA 2WB7A 2HS5A 1A7EA 1TWGA 1MNEA 4XQ1A 3U2MA 4DBQA 1ZW2A 4NTFA 3O10A 2W4BA 5KYUA 3SP1A 2IXNA 2RD9A 3K33A 1D0YA 1XWJA 2EPOA 3KMIA 5A6BD 4YL1A 1NLXA 2XLWA 2Q4FA 3HKKA 3LNRA 1RJ9B 1C02A 1OKKA 1Q0FA 2Y3HA 4Q7CA 1K40A 3K6BA 5DVWA 2R7VA 2R7XA 4BJ6A 1G5ZA 2OKUA 4MS2A 3Q6MA 4JIOA 4BJ5C 4GYTA 4BJ1A 3ECSA 1T5OA 2OEXA 3U8VA 1V4AA 3FXHA 2EPKX 4OIQF 2LQGA 4G78A 1L3PA 2IOQA 5E3AA 2QY9A 2KC3A 3IEEA 3M1CB 3DMDA 5D92A 2FAPB 2AVKA 3U8PA 2W45A 4YT4A 4YL0A 3TK0A 1E83A 1Z23A 1ZHZA 4QDLA 1D1CA 3UMKA 5L0HA 5KYNA 4NC3A 4MVOA 4GQHA 1BR4A 2FGYA 3EGDA 3N24A 4OINF 5KYYB 4KBLA 4OD4A 1LKXA 2DI3A 1QZXA 1NFNA 5A69A 1I4YA 3LNMB 2Q9BA 1O3UA 3B0UX 4A4AA 2W9YA 1Z7Qc 3SZRA 3TJ5A 2XXAB 3S28A 3T9OA 2ZXRA 2EPNA 4DJ9A 5L3VA 3VM6A 2NPUA 4NY3A 5K0IA 2L6FA 3DJUB 3DD7A 3PCVA 4O6MA 1S7ZA 3ZG1A 1WASA 2KJGA 4KNWA 5AGFA 3S9OA 2X51A 2R7OA 2LFFA 2YRFA 3E70C 1SYQA 3HTKC 2PNOA 2L81A 4U5DE 4P9TA 4MVSA 2GA0A 2XLMA 4PFPA 4Q4ZF 2MYSA 3L8IA 3U5SA 1QSPA 2WZLA 1KU2A 2H7OA 5BQGA 1MQVA 4GEHA 1TR2A 4JEBA 4O6NA 5CI8A 4PFOA 4JZAA 2WZFA 4JRZA 3F46A 3UMHA 4IARA 4OD5A 5A6AA 3JRTA 4MNDA 1NZEA 3AJMA 3ZTZA 5CIVA 3K66A 3AOUA 4LDRA 1QKRA 1LE2A 2YL1A 3C7JA 2Y39A 3FHDA 1VLTA 2BC5A 2Y3BA 4MVQA 3ABKC 5T1DB 4BEJA 4RDAA 5L0DA 2GDCA 3HNJA 1LM3B 2Q00A 3V5YA 4DRIB 4G7OF 1ZHXA 1VYKA 4YT8A 1RCPA 3NYMA 2CNWD 1YAUO 2WVNA 1U6HA 3RQEA 1JOGA 3T4RA 3SEOA 2A0BA 4EBBA 1YVIA 4JURI 4CSAA 2OOCA 1GGQA 2F22A 4LDQA 1ORJA 4CS9A 2LIGA 5L0JA 5L0IA 1YYXA 4CX9A 2V3CC 2PF4E 3KYJA 1WN0A 1VK5A 1YYJA 4JEAA 4U9EA 2CW0F 1T6IA 2A0UA 3C8GA 4OIRF 5KYUB 1YLMA 3LAYA 1NU9C 5COMA 5FZTA 3VAYA 3W4YA 2A6HF 1C17M 1M2OA 4CJGA 3HNKA 1OCCC 3LS0A 1HW1A 2CYDA 2GAQA 2KK1A 3JTLO 4FWVA 1DOVA 1JR8A 1WATA 3RQGA 3S90A 4C7OB 3SNHA 3RFYA 3B0PA 2R7RA 5A6BA 2G3KA 2YL7A 1OW6A 4R32A 2EIMC 1HW2A 1G4WR 2Q9CA 3LS1A 4W8PA 2JX0A 3AG1C 1TKNA 2J7PD 3BEHA 2VCAA 2XM4A 2PX0A 3US6A 2XRHA 1EA8A 2R7UA 2Z15A 2ASRA 1F1MA 4HE8D 1Q0GA 1OW8A 2PX3A 2UUIA 2IXPA 4P6IC 4U5BE 4MVRA 4E17A 1M2VA 4N6HA 5T3TA 3TJ6A 4C3EA 5F5FA 4FESA 3RYLA 3SXZA 1EKYA 1PD0A 2XLEA 1U89A 2J46A 2M4EA 2L6HA 2E87A 1E86A 3IQ6A 2DYSC 1T6UA 4EHPA 4C7OA 1WTYA 5EK0A 1G8XA 5JT4A 2EINC 2HV6A 2J0XA 4CDVA 4RBNA 5B3IA 4E7SA 4CIHA 2J45A 3G50A 5DQZA 2Q9AA 2UUHA 4I1OB 5JRAA 3ZIBA 2LFDA 4WGYA 2HSQA 4EBJA 4MVZA 1ZVZA 2R7QA 4G7HF 3C8GB 1YA9A 2AU5A 3QVYA 4IWBA 2L9JA 2L7AA 4K0DA 4PK4A 1AEPA 3S0XA 4N4WA 1Y4CA 3K1IC 3W8IA 3J06A 1E85A 1QLEC 1U0BB 4JC7A 1VLSA 4PJJA 4ANJA 1LPEA 2VCCA 5TJ5E 2NSGA 3CZ6A 3NDBB 2IXOA 2NUPB 1QVXA 2XM0A 2XLHA 2YL0A 4F4BA 3BRJA 4K1OA 2XL8A 4CBEA 4ULVA 5T3WA 3U9JA 2YKZA 1AUEA 2B0HA 4LACB 2IYLD 2R9RB 2HMZA 3RF3A 2Y3GA 4XTKA 1JPJA 3VF0A 1L7CA 1SF8A 3KYIA 1VTMP 2XL4A 2QLAA 2VCBA 1ZU4A 2A6EF 1M57C 4C3BA 3POVA 3GEIA 3FAPB 2NUPA 3QTHA 4C3DA 2H7BA 3F47A 1BBHA 2LCHA 5COGA 4MQ9F 2R7WA 2ETSA 2WZGA 4D4NA 2J9VA 4LLEA 3EQLF 3L8JA 5IY5C 2HJMA 2QNLA 2RSEB 3KKBA 3LEOA 4JTDB 4DOZA 3MLGA 5DS4A 4IRUA 4DVYP 2J7PA 3JCUQ 3DJNB 3ASNC 1ZHYA 3MX3A 1TWAA 4FX5A 1DOWA 4HFKB 3R7CA 3C18A 4U5CE 1OQCA 1J8MF 1ST6A 3UMIA 4IGGA 2D5RB 3A9CA 3TOLA 3H2VA 2AWCA 4MW3A 5A6JA 4CSAC 1YZCA 4X0RA 3L0IA 1D0ZA 1XZPA 2R03A 3M4CA 1RMVA 1O87A 2P7VA 3S27A 5JLIA 2XSEA 2XXAA 2KGOA 1FR0A 3DM5A 4U5EE 4AX2A 1YDIA 1YA7O 4U9DA 3LLIA 2R7TA 3MFNA 5L0FA 3HNLA 3RW0A 4O7GA 3ITFA 1AVOB 3O39A 3NMKA 1M2VB 4XEVA 2OG2A 2P6VA 2CNWA 2CGEA 5AC4A 3WODF 1UG7A 1ZHWA 3EFOA 4EBKA 3EHMA 4J32B 4BG0A 2A1DD 3FOPA 3FDQA 3U0CA 3IPMO 4E7ZA 2HV7A 2G3VA 4OIPF 1M56C 4DRJB 1JMWA 3GORA 2P0NA 3V7OA 3B0VC 3WG7C 2YZSA 5DS5A 3DI5A 1A7DA 1TFKB 3EH2A 1KTMA 1V55C 3L34A 2KNHA 4JVSA 4XPWA 1G4US 2JPUA 2A68F 1V54C 2HKVA 2P61A 4JCZA 3CEXA 4BPMA 5KYXA 1QPUA 1E84A 3QMKA 4MVMA 5CI9A 3QW0A 4WABA 3U3FA 3EZIA 4H4KC 4E18A 3PHF2 2O9XA 3EZHA 4YWQA 3JSEO 2TMVP 5BQHA 2YVKA 3M4BA 4OIOF 1H7IA 1VOMA 2VASA 1RJ9A 3X1OA 3ASOC 3DE9A 3EH1A 2J9BA 2YL3A 5GPGB 1YARO 2V26A 3DWWA 3EGXA 2MHRA 1ORSC 2AWYA 3W8HA 3FMSA 2IM8A 3JSZA 5KYXB 3O6XA 3Q7LA 2LK4A 5BUOA 1JRAA 2DB4A 3NMJA 5JP7A 4L6RA 5HSWA 3DKAA 1ZYRF 4FAPB 1OW7A 1HMDA 3EFOB 2HJ3A 5EHHA 1TQGA 2NG1A 4ONSA 3SXKA 3JYHA 5KYYA 2NUTA 3FAJA 2H8AA 2R05A 2YLGA 1SZIA 1OXBA 3OA1A 4XPXA 5JS5A 4JCHA 2EILC 2ZPAA 2Q7RA 3S29A 4YL3A 3AG3C 4DXWA 3TULA 3AQCA 3H65A 2Y69C 3N0TA 1BR2A 1FAPB 1FMVA 3RVYA 5L0GA 2G62A 1OR3A 1Z3IX 3U3BA 4BJTA 1CGNA 4YN0B 1LS4A 3EPVA 4PACA 1Z5ZA 3Q7GA 2GWWA 1I4ZA 3KL4A 3Q6NA 1OKKD 3LUTB 2YLIA 5B1AC 1TWCA 3T6BA 2OU6A 3MYIA 1N1CA 4EWCA 3C8GD 1FFTC 2VH3A 3NKDA 3I5QA 1FFHA 3K1HA 3JYYA 4O79A 3WHNA 1CPQA 3ZQYA 2ZD9A 4LDKA 2Q3TA 3ZTMA 4DRHB 3QW1A 2KSFA 3ZVRA 4MVUA 5JVEA 2IBFA 3UGPA 3GM1A 3G4ZA 3DE8A 1NFOA 3B9QA 4PJMA 1ORYA 5L0CA 3IHUA 5F28E 1YJGA 4XEFA 4Q5SF 3SXYA 2ICWG 4RD9A 3LLKA 2EPMX 1H6GA 3KH2A 3NRHA 3RIPA 3LEVA 2M64A 3GODA 1A7VA 3UR3C 3QZCA 5JSLA 3V5XA 4AE4B 1I5NA 3AGUA 2EIKC 4E0IA 5FCLA 1CGME 1LS1A 1ZW3A 1IW7F 4G0HA 4M63A 1T01A 3H2UA 2MWQA 2XS8A 3RKOF 2WVQA 2PBEA 1MMGA 1A41A 4QI0A 1Y6DA
chains in the Genus database with same CATH topology
1EA8A 1LS4A 1OR2A 2KC3A 3R2PA 1LE2A 1BZ4A 1LPEA 1LE4A 1EQ1A 1NFOA 3S84A 1GS9A 1AEPA 1B68A 1OR3A 1NFNA 1H7IA 1YA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA8 A;  1LS4 A;  1OR2 A;  2KC3 A;  3R2P A;  1LE2 A;  1BZ4 A;  1LPE A;  1LE4 A;  1EQ1 A;  1NFO A;  3S84 A;  1GS9 A;  1AEP A;  1B68 A;  1OR3 A;  1NFN A;  1H7I A;  1YA9 A; 
#chains in the Genus database with same CATH topology
 5DQT A;  1PD1 A;  1FNT c;  3FVY A;  4P9F A;  4WGZ A;  1CGO A;  4WJ0 A;  1Q0K A;  3DAF A;  3T6G B;  5B1B C;  1RKE B;  2WVO A;  2P1A A;  3NYL A;  5KYW A;  2H7V C;  2QUP A;  4CS7 A;  1J8Y F;  1R4T A;  3HNI A;  4CS8 C;  1VYI A;  3LES A;  1K05 A;  3MYF A;  4XLP F;  1H9G A;  3AG2 C;  3EG9 B;  3HLZ A;  1PV3 A;  1LVK A;  3AG4 C;  3JRM O;  4U5G A;  5E3C A;  2ZXW C;  4EIY A;  3I4U A;  1OCZ C;  2JD3 A;  3OEO A;  2HFI A;  3N2Z B;  4N6C A;  1MMD A;  3S84 A;  4CIP A;  2HMQ A;  2YLD A;  3GWN A;  4NQF A;  1BDJ B;  3G4X A;  1QQ3 A;  4XEK A;  4I3M A;  4Z9H A;  3TD7 A;  1Z6A A;  2BE5 F;  2J9U A;  3O55 A;  2QTV A;  3GEH A;  2CCY A;  4AK9 A;  1RKE A;  4YK5 A;  2HZ8 A;  1VMA A;  1JPN A;  2VB6 A;  1WGW A;  2J8W A;  1HE9 A;  1MMA A;  3C8Z A;  4HEA J;  4H54 A;  4JTA B;  2C03 A;  3ZWI A;  3T6J A;  3EG9 A;  4JTC B;  1B68 A;  2ZXP A;  3GWL A;  1GM5 A;  2OEV A;  3LJB A;  3QVZ A;  1ZHT A;  4EUK B;  1C03 A;  3W2W A;  1NU7 D;  1EI7 A;  4CDA A;  2HUJ A;  4CDY A;  1YZA A;  4U5H A;  3NMI A;  3E9V A;  5D91 A;  4CS8 A;  2KQ9 A;  3NG1 A;  2VC9 A;  1HY5 A;  1TWH A;  2WL8 A;  3DZA A;  1BZ4 A;  1FMW A;  1LE4 A;  3K1I A;  1UFB A;  3JZ0 A;  3RVZ A;  2W4M A;  3RH3 A;  2XL6 A;  1TFO B;  1ZU5 A;  3B29 A;  1ZZP A;  3EGX B;  4PR9 A;  3C62 A;  2OJE D;  2EIJ C;  1PCX A;  5E33 A;  4BJ6 C;  1WOL A;  3SYN A;  2CDQ A;  1NBB A;  3V5Z A;  3WAQ A;  4I44 A;  4BJ5 A;  4UDV A;  4BEM J;  3TOM A;  5B3S C;  1OR2 A;  3VYW A;  3FOO A;  1GQA A;  4JJF A;  3MBG A;  3ZQV A;  3OWT A;  1A0B A;  1SR2 A;  1Z63 A;  2R25 A;  5EGY A;  2KW3 C;  1HE1 A;  2NUT B;  4Z9J A;  3CSK A;  3RQF A;  3C63 A;  3W2V A;  4QI2 A;  2XLO A;  4K7B A;  1R5I D;  3R2P A;  3ABM C;  2YHS A;  1NG1 A;  1M6T A;  4W8K A;  3M15 A;  3GEE A;  1H9T A;  1MMN A;  1T9K A;  4JJG A;  4MTG A;  3ABL C;  3DAG A;  5L3Q A;  2GFH A;  5JUA A;  2DYR C;  2ZXO A;  2NSF A;  2X0C A;  3UGO A;  3EJN A;  5DS6 A;  3CQZ A;  2BL2 A;  3L1M A;  3JT1 A;  4EKW A;  3IQT A;  1D0X A;  1BR1 A;  3HJC A;  1XZQ A;  4I1M A;  4NTA A;  4NCQ A;  3K7D A;  1E2X A;  2PP4 A;  3TQO A;  5BQI A;  3PDM P;  4ZLD A;  1LIH A;  4XLN F;  1CPR A;  4LER A;  3VRC A;  3B71 A;  4YT2 A;  1GS9 A;  2HSB A;  1OXK A;  2Y3D A;  2YEV A;  4O6Y A;  3UNG C;  4KI2 A;  4JKV A;  4U5F E;  3EHN A;  1OCO C;  256B A;  4LLC A;  3DXJ F;  4NTB A;  4Z9I A;  3ZC4 A;  3ZSU A;  4JW1 A;  1O5H A;  3X2Q C;  4N06 A;  2YWA A;  4G7Z F;  1Q0M A;  1HMO A;  2B0J A;  2DGJ A;  3ZDL A;  1APC A;  4IAO A;  2OCC C;  2J0W A;  2L6G A;  3AGT A;  3PMR A;  5E2Q A;  4ZLC A;  2KYH A;  3SXM A;  4KC9 A;  4AE4 A;  4B6I A;  1S05 A;  1MND A;  4MTO A;  4J7T A;  5HV9 A;  5A6K A;  1OCR C;  5DLJ A;  1V74 B;  3AQB A;  3CAX A;  3GM3 A;  4YT5 A;  2AP3 A;  5F5H A;  4XWJ A;  4MW8 A;  5AC5 A;  2I15 A;  1FTS A;  1IZM A;  1LI5 A;  4ER9 A;  4XPY A;  1EQ1 A;  1RKC A;  4J30 B;  4IB4 A;  1JAF A;  2FFH A;  4JE9 A;  1T6Q A;  3I5P A;  1WWP A;  2XS1 A;  4HFF B;  3M79 A;  4CS9 C;  3KPH A;  5KYW B;  2J9W A;  3IQC A;  2XLV A;  4MTF A;  3ATP A;  2QE9 A;  2EPL X;  3A11 A;  3EGD B;  3GM2 A;  2YQY A;  4ULW A;  4AL1 A;  4DBR A;  2PFD A;  3U2L A;  3GAN A;  1K04 A;  2LD6 A;  4IAQ A;  4E0H A;  4D4X A;  1D1B A;  4AL0 A;  4IJJ A;  4PJN A;  3DM9 B;  4YJW A;  2LP4 A;  5COF A;  2OJQ A;  4CJO A;  4DVZ A;  4A2N B;  2A69 F;  1VB5 A;  4J7Y A;  4KNV A;  1NSG B;  2C04 A;  1Q0D A;  2OQM A;  1RXQ A;  2LSE A;  1W2W A;  2R7S A;  2I8B A;  1SMY F;  1D1A A;  2IXM A;  3NKE A;  3U9M A;  2D4U A;  3IQ5 A;  4PJL A;  1LI7 A;  2R02 A;  2XLD A;  1KNY A;  3NYJ A;  2WB7 A;  2HS5 A;  1A7E A;  1TWG A;  1MNE A;  4XQ1 A;  3U2M A;  4DBQ A;  1ZW2 A;  4NTF A;  3O10 A;  2W4B A;  5KYU A;  3SP1 A;  2IXN A;  2RD9 A;  3K33 A;  1D0Y A;  1XWJ A;  2EPO A;  3KMI A;  5A6B D;  4YL1 A;  1NLX A;  2XLW A;  2Q4F A;  3HKK A;  3LNR A;  1RJ9 B;  1C02 A;  1OKK A;  1Q0F A;  2Y3H A;  4Q7C A;  1K40 A;  3K6B A;  5DVW A;  2R7V A;  2R7X A;  4BJ6 A;  1G5Z A;  2OKU A;  4MS2 A;  3Q6M A;  4JIO A;  4BJ5 C;  4GYT A;  4BJ1 A;  3ECS A;  1T5O A;  2OEX A;  3U8V A;  1V4A A;  3FXH A;  2EPK X;  4OIQ F;  2LQG A;  4G78 A;  1L3P A;  2IOQ A;  5E3A A;  2QY9 A;  2KC3 A;  3IEE A;  3M1C B;  3DMD A;  5D92 A;  2FAP B;  2AVK A;  3U8P A;  2W45 A;  4YT4 A;  4YL0 A;  3TK0 A;  1E83 A;  1Z23 A;  1ZHZ A;  4QDL A;  1D1C A;  3UMK A;  5L0H A;  5KYN A;  4NC3 A;  4MVO A;  4GQH A;  1BR4 A;  2FGY A;  3EGD A;  3N24 A;  4OIN F;  5KYY B;  4KBL A;  4OD4 A;  1LKX A;  2DI3 A;  1QZX A;  1NFN A;  5A69 A;  1I4Y A;  3LNM B;  2Q9B A;  1O3U A;  3B0U X;  4A4A A;  2W9Y A;  1Z7Q c;  3SZR A;  3TJ5 A;  2XXA B;  3S28 A;  3T9O A;  2ZXR A;  2EPN A;  4DJ9 A;  5L3V A;  3VM6 A;  2NPU A;  4NY3 A;  5K0I A;  2L6F A;  3DJU B;  3DD7 A;  3PCV A;  4O6M A;  1S7Z A;  3ZG1 A;  1WAS A;  2KJG A;  4KNW A;  5AGF A;  3S9O A;  2X51 A;  2R7O A;  2LFF A;  2YRF A;  3E70 C;  1SYQ A;  3HTK C;  2PNO A;  2L81 A;  4U5D E;  4P9T A;  4MVS A;  2GA0 A;  2XLM A;  4PFP A;  4Q4Z F;  2MYS A;  3L8I A;  3U5S A;  1QSP A;  2WZL A;  1KU2 A;  2H7O A;  5BQG A;  1MQV A;  4GEH A;  1TR2 A;  4JEB A;  4O6N A;  5CI8 A;  4PFO A;  4JZA A;  2WZF A;  4JRZ A;  3F46 A;  3UMH A;  4IAR A;  4OD5 A;  5A6A A;  3JRT A;  4MND A;  1NZE A;  3AJM A;  3ZTZ A;  5CIV A;  3K66 A;  3AOU A;  4LDR A;  1QKR A;  1LE2 A;  2YL1 A;  3C7J A;  2Y39 A;  3FHD A;  1VLT A;  2BC5 A;  2Y3B A;  4MVQ A;  3ABK C;  5T1D B;  4BEJ A;  4RDA A;  5L0D A;  2GDC A;  3HNJ A;  1LM3 B;  2Q00 A;  3V5Y A;  4DRI B;  4G7O F;  1ZHX A;  1VYK A;  4YT8 A;  1RCP A;  3NYM A;  2CNW D;  1YAU O;  2WVN A;  1U6H A;  3RQE A;  1JOG A;  3T4R A;  3SEO A;  2A0B A;  4EBB A;  1YVI A;  4JUR I;  4CSA A;  2OOC A;  1GGQ A;  2F22 A;  4LDQ A;  1ORJ A;  4CS9 A;  2LIG A;  5L0J A;  5L0I A;  1YYX A;  4CX9 A;  2V3C C;  2PF4 E;  3KYJ A;  1WN0 A;  1VK5 A;  1YYJ A;  4JEA A;  4U9E A;  2CW0 F;  1T6I A;  2A0U A;  3C8G A;  4OIR F;  5KYU B;  1YLM A;  3LAY A;  1NU9 C;  5COM A;  5FZT A;  3VAY A;  3W4Y A;  2A6H F;  1C17 M;  1M2O A;  4CJG A;  3HNK A;  1OCC C;  3LS0 A;  1HW1 A;  2CYD A;  2GAQ A;  2KK1 A;  3JTL O;  4FWV A;  1DOV A;  1JR8 A;  1WAT A;  3RQG A;  3S90 A;  4C7O B;  3SNH A;  3RFY A;  3B0P A;  2R7R A;  5A6B A;  2G3K A;  2YL7 A;  1OW6 A;  4R32 A;  2EIM C;  1HW2 A;  1G4W R;  2Q9C A;  3LS1 A;  4W8P A;  2JX0 A;  3AG1 C;  1TKN A;  2J7P D;  3BEH A;  2VCA A;  2XM4 A;  2PX0 A;  3US6 A;  2XRH A;  1EA8 A;  2R7U A;  2Z15 A;  2ASR A;  1F1M A;  4HE8 D;  1Q0G A;  1OW8 A;  2PX3 A;  2UUI A;  2IXP A;  4P6I C;  4U5B E;  4MVR A;  4E17 A;  1M2V A;  4N6H A;  5T3T A;  3TJ6 A;  4C3E A;  5F5F A;  4FES A;  3RYL A;  3SXZ A;  1EKY A;  1PD0 A;  2XLE A;  1U89 A;  2J46 A;  2M4E A;  2L6H A;  2E87 A;  1E86 A;  3IQ6 A;  2DYS C;  1T6U A;  4EHP A;  4C7O A;  1WTY A;  5EK0 A;  1G8X A;  5JT4 A;  2EIN C;  2HV6 A;  2J0X A;  4CDV A;  4RBN A;  5B3I A;  4E7S A;  4CIH A;  2J45 A;  3G50 A;  5DQZ A;  2Q9A A;  2UUH A;  4I1O B;  5JRA A;  3ZIB A;  2LFD A;  4WGY A;  2HSQ A;  4EBJ A;  4MVZ A;  1ZVZ A;  2R7Q A;  4G7H F;  3C8G B;  1YA9 A;  2AU5 A;  3QVY A;  4IWB A;  2L9J A;  2L7A A;  4K0D A;  4PK4 A;  1AEP A;  3S0X A;  4N4W A;  1Y4C A;  3K1I C;  3W8I A;  3J06 A;  1E85 A;  1QLE C;  1U0B B;  4JC7 A;  1VLS A;  4PJJ A;  4ANJ A;  1LPE A;  2VCC A;  5TJ5 E;  2NSG A;  3CZ6 A;  3NDB B;  2IXO A;  2NUP B;  1QVX A;  2XM0 A;  2XLH A;  2YL0 A;  4F4B A;  3BRJ A;  4K1O A;  2XL8 A;  4CBE A;  4ULV A;  5T3W A;  3U9J A;  2YKZ A;  1AUE A;  2B0H A;  4LAC B;  2IYL D;  2R9R B;  2HMZ A;  3RF3 A;  2Y3G A;  4XTK A;  1JPJ A;  3VF0 A;  1L7C A;  1SF8 A;  3KYI A;  1VTM P;  2XL4 A;  2QLA A;  2VCB A;  1ZU4 A;  2A6E F;  1M57 C;  4C3B A;  3POV A;  3GEI A;  3FAP B;  2NUP A;  3QTH A;  4C3D A;  2H7B A;  3F47 A;  1BBH A;  2LCH A;  5COG A;  4MQ9 F;  2R7W A;  2ETS A;  2WZG A;  4D4N A;  2J9V A;  4LLE A;  3EQL F;  3L8J A;  5IY5 C;  2HJM A;  2QNL A;  2RSE B;  3KKB A;  3LEO A;  4JTD B;  4DOZ A;  3MLG A;  5DS4 A;  4IRU A;  4DVY P;  2J7P A;  3JCU Q;  3DJN B;  3ASN C;  1ZHY A;  3MX3 A;  1TWA A;  4FX5 A;  1DOW A;  4HFK B;  3R7C A;  3C18 A;  4U5C E;  1OQC A;  1J8M F;  1ST6 A;  3UMI A;  4IGG A;  2D5R B;  3A9C A;  3TOL A;  3H2V A;  2AWC A;  4MW3 A;  5A6J A;  4CSA C;  1YZC A;  4X0R A;  3L0I A;  1D0Z A;  1XZP A;  2R03 A;  3M4C A;  1RMV A;  1O87 A;  2P7V A;  3S27 A;  5JLI A;  2XSE A;  2XXA A;  2KGO A;  1FR0 A;  3DM5 A;  4U5E E;  4AX2 A;  1YDI A;  1YA7 O;  4U9D A;  3LLI A;  2R7T A;  3MFN A;  5L0F A;  3HNL A;  3RW0 A;  4O7G A;  3ITF A;  1AVO B;  3O39 A;  3NMK A;  1M2V B;  4XEV A;  2OG2 A;  2P6V A;  2CNW A;  2CGE A;  5AC4 A;  3WOD F;  1UG7 A;  1ZHW A;  3EFO A;  4EBK A;  3EHM A;  4J32 B;  4BG0 A;  2A1D D;  3FOP A;  3FDQ A;  3U0C A;  3IPM O;  4E7Z A;  2HV7 A;  2G3V A;  4OIP F;  1M56 C;  4DRJ B;  1JMW A;  3GOR A;  2P0N A;  3V7O A;  3B0V C;  3WG7 C;  2YZS A;  5DS5 A;  3DI5 A;  1A7D A;  1TFK B;  3EH2 A;  1KTM A;  1V55 C;  3L34 A;  2KNH A;  4JVS A;  4XPW A;  1G4U S;  2JPU A;  2A68 F;  1V54 C;  2HKV A;  2P61 A;  4JCZ A;  3CEX A;  4BPM A;  5KYX A;  1QPU A;  1E84 A;  3QMK A;  4MVM A;  5CI9 A;  3QW0 A;  4WAB A;  3U3F A;  3EZI A;  4H4K C;  4E18 A;  3PHF 2;  2O9X A;  3EZH A;  4YWQ A;  3JSE O;  2TMV P;  5BQH A;  2YVK A;  3M4B A;  4OIO F;  1H7I A;  1VOM A;  2VAS A;  1RJ9 A;  3X1O A;  3ASO C;  3DE9 A;  3EH1 A;  2J9B A;  2YL3 A;  5GPG B;  1YAR O;  2V26 A;  3DWW A;  3EGX A;  2MHR A;  1ORS C;  2AWY A;  3W8H A;  3FMS A;  2IM8 A;  3JSZ A;  5KYX B;  3O6X A;  3Q7L A;  2LK4 A;  5BUO A;  1JRA A;  2DB4 A;  3NMJ A;  5JP7 A;  4L6R A;  5HSW A;  3DKA A;  1ZYR F;  4FAP B;  1OW7 A;  1HMD A;  3EFO B;  2HJ3 A;  5EHH A;  1TQG A;  2NG1 A;  4ONS A;  3SXK A;  3JYH A;  5KYY A;  2NUT A;  3FAJ A;  2H8A A;  2R05 A;  2YLG A;  1SZI A;  1OXB A;  3OA1 A;  4XPX A;  5JS5 A;  4JCH A;  2EIL C;  2ZPA A;  2Q7R A;  3S29 A;  4YL3 A;  3AG3 C;  4DXW A;  3TUL A;  3AQC A;  3H65 A;  2Y69 C;  3N0T A;  1BR2 A;  1FAP B;  1FMV A;  3RVY A;  5L0G A;  2G62 A;  1OR3 A;  1Z3I X;  3U3B A;  4BJT A;  1CGN A;  4YN0 B;  1LS4 A;  3EPV A;  4PAC A;  1Z5Z A;  3Q7G A;  2GWW A;  1I4Z A;  3KL4 A;  3Q6N A;  1OKK D;  3LUT B;  2YLI A;  5B1A C;  1TWC A;  3T6B A;  2OU6 A;  3MYI A;  1N1C A;  4EWC A;  3C8G D;  1FFT C;  2VH3 A;  3NKD A;  3I5Q A;  1FFH A;  3K1H A;  3JYY A;  4O79 A;  3WHN A;  1CPQ A;  3ZQY A;  2ZD9 A;  4LDK A;  2Q3T A;  3ZTM A;  4DRH B;  3QW1 A;  2KSF A;  3ZVR A;  4MVU A;  5JVE A;  2IBF A;  3UGP A;  3GM1 A;  3G4Z A;  3DE8 A;  1NFO A;  3B9Q A;  4PJM A;  1ORY A;  5L0C A;  3IHU A;  5F28 E;  1YJG A;  4XEF A;  4Q5S F;  3SXY A;  2ICW G;  4RD9 A;  3LLK A;  2EPM X;  1H6G A;  3KH2 A;  3NRH A;  3RIP A;  3LEV A;  2M64 A;  3GOD A;  1A7V A;  3UR3 C;  3QZC A;  5JSL A;  3V5X A;  4AE4 B;  1I5N A;  3AGU A;  2EIK C;  4E0I A;  5FCL A;  1CGM E;  1LS1 A;  1ZW3 A;  1IW7 F;  4G0H A;  4M63 A;  1T01 A;  3H2U A;  2MWQ A;  2XS8 A;  3RKO F;  2WVQ A;  2PBE A;  1MMG A;  1A41 A;  4QI0 A;  1Y6D A; 
#chains in the Genus database with same CATH homology
 1EA8 A;  1LS4 A;  1OR2 A;  2KC3 A;  3R2P A;  1LE2 A;  1BZ4 A;  1LPE A;  1LE4 A;  1EQ1 A;  1NFO A;  3S84 A;  1GS9 A;  1AEP A;  1B68 A;  1OR3 A;  1NFN A;  1H7I A;  1YA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...