1LE4A

Structural basis for altered function in the common mutants of human apolipoprotein-e
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
139
structure length
139
Chain Sequence
QRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E4
publication title Human apolipoprotein E. Role of arginine 61 in mediating the lipoprotein preferences of the E3 and E4 isoforms.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipoprotein
total genus 61
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1991-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1le4A00
1OR3A 1NFNA 3S84A 1EQ1A 1H7IA 1EA8A 1NFOA 1YA9A 1LS4A 1LPEA 1GS9A 1LE2A 3R2PA 1B68A 1OR2A 1AEPA 1BZ4A 1LE4A 2KC3A
chains in the Genus database with same CATH superfamily
4P9TA 4HFFB 1NFNA 2WZLA 3G50A 3NYLA 1OKKD 1ORSC 3EPVA 2CNWD 2L81A 2NUTB 5E33A 3NG1A 1XZQA 5KYNA 3TULA 1DOWA 1H9TA 3FXHA 1CGNA 4MVOA 1WN0A 1TKNA 2XM0A 4EBBA 5A6BD 3ZC4A 4MQ9F 4HEAJ 3ASNC 3FOPA 2MWQA 4JZAA 4P6IC 1LIHA 3H2UA 4QI0A 5AGFA 1YARO 1MQVA 4QI2A 1U6HA 3MYIA 1WASA 2YL3A 3U9JA 3QTHA 4I44A 4ANJA 2XXAA 4F4BA 1VYKA 256BA 4LERA 1E2XA 2HV7A 1ORYA 4AE4B 4BEMJ 2I15A 1UG7A 2QLAA 3TK0A 3B0PA 1IW7F 4KNWA 4CSAA 2VB6A 3M4BA 4W8KA 3AG1C 1OQCA 1V74B 3E70C 2R05A 1FMWA 2ASRA 4MNDA 4CS8C 2VCAA 2YLIA 3W8HA 3S0XA 2HJMA 2WB7A 5E3CA 4ULWA 5A69A 1RJ9B 4IWBA 4NQFA 4ONSA 4RD9A 2NUTA 3KYJA 1Z3IX 2IBFA 1FR0A 5BUOA 2XSEA 3NMJA 4H54A 1FMVA 3SP1A 1MMDA 2HV6A 3DJNB 4OIQF 5L0DA 5B3IA 4Q4ZF 3FHDA 3OWTA 5JSLA 4XPXA 4OIRF 2M4EA 4JTAB 4N4WA 2LK4A 2ZXOA 2WVNA 3RQEA 2J9VA 3SZRA 2HZ8A 4AE4A 3QMKA 5B1AC 5JRAA 3E9VA 1LE4A 1TQGA 5KYUB 4YL3A 4KI2A 1FFTC 3GWLA 4K7BA 1NSGB 2G62A 2Y3HA 1O3UA 3C8GD 4E0HA 3RH3A 1H7IA 4CJGA 1E84A 1G4WR 1SMYF 4J30B 2DGJA 4G7HF 1Z63A 1EI7A 1RJ9A 2BE5F 3L1MA 2YHSA 3EH2A 2YLDA 3RVYA 4XLPF 3DI5A 4L6RA 4MW3A 3QW1A 3NDBB 5JS5A 2QUPA 1EKYA 3M4CA 3RKOF 3EFOA 4OIPF 1D1AA 1CGME 2OQMA 5KYWB 2CGEA 2YL0A 3I5PA 4LLEA 3O6XA 1APCA 3QW0A 3VYWA 2JPUA 2XL8A 5K0IA 2HMQA 1G4US 2NUPB 1MMAA 3MYFA 3K66A 1ZW2A 3UGOA 2IXPA 4Z9HA 2HMZA 2KC3A 5E3AA 3DWWA 2PP4A 1WWPA 2ZPAA 3IQ6A 2YRFA 4FESA 1V55C 2HJ3A 2J0XA 2VH3A 2ZD9A 3CZ6A 3F47A 1ZHWA 1G8XA 4I1MA 4MVQA 1QVXA 5AC4A 2C04A 2GAQA 3S29A 4O6NA 5DVWA 4A4AA 1NFOA 1JR8A 4CDYA 4YWQA 1YDIA 2KYHA 2R7QA 2DYSC 3U3BA 5DQTA 1E83A 2PBEA 1LE2A 3LS0A 3MLGA 1MNDA 4MVMA 2OOCA 1V4AA 1B68A 1ZYRF 3GANA 5T3TA 3R7CA 3U5SA 1TWAA 3SEOA 2KJGA 1QPUA 5COFA 2G3VA 2NSFA 4O79A 3B29A 5L0FA 2PX3A 4LLCA 5KYYA 3HTKC 5KYXB 2LCHA 2NUPA 2A6HF 3TD7A 2XLOA 1ZU4A 3V7OA 5D92A 2OKUA 1PV3A 4PR9A 2XRHA 3ABKC 1SF8A 4Z9IA 1YYJA 4OD4A 4JKVA 1JAFA 4OIOF 2JD3A 4J7YA 2W9YA 4E18A 3EGDB 5JP7A 3K1IA 2EIKC 5L3VA 3GEEA 3TJ6A 4PK4A 3EJNA 1Q0FA 3GM2A 1YA9A 2R25A 3AGUA 3H65A 2QNLA 3HJCA 1RKEB 4BEJA 3DM5A 5FCLA 4LDKA 4WGYA 3FAPB 5B3SC 4JTDB 1M56C 4DVYP 5DS5A 3HKKA 2Q4FA 2XLWA 1JPNA 1ORJA 2GWWA 4X0RA 1KU2A 2J8WA 3NRHA 1MMNA 2Y3DA 3VRCA 5BQHA 5EGYA 3X2QC 3ATPA 3NMIA 2EPOA 3U9MA 3LUTB 1VTMP 3AOUA 3DZAA 5KYXA 2FAPB 3U8VA 1OCCC 1QSPA 2EPKX 2XS1A 3H2VA 3I5QA 4IAOA 4MVRA 4Q7CA 3T4RA 2OEVA 4AK9A 4CS7A 5CIVA 2J7PA 4YT2A 4E0IA 5DLJA 2EPLX 4JC7A 4U5GA 1J8YF 2XM4A 3V5XA 2XLMA 3KPHA 3EGDA 4ZLDA 1VLTA 3EHNA 1TFKB 4MTGA 3NKEA 3NYJA 3EGXB 3M1CB 1RKEA 3CQZA 3O55A 3QZCA 1H9GA 5DS4A 1T9KA 2LP4A 1K04A 2R7OA 3LS1A 3S28A 3IQCA 3FOOA 1K40A 4MS2A 4C3EA 3CEXA 1OR2A 3SNHA 3DKAA 3K7DA 4O6MA 3U3FA 2L6FA 4XPYA 2H8AA 3JRTA 2IXOA 2HUJA 4XEFA 4YJWA 4ER9A 1T6QA 4I1OB 3EQLF 3UNGC 3LAYA 4HFKB 4AX2A 3W8IA 3K1HA 2CYDA 2YEVA 1TWGA 3OA1A 3FMSA 3X1OA 2WVQA 3NKDA 3PHF2 2IM8A 2L7AA 2Y69C 3GEIA 3HLZA 3NMKA 2VCCA 3C8ZA 1YZAA 1YYXA 3AQCA 4JCHA 4P9FA 3V5YA 2ZXRA 1OKKA 3O10A 1HMDA 4AL1A 2CNWA 4JEBA 1OCRC 1Q0MA 4WABA 4XPWA 5A6BA 1ZHXA 3GODA 1AEPA 1BR4A 4LDQA 3L8JA 3RFYA 2P0NA 2R9RB 4CBEA 5F28E 1YA7O 4K1OA 2YWAA 5EK0A 4EHPA 2VCBA 3KMIA 5L0CA 1Q0DA 2AWCA 3JRMO 4JE9A 4LACB 2HSBA 4IARA 2YLGA 1I5NA 4U5BE 1OW7A 1JPJA 2W45A 4O6YA 4ULVA 4G7OF 4DJ9A 1M2VB 1MNEA 2KQ9A 5DQZA 1BR2A 3C8GB 5IY5C 4BJ1A 2WZFA 2YL1A 2R7UA 3R2PA 4E17A 4CDAA 3B9QA 3DAGA 1M2OA 1YVIA 2CDQA 4PJMA 4D4XA 4PJJA 3ZDLA 2KSFA 1OW8A 2OCCC 1UFBA 4IAQA 4B6IA 2R02A 1BBHA 4YL0A 1A7EA 4KC9A 4YK5A 3RW0A 3WAQA 3JSZA 3DM9B 4QDLA 1T01A 2LQGA 3A9CA 4JW1A 4YT8A 3FAJA 3ZVRA 3UR3C 2Y3BA 2V26A 4NTBA 3WG7C 3G4XA 3B0VC 4KBLA 1NU9C 2P7VA 4BJ6C 1I4ZA 3G4ZA 2CCYA 3CAXA 3QVZA 1D0XA 1RCPA 2PX0A 1YZCA 2QY9A 2R03A 1LVKA 4G0HA 4N6CA 1AVOB 1FAPB 4CS9C 2L6GA 2EIJC 5L0IA 2EINC 3LEOA 4XWJA 3W2WA 3SXMA 4I3MA 4EBKA 1A7DA 1D1CA 3LNRA 4GEHA 3ZG1A 2QTVA 1JMWA 3GEHA 1LPEA 1OXKA 3JYYA 4NC3A 2E87A 1CPRA 1GS9A 3DE9A 4PACA 3C8GA 1XZPA 3IPMO 1U0BB 4FAPB 4Q5SF 4JJFA 1RXQA 3DJUB 5EHHA 5KYWA 1ZU5A 4U5CE 3LJBA 4DBQA 1OW6A 3GWNA 4N6HA 3ABMC 4MVUA 5T1DB 1VK5A 3WHNA 2XS8A 4PJLA 4CS8A 1D0ZA 2LIGA 2Y39A 2KGOA 3DD7A 1L3PA 3V5ZA 1RKCA 3ECSA 3KL4A 2J9UA 1E86A 3DAFA 2PF4E 1M57C 3JT1A 3AG3C 4U5DE 1ZHYA 1KNYA 4DXWA 1FTSA 3EG9B 1TR2A 1Z23A 3JCUQ 2Z15A 3VF0A 3S27A 3T6GB 4MVZA 3I4UA 4JVSA 3NYMA 2HFIA 2ICWG 1GGQA 1ZZPA 2JX0A 5KYUA 3SXYA 3ASOC 2IYLD 4U5FE 3DXJF 3EZHA 3LLKA 3DMDA 1VMAA 4FX5A 1LI5A 4O7GA 4U9DA 2HS5A 1HW2A 1O5HA 1ZHZA 1K05A 4C7OB 1Z5ZA 5HSWA 3C18A 1I4YA 3L8IA 2KNHA 3JYHA 4JEAA 1T6UA 3MFNA 3RQFA 4U5HA 1BZ4A 3AG2C 2D5RB 3RIPA 2OEXA 4YT4A 2DYRC 2NG1A 2OG2A 2Q9AA 2V3CC 4DRIB 5A6KA 5D91A 4EUKB 2EILC 1IZMA 4BPMA 3TJ5A 3EG9A 2X0CA 4LDRA 1EA8A 2C03A 3LESA 2GA0A 3IQ5A 2J46A 1FFHA 1QLEC 4EWCA 3KKBA 3ZQVA 2DI3A 2Q7RA 2P1AA 1VB5A 2EPMX 1L7CA 2OJQA 2Q9BA 4XTKA 3Q6MA 1A7VA 2Q00A 2WL8A 4JCZA 4FWVA 3TOLA 2A69F 3UMKA 1NBBA 4M63A 3BRJA 4CDVA 5JVEA 4C7OA 5COMA 3WODF 1SZIA 2PFDA 4DBRA 2A0UA 1FNTc 3HNLA 1D1BA 2A6EF 4WGZA 4N06A 2P61A 4BG0A 2D4UA 3IHUA 1W2WA 2ETSA 2GFHA 2I8BA 1PCXA 2BL2A 4AL0A 1HY5A 3KYIA 2OU6A 4J32B 3U2MA 2XL4A 5L3QA 4WJ0A 1CPQA 4CIHA 3A11A 3LEVA 2DB4A 4U9EA 5E2QA 1WTYA 3M15A 1BR1A 3JSEO 1M6TA 2YZSA 2YQYA 4XEKA 2KK1A 1D0YA 1DOVA 2TMVP 3N2ZB 1SYQA 1TFOB 1H6GA 1ZW3A 2F22A 1E85A 3TOMA 3EGXA 1QKRA 2LSEA 2VC9A 2XL6A 1PD0A 3CSKA 4GQHA 4DVZA 2NPUA 1JOGA 1ZHTA 3RQGA 4H4KC 2KW3C 3M79A 2J45A 3POVA 4YT5A 5CI9A 4OD5A 3SXZA 2AU5A 1OCOC 4DRJB 4DOZA 1T5OA 3MBGA 4E7ZA 2LFFA 1QZXA 2UUIA 4BJ5C 4BJTA 4G7ZF 3GM3A 4KNVA 2ZXPA 4YN0B 1Z6AA 3S84A 2FFHA 2QE9A 1EQ1A 1HE9A 2R7TA 1NZEA 2PNOA 2EIMC 5B1BC 2RD9A 3EFOB 1LS4A 2YL7A 4EBJA 3K1IC 3AQBA 1NG1A 2R7XA 1O87A 2A1DD 2HKVA 4JTCB 1G5ZA 2G3KA 2NSGA 1YAUO 2Q9CA 2XLHA 3EHMA 3HNIA 3Q7LA 1VOMA 1Q0KA 2ZXWC 1YLMA 5JLIA 5F5FA 3IEEA 4IGGA 3EH1A 4YL1A 1R4TA 3ZTZA 1C03A 3HNKA 2IOQA 3RF3A 4XEVA 1NLXA 3US6A 1S7ZA 1HMOA 3N24A 4MTOA 1J8MF 4UDVA 2LD6A 4NY3A 4D4NA 2AVKA 4NCQA 1YJGA 3ABLC 1SR2A 1GM5A 5F5HA 1U89A 2B0JA 1Y6DA 1RMVA 2FGYA 1A41A 1S05A 2LFDA 3AG4C 1Y4CA 5A6JA 1JRAA 2CW0F 4J7TA 5A6AA 2O9XA 1M2VA 2WVOA 4NTFA 2B0HA 3ZTMA 2L9JA 2OJED 3SYNA 3ZWIA 4RDAA 2EPNA 4XQ1A 5L0GA 4CIPA 4IJJA 1MMGA 4IB4A 5KYYB 4C3BA 5HV9A 1CGOA 3B71A 4MVSA 4NTAA 3UMIA 1LKXA 2Q3TA 3MX3A 2W4BA 2R7VA 3ZQYA 3T6JA 2H7OA 2YVKA 2MYSA 3IQTA 3U0CA 1ZVZA 3LNMB 1Q0GA 3SXKA 3C63A 3T9OA 4JIOA 5COGA 3GM1A 3TQOA 2A0BA 1OR3A 4A2NB 4CX9A 1PD1A 4K0DA 4EIYA 4Z9JA 2R7WA 4MTFA 1TWCA 1KTMA 3HNJA 3O39A 1C02A 3DE8A 2W4MA 2IXNA 1A0BA 2X51A 4CSAC 3Q6NA 4JJGA 3AJMA 1T6IA 2YKZA 5DS6A 2GDCA 4XLNF 1V54C 3ITFA 1HE1A 3OEOA 4PJNA 3C62A 5GPGB 3L34A 5CI8A 2UUHA 5BQIA 3PDMP 1AUEA 3KH2A 3C7JA 4C3DA 3PMRA 2R7SA 1BDJB 3K6BA 2J7PD 3T6BA 3U2LA 4BJ5A 2R7RA 3FDQA 3VAYA 1C17M 1F1MA 1QQ3A 3U8PA 3UMHA 3W4YA 4U5EE 3N0TA 2J9BA 4RBNA 1OXBA 2M64A 3LLIA 3JZ0A 4JRZA 5BQGA 2WZGA 4CJOA 5JUAA 1VYIA 2RSEB 1Z7Qc 4HE8D 3RYLA 4IRUA 1HW1A 3ZSUA 4OINF 4G78A 1LI7A 1XWJA 1VLSA 1GQAA 1TWHA 1N1CA 2P6VA 1OCZC 3JTLO 4ZLCA 1WGWA 3EZIA 2A68F 3S9OA 2AWYA 3AGTA 4E7SA 2XLEA 3UGPA 1WOLA 2VASA 2J0WA 5FZTA 5TJ5E 5JT4A 3L0IA 3B0UX 3W2VA 3VM6A 3ZIBA 2Y3GA 1NU7D 1ST6A 1R5ID 4DRHB 3GORA 1LS1A 3BEHA 3PCVA 5AC5A 4PFPA 2J9WA 2HSQA 3FVYA 4GYTA 4EKWA 2XXAB 3K33A 2H7VC 4MW8A 2L6HA 2MHRA 3QVYA 2IXMA 1LM3B 2AP3A 2XLVA 2BC5A 3F46A 4R32A 5T3WA 5L0JA 3S90A 4BJ6A 2XLDA 1WATA 3J06A 2H7BA 4JURI 3RVZA 4PFOA 4CS9A 3Q7GA 4W8PA 5L0HA
chains in the Genus database with same CATH topology
1OR3A 1NFNA 3S84A 1EQ1A 1H7IA 1EA8A 1NFOA 1YA9A 1LS4A 1LPEA 1GS9A 1LE2A 3R2PA 1B68A 1OR2A 1AEPA 1BZ4A 1LE4A 2KC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR3 A;  1NFN A;  3S84 A;  1EQ1 A;  1H7I A;  1EA8 A;  1NFO A;  1YA9 A;  1LS4 A;  1LPE A;  1GS9 A;  1LE2 A;  3R2P A;  1B68 A;  1OR2 A;  1AEP A;  1BZ4 A;  1LE4 A;  2KC3 A; 
#chains in the Genus database with same CATH topology
 4P9T A;  4HFF B;  1NFN A;  2WZL A;  3G50 A;  3NYL A;  1OKK D;  1ORS C;  3EPV A;  2CNW D;  2L81 A;  2NUT B;  5E33 A;  3NG1 A;  1XZQ A;  5KYN A;  3TUL A;  1DOW A;  1H9T A;  3FXH A;  1CGN A;  4MVO A;  1WN0 A;  1TKN A;  2XM0 A;  4EBB A;  5A6B D;  3ZC4 A;  4MQ9 F;  4HEA J;  3ASN C;  3FOP A;  2MWQ A;  4JZA A;  4P6I C;  1LIH A;  3H2U A;  4QI0 A;  5AGF A;  1YAR O;  1MQV A;  4QI2 A;  1U6H A;  3MYI A;  1WAS A;  2YL3 A;  3U9J A;  3QTH A;  4I44 A;  4ANJ A;  2XXA A;  4F4B A;  1VYK A;  256B A;  4LER A;  1E2X A;  2HV7 A;  1ORY A;  4AE4 B;  4BEM J;  2I15 A;  1UG7 A;  2QLA A;  3TK0 A;  3B0P A;  1IW7 F;  4KNW A;  4CSA A;  2VB6 A;  3M4B A;  4W8K A;  3AG1 C;  1OQC A;  1V74 B;  3E70 C;  2R05 A;  1FMW A;  2ASR A;  4MND A;  4CS8 C;  2VCA A;  2YLI A;  3W8H A;  3S0X A;  2HJM A;  2WB7 A;  5E3C A;  4ULW A;  5A69 A;  1RJ9 B;  4IWB A;  4NQF A;  4ONS A;  4RD9 A;  2NUT A;  3KYJ A;  1Z3I X;  2IBF A;  1FR0 A;  5BUO A;  2XSE A;  3NMJ A;  4H54 A;  1FMV A;  3SP1 A;  1MMD A;  2HV6 A;  3DJN B;  4OIQ F;  5L0D A;  5B3I A;  4Q4Z F;  3FHD A;  3OWT A;  5JSL A;  4XPX A;  4OIR F;  2M4E A;  4JTA B;  4N4W A;  2LK4 A;  2ZXO A;  2WVN A;  3RQE A;  2J9V A;  3SZR A;  2HZ8 A;  4AE4 A;  3QMK A;  5B1A C;  5JRA A;  3E9V A;  1LE4 A;  1TQG A;  5KYU B;  4YL3 A;  4KI2 A;  1FFT C;  3GWL A;  4K7B A;  1NSG B;  2G62 A;  2Y3H A;  1O3U A;  3C8G D;  4E0H A;  3RH3 A;  1H7I A;  4CJG A;  1E84 A;  1G4W R;  1SMY F;  4J30 B;  2DGJ A;  4G7H F;  1Z63 A;  1EI7 A;  1RJ9 A;  2BE5 F;  3L1M A;  2YHS A;  3EH2 A;  2YLD A;  3RVY A;  4XLP F;  3DI5 A;  4L6R A;  4MW3 A;  3QW1 A;  3NDB B;  5JS5 A;  2QUP A;  1EKY A;  3M4C A;  3RKO F;  3EFO A;  4OIP F;  1D1A A;  1CGM E;  2OQM A;  5KYW B;  2CGE A;  2YL0 A;  3I5P A;  4LLE A;  3O6X A;  1APC A;  3QW0 A;  3VYW A;  2JPU A;  2XL8 A;  5K0I A;  2HMQ A;  1G4U S;  2NUP B;  1MMA A;  3MYF A;  3K66 A;  1ZW2 A;  3UGO A;  2IXP A;  4Z9H A;  2HMZ A;  2KC3 A;  5E3A A;  3DWW A;  2PP4 A;  1WWP A;  2ZPA A;  3IQ6 A;  2YRF A;  4FES A;  1V55 C;  2HJ3 A;  2J0X A;  2VH3 A;  2ZD9 A;  3CZ6 A;  3F47 A;  1ZHW A;  1G8X A;  4I1M A;  4MVQ A;  1QVX A;  5AC4 A;  2C04 A;  2GAQ A;  3S29 A;  4O6N A;  5DVW A;  4A4A A;  1NFO A;  1JR8 A;  4CDY A;  4YWQ A;  1YDI A;  2KYH A;  2R7Q A;  2DYS C;  3U3B A;  5DQT A;  1E83 A;  2PBE A;  1LE2 A;  3LS0 A;  3MLG A;  1MND A;  4MVM A;  2OOC A;  1V4A A;  1B68 A;  1ZYR F;  3GAN A;  5T3T A;  3R7C A;  3U5S A;  1TWA A;  3SEO A;  2KJG A;  1QPU A;  5COF A;  2G3V A;  2NSF A;  4O79 A;  3B29 A;  5L0F A;  2PX3 A;  4LLC A;  5KYY A;  3HTK C;  5KYX B;  2LCH A;  2NUP A;  2A6H F;  3TD7 A;  2XLO A;  1ZU4 A;  3V7O A;  5D92 A;  2OKU A;  1PV3 A;  4PR9 A;  2XRH A;  3ABK C;  1SF8 A;  4Z9I A;  1YYJ A;  4OD4 A;  4JKV A;  1JAF A;  4OIO F;  2JD3 A;  4J7Y A;  2W9Y A;  4E18 A;  3EGD B;  5JP7 A;  3K1I A;  2EIK C;  5L3V A;  3GEE A;  3TJ6 A;  4PK4 A;  3EJN A;  1Q0F A;  3GM2 A;  1YA9 A;  2R25 A;  3AGU A;  3H65 A;  2QNL A;  3HJC A;  1RKE B;  4BEJ A;  3DM5 A;  5FCL A;  4LDK A;  4WGY A;  3FAP B;  5B3S C;  4JTD B;  1M56 C;  4DVY P;  5DS5 A;  3HKK A;  2Q4F A;  2XLW A;  1JPN A;  1ORJ A;  2GWW A;  4X0R A;  1KU2 A;  2J8W A;  3NRH A;  1MMN A;  2Y3D A;  3VRC A;  5BQH A;  5EGY A;  3X2Q C;  3ATP A;  3NMI A;  2EPO A;  3U9M A;  3LUT B;  1VTM P;  3AOU A;  3DZA A;  5KYX A;  2FAP B;  3U8V A;  1OCC C;  1QSP A;  2EPK X;  2XS1 A;  3H2V A;  3I5Q A;  4IAO A;  4MVR A;  4Q7C A;  3T4R A;  2OEV A;  4AK9 A;  4CS7 A;  5CIV A;  2J7P A;  4YT2 A;  4E0I A;  5DLJ A;  2EPL X;  4JC7 A;  4U5G A;  1J8Y F;  2XM4 A;  3V5X A;  2XLM A;  3KPH A;  3EGD A;  4ZLD A;  1VLT A;  3EHN A;  1TFK B;  4MTG A;  3NKE A;  3NYJ A;  3EGX B;  3M1C B;  1RKE A;  3CQZ A;  3O55 A;  3QZC A;  1H9G A;  5DS4 A;  1T9K A;  2LP4 A;  1K04 A;  2R7O A;  3LS1 A;  3S28 A;  3IQC A;  3FOO A;  1K40 A;  4MS2 A;  4C3E A;  3CEX A;  1OR2 A;  3SNH A;  3DKA A;  3K7D A;  4O6M A;  3U3F A;  2L6F A;  4XPY A;  2H8A A;  3JRT A;  2IXO A;  2HUJ A;  4XEF A;  4YJW A;  4ER9 A;  1T6Q A;  4I1O B;  3EQL F;  3UNG C;  3LAY A;  4HFK B;  4AX2 A;  3W8I A;  3K1H A;  2CYD A;  2YEV A;  1TWG A;  3OA1 A;  3FMS A;  3X1O A;  2WVQ A;  3NKD A;  3PHF 2;  2IM8 A;  2L7A A;  2Y69 C;  3GEI A;  3HLZ A;  3NMK A;  2VCC A;  3C8Z A;  1YZA A;  1YYX A;  3AQC A;  4JCH A;  4P9F A;  3V5Y A;  2ZXR A;  1OKK A;  3O10 A;  1HMD A;  4AL1 A;  2CNW A;  4JEB A;  1OCR C;  1Q0M A;  4WAB A;  4XPW A;  5A6B A;  1ZHX A;  3GOD A;  1AEP A;  1BR4 A;  4LDQ A;  3L8J A;  3RFY A;  2P0N A;  2R9R B;  4CBE A;  5F28 E;  1YA7 O;  4K1O A;  2YWA A;  5EK0 A;  4EHP A;  2VCB A;  3KMI A;  5L0C A;  1Q0D A;  2AWC A;  3JRM O;  4JE9 A;  4LAC B;  2HSB A;  4IAR A;  2YLG A;  1I5N A;  4U5B E;  1OW7 A;  1JPJ A;  2W45 A;  4O6Y A;  4ULV A;  4G7O F;  4DJ9 A;  1M2V B;  1MNE A;  2KQ9 A;  5DQZ A;  1BR2 A;  3C8G B;  5IY5 C;  4BJ1 A;  2WZF A;  2YL1 A;  2R7U A;  3R2P A;  4E17 A;  4CDA A;  3B9Q A;  3DAG A;  1M2O A;  1YVI A;  2CDQ A;  4PJM A;  4D4X A;  4PJJ A;  3ZDL A;  2KSF A;  1OW8 A;  2OCC C;  1UFB A;  4IAQ A;  4B6I A;  2R02 A;  1BBH A;  4YL0 A;  1A7E A;  4KC9 A;  4YK5 A;  3RW0 A;  3WAQ A;  3JSZ A;  3DM9 B;  4QDL A;  1T01 A;  2LQG A;  3A9C A;  4JW1 A;  4YT8 A;  3FAJ A;  3ZVR A;  3UR3 C;  2Y3B A;  2V26 A;  4NTB A;  3WG7 C;  3G4X A;  3B0V C;  4KBL A;  1NU9 C;  2P7V A;  4BJ6 C;  1I4Z A;  3G4Z A;  2CCY A;  3CAX A;  3QVZ A;  1D0X A;  1RCP A;  2PX0 A;  1YZC A;  2QY9 A;  2R03 A;  1LVK A;  4G0H A;  4N6C A;  1AVO B;  1FAP B;  4CS9 C;  2L6G A;  2EIJ C;  5L0I A;  2EIN C;  3LEO A;  4XWJ A;  3W2W A;  3SXM A;  4I3M A;  4EBK A;  1A7D A;  1D1C A;  3LNR A;  4GEH A;  3ZG1 A;  2QTV A;  1JMW A;  3GEH A;  1LPE A;  1OXK A;  3JYY A;  4NC3 A;  2E87 A;  1CPR A;  1GS9 A;  3DE9 A;  4PAC A;  3C8G A;  1XZP A;  3IPM O;  1U0B B;  4FAP B;  4Q5S F;  4JJF A;  1RXQ A;  3DJU B;  5EHH A;  5KYW A;  1ZU5 A;  4U5C E;  3LJB A;  4DBQ A;  1OW6 A;  3GWN A;  4N6H A;  3ABM C;  4MVU A;  5T1D B;  1VK5 A;  3WHN A;  2XS8 A;  4PJL A;  4CS8 A;  1D0Z A;  2LIG A;  2Y39 A;  2KGO A;  3DD7 A;  1L3P A;  3V5Z A;  1RKC A;  3ECS A;  3KL4 A;  2J9U A;  1E86 A;  3DAF A;  2PF4 E;  1M57 C;  3JT1 A;  3AG3 C;  4U5D E;  1ZHY A;  1KNY A;  4DXW A;  1FTS A;  3EG9 B;  1TR2 A;  1Z23 A;  3JCU Q;  2Z15 A;  3VF0 A;  3S27 A;  3T6G B;  4MVZ A;  3I4U A;  4JVS A;  3NYM A;  2HFI A;  2ICW G;  1GGQ A;  1ZZP A;  2JX0 A;  5KYU A;  3SXY A;  3ASO C;  2IYL D;  4U5F E;  3DXJ F;  3EZH A;  3LLK A;  3DMD A;  1VMA A;  4FX5 A;  1LI5 A;  4O7G A;  4U9D A;  2HS5 A;  1HW2 A;  1O5H A;  1ZHZ A;  1K05 A;  4C7O B;  1Z5Z A;  5HSW A;  3C18 A;  1I4Y A;  3L8I A;  2KNH A;  3JYH A;  4JEA A;  1T6U A;  3MFN A;  3RQF A;  4U5H A;  1BZ4 A;  3AG2 C;  2D5R B;  3RIP A;  2OEX A;  4YT4 A;  2DYR C;  2NG1 A;  2OG2 A;  2Q9A A;  2V3C C;  4DRI B;  5A6K A;  5D91 A;  4EUK B;  2EIL C;  1IZM A;  4BPM A;  3TJ5 A;  3EG9 A;  2X0C A;  4LDR A;  1EA8 A;  2C03 A;  3LES A;  2GA0 A;  3IQ5 A;  2J46 A;  1FFH A;  1QLE C;  4EWC A;  3KKB A;  3ZQV A;  2DI3 A;  2Q7R A;  2P1A A;  1VB5 A;  2EPM X;  1L7C A;  2OJQ A;  2Q9B A;  4XTK A;  3Q6M A;  1A7V A;  2Q00 A;  2WL8 A;  4JCZ A;  4FWV A;  3TOL A;  2A69 F;  3UMK A;  1NBB A;  4M63 A;  3BRJ A;  4CDV A;  5JVE A;  4C7O A;  5COM A;  3WOD F;  1SZI A;  2PFD A;  4DBR A;  2A0U A;  1FNT c;  3HNL A;  1D1B A;  2A6E F;  4WGZ A;  4N06 A;  2P61 A;  4BG0 A;  2D4U A;  3IHU A;  1W2W A;  2ETS A;  2GFH A;  2I8B A;  1PCX A;  2BL2 A;  4AL0 A;  1HY5 A;  3KYI A;  2OU6 A;  4J32 B;  3U2M A;  2XL4 A;  5L3Q A;  4WJ0 A;  1CPQ A;  4CIH A;  3A11 A;  3LEV A;  2DB4 A;  4U9E A;  5E2Q A;  1WTY A;  3M15 A;  1BR1 A;  3JSE O;  1M6T A;  2YZS A;  2YQY A;  4XEK A;  2KK1 A;  1D0Y A;  1DOV A;  2TMV P;  3N2Z B;  1SYQ A;  1TFO B;  1H6G A;  1ZW3 A;  2F22 A;  1E85 A;  3TOM A;  3EGX A;  1QKR A;  2LSE A;  2VC9 A;  2XL6 A;  1PD0 A;  3CSK A;  4GQH A;  4DVZ A;  2NPU A;  1JOG A;  1ZHT A;  3RQG A;  4H4K C;  2KW3 C;  3M79 A;  2J45 A;  3POV A;  4YT5 A;  5CI9 A;  4OD5 A;  3SXZ A;  2AU5 A;  1OCO C;  4DRJ B;  4DOZ A;  1T5O A;  3MBG A;  4E7Z A;  2LFF A;  1QZX A;  2UUI A;  4BJ5 C;  4BJT A;  4G7Z F;  3GM3 A;  4KNV A;  2ZXP A;  4YN0 B;  1Z6A A;  3S84 A;  2FFH A;  2QE9 A;  1EQ1 A;  1HE9 A;  2R7T A;  1NZE A;  2PNO A;  2EIM C;  5B1B C;  2RD9 A;  3EFO B;  1LS4 A;  2YL7 A;  4EBJ A;  3K1I C;  3AQB A;  1NG1 A;  2R7X A;  1O87 A;  2A1D D;  2HKV A;  4JTC B;  1G5Z A;  2G3K A;  2NSG A;  1YAU O;  2Q9C A;  2XLH A;  3EHM A;  3HNI A;  3Q7L A;  1VOM A;  1Q0K A;  2ZXW C;  1YLM A;  5JLI A;  5F5F A;  3IEE A;  4IGG A;  3EH1 A;  4YL1 A;  1R4T A;  3ZTZ A;  1C03 A;  3HNK A;  2IOQ A;  3RF3 A;  4XEV A;  1NLX A;  3US6 A;  1S7Z A;  1HMO A;  3N24 A;  4MTO A;  1J8M F;  4UDV A;  2LD6 A;  4NY3 A;  4D4N A;  2AVK A;  4NCQ A;  1YJG A;  3ABL C;  1SR2 A;  1GM5 A;  5F5H A;  1U89 A;  2B0J A;  1Y6D A;  1RMV A;  2FGY A;  1A41 A;  1S05 A;  2LFD A;  3AG4 C;  1Y4C A;  5A6J A;  1JRA A;  2CW0 F;  4J7T A;  5A6A A;  2O9X A;  1M2V A;  2WVO A;  4NTF A;  2B0H A;  3ZTM A;  2L9J A;  2OJE D;  3SYN A;  3ZWI A;  4RDA A;  2EPN A;  4XQ1 A;  5L0G A;  4CIP A;  4IJJ A;  1MMG A;  4IB4 A;  5KYY B;  4C3B A;  5HV9 A;  1CGO A;  3B71 A;  4MVS A;  4NTA A;  3UMI A;  1LKX A;  2Q3T A;  3MX3 A;  2W4B A;  2R7V A;  3ZQY A;  3T6J A;  2H7O A;  2YVK A;  2MYS A;  3IQT A;  3U0C A;  1ZVZ A;  3LNM B;  1Q0G A;  3SXK A;  3C63 A;  3T9O A;  4JIO A;  5COG A;  3GM1 A;  3TQO A;  2A0B A;  1OR3 A;  4A2N B;  4CX9 A;  1PD1 A;  4K0D A;  4EIY A;  4Z9J A;  2R7W A;  4MTF A;  1TWC A;  1KTM A;  3HNJ A;  3O39 A;  1C02 A;  3DE8 A;  2W4M A;  2IXN A;  1A0B A;  2X51 A;  4CSA C;  3Q6N A;  4JJG A;  3AJM A;  1T6I A;  2YKZ A;  5DS6 A;  2GDC A;  4XLN F;  1V54 C;  3ITF A;  1HE1 A;  3OEO A;  4PJN A;  3C62 A;  5GPG B;  3L34 A;  5CI8 A;  2UUH A;  5BQI A;  3PDM P;  1AUE A;  3KH2 A;  3C7J A;  4C3D A;  3PMR A;  2R7S A;  1BDJ B;  3K6B A;  2J7P D;  3T6B A;  3U2L A;  4BJ5 A;  2R7R A;  3FDQ A;  3VAY A;  1C17 M;  1F1M A;  1QQ3 A;  3U8P A;  3UMH A;  3W4Y A;  4U5E E;  3N0T A;  2J9B A;  4RBN A;  1OXB A;  2M64 A;  3LLI A;  3JZ0 A;  4JRZ A;  5BQG A;  2WZG A;  4CJO A;  5JUA A;  1VYI A;  2RSE B;  1Z7Q c;  4HE8 D;  3RYL A;  4IRU A;  1HW1 A;  3ZSU A;  4OIN F;  4G78 A;  1LI7 A;  1XWJ A;  1VLS A;  1GQA A;  1TWH A;  1N1C A;  2P6V A;  1OCZ C;  3JTL O;  4ZLC A;  1WGW A;  3EZI A;  2A68 F;  3S9O A;  2AWY A;  3AGT A;  4E7S A;  2XLE A;  3UGP A;  1WOL A;  2VAS A;  2J0W A;  5FZT A;  5TJ5 E;  5JT4 A;  3L0I A;  3B0U X;  3W2V A;  3VM6 A;  3ZIB A;  2Y3G A;  1NU7 D;  1ST6 A;  1R5I D;  4DRH B;  3GOR A;  1LS1 A;  3BEH A;  3PCV A;  5AC5 A;  4PFP A;  2J9W A;  2HSQ A;  3FVY A;  4GYT A;  4EKW A;  2XXA B;  3K33 A;  2H7V C;  4MW8 A;  2L6H A;  2MHR A;  3QVY A;  2IXM A;  1LM3 B;  2AP3 A;  2XLV A;  2BC5 A;  3F46 A;  4R32 A;  5T3W A;  5L0J A;  3S90 A;  4BJ6 A;  2XLD A;  1WAT A;  3J06 A;  2H7B A;  4JUR I;  3RVZ A;  4PFO A;  4CS9 A;  3Q7G A;  4W8P A;  5L0H A; 
#chains in the Genus database with same CATH homology
 1OR3 A;  1NFN A;  3S84 A;  1EQ1 A;  1H7I A;  1EA8 A;  1NFO A;  1YA9 A;  1LS4 A;  1LPE A;  1GS9 A;  1LE2 A;  3R2P A;  1B68 A;  1OR2 A;  1AEP A;  1BZ4 A;  1LE4 A;  2KC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...