1LE4A

Structural basis for altered function in the common mutants of human apolipoprotein-e
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
139
structure length
139
Chain Sequence
QRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human apolipoprotein E. Role of arginine 61 in mediating the lipoprotein preferences of the E3 and E4 isoforms.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipoprotein
molecule keywords APOLIPOPROTEIN E4
total genus 61
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1991-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1le4A00
3R2PA 1NFOA 1NFNA 1BZ4A 1GS9A 1LE2A 1OR3A 1LS4A 3S84A 1EQ1A 1LE4A 1YA9A 1AEPA 2KC3A 1EA8A 1LPEA 1OR2A 1B68A 1H7IA
chains in the Genus database with same CATH superfamily
5T3TA 3E70C 1VK5A 2XL4A 3GWLA 5T1DB 4BJ1A 1O5HA 1FNTc 1YAUO 1A7EA 1V4AA 3K7DA 3QVYA 4BPMA 5F5HA 2NUPB 1LKXA 4GYTA 3L8IA 4C7OA 1Q0DA 2Q9CA 2Y3HA 4IRUA 3AQCA 3FMSA 3UR3C 2XRHA 4EBKA 2LSEA 3IQ5A 4YL0A 3N0TA 2LIGA 3W8HA 2YWAA 2P7VA 2EIKC 1NFNA 3L1MA 2ZXRA 3CAXA 3UMHA 5EK0A 3AG1C 5JT4A 1FMVA 4MVZA 1NLXA 3RW0A 4IARA 1SZIA 1VYIA 5A6KA 5DQZA 3CEXA 3S29A 3HTKC 2R05A 3ZDLA 2A69F 1V55C 3QW1A 4MVQA 1HMDA 2NPUA 3VRCA 4EIYA 5KYUB 3Q6MA 4PR9A 4L6RA 4XEVA 1TWHA 4XPWA 4YT2A 5IY5C 2VCCA 3LUTB 2Q00A 3NYMA 4HFKB 2XM4A 3AG2C 4YT5A 4CDAA 1OR3A 4HE8D 1Y6DA 4XEKA 3SXMA 2Q9BA 4CS8A 3O10A 3GEIA 4DXWA 2CGEA 5KYUA 2WZLA 1ZW2A 2R02A 2Q4FA 2YL7A 4J30B 4CBEA 4A4AA 4EBBA 2J9BA 5CI8A 4Q4ZF 1R4TA 2B0HA 1T6UA 3E9VA 3EFOA 3FOPA 2J9WA 3C63A 4K1OA 3ZQYA 2HJ3A 2IOQA 1H9GA 3K66A 4R32A 2YL0A 5TJ5E 1Z63A 3B0UX 3B71A 3AGTA 3UMIA 1RKEA 1UG7A 5JLIA 2KJGA 3W2VA 1W2WA 4I3MA 5FZTA 4PJLA 1CPRA 2KK1A 3ASOC 2IXPA 4DBQA 1FAPB 1ZHWA 1EI7A 5AC4A 1WN0A 4U5BE 2M64A 1ZW3A 2R7OA 3MLGA 1JPNA 1AVOB 1OXBA 3I5QA 3DE8A 3NRHA 1G8XA 1CGNA 4XLNF 4XTKA 3ZQVA 3G50A 2Y39A 3L0IA 4PJNA 2QTVA 2XSEA 4CJOA 2JD3A 2R7QA 3RFYA 5KYXB 4H54A 2E87A 3TOLA 2OJED 3C8GA 2M4EA 1A41A 3LS1A 3AJMA 2LK4A 4OINF 1H7IA 1ZHXA 1MQVA 2XM0A 2R7VA 2AWYA 2GWWA 1WWPA 2VB6A 3C8GD 3TD7A 3U8VA 3VM6A 4Z9JA 3ZTMA 2LP4A 2IXMA 5L0HA 2R7XA 1YZAA 1VB5A 2KYHA 2VH3A 4B6IA 1OR2A 3S90A 3DMDA 4O7GA 3SYNA 2G62A 5B3IA 4UDVA 2CCYA 3GEHA 5BQGA 4I1MA 1ZZPA 1M2VB 2PNOA 3DKAA 3AOUA 3EGXA 3DD7A 2XLHA 3H65A 2G3KA 2H7BA 4LDRA 4NTAA 1BR1A 3SZRA 1ORJA 2R7WA 3KYJA 2OEXA 2IXNA 3IQTA 3SEOA 1QPUA 1I4ZA 5A6BD 1KNYA 4W8KA 2QY9A 3MFNA 1H9TA 4CX9A 1VLSA 1FMWA 4KNWA 2HFIA 3U0CA 1V54C 2YRFA 4G78A 3GEEA 3RVZA 2EPNA 3JTLO 3RQGA 3GODA 4MVRA 1E2XA 4RD9A 2D4UA 5E3AA 4CS7A 4E0HA 1D0XA 3ATPA 3NG1A 3B0VC 1RCPA 3O39A 1BR2A 3WAQA 1YJGA 5CIVA 2J9VA 4O79A 5BQIA 3RVYA 1WGWA 4AL0A 1MMGA 2HV7A 3F47A 1V74B 3EH1A 2Q7RA 1PD0A 2JX0A 4HEAJ 3U5SA 2DGJA 3NDBB 1EKYA 2KC3A 3VAYA 5KYYA 1WTYA 4PJMA 3ABLC 3EH2A 4U5HA 2R03A 3K1IA 3ASNC 1ZYRF 4JTDB 5EGYA 1FFTC 4FAPB 4BG0A 2LCHA 2HV6A 3DM9B 3CSKA 4EBJA 3N2ZB 1ZHZA 3U3BA 4I1OB 4E7ZA 5A6JA 4OIQF 2OKUA 4K0DA 4XEFA 4U9DA 3DI5A 3S9OA 2H7OA 4CJGA 1S7ZA 2CNWD 1M2OA 2HKVA 1C17M 2Y3BA 4C3DA 5L3VA 3AQBA 1UFBA 2L9JA 2YLGA 2XXAB 1J8YF 2D5RB 3H2UA 1T5OA 3SXYA 1YA7O 256BA 1LS4A 2YL1A 2EINC 2WVQA 3K6BA 1A7DA 2Y3DA 2ZXPA 3T9OA 1TQGA 1ZHYA 1OW7A 3HNLA 3HNKA 5B3SC 3VF0A 1OW8A 2YLDA 1YYXA 2BL2A 1K40A 1MNDA 2F22A 2HMQA 2NG1A 1LVKA 3I5PA 3IQ6A 1OCCC 1TFKB 3IPMO 4ZLCA 5KYYB 1D1AA 1GQAA 2A0UA 1ZU5A 2QE9A 3EG9A 4N4WA 3SXKA 3AG3C 1JRAA 2PBEA 5KYNA 2IXOA 1Z23A 1H6GA 2YVKA 1DOVA 3IEEA 1QKRA 4RDAA 4JC7A 5COMA 1I5NA 3I4UA 3B29A 3EHMA 4C3EA 1MMAA 2A6EF 3B0PA 3POVA 3EPVA 4GEHA 4N06A 4KI2A 2P1AA 3V5XA 1YARO 1TWGA 1MNEA 5HSWA 4MTOA 1U0BB 3JRTA 4YWQA 1D0ZA 2H8AA 1J8MF 4DVZA 3S84A 4MW3A 4DOZA 1LI5A 2LFDA 3C8ZA 1Q0FA 5CI9A 1VMAA 2YHSA 5F5FA 1T01A 2YL3A 3OEOA 4ONSA 3ZWIA 1I4YA 1Q0MA 1NSGB 2NUTB 2A1DD 5AC5A 2FFHA 4MTFA 2AWCA 3O55A 3V5YA 3NMKA 2YLIA 4WGYA 2HSQA 2UUIA 2LQGA 2EILC 1JR8A 5L0DA 2LFFA 3RQEA 2J46A 2ZXWC 3UNGC 4YT8A 2HZ8A 3LEVA 1BDJB 2XS8A 3LESA 3W2WA 2HS5A 2WB7A 1NZEA 4BEMJ 2EPKX 1GM5A 3W8IA 3BRJA 5A69A 2J9UA 2W4BA 3HNJA 4NY3A 5L3QA 1OQCA 4JW1A 2J0XA 3RKOF 4BJTA 1EQ1A 5KYWB 2UUHA 2WL8A 3WODF 1B68A 2XLEA 3EGXB 4ULWA 3ABKC 3R2PA 4YN0B 1C02A 4CDYA 3OWTA 4NC3A 3CZ6A 3EG9B 2RD9A 4N6HA 4MTGA 4A2NB 3K33A 1OW6A 2OCCC 3U8PA 5L0GA 3AGUA 3QZCA 2XXAA 3PDMP 4MVSA 4OIRF 3U3FA 1RKEB 1LE4A 2KW3C 3F46A 1ORYA 2O9XA 1TFOB 2W45A 3JSZA 3MBGA 1YVIA 2KQ9A 3LEOA 2J7PA 3O6XA 3U9MA 5L0FA 3DZAA 3N24A 4Z9HA 2GAQA 1TWAA 4D4XA 3RH3A 1D1BA 1L3PA 3FXHA 1QLEC 3JYYA 2R9RB 3S28A 3RIPA 3HNIA 4YL1A 4C7OB 2L6FA 4JJFA 3GORA 4JEBA 4BJ6A 3US6A 2XL8A 2Q9AA 4H4KC 4AX2A 1RKCA 1G4WR 3PCVA 2HUJA 1KU2A 3EHNA 3KYIA 4AE4A 5KYWA 1MMDA 4HFFB 3Q7GA 1U89A 2AP3A 2EPMX 3C18A 2YEVA 3T6GB 4EHPA 4G0HA 4JZAA 3KMIA 1NBBA 4IJJA 3M79A 4ZLDA 3NKEA 5L0IA 3OA1A 1O87A 1QZXA 2R25A 3G4ZA 1OCOC 4CS9C 3X1OA 4DRHB 3CQZA 4LERA 1HW1A 2PX3A 1S05A 1D0YA 3C62A 1JMWA 1Z7Qc 4ER9A 1E84A 4KBLA 1ORSC 5T3WA 3NMIA 4EWCA 1O3UA 1RJ9B 3HLZA 4CDVA 2ICWG 3L34A 1QVXA 2V3CC 2NUTA 4NTFA 3WG7C 2PX0A 2XLVA 1OKKD 3JT1A 3T6JA 4U5GA 4DRJB 1HE1A 4YT4A 4JIOA 4PACA 1LM3B 3FAPB 4RBNA 3JRMO 5EHHA 4XPXA 3IHUA 4BJ6C 3IQCA 4CIPA 1RXQA 1FR0A 5E2QA 3DXJF 3TK0A 3T6BA 4PFOA 4J7YA 5COGA 3EQLF 3LAYA 3Q6NA 3EFOB 3FVYA 1A0BA 4LLEA 4KNVA 1KTMA 2X51A 4OD4A 1G5ZA 3H2VA 1G4US 2HJMA 1Z5ZA 3DM5A 4MNDA 3U2MA 3G4XA 4DJ9A 1M2VA 2OU6A 2A68F 4WJ0A 5DS6A 1C03A 1XWJA 4KC9A 1M56C 2R7RA 1ST6A 1PD1A 2XL6A 4JCZA 2TMVP 3GM3A 1NU7D 2EIJC 2L7AA 2Y69C 2J7PD 3MX3A 2AVKA 1M6TA 2ETSA 3DAGA 4IGGA 3SNHA 4BJ5C 2J45A 5KYXA 4K7BA 1CPQA 2HMZA 1VLTA 3RQFA 2GDCA 4MVUA 3A9CA 5JRAA 2W4MA 4NTBA 2A6HF 4Q5SF 2DYSC 3LNMB 3TULA 2YQYA 3ECSA 3MYIA 4I44A 3DAFA 2R7TA 1T6IA 2KSFA 4XPYA 2IM8A 1BR4A 2WZFA 2NUPA 4QI0A 1U6HA 4MW8A 3TJ6A 4G7OF 4JTCB 3ZTZA 2HSBA 1AUEA 5D92A 2PFDA 3LLKA 3BEHA 4U9EA 3JSEO 1D1CA 3KL4A 3NYLA 3QVZA 5BQHA 5E33A 1T6QA 4J7TA 4JKVA 4C3BA 4PFPA 3M4BA 4EUKB 2EPOA 2GFHA 5HV9A 5COFA 2LD6A 3GM2A 5L0CA 2VCBA 1PV3A 3TQOA 1IW7F 3V7OA 5BUOA 1CGME 1HY5A 2ZXOA 4BEJA 2ASRA 3QMKA 4IAQA 1VTMP 2VC9A 4JRZA 3EZHA 3R7CA 2OJQA 4M63A 4CS9A 3FOOA 2EPLX 1TR2A 1OKKA 3JZ0A 3Q7LA 4P9TA 2RSEB 3PHF2 4ULVA 3UGPA 3EJNA 1Q0GA 2CDQA 1VOMA 1MMNA 3HKKA 2VCAA 4IWBA 1LPEA 1VYKA 4O6YA 2B0JA 2I15A 4JTAB 2MWQA 1YYJA 4DRIB 3LLIA 3W4YA 2Z15A 4LACB 5JUAA 2C03A 2DB4A 3FDQA 3LS0A 2WVNA 3X2QC 3QTHA 4WGZA 5F28E 4JJGA 4XQ1A 1E86A 3K1HA 2QLAA 2KNHA 2MYSA 4O6NA 4LLCA 4U5CE 4U5FE 1E83A 2H7VC 2CYDA 5JSLA 2P61A 3RYLA 2Y3GA 4E0IA 5E3CA 4JVSA 1A7VA 4JE9A 3C7JA 2AU5A 3QW0A 5GPGB 3DJNB 1XZQA 2V26A 4IB4A 3K1IC 1F1MA 4E18A 4NCQA 2DI3A 1RJ9A 4P9FA 3T4RA 1SF8A 3NKDA 5JVEA 3J06A 4AE4B 2XLWA 4JEAA 2NSGA 1HMOA 3TJ5A 3ZVRA 4G7ZF 3NMJA 2L6GA 5D91A 5DS5A 1SR2A 2IYLD 4AL1A 2IBFA 3V5ZA 3WHNA 5JS5A 1WATA 2FGYA 2OG2A 1L7CA 5B1BC 4U5DE 1LS1A 4J32B 5DS4A 3S0XA 3S27A 3M4CA 1NG1A 4PJJA 4E7SA 3RF3A 2PF4E 1K04A 3ITFA 4MVMA 2ZD9A 4EKWA 2DYRC 2W9YA 4FX5A 3U9JA 4G7HF 3VYWA 3L8JA 2Q3TA 1Z3IX 1CGOA 2BE5F 3U2LA 4YJWA 1OXKA 1QQ3A 1FFHA 3GANA 1T9KA 2EIMC 1Z6AA 2WZGA 4PK4A 2OOCA 2NSFA 4OIPF 5A6BA 2XLOA 4QI2A 1NU9C 2JPUA 2XLDA 5DVWA 2KGOA 2QUPA 3TOMA 2VASA 4CSAA 2CNWA 2YZSA 4N6CA 4YL3A 3C8GB 1RMVA 4QDLA 3FHDA 1YLMA 3M1CB 4JURI 1ZVZA 1XZPA 2I8BA 1YZCA 3ABMC 2YKZA 3DJUB 1R5ID 4D4NA 2R7UA 5A6AA 2C04A 2G3VA 1QSPA 2ZPAA 1PCXA 3B9QA 1SMYF 4CSAC 4NQFA 4BJ5A 4AK9A 4W8PA 1JPJA 3ZIBA 1HE9A 1DOWA 4CS8C 2R7SA 3FAJA 2J8WA 2FAPB 3EZIA 3KH2A 1AEPA 2CW0F 1APCA 1EA8A 3EGDA 2OEVA 1WASA 2L6HA 3SP1A 4ANJA 4FESA 1Y4CA 1K05A 3DE9A 1OCZC 4WABA 2P0NA 5DQTA 4CIHA 3JCUQ 2WVOA 1Q0KA 3ZSUA 3UGOA 4XWJA 3SXZA 1SYQA 2J0WA 3KPHA 1HW2A 4F4BA 1NFOA 4FWVA 4O6MA 5B1AC 5JP7A 4OIOF 1JAFA 1OCRC 3AG4C 3ZG1A 3GM1A 5AGFA 3M15A 2X0CA 1ZHTA 1N1CA 3GWNA 2PP4A 3KKBA 1JOGA 2XS1A 4IAOA 4DBRA 1ZU4A 1E85A 1TKNA 2P6VA 2XLMA 5DLJA 2MHRA 4MVOA 4E17A 4GQHA 4MQ9F 4U5EE 1GS9A 3NYJA 5FCLA 1LI7A 1GGQA 4DVYP 1TWCA 3LJBA 4JCHA 2QNLA 4XLPF 3EGDB 5K0IA 1BZ4A 2BC5A 3HJCA 2L81A 1M57C 3PMRA 4Z9IA 4LDQA 1YDIA 4LDKA 5L0JA 4OD5A 4X0RA 3ZC4A 2GA0A 3A11A 3JYHA 1BBHA 3UMKA 1WOLA 1LIHA 2OQMA 4YK5A 4P6IC 1LE2A 4Q7CA 4MS2A 1FTSA 1YA9A 3MYFA 3DWWA 1IZMA 2A0BA 3LNRA
chains in the Genus database with same CATH topology
3R2PA 1NFOA 1NFNA 1BZ4A 1GS9A 1LE2A 1OR3A 1LS4A 3S84A 1EQ1A 1LE4A 1YA9A 1AEPA 2KC3A 1EA8A 1LPEA 1OR2A 1B68A 1H7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2P A;  1NFO A;  1NFN A;  1BZ4 A;  1GS9 A;  1LE2 A;  1OR3 A;  1LS4 A;  3S84 A;  1EQ1 A;  1LE4 A;  1YA9 A;  1AEP A;  2KC3 A;  1EA8 A;  1LPE A;  1OR2 A;  1B68 A;  1H7I A; 
#chains in the Genus database with same CATH topology
 5T3T A;  3E70 C;  1VK5 A;  2XL4 A;  3GWL A;  5T1D B;  4BJ1 A;  1O5H A;  1FNT c;  1YAU O;  1A7E A;  1V4A A;  3K7D A;  3QVY A;  4BPM A;  5F5H A;  2NUP B;  1LKX A;  4GYT A;  3L8I A;  4C7O A;  1Q0D A;  2Q9C A;  2Y3H A;  4IRU A;  3AQC A;  3FMS A;  3UR3 C;  2XRH A;  4EBK A;  2LSE A;  3IQ5 A;  4YL0 A;  3N0T A;  2LIG A;  3W8H A;  2YWA A;  2P7V A;  2EIK C;  1NFN A;  3L1M A;  2ZXR A;  3CAX A;  3UMH A;  5EK0 A;  3AG1 C;  5JT4 A;  1FMV A;  4MVZ A;  1NLX A;  3RW0 A;  4IAR A;  1SZI A;  1VYI A;  5A6K A;  5DQZ A;  3CEX A;  3S29 A;  3HTK C;  2R05 A;  3ZDL A;  2A69 F;  1V55 C;  3QW1 A;  4MVQ A;  1HMD A;  2NPU A;  3VRC A;  4EIY A;  5KYU B;  3Q6M A;  4PR9 A;  4L6R A;  4XEV A;  1TWH A;  4XPW A;  4YT2 A;  5IY5 C;  2VCC A;  3LUT B;  2Q00 A;  3NYM A;  4HFK B;  2XM4 A;  3AG2 C;  4YT5 A;  4CDA A;  1OR3 A;  4HE8 D;  1Y6D A;  4XEK A;  3SXM A;  2Q9B A;  4CS8 A;  3O10 A;  3GEI A;  4DXW A;  2CGE A;  5KYU A;  2WZL A;  1ZW2 A;  2R02 A;  2Q4F A;  2YL7 A;  4J30 B;  4CBE A;  4A4A A;  4EBB A;  2J9B A;  5CI8 A;  4Q4Z F;  1R4T A;  2B0H A;  1T6U A;  3E9V A;  3EFO A;  3FOP A;  2J9W A;  3C63 A;  4K1O A;  3ZQY A;  2HJ3 A;  2IOQ A;  1H9G A;  3K66 A;  4R32 A;  2YL0 A;  5TJ5 E;  1Z63 A;  3B0U X;  3B71 A;  3AGT A;  3UMI A;  1RKE A;  1UG7 A;  5JLI A;  2KJG A;  3W2V A;  1W2W A;  4I3M A;  5FZT A;  4PJL A;  1CPR A;  2KK1 A;  3ASO C;  2IXP A;  4DBQ A;  1FAP B;  1ZHW A;  1EI7 A;  5AC4 A;  1WN0 A;  4U5B E;  2M64 A;  1ZW3 A;  2R7O A;  3MLG A;  1JPN A;  1AVO B;  1OXB A;  3I5Q A;  3DE8 A;  3NRH A;  1G8X A;  1CGN A;  4XLN F;  4XTK A;  3ZQV A;  3G50 A;  2Y39 A;  3L0I A;  4PJN A;  2QTV A;  2XSE A;  4CJO A;  2JD3 A;  2R7Q A;  3RFY A;  5KYX B;  4H54 A;  2E87 A;  3TOL A;  2OJE D;  3C8G A;  2M4E A;  1A41 A;  3LS1 A;  3AJM A;  2LK4 A;  4OIN F;  1H7I A;  1ZHX A;  1MQV A;  2XM0 A;  2R7V A;  2AWY A;  2GWW A;  1WWP A;  2VB6 A;  3C8G D;  3TD7 A;  3U8V A;  3VM6 A;  4Z9J A;  3ZTM A;  2LP4 A;  2IXM A;  5L0H A;  2R7X A;  1YZA A;  1VB5 A;  2KYH A;  2VH3 A;  4B6I A;  1OR2 A;  3S90 A;  3DMD A;  4O7G A;  3SYN A;  2G62 A;  5B3I A;  4UDV A;  2CCY A;  3GEH A;  5BQG A;  4I1M A;  1ZZP A;  1M2V B;  2PNO A;  3DKA A;  3AOU A;  3EGX A;  3DD7 A;  2XLH A;  3H65 A;  2G3K A;  2H7B A;  4LDR A;  4NTA A;  1BR1 A;  3SZR A;  1ORJ A;  2R7W A;  3KYJ A;  2OEX A;  2IXN A;  3IQT A;  3SEO A;  1QPU A;  1I4Z A;  5A6B D;  1KNY A;  4W8K A;  2QY9 A;  3MFN A;  1H9T A;  4CX9 A;  1VLS A;  1FMW A;  4KNW A;  2HFI A;  3U0C A;  1V54 C;  2YRF A;  4G78 A;  3GEE A;  3RVZ A;  2EPN A;  3JTL O;  3RQG A;  3GOD A;  4MVR A;  1E2X A;  4RD9 A;  2D4U A;  5E3A A;  4CS7 A;  4E0H A;  1D0X A;  3ATP A;  3NG1 A;  3B0V C;  1RCP A;  3O39 A;  1BR2 A;  3WAQ A;  1YJG A;  5CIV A;  2J9V A;  4O79 A;  5BQI A;  3RVY A;  1WGW A;  4AL0 A;  1MMG A;  2HV7 A;  3F47 A;  1V74 B;  3EH1 A;  2Q7R A;  1PD0 A;  2JX0 A;  4HEA J;  3U5S A;  2DGJ A;  3NDB B;  1EKY A;  2KC3 A;  3VAY A;  5KYY A;  1WTY A;  4PJM A;  3ABL C;  3EH2 A;  4U5H A;  2R03 A;  3K1I A;  3ASN C;  1ZYR F;  4JTD B;  5EGY A;  1FFT C;  4FAP B;  4BG0 A;  2LCH A;  2HV6 A;  3DM9 B;  3CSK A;  4EBJ A;  3N2Z B;  1ZHZ A;  3U3B A;  4I1O B;  4E7Z A;  5A6J A;  4OIQ F;  2OKU A;  4K0D A;  4XEF A;  4U9D A;  3DI5 A;  3S9O A;  2H7O A;  4CJG A;  1S7Z A;  2CNW D;  1M2O A;  2HKV A;  1C17 M;  2Y3B A;  4C3D A;  5L3V A;  3AQB A;  1UFB A;  2L9J A;  2YLG A;  2XXA B;  1J8Y F;  2D5R B;  3H2U A;  1T5O A;  3SXY A;  1YA7 O;  256B A;  1LS4 A;  2YL1 A;  2EIN C;  2WVQ A;  3K6B A;  1A7D A;  2Y3D A;  2ZXP A;  3T9O A;  1TQG A;  1ZHY A;  1OW7 A;  3HNL A;  3HNK A;  5B3S C;  3VF0 A;  1OW8 A;  2YLD A;  1YYX A;  2BL2 A;  1K40 A;  1MND A;  2F22 A;  2HMQ A;  2NG1 A;  1LVK A;  3I5P A;  3IQ6 A;  1OCC C;  1TFK B;  3IPM O;  4ZLC A;  5KYY B;  1D1A A;  1GQA A;  2A0U A;  1ZU5 A;  2QE9 A;  3EG9 A;  4N4W A;  3SXK A;  3AG3 C;  1JRA A;  2PBE A;  5KYN A;  2IXO A;  1Z23 A;  1H6G A;  2YVK A;  1DOV A;  3IEE A;  1QKR A;  4RDA A;  4JC7 A;  5COM A;  1I5N A;  3I4U A;  3B29 A;  3EHM A;  4C3E A;  1MMA A;  2A6E F;  3B0P A;  3POV A;  3EPV A;  4GEH A;  4N06 A;  4KI2 A;  2P1A A;  3V5X A;  1YAR O;  1TWG A;  1MNE A;  5HSW A;  4MTO A;  1U0B B;  3JRT A;  4YWQ A;  1D0Z A;  2H8A A;  1J8M F;  4DVZ A;  3S84 A;  4MW3 A;  4DOZ A;  1LI5 A;  2LFD A;  3C8Z A;  1Q0F A;  5CI9 A;  1VMA A;  2YHS A;  5F5F A;  1T01 A;  2YL3 A;  3OEO A;  4ONS A;  3ZWI A;  1I4Y A;  1Q0M A;  1NSG B;  2NUT B;  2A1D D;  5AC5 A;  2FFH A;  4MTF A;  2AWC A;  3O55 A;  3V5Y A;  3NMK A;  2YLI A;  4WGY A;  2HSQ A;  2UUI A;  2LQG A;  2EIL C;  1JR8 A;  5L0D A;  2LFF A;  3RQE A;  2J46 A;  2ZXW C;  3UNG C;  4YT8 A;  2HZ8 A;  3LEV A;  1BDJ B;  2XS8 A;  3LES A;  3W2W A;  2HS5 A;  2WB7 A;  1NZE A;  4BEM J;  2EPK X;  1GM5 A;  3W8I A;  3BRJ A;  5A69 A;  2J9U A;  2W4B A;  3HNJ A;  4NY3 A;  5L3Q A;  1OQC A;  4JW1 A;  2J0X A;  3RKO F;  4BJT A;  1EQ1 A;  5KYW B;  2UUH A;  2WL8 A;  3WOD F;  1B68 A;  2XLE A;  3EGX B;  4ULW A;  3ABK C;  3R2P A;  4YN0 B;  1C02 A;  4CDY A;  3OWT A;  4NC3 A;  3CZ6 A;  3EG9 B;  2RD9 A;  4N6H A;  4MTG A;  4A2N B;  3K33 A;  1OW6 A;  2OCC C;  3U8P A;  5L0G A;  3AGU A;  3QZC A;  2XXA A;  3PDM P;  4MVS A;  4OIR F;  3U3F A;  1RKE B;  1LE4 A;  2KW3 C;  3F46 A;  1ORY A;  2O9X A;  1TFO B;  2W45 A;  3JSZ A;  3MBG A;  1YVI A;  2KQ9 A;  3LEO A;  2J7P A;  3O6X A;  3U9M A;  5L0F A;  3DZA A;  3N24 A;  4Z9H A;  2GAQ A;  1TWA A;  4D4X A;  3RH3 A;  1D1B A;  1L3P A;  3FXH A;  1QLE C;  3JYY A;  2R9R B;  3S28 A;  3RIP A;  3HNI A;  4YL1 A;  4C7O B;  2L6F A;  4JJF A;  3GOR A;  4JEB A;  4BJ6 A;  3US6 A;  2XL8 A;  2Q9A A;  4H4K C;  4AX2 A;  1RKC A;  1G4W R;  3PCV A;  2HUJ A;  1KU2 A;  3EHN A;  3KYI A;  4AE4 A;  5KYW A;  1MMD A;  4HFF B;  3Q7G A;  1U89 A;  2AP3 A;  2EPM X;  3C18 A;  2YEV A;  3T6G B;  4EHP A;  4G0H A;  4JZA A;  3KMI A;  1NBB A;  4IJJ A;  3M79 A;  4ZLD A;  3NKE A;  5L0I A;  3OA1 A;  1O87 A;  1QZX A;  2R25 A;  3G4Z A;  1OCO C;  4CS9 C;  3X1O A;  4DRH B;  3CQZ A;  4LER A;  1HW1 A;  2PX3 A;  1S05 A;  1D0Y A;  3C62 A;  1JMW A;  1Z7Q c;  4ER9 A;  1E84 A;  4KBL A;  1ORS C;  5T3W A;  3NMI A;  4EWC A;  1O3U A;  1RJ9 B;  3HLZ A;  4CDV A;  2ICW G;  3L34 A;  1QVX A;  2V3C C;  2NUT A;  4NTF A;  3WG7 C;  2PX0 A;  2XLV A;  1OKK D;  3JT1 A;  3T6J A;  4U5G A;  4DRJ B;  1HE1 A;  4YT4 A;  4JIO A;  4PAC A;  1LM3 B;  3FAP B;  4RBN A;  3JRM O;  5EHH A;  4XPX A;  3IHU A;  4BJ6 C;  3IQC A;  4CIP A;  1RXQ A;  1FR0 A;  5E2Q A;  3DXJ F;  3TK0 A;  3T6B A;  4PFO A;  4J7Y A;  5COG A;  3EQL F;  3LAY A;  3Q6N A;  3EFO B;  3FVY A;  1A0B A;  4LLE A;  4KNV A;  1KTM A;  2X51 A;  4OD4 A;  1G5Z A;  3H2V A;  1G4U S;  2HJM A;  1Z5Z A;  3DM5 A;  4MND A;  3U2M A;  3G4X A;  4DJ9 A;  1M2V A;  2OU6 A;  2A68 F;  4WJ0 A;  5DS6 A;  1C03 A;  1XWJ A;  4KC9 A;  1M56 C;  2R7R A;  1ST6 A;  1PD1 A;  2XL6 A;  4JCZ A;  2TMV P;  3GM3 A;  1NU7 D;  2EIJ C;  2L7A A;  2Y69 C;  2J7P D;  3MX3 A;  2AVK A;  1M6T A;  2ETS A;  3DAG A;  4IGG A;  3SNH A;  4BJ5 C;  2J45 A;  5KYX A;  4K7B A;  1CPQ A;  2HMZ A;  1VLT A;  3RQF A;  2GDC A;  4MVU A;  3A9C A;  5JRA A;  2W4M A;  4NTB A;  2A6H F;  4Q5S F;  2DYS C;  3LNM B;  3TUL A;  2YQY A;  3ECS A;  3MYI A;  4I44 A;  3DAF A;  2R7T A;  1T6I A;  2KSF A;  4XPY A;  2IM8 A;  1BR4 A;  2WZF A;  2NUP A;  4QI0 A;  1U6H A;  4MW8 A;  3TJ6 A;  4G7O F;  4JTC B;  3ZTZ A;  2HSB A;  1AUE A;  5D92 A;  2PFD A;  3LLK A;  3BEH A;  4U9E A;  3JSE O;  1D1C A;  3KL4 A;  3NYL A;  3QVZ A;  5BQH A;  5E33 A;  1T6Q A;  4J7T A;  4JKV A;  4C3B A;  4PFP A;  3M4B A;  4EUK B;  2EPO A;  2GFH A;  5HV9 A;  5COF A;  2LD6 A;  3GM2 A;  5L0C A;  2VCB A;  1PV3 A;  3TQO A;  1IW7 F;  3V7O A;  5BUO A;  1CGM E;  1HY5 A;  2ZXO A;  4BEJ A;  2ASR A;  3QMK A;  4IAQ A;  1VTM P;  2VC9 A;  4JRZ A;  3EZH A;  3R7C A;  2OJQ A;  4M63 A;  4CS9 A;  3FOO A;  2EPL X;  1TR2 A;  1OKK A;  3JZ0 A;  3Q7L A;  4P9T A;  2RSE B;  3PHF 2;  4ULV A;  3UGP A;  3EJN A;  1Q0G A;  2CDQ A;  1VOM A;  1MMN A;  3HKK A;  2VCA A;  4IWB A;  1LPE A;  1VYK A;  4O6Y A;  2B0J A;  2I15 A;  4JTA B;  2MWQ A;  1YYJ A;  4DRI B;  3LLI A;  3W4Y A;  2Z15 A;  4LAC B;  5JUA A;  2C03 A;  2DB4 A;  3FDQ A;  3LS0 A;  2WVN A;  3X2Q C;  3QTH A;  4WGZ A;  5F28 E;  4JJG A;  4XQ1 A;  1E86 A;  3K1H A;  2QLA A;  2KNH A;  2MYS A;  4O6N A;  4LLC A;  4U5C E;  4U5F E;  1E83 A;  2H7V C;  2CYD A;  5JSL A;  2P61 A;  3RYL A;  2Y3G A;  4E0I A;  5E3C A;  4JVS A;  1A7V A;  4JE9 A;  3C7J A;  2AU5 A;  3QW0 A;  5GPG B;  3DJN B;  1XZQ A;  2V26 A;  4IB4 A;  3K1I C;  1F1M A;  4E18 A;  4NCQ A;  2DI3 A;  1RJ9 A;  4P9F A;  3T4R A;  1SF8 A;  3NKD A;  5JVE A;  3J06 A;  4AE4 B;  2XLW A;  4JEA A;  2NSG A;  1HMO A;  3TJ5 A;  3ZVR A;  4G7Z F;  3NMJ A;  2L6G A;  5D91 A;  5DS5 A;  1SR2 A;  2IYL D;  4AL1 A;  2IBF A;  3V5Z A;  3WHN A;  5JS5 A;  1WAT A;  2FGY A;  2OG2 A;  1L7C A;  5B1B C;  4U5D E;  1LS1 A;  4J32 B;  5DS4 A;  3S0X A;  3S27 A;  3M4C A;  1NG1 A;  4PJJ A;  4E7S A;  3RF3 A;  2PF4 E;  1K04 A;  3ITF A;  4MVM A;  2ZD9 A;  4EKW A;  2DYR C;  2W9Y A;  4FX5 A;  3U9J A;  4G7H F;  3VYW A;  3L8J A;  2Q3T A;  1Z3I X;  1CGO A;  2BE5 F;  3U2L A;  4YJW A;  1OXK A;  1QQ3 A;  1FFH A;  3GAN A;  1T9K A;  2EIM C;  1Z6A A;  2WZG A;  4PK4 A;  2OOC A;  2NSF A;  4OIP F;  5A6B A;  2XLO A;  4QI2 A;  1NU9 C;  2JPU A;  2XLD A;  5DVW A;  2KGO A;  2QUP A;  3TOM A;  2VAS A;  4CSA A;  2CNW A;  2YZS A;  4N6C A;  4YL3 A;  3C8G B;  1RMV A;  4QDL A;  3FHD A;  1YLM A;  3M1C B;  4JUR I;  1ZVZ A;  1XZP A;  2I8B A;  1YZC A;  3ABM C;  2YKZ A;  3DJU B;  1R5I D;  4D4N A;  2R7U A;  5A6A A;  2C04 A;  2G3V A;  1QSP A;  2ZPA A;  1PCX A;  3B9Q A;  1SMY F;  4CSA C;  4NQF A;  4BJ5 A;  4AK9 A;  4W8P A;  1JPJ A;  3ZIB A;  1HE9 A;  1DOW A;  4CS8 C;  2R7S A;  3FAJ A;  2J8W A;  2FAP B;  3EZI A;  3KH2 A;  1AEP A;  2CW0 F;  1APC A;  1EA8 A;  3EGD A;  2OEV A;  1WAS A;  2L6H A;  3SP1 A;  4ANJ A;  4FES A;  1Y4C A;  1K05 A;  3DE9 A;  1OCZ C;  4WAB A;  2P0N A;  5DQT A;  4CIH A;  3JCU Q;  2WVO A;  1Q0K A;  3ZSU A;  3UGO A;  4XWJ A;  3SXZ A;  1SYQ A;  2J0W A;  3KPH A;  1HW2 A;  4F4B A;  1NFO A;  4FWV A;  4O6M A;  5B1A C;  5JP7 A;  4OIO F;  1JAF A;  1OCR C;  3AG4 C;  3ZG1 A;  3GM1 A;  5AGF A;  3M15 A;  2X0C A;  1ZHT A;  1N1C A;  3GWN A;  2PP4 A;  3KKB A;  1JOG A;  2XS1 A;  4IAO A;  4DBR A;  1ZU4 A;  1E85 A;  1TKN A;  2P6V A;  2XLM A;  5DLJ A;  2MHR A;  4MVO A;  4E17 A;  4GQH A;  4MQ9 F;  4U5E E;  1GS9 A;  3NYJ A;  5FCL A;  1LI7 A;  1GGQ A;  4DVY P;  1TWC A;  3LJB A;  4JCH A;  2QNL A;  4XLP F;  3EGD B;  5K0I A;  1BZ4 A;  2BC5 A;  3HJC A;  2L81 A;  1M57 C;  3PMR A;  4Z9I A;  4LDQ A;  1YDI A;  4LDK A;  5L0J A;  4OD5 A;  4X0R A;  3ZC4 A;  2GA0 A;  3A11 A;  3JYH A;  1BBH A;  3UMK A;  1WOL A;  1LIH A;  2OQM A;  4YK5 A;  4P6I C;  1LE2 A;  4Q7C A;  4MS2 A;  1FTS A;  1YA9 A;  3MYF A;  3DWW A;  1IZM A;  2A0B A;  3LNR A; 
#chains in the Genus database with same CATH homology
 3R2P A;  1NFO A;  1NFN A;  1BZ4 A;  1GS9 A;  1LE2 A;  1OR3 A;  1LS4 A;  3S84 A;  1EQ1 A;  1LE4 A;  1YA9 A;  1AEP A;  2KC3 A;  1EA8 A;  1LPE A;  1OR2 A;  1B68 A;  1H7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...