1LE4A

Structural basis for altered function in the common mutants of human apolipoprotein-e
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
139
structure length
139
Chain Sequence
QRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipoprotein
molecule keywords APOLIPOPROTEIN E4
publication title Human apolipoprotein E. Role of arginine 61 in mediating the lipoprotein preferences of the E3 and E4 isoforms.
pubmed rcsb
source organism Homo sapiens
total genus 61
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1991-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1le4A00
1OR2A 1YA9A 1NFOA 2KC3A 3S84A 1EA8A 1LE2A 3R2PA 1LS4A 1BZ4A 1OR3A 1NFNA 1AEPA 1LPEA 1H7IA 1EQ1A 1LE4A 1GS9A 1B68A
chains in the Genus database with same CATH superfamily
4I44A 4H4KC 2DYSC 4PJJA 1Z7Qc 2R7SA 1YYJA 3Q7LA 1LIHA 1JOGA 1JPJA 2CNWD 1C02A 2DGJA 2L7AA 3N24A 5TJ5E 4Q5SF 1BR4A 1YDIA 4WGYA 5E3AA 1OQCA 4YWQA 1QVXA 2LD6A 5L0CA 2OOCA 3VAYA 1A7VA 3SP1A 5DQZA 2J9VA 3ZIBA 4JJFA 5KYUB 4CIPA 4DVYP 4YL3A 5L3QA 1D1CA 4PFPA 3C7JA 3UGPA 1V74B 4C3BA 4NTBA 3DAGA 2V26A 3DAFA 3R2PA 1E84A 4IGGA 5KYNA 4YK5A 4JTDB 2A6EF 2PNOA 5COFA 4CS7A 1K05A 2AP3A 1Z23A 4CDYA 2P1AA 3ZTMA 3NMKA 4CX9A 3B29A 3LEVA 4H54A 4XPXA 4C3DA 4YJWA 1N1CA 5T1DB 4YT8A 3GORA 2EILC 1BDJB 4CS8C 1VTMP 4PFOA 4YT2A 2YL0A 3U9JA 4GEHA 4CS8A 1YA9A 2D4UA 3W8HA 5D92A 3S0XA 3LESA 2VC9A 2WVQA 3EGXA 1IW7F 4CBEA 2HMQA 4FWVA 2BE5F 1NBBA 3K1IC 3BEHA 3G4ZA 1DOWA 3JYHA 2WB7A 4J30B 2X0CA 2NUTA 3TOLA 3U5SA 4DRIB 3K1IA 3S84A 4E18A 1EA8A 2QUPA 3EHMA 2GAQA 3U3BA 2JPUA 3K7DA 4EUKB 3DE9A 2R7XA 2P61A 1HW1A 5T3WA 3HNIA 4MNDA 3MFNA 1FR0A 3SXMA 1AEPA 3A9CA 5JP7A 2KYHA 3V5XA 3S28A 3V5ZA 5A6KA 5JLIA 2RSEB 4XTKA 3RVYA 1TFOB 1S05A 2WZGA 5A6BD 5JUAA 2OJED 1K40A 2AWYA 1QLEC 1WATA 1U89A 4XLPF 2YKZA 4BJ5A 4LLCA 1H9TA 3VYWA 5AC4A 3ZG1A 4CDVA 1E2XA 2H7BA 2R03A 3GANA 2IM8A 3V7OA 2WL8A 2ZPAA 1ZHWA 4D4XA 5DS4A 1MMNA 5COGA 1U6HA 4DXWA 4CDAA 5KYYA 2XL6A 2R7WA 3JRMO 1Y6DA 1T6UA 1VYIA 3E9VA 3UMKA 2EPMX 2QTVA 3RVZA 1ZW3A 1D0YA 3DWWA 3F47A 1E86A 4U9DA 2MHRA 4P9TA 1M6TA 3TQOA 1TQGA 2G3VA 4EWCA 3EGXB 1WOLA 3L34A 4JEBA 1AUEA 1B68A 4JIOA 2KNHA 2LFDA 2NUTB 2C03A 3B9QA 3M79A 4XQ1A 3SXYA 2CCYA 2ZXOA 3U3FA 1JAFA 3ZTZA 3FDQA 3WG7C 5GPGB 5BQHA 2WZLA 3EPVA 2A1DD 3JTLO 3NRHA 1FFTC 4IJJA 1OCOC 5EGYA 3A11A 1OKKD 2Y39A 4AK9A 1JPNA 2P6VA 2ASRA 4JTCB 1UFBA 4WGZA 4O6NA 1M2OA 1YZCA 4P6IC 1T6QA 1A7DA 2M4EA 3IQCA 5L0JA 4FX5A 2Q7RA 4K7BA 1QQ3A 2LCHA 5B1BC 4JURI 1G4US 1GGQA 1VMAA 2J9UA 1HY5A 1HMDA 1VK5A 2OQMA 4U5GA 3C8ZA 4J7TA 3ZQYA 3OWTA 3AG2C 4LDQA 4NTAA 1M57C 2AU5A 4OINF 5KYYB 4Q7CA 5JRAA 2J9BA 4QDLA 4JC7A 1Q0DA 3EFOA 4P9FA 5T3TA 5JT4A 1L7CA 2DB4A 2GWWA 4RD9A 4BG0A 1E83A 1W2WA 3TJ5A 1NFOA 2B0HA 1A41A 1TWGA 3SYNA 2KQ9A 2YHSA 3POVA 2OEVA 3MYFA 3S90A 2EIJC 3N0TA 4DRJB 3K6BA 3IHUA 3RH3A 4CS9C 5BQIA 4OIRF 5JVEA 2Q9AA 3DZAA 4MVQA 2TMVP 2LIGA 4ZLDA 2XS8A 4CS9A 3FOPA 2QLAA 1JMWA 1LS4A 5BUOA 2IOQA 2EINC 5A6JA 1NFNA 2YL3A 3RIPA 1R4TA 1SMYF 4JW1A 2Q9BA 1ORSC 2R02A 1PV3A 1J8YF 2XLHA 3GODA 3FXHA 3HTKC 4N6CA 4ZLCA 2WZFA 4JTAB 1TWHA 2VCCA 4U5HA 2WVOA 1MNEA 5HV9A 4NC3A 4PACA 3C8GD 1LS1A 3GM2A 2M64A 3BRJA 5F5HA 2Q3TA 1M56C 2XM4A 4QI0A 1G8XA 1Q0FA 4FAPB 4BEJA 3GWLA 1T9KA 2KC3A 1BR1A 3AOUA 4EKWA 4G7ZF 3U8VA 4MTOA 2JX0A 2OJQA 5COMA 1SYQA 2L9JA 3JCUQ 4JCZA 3ECSA 1OW6A 2C04A 2FFHA 2JD3A 3QTHA 4K1OA 4Z9HA 2J0WA 1BZ4A 2W9YA 3ABLC 3EFOB 3LLKA 3UGOA 5F5FA 1HE9A 5BQGA 1RKEA 3R7CA 2HSBA 1ZHXA 2OKUA 1G5ZA 4J7YA 4E0IA 4BEMJ 1LE4A 2J45A 3FAPB 1XZPA 2R25A 3ABKC 1YLMA 4OIQF 2LFFA 2ETSA 3GEIA 2NUPA 2PP4A 3HNKA 3KYIA 4LERA 4NTFA 4G0HA 3KPHA 1FNTc 3PDMP 3MBGA 5K0IA 2R7TA 3NMIA 3NKDA 4DBQA 3GM3A 3M4CA 4PJMA 2LSEA 3M15A 3SEOA 2Y3HA 3U9MA 3X1OA 3RYLA 2G3KA 1TR2A 3LS1A 4PJLA 3ITFA 4PR9A 2QY9A 2NSFA 2VH3A 1FAPB 5KYXA 5B3IA 1A0BA 1L3PA 4Z9IA 3RQEA 2O9XA 3EQLF 2HSQA 2L6GA 2F22A 1A7EA 3CZ6A 1SF8A 1FFHA 1WASA 3KMIA 2R7OA 4JJGA 1LPEA 1OCZC 3C63A 4KC9A 3LUTB 3WAQA 1MMDA 2HJMA 3S29A 2EPKX 3Q6MA 2KJGA 3CSKA 3TOMA 4BJ5C 5FZTA 3O6XA 1VLSA 2VASA 4QI2A 3V5YA 4IWBA 3UNGC 4XEKA 3QW1A 1NU7D 4JKVA 1RXQA 1OCCC 2EPNA 3FVYA 2LP4A 1K04A 2IYLD 1RKEB 4W8PA 3G4XA 2J7PD 5DLJA 4MVRA 4N6HA 2R7VA 4ER9A 3EHNA 3NKEA 4I1MA 4MVOA 2KK1A 4Q4ZF 3U2MA 1VB5A 2FAPB 3W8IA 2NUPB 3DM5A 4WABA 1OCRC 4KNVA 4O6MA 2CNWA 3PHF2 3DXJF 3NYLA 1BBHA 1Z3IX 4D4NA 3US6A 1XWJA 3EJNA 3CEXA 3C62A 3AG1C 1H7IA 5JSLA 2DI3A 1MMAA 2MYSA 3PCVA 3RF3A 3LJBA 2FGYA 4PJNA 3NDBB 3QZCA 1I4ZA 5KYWA 2Q9CA 5L3VA 3VRCA 1O5HA 1NG1A 2XLOA 1F1MA 2PBEA 4YT5A 2RD9A 3ASOC 1OR2A 5KYXB 4I3MA 1HW2A 3W4YA 4OIOF 1ZVZA 4BJ6A 5JS5A 3IQ6A 4OIPF 5E3CA 1TWCA 2XSEA 1EKYA 2HZ8A 4XLNF 4LLEA 5L0FA 4ONSA 1Q0KA 2IXOA 3HNJA 4IARA 1APCA 1PD1A 3TD7A 2KSFA 2QE9A 4ULVA 3ASNC 4N06A 3VM6A 5E2QA 1KU2A 2YWAA 3K66A 1V55C 2YLGA 5A69A 4LACB 1QSPA 3QVZA 3G50A 3O10A 1ZHYA 2YEVA 4AX2A 1EQ1A 4MS2A 1OW8A 3K33A 2PX3A 3L8JA 1KTMA 1CPQA 1MNDA 2MWQA 1VOMA 2ZD9A 3AJMA 3DM9B 3ZQVA 1LM3B 4OD4A 2OG2A 4C7OA 1E85A 1YVIA 3RFYA 1ZHTA 1DOVA 1ST6A 1G4WR 3EG9A 1U0BB 2YZSA 1GQAA 4NY3A 2GA0A 1ORYA 1XZQA 2OEXA 1YA7O 3IPMO 5L0HA 4U5FE 5A6BA 1D0XA 2Y3DA 4G7HF 2CGEA 4XPYA 5KYWB 2H7VC 1M2VA 4IB4A 3FAJA 3DD7A 3NG1A 3SZRA 2EIMC 4U5BE 1PCXA 2J7PA 3HJCA 1HMOA 1ZYRF 2VCAA 2XS1A 3T6GB 3CQZA 3ATPA 2XLEA 1GM5A 2QNLA 2Y3GA 4JRZA 5CIVA 3TJ6A 3K1HA 2R7QA 4MTFA 3RQFA 3WHNA 3QW0A 1ZW2A 2KGOA 2Y69C 1LI7A 2G62A 3VF0A 4AE4A 1C17M 5EK0A 4W8KA 3T4RA 2H8AA 1S7ZA 3DE8A 3H2UA 3M1CB 3JYYA 5DS5A 1CPRA 1NSGB 1ORJA 1Q0MA 1VLTA 4CSAC 3M4BA 3PMRA 2CW0F 2HMZA 3MX3A 1Y4CA 1D1BA 2A0BA 2YQYA 3UMHA 4CSAA 2Q00A 2P0NA 5B1AC 1ZU4A 3S9OA 3WODF 4DOZA 3B0UX 2ZXPA 1R5ID 1EI7A 4CJOA 4E7ZA 4C7OB 5AGFA 1PD0A 3W2VA 1FMWA 1OKKA 1JRAA 1WWPA 3EG9B 3ZSUA 4KI2A 2XLDA 4YL0A 2J8WA 3EGDA 3Q6NA 2GDCA 1J8MF 2L6HA 2D5RB 2R05A 3I5PA 3O39A 3F46A 4MW3A 1SZIA 4J32B 1YARO 3IEEA 1M2VB 3FHDA 4KBLA 2J46A 4G7OF 4EHPA 2X51A 2CYDA 4RBNA 3GEHA 3LEOA 2IXNA 2ZXWC 4JVSA 1YJGA 3KYJA 4G78A 2IXPA 4EBKA 1QPUA 1O3UA 3W2WA 1FMVA 2R7UA 4ANJA 2HV6A 2XRHA 1QZXA 5DS6A 3EH2A 3NMJA 2LQGA 4ULWA 5DQTA 3KKBA 5AC5A 4KNWA 4X0RA 2HKVA 1HE1A 1YAUO 2XLMA 3LAYA 4HEAJ 3U2LA 4L6RA 1OR3A 3HLZA 2R7RA 4AE4B 2A0UA 4K0DA 2Z15A 4CJGA 4JEAA 4PK4A 5D91A 2R9RB 2OU6A 3DJUB 1H6GA 3ABMC 3DI5A 3Q7GA 4E17A 5FCLA 2EIKC 2VCBA 2NSGA 2Q4FA 3TK0A 4BPMA 3H65A 3U0CA 5HSWA 2HJ3A 3OA1A 1BR2A 4HFFB 3SXKA 1NU9C 4DJ9A 3I5QA 2I8BA 2XL8A 3T6JA 5B3SC 3FMSA 2AWCA 3L0IA 4C3EA 2PFDA 1JR8A 1I5NA 3JSEO 2CDQA 2J0XA 4IAOA 3RKOF 4O6YA 1CGOA 3NYJA 1D1AA 3B0PA 1NLXA 3EGDB 4HFKB 1Z63A 4RDAA 3TULA 1RMVA 1T5OA 2A68F 4BJ1A 3C8GA 2BC5A 2ICWG 3IQ5A 3KL4A 4A2NB 3H2VA 5E33A 1C03A 4MW8A 2IXMA 3KH2A 3LLIA 3T6BA 4LDKA 4F4BA 4N4WA 3ZVRA 3IQTA 2L6FA 3AQBA 1GS9A 4MVMA 4U9EA 4YL1A 3FOOA 4XWJA 1VYKA 4EBBA 2IBFA 1OXKA 3JZ0A 4E0HA 4EBJA 5IY5C 1QKRA 3AGTA 1Q0GA 4GYTA 4XPWA 4XEFA 5F28E 4BJ6C 3MYIA 3SNHA 4DBRA 1RJ9A 2GFHA 4WJ0A 3LNRA 4NCQA 3L8IA 3U8PA 5CI9A 4A4AA 4YN0B 2NPUA 4GQHA 1KNYA 3CAXA 4AL0A 2Y3BA 2XLWA 2EPOA 2BL2A 1Z5ZA 2YVKA 1ZU5A 3JT1A 3X2QC 4DRHB 4JZAA 3B0VC 4MQ9F 3DMDA 1WTYA 1YZAA 2YLDA 1LKXA 4AL1A 3J06A 1V54C 1WN0A 2W4MA 2XLVA 4R32A 4XEVA 4U5CE 2B0JA 3T9OA 1YYXA 3S27A 3GWNA 2E87A 2J9WA 1Z6AA 2XXAA 2OCCC 2UUHA 5DVWA 3ZWIA 4O7GA 4MVZA 4I1OB 3B71A 3O55A 1RCPA 1ZHZA 3ZDLA 3LS0A 3C8GB 4MVUA 4OD5A 5L0GA 2ZXRA 1OXBA 2YL1A 4IAQA 2H7OA 2P7VA 4IRUA 4UDVA 2V3CC 3JRTA 4U5DE 1NZEA 3UMIA 2PF4E 4HE8D 2WVNA 3JSZA 4LDRA 3AGUA 2YL7A 1LE2A 4BJTA 4EIYA 1WGWA 3N2ZB 3MLGA 3I4UA 3UR3C 1OW7A 2EPLX 1AVOB 1H9GA 1SR2A 2PX0A 2YRFA 1D0ZA 3AG4C 2LK4A 3GM1A 1TKNA 2XM0A 4JCHA 3C18A 4MVSA 4NQFA 2AVKA 3NYMA 1RJ9B 4O79A 2L81A 3QVYA 3HKKA 4JE9A 3RW0A 4DVZA 4M63A 1TFKB 1V4AA 1CGNA 3EZIA 3QMKA 3DJNB 5KYUA 4B6IA 1T01A 3SXZA 1LVKA 2HFIA 5L0DA 1ZZPA 5CI8A 3HNLA 1CGME 2HS5A 2XL4A 3E70C 3LNMB 2NG1A 3RQGA 4CIHA 4Z9JA 2W45A 2YLIA 4E7SA 1T6IA 1MMGA 2KW3C 2HUJA 2DYRC 3EH1A 2A6HF 2UUIA 1MQVA 2VB6A 3L1MA 4FESA 3AG3C 1I4YA 2XXAB 256BA 4YT4A 4U5EE 2I15A 3EZHA 3GEEA 1TWAA 1FTSA 1UG7A 2HV7A 3ZC4A 1LI5A 5A6AA 3DKAA 3OEOA 5L0IA 1RKCA 1O87A 4MTGA 5EHHA 1IZMA 2W4BA 3AQCA 2A69F
chains in the Genus database with same CATH topology
1OR2A 1YA9A 1NFOA 2KC3A 3S84A 1EA8A 1LE2A 3R2PA 1LS4A 1BZ4A 1OR3A 1NFNA 1AEPA 1LPEA 1H7IA 1EQ1A 1LE4A 1GS9A 1B68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR2 A;  1YA9 A;  1NFO A;  2KC3 A;  3S84 A;  1EA8 A;  1LE2 A;  3R2P A;  1LS4 A;  1BZ4 A;  1OR3 A;  1NFN A;  1AEP A;  1LPE A;  1H7I A;  1EQ1 A;  1LE4 A;  1GS9 A;  1B68 A; 
#chains in the Genus database with same CATH topology
 4I44 A;  4H4K C;  2DYS C;  4PJJ A;  1Z7Q c;  2R7S A;  1YYJ A;  3Q7L A;  1LIH A;  1JOG A;  1JPJ A;  2CNW D;  1C02 A;  2DGJ A;  2L7A A;  3N24 A;  5TJ5 E;  4Q5S F;  1BR4 A;  1YDI A;  4WGY A;  5E3A A;  1OQC A;  4YWQ A;  1QVX A;  2LD6 A;  5L0C A;  2OOC A;  3VAY A;  1A7V A;  3SP1 A;  5DQZ A;  2J9V A;  3ZIB A;  4JJF A;  5KYU B;  4CIP A;  4DVY P;  4YL3 A;  5L3Q A;  1D1C A;  4PFP A;  3C7J A;  3UGP A;  1V74 B;  4C3B A;  4NTB A;  3DAG A;  2V26 A;  3DAF A;  3R2P A;  1E84 A;  4IGG A;  5KYN A;  4YK5 A;  4JTD B;  2A6E F;  2PNO A;  5COF A;  4CS7 A;  1K05 A;  2AP3 A;  1Z23 A;  4CDY A;  2P1A A;  3ZTM A;  3NMK A;  4CX9 A;  3B29 A;  3LEV A;  4H54 A;  4XPX A;  4C3D A;  4YJW A;  1N1C A;  5T1D B;  4YT8 A;  3GOR A;  2EIL C;  1BDJ B;  4CS8 C;  1VTM P;  4PFO A;  4YT2 A;  2YL0 A;  3U9J A;  4GEH A;  4CS8 A;  1YA9 A;  2D4U A;  3W8H A;  5D92 A;  3S0X A;  3LES A;  2VC9 A;  2WVQ A;  3EGX A;  1IW7 F;  4CBE A;  2HMQ A;  4FWV A;  2BE5 F;  1NBB A;  3K1I C;  3BEH A;  3G4Z A;  1DOW A;  3JYH A;  2WB7 A;  4J30 B;  2X0C A;  2NUT A;  3TOL A;  3U5S A;  4DRI B;  3K1I A;  3S84 A;  4E18 A;  1EA8 A;  2QUP A;  3EHM A;  2GAQ A;  3U3B A;  2JPU A;  3K7D A;  4EUK B;  3DE9 A;  2R7X A;  2P61 A;  1HW1 A;  5T3W A;  3HNI A;  4MND A;  3MFN A;  1FR0 A;  3SXM A;  1AEP A;  3A9C A;  5JP7 A;  2KYH A;  3V5X A;  3S28 A;  3V5Z A;  5A6K A;  5JLI A;  2RSE B;  4XTK A;  3RVY A;  1TFO B;  1S05 A;  2WZG A;  5A6B D;  5JUA A;  2OJE D;  1K40 A;  2AWY A;  1QLE C;  1WAT A;  1U89 A;  4XLP F;  2YKZ A;  4BJ5 A;  4LLC A;  1H9T A;  3VYW A;  5AC4 A;  3ZG1 A;  4CDV A;  1E2X A;  2H7B A;  2R03 A;  3GAN A;  2IM8 A;  3V7O A;  2WL8 A;  2ZPA A;  1ZHW A;  4D4X A;  5DS4 A;  1MMN A;  5COG A;  1U6H A;  4DXW A;  4CDA A;  5KYY A;  2XL6 A;  2R7W A;  3JRM O;  1Y6D A;  1T6U A;  1VYI A;  3E9V A;  3UMK A;  2EPM X;  2QTV A;  3RVZ A;  1ZW3 A;  1D0Y A;  3DWW A;  3F47 A;  1E86 A;  4U9D A;  2MHR A;  4P9T A;  1M6T A;  3TQO A;  1TQG A;  2G3V A;  4EWC A;  3EGX B;  1WOL A;  3L34 A;  4JEB A;  1AUE A;  1B68 A;  4JIO A;  2KNH A;  2LFD A;  2NUT B;  2C03 A;  3B9Q A;  3M79 A;  4XQ1 A;  3SXY A;  2CCY A;  2ZXO A;  3U3F A;  1JAF A;  3ZTZ A;  3FDQ A;  3WG7 C;  5GPG B;  5BQH A;  2WZL A;  3EPV A;  2A1D D;  3JTL O;  3NRH A;  1FFT C;  4IJJ A;  1OCO C;  5EGY A;  3A11 A;  1OKK D;  2Y39 A;  4AK9 A;  1JPN A;  2P6V A;  2ASR A;  4JTC B;  1UFB A;  4WGZ A;  4O6N A;  1M2O A;  1YZC A;  4P6I C;  1T6Q A;  1A7D A;  2M4E A;  3IQC A;  5L0J A;  4FX5 A;  2Q7R A;  4K7B A;  1QQ3 A;  2LCH A;  5B1B C;  4JUR I;  1G4U S;  1GGQ A;  1VMA A;  2J9U A;  1HY5 A;  1HMD A;  1VK5 A;  2OQM A;  4U5G A;  3C8Z A;  4J7T A;  3ZQY A;  3OWT A;  3AG2 C;  4LDQ A;  4NTA A;  1M57 C;  2AU5 A;  4OIN F;  5KYY B;  4Q7C A;  5JRA A;  2J9B A;  4QDL A;  4JC7 A;  1Q0D A;  3EFO A;  4P9F A;  5T3T A;  5JT4 A;  1L7C A;  2DB4 A;  2GWW A;  4RD9 A;  4BG0 A;  1E83 A;  1W2W A;  3TJ5 A;  1NFO A;  2B0H A;  1A41 A;  1TWG A;  3SYN A;  2KQ9 A;  2YHS A;  3POV A;  2OEV A;  3MYF A;  3S90 A;  2EIJ C;  3N0T A;  4DRJ B;  3K6B A;  3IHU A;  3RH3 A;  4CS9 C;  5BQI A;  4OIR F;  5JVE A;  2Q9A A;  3DZA A;  4MVQ A;  2TMV P;  2LIG A;  4ZLD A;  2XS8 A;  4CS9 A;  3FOP A;  2QLA A;  1JMW A;  1LS4 A;  5BUO A;  2IOQ A;  2EIN C;  5A6J A;  1NFN A;  2YL3 A;  3RIP A;  1R4T A;  1SMY F;  4JW1 A;  2Q9B A;  1ORS C;  2R02 A;  1PV3 A;  1J8Y F;  2XLH A;  3GOD A;  3FXH A;  3HTK C;  4N6C A;  4ZLC A;  2WZF A;  4JTA B;  1TWH A;  2VCC A;  4U5H A;  2WVO A;  1MNE A;  5HV9 A;  4NC3 A;  4PAC A;  3C8G D;  1LS1 A;  3GM2 A;  2M64 A;  3BRJ A;  5F5H A;  2Q3T A;  1M56 C;  2XM4 A;  4QI0 A;  1G8X A;  1Q0F A;  4FAP B;  4BEJ A;  3GWL A;  1T9K A;  2KC3 A;  1BR1 A;  3AOU A;  4EKW A;  4G7Z F;  3U8V A;  4MTO A;  2JX0 A;  2OJQ A;  5COM A;  1SYQ A;  2L9J A;  3JCU Q;  4JCZ A;  3ECS A;  1OW6 A;  2C04 A;  2FFH A;  2JD3 A;  3QTH A;  4K1O A;  4Z9H A;  2J0W A;  1BZ4 A;  2W9Y A;  3ABL C;  3EFO B;  3LLK A;  3UGO A;  5F5F A;  1HE9 A;  5BQG A;  1RKE A;  3R7C A;  2HSB A;  1ZHX A;  2OKU A;  1G5Z A;  4J7Y A;  4E0I A;  4BEM J;  1LE4 A;  2J45 A;  3FAP B;  1XZP A;  2R25 A;  3ABK C;  1YLM A;  4OIQ F;  2LFF A;  2ETS A;  3GEI A;  2NUP A;  2PP4 A;  3HNK A;  3KYI A;  4LER A;  4NTF A;  4G0H A;  3KPH A;  1FNT c;  3PDM P;  3MBG A;  5K0I A;  2R7T A;  3NMI A;  3NKD A;  4DBQ A;  3GM3 A;  3M4C A;  4PJM A;  2LSE A;  3M15 A;  3SEO A;  2Y3H A;  3U9M A;  3X1O A;  3RYL A;  2G3K A;  1TR2 A;  3LS1 A;  4PJL A;  3ITF A;  4PR9 A;  2QY9 A;  2NSF A;  2VH3 A;  1FAP B;  5KYX A;  5B3I A;  1A0B A;  1L3P A;  4Z9I A;  3RQE A;  2O9X A;  3EQL F;  2HSQ A;  2L6G A;  2F22 A;  1A7E A;  3CZ6 A;  1SF8 A;  1FFH A;  1WAS A;  3KMI A;  2R7O A;  4JJG A;  1LPE A;  1OCZ C;  3C63 A;  4KC9 A;  3LUT B;  3WAQ A;  1MMD A;  2HJM A;  3S29 A;  2EPK X;  3Q6M A;  2KJG A;  3CSK A;  3TOM A;  4BJ5 C;  5FZT A;  3O6X A;  1VLS A;  2VAS A;  4QI2 A;  3V5Y A;  4IWB A;  3UNG C;  4XEK A;  3QW1 A;  1NU7 D;  4JKV A;  1RXQ A;  1OCC C;  2EPN A;  3FVY A;  2LP4 A;  1K04 A;  2IYL D;  1RKE B;  4W8P A;  3G4X A;  2J7P D;  5DLJ A;  4MVR A;  4N6H A;  2R7V A;  4ER9 A;  3EHN A;  3NKE A;  4I1M A;  4MVO A;  2KK1 A;  4Q4Z F;  3U2M A;  1VB5 A;  2FAP B;  3W8I A;  2NUP B;  3DM5 A;  4WAB A;  1OCR C;  4KNV A;  4O6M A;  2CNW A;  3PHF 2;  3DXJ F;  3NYL A;  1BBH A;  1Z3I X;  4D4N A;  3US6 A;  1XWJ A;  3EJN A;  3CEX A;  3C62 A;  3AG1 C;  1H7I A;  5JSL A;  2DI3 A;  1MMA A;  2MYS A;  3PCV A;  3RF3 A;  3LJB A;  2FGY A;  4PJN A;  3NDB B;  3QZC A;  1I4Z A;  5KYW A;  2Q9C A;  5L3V A;  3VRC A;  1O5H A;  1NG1 A;  2XLO A;  1F1M A;  2PBE A;  4YT5 A;  2RD9 A;  3ASO C;  1OR2 A;  5KYX B;  4I3M A;  1HW2 A;  3W4Y A;  4OIO F;  1ZVZ A;  4BJ6 A;  5JS5 A;  3IQ6 A;  4OIP F;  5E3C A;  1TWC A;  2XSE A;  1EKY A;  2HZ8 A;  4XLN F;  4LLE A;  5L0F A;  4ONS A;  1Q0K A;  2IXO A;  3HNJ A;  4IAR A;  1APC A;  1PD1 A;  3TD7 A;  2KSF A;  2QE9 A;  4ULV A;  3ASN C;  4N06 A;  3VM6 A;  5E2Q A;  1KU2 A;  2YWA A;  3K66 A;  1V55 C;  2YLG A;  5A69 A;  4LAC B;  1QSP A;  3QVZ A;  3G50 A;  3O10 A;  1ZHY A;  2YEV A;  4AX2 A;  1EQ1 A;  4MS2 A;  1OW8 A;  3K33 A;  2PX3 A;  3L8J A;  1KTM A;  1CPQ A;  1MND A;  2MWQ A;  1VOM A;  2ZD9 A;  3AJM A;  3DM9 B;  3ZQV A;  1LM3 B;  4OD4 A;  2OG2 A;  4C7O A;  1E85 A;  1YVI A;  3RFY A;  1ZHT A;  1DOV A;  1ST6 A;  1G4W R;  3EG9 A;  1U0B B;  2YZS A;  1GQA A;  4NY3 A;  2GA0 A;  1ORY A;  1XZQ A;  2OEX A;  1YA7 O;  3IPM O;  5L0H A;  4U5F E;  5A6B A;  1D0X A;  2Y3D A;  4G7H F;  2CGE A;  4XPY A;  5KYW B;  2H7V C;  1M2V A;  4IB4 A;  3FAJ A;  3DD7 A;  3NG1 A;  3SZR A;  2EIM C;  4U5B E;  1PCX A;  2J7P A;  3HJC A;  1HMO A;  1ZYR F;  2VCA A;  2XS1 A;  3T6G B;  3CQZ A;  3ATP A;  2XLE A;  1GM5 A;  2QNL A;  2Y3G A;  4JRZ A;  5CIV A;  3TJ6 A;  3K1H A;  2R7Q A;  4MTF A;  3RQF A;  3WHN A;  3QW0 A;  1ZW2 A;  2KGO A;  2Y69 C;  1LI7 A;  2G62 A;  3VF0 A;  4AE4 A;  1C17 M;  5EK0 A;  4W8K A;  3T4R A;  2H8A A;  1S7Z A;  3DE8 A;  3H2U A;  3M1C B;  3JYY A;  5DS5 A;  1CPR A;  1NSG B;  1ORJ A;  1Q0M A;  1VLT A;  4CSA C;  3M4B A;  3PMR A;  2CW0 F;  2HMZ A;  3MX3 A;  1Y4C A;  1D1B A;  2A0B A;  2YQY A;  3UMH A;  4CSA A;  2Q00 A;  2P0N A;  5B1A C;  1ZU4 A;  3S9O A;  3WOD F;  4DOZ A;  3B0U X;  2ZXP A;  1R5I D;  1EI7 A;  4CJO A;  4E7Z A;  4C7O B;  5AGF A;  1PD0 A;  3W2V A;  1FMW A;  1OKK A;  1JRA A;  1WWP A;  3EG9 B;  3ZSU A;  4KI2 A;  2XLD A;  4YL0 A;  2J8W A;  3EGD A;  3Q6N A;  2GDC A;  1J8M F;  2L6H A;  2D5R B;  2R05 A;  3I5P A;  3O39 A;  3F46 A;  4MW3 A;  1SZI A;  4J32 B;  1YAR O;  3IEE A;  1M2V B;  3FHD A;  4KBL A;  2J46 A;  4G7O F;  4EHP A;  2X51 A;  2CYD A;  4RBN A;  3GEH A;  3LEO A;  2IXN A;  2ZXW C;  4JVS A;  1YJG A;  3KYJ A;  4G78 A;  2IXP A;  4EBK A;  1QPU A;  1O3U A;  3W2W A;  1FMV A;  2R7U A;  4ANJ A;  2HV6 A;  2XRH A;  1QZX A;  5DS6 A;  3EH2 A;  3NMJ A;  2LQG A;  4ULW A;  5DQT A;  3KKB A;  5AC5 A;  4KNW A;  4X0R A;  2HKV A;  1HE1 A;  1YAU O;  2XLM A;  3LAY A;  4HEA J;  3U2L A;  4L6R A;  1OR3 A;  3HLZ A;  2R7R A;  4AE4 B;  2A0U A;  4K0D A;  2Z15 A;  4CJG A;  4JEA A;  4PK4 A;  5D91 A;  2R9R B;  2OU6 A;  3DJU B;  1H6G A;  3ABM C;  3DI5 A;  3Q7G A;  4E17 A;  5FCL A;  2EIK C;  2VCB A;  2NSG A;  2Q4F A;  3TK0 A;  4BPM A;  3H65 A;  3U0C A;  5HSW A;  2HJ3 A;  3OA1 A;  1BR2 A;  4HFF B;  3SXK A;  1NU9 C;  4DJ9 A;  3I5Q A;  2I8B A;  2XL8 A;  3T6J A;  5B3S C;  3FMS A;  2AWC A;  3L0I A;  4C3E A;  2PFD A;  1JR8 A;  1I5N A;  3JSE O;  2CDQ A;  2J0X A;  4IAO A;  3RKO F;  4O6Y A;  1CGO A;  3NYJ A;  1D1A A;  3B0P A;  1NLX A;  3EGD B;  4HFK B;  1Z63 A;  4RDA A;  3TUL A;  1RMV A;  1T5O A;  2A68 F;  4BJ1 A;  3C8G A;  2BC5 A;  2ICW G;  3IQ5 A;  3KL4 A;  4A2N B;  3H2V A;  5E33 A;  1C03 A;  4MW8 A;  2IXM A;  3KH2 A;  3LLI A;  3T6B A;  4LDK A;  4F4B A;  4N4W A;  3ZVR A;  3IQT A;  2L6F A;  3AQB A;  1GS9 A;  4MVM A;  4U9E A;  4YL1 A;  3FOO A;  4XWJ A;  1VYK A;  4EBB A;  2IBF A;  1OXK A;  3JZ0 A;  4E0H A;  4EBJ A;  5IY5 C;  1QKR A;  3AGT A;  1Q0G A;  4GYT A;  4XPW A;  4XEF A;  5F28 E;  4BJ6 C;  3MYI A;  3SNH A;  4DBR A;  1RJ9 A;  2GFH A;  4WJ0 A;  3LNR A;  4NCQ A;  3L8I A;  3U8P A;  5CI9 A;  4A4A A;  4YN0 B;  2NPU A;  4GQH A;  1KNY A;  3CAX A;  4AL0 A;  2Y3B A;  2XLW A;  2EPO A;  2BL2 A;  1Z5Z A;  2YVK A;  1ZU5 A;  3JT1 A;  3X2Q C;  4DRH B;  4JZA A;  3B0V C;  4MQ9 F;  3DMD A;  1WTY A;  1YZA A;  2YLD A;  1LKX A;  4AL1 A;  3J06 A;  1V54 C;  1WN0 A;  2W4M A;  2XLV A;  4R32 A;  4XEV A;  4U5C E;  2B0J A;  3T9O A;  1YYX A;  3S27 A;  3GWN A;  2E87 A;  2J9W A;  1Z6A A;  2XXA A;  2OCC C;  2UUH A;  5DVW A;  3ZWI A;  4O7G A;  4MVZ A;  4I1O B;  3B71 A;  3O55 A;  1RCP A;  1ZHZ A;  3ZDL A;  3LS0 A;  3C8G B;  4MVU A;  4OD5 A;  5L0G A;  2ZXR A;  1OXB A;  2YL1 A;  4IAQ A;  2H7O A;  2P7V A;  4IRU A;  4UDV A;  2V3C C;  3JRT A;  4U5D E;  1NZE A;  3UMI A;  2PF4 E;  4HE8 D;  2WVN A;  3JSZ A;  4LDR A;  3AGU A;  2YL7 A;  1LE2 A;  4BJT A;  4EIY A;  1WGW A;  3N2Z B;  3MLG A;  3I4U A;  3UR3 C;  1OW7 A;  2EPL X;  1AVO B;  1H9G A;  1SR2 A;  2PX0 A;  2YRF A;  1D0Z A;  3AG4 C;  2LK4 A;  3GM1 A;  1TKN A;  2XM0 A;  4JCH A;  3C18 A;  4MVS A;  4NQF A;  2AVK A;  3NYM A;  1RJ9 B;  4O79 A;  2L81 A;  3QVY A;  3HKK A;  4JE9 A;  3RW0 A;  4DVZ A;  4M63 A;  1TFK B;  1V4A A;  1CGN A;  3EZI A;  3QMK A;  3DJN B;  5KYU A;  4B6I A;  1T01 A;  3SXZ A;  1LVK A;  2HFI A;  5L0D A;  1ZZP A;  5CI8 A;  3HNL A;  1CGM E;  2HS5 A;  2XL4 A;  3E70 C;  3LNM B;  2NG1 A;  3RQG A;  4CIH A;  4Z9J A;  2W45 A;  2YLI A;  4E7S A;  1T6I A;  1MMG A;  2KW3 C;  2HUJ A;  2DYR C;  3EH1 A;  2A6H F;  2UUI A;  1MQV A;  2VB6 A;  3L1M A;  4FES A;  3AG3 C;  1I4Y A;  2XXA B;  256B A;  4YT4 A;  4U5E E;  2I15 A;  3EZH A;  3GEE A;  1TWA A;  1FTS A;  1UG7 A;  2HV7 A;  3ZC4 A;  1LI5 A;  5A6A A;  3DKA A;  3OEO A;  5L0I A;  1RKC A;  1O87 A;  4MTG A;  5EHH A;  1IZM A;  2W4B A;  3AQC A;  2A69 F; 
#chains in the Genus database with same CATH homology
 1OR2 A;  1YA9 A;  1NFO A;  2KC3 A;  3S84 A;  1EA8 A;  1LE2 A;  3R2P A;  1LS4 A;  1BZ4 A;  1OR3 A;  1NFN A;  1AEP A;  1LPE A;  1H7I A;  1EQ1 A;  1LE4 A;  1GS9 A;  1B68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...