1LE4A

Structural basis for altered function in the common mutants of human apolipoprotein-e
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
139
structure length
139
Chain Sequence
QRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E4
publication title Human apolipoprotein E. Role of arginine 61 in mediating the lipoprotein preferences of the E3 and E4 isoforms.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipoprotein
total genus 61
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1991-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1le4A00
1YA9A 2KC3A 1NFNA 1H7IA 1B68A 1OR2A 3R2PA 1EA8A 1LE4A 1LE2A 1GS9A 1NFOA 1LS4A 1OR3A 1BZ4A 3S84A 1EQ1A 1AEPA 1LPEA
chains in the Genus database with same CATH superfamily
2XRHA 1ST6A 2ZXWC 5BQHA 2YLDA 2EPOA 1LS1A 3LS0A 3QVZA 1Z7Qc 2L7AA 2W4MA 4RDAA 4OIPF 1N1CA 4IAQA 1LM3B 2FGYA 4EBKA 4IB4A 1NBBA 4WJ0A 1EI7A 1O87A 2ZXOA 4KBLA 3K1IC 1OKKA 1WATA 3EZIA 5B3SC 1S05A 2OG2A 3LS1A 5DLJA 3ATPA 3MFNA 5E3AA 2KNHA 3NYMA 5COMA 2OU6A 2AVKA 2VASA 3L34A 3DD7A 5FZTA 2E87A 3S90A 2R7RA 2KGOA 3HNLA 4RBNA 2OJED 2AWCA 1OQCA 1OXBA 5JSLA 5L0DA 3LJBA 3VYWA 1PCXA 4XPXA 1K40A 2GFHA 2HSBA 4IRUA 2GDCA 2LK4A 2PX3A 2KJGA 3O55A 5A6JA 1E2XA 3QMKA 4IGGA 2J7PA 1IZMA 3RW0A 3C8GA 4YT4A 3T6BA 4JCHA 3DJNB 4J7TA 4JEBA 1V55C 4CIHA 4R32A 3RH3A 4DRIB 4CJOA 3G4XA 4I1MA 1M6TA 2J9BA 1TWGA 2DGJA 3C63A 3GORA 2QLAA 2PFDA 4FESA 4J7YA 2WB7A 4O6YA 3ECSA 5D91A 3TQOA 4U9DA 1T5OA 1VTMP 2XM4A 1JAFA 2OOCA 2WZGA 1OW7A 4N06A 2WZFA 3I5QA 3N0TA 3EHMA 4MVOA 4CX9A 1R5ID 2IXOA 2KYHA 5E33A 3T6JA 2NPUA 3Q6NA 1RKEB 2KC3A 2R7UA 5L0IA 4MVUA 1TWAA 3WAQA 1MNDA 1PV3A 3E9VA 4CS9C 3HLZA 2H7VC 3KYIA 1G4US 3C7JA 3FAPB 4FWVA 4P9TA 3JSEO 2EPNA 4I1OB 1LI5A 5D92A 4BJ5C 4MVRA 2CYDA 3AOUA 3DE8A 3JTLO 4BJTA 4NTBA 1U6HA 5JUAA 3F46A 3M1CB 3SXYA 3C8ZA 5COGA 1YYXA 2Q7RA 3MBGA 3L1MA 1RKEA 3FOPA 4WGZA 4YL3A 1XZQA 2HUJA 4IARA 3CEXA 3V5ZA 5T1DB 4KNVA 2DI3A 4G7HF 4KI2A 2X0CA 4E0HA 2C04A 3UR3C 2HKVA 2YKZA 1KU2A 1MMNA 4EIYA 2FFHA 1ZW3A 1ZYRF 2ICWG 4U5HA 4E17A 3MYFA 3X2QC 1I4YA 2XM0A 2UUIA 4U5DE 3NYJA 5CIVA 2IXNA 4Z9HA 4BJ6A 1HW1A 3J06A 2OJQA 2Q9AA 2M64A 1KTMA 4Q4ZF 4UDVA 2VC9A 3SEOA 4C3DA 2P1AA 3SXMA 2AP3A 2Q00A 2MHRA 1JMWA 1RXQA 3WHNA 3KL4A 2WL8A 1I4ZA 4U5GA 1LE2A 2CNWD 5CI9A 5L3QA 2VCAA 1TFOB 4N4WA 3HJCA 1LS4A 1VK5A 2JD3A 1QVXA 2XLHA 3HNIA 2PX0A 1K05A 2YLIA 5DS4A 1JR8A 1DOVA 3U0CA 1D0XA 3JYYA 4MTGA 4XEKA 2R7SA 4DBRA 2A1DD 5BUOA 2OKUA 3OWTA 1VOMA 3UMHA 1CGME 3ABLC 4O79A 3S29A 2IM8A 3DMDA 1GGQA 1B68A 1H7IA 1VYKA 2GA0A 3JZ0A 2L6HA 4LDRA 4MVSA 5EHHA 1ORYA 3GEEA 3NYLA 3EQLF 4F4BA 4Z9JA 1RJ9B 3UNGC 3ZDLA 2HJMA 4G7OF 1O3UA 3V7OA 2DYRC 2HFIA 1Y4CA 4YT5A 3KMIA 1NZEA 4K1OA 2DB4A 2KK1A 3U9MA 3LLIA 4ANJA 2PP4A 1OCZC 3VM6A 3GANA 3OA1A 3PHF2 3LNRA 1A0BA 1QLEC 4Z9IA 4EHPA 2Y69C 3RQEA 4AX2A 2LQGA 5K0IA 4CJGA 3NRHA 3ZWIA 2R7WA 5F28E 1D1CA 1NFNA 1BR4A 3M79A 2KSFA 4JURI 2R7QA 4YL0A 2EPKX 4GEHA 1W2WA 5DS5A 4L6RA 2ZPAA 1BBHA 1MMGA 3EG9A 3ITFA 1G4WR 3B29A 4YL1A 2BE5F 1SR2A 5B3IA 1SYQA 2D4UA 3EGDA 4A4AA 1ZW2A 4U5CE 3IQ5A 4HFFB 1A41A 4CS7A 3S28A 3TJ6A 2CGEA 2LCHA 4O7GA 1HMOA 1ZHYA 2HS5A 1M57C 4PFOA 5E2QA 1U89A 5JP7A 4EBBA 5KYWA 1HW2A 2I15A 1T9KA 4CDAA 1E84A 1ZHXA 2PF4E 4NC3A 1CPRA 3KYJA 3M4CA 2LIGA 5B1AC 3RVYA 4DXWA 3S0XA 2NSFA 1TWCA 3DE9A 4K7BA 1TFKB 1H9GA 4EWCA 1YYJA 3M15A 2H7OA 3FXHA 1T6UA 3H65A 1TQGA 4J30B 4Q7CA 3RQFA 2J9UA 2ZD9A 2G3KA 3CZ6A 4XEFA 2WVNA 1HE1A 1JPNA 3I5PA 4FX5A 1BDJB 3QW0A 4JIOA 1BR2A 1JRAA 4XEVA 2IBFA 4NCQA 1LI7A 4XQ1A 5DVWA 3U5SA 4BJ6C 1Q0FA 1FNTc 5GPGB 1QZXA 1ZVZA 3AQCA 1Q0GA 4AK9A 4YN0B 1NG1A 3EJNA 4MVQA 4XLNF 1C03A 2P6VA 3CSKA 4ULWA 1G5ZA 1A7EA 1QSPA 4BPMA 4C3EA 1Q0DA 1YJGA 4G0HA 5B1BC 3WG7C 3BRJA 1V4AA 3Q7GA 1M2OA 3RKOF 4U5BE 2XXAB 3DJUB 4CDVA 3POVA 2L9JA 2OEXA 3ZG1A 3IQ6A 1A7VA 3RFYA 3ZC4A 5AC5A 2RD9A 3GEHA 1XZPA 2NSGA 2YWAA 3HTKC 3VRCA 1OR2A 4C7OB 2XLVA 3SYNA 1TWHA 1E86A 5AC4A 1OCOC 2Y3DA 4LLEA 4IJJA 1CGNA 1QKRA 4XPWA 5DS6A 4EBJA 5HV9A 2P7VA 1NSGB 2W4BA 3CQZA 3M4BA 5A6BD 3QZCA 1OCCC 4DRHB 4FAPB 1O5HA 3LLKA 4YJWA 1HMDA 3NKDA 5AGFA 3ZVRA 3GEIA 4LLCA 1BZ4A 2YQYA 5F5HA 2XXAA 3UGPA 2YL1A 2WVOA 3LEOA 3L8IA 3SZRA 3LNMB 2Y3HA 1SZIA 3SNHA 1D1AA 2GWWA 2R02A 2R05A 3EZHA 1YDIA 5IY5C 3B0UX 4AL0A 4JJFA 5COFA 3K7DA 4LDKA 3TJ5A 3KPHA 3IEEA 2A69F 3OEOA 4D4XA 1Z23A 4ONSA 2Q4FA 2HSQA 2VB6A 2XLWA 3K66A 1D0YA 2AU5A 2LP4A 2YVKA 3R2PA 4WABA 2HV6A 4AL1A 3IPMO 3PCVA 3GWNA 2EILC 3KH2A 1ZU4A 3HNKA 1Y6DA 2H8AA 5A6KA 1YZAA 3UMIA 3AG4C 2OEVA 2L81A 2YEVA 2AWYA 3W8IA 5T3TA 4EKWA 1D0ZA 3EH2A 2DYSC 2Z15A 2IOQA 3IHUA 4JTAB 4JC7A 5KYUB 1OW6A 1Q0KA 4G7ZF 4RD9A 2B0JA 3S84A 5HSWA 1WGWA 2EIJC 3TOLA 3EGXB 4JE9A 1ORSC 3ZTMA 2VCBA 2Q3TA 3AG2C 3SXZA 3RIPA 3NMIA 5E3CA 3W2VA 4GQHA 1Z3IX 2LD6A 2XS1A 3AGTA 1XWJA 1H9TA 1BR1A 1JPJA 2NUTB 4PJNA 1FAPB 2W9YA 4XWJA 1M2VB 3JRTA 5F5FA 2HMZA 2YHSA 1OCRC 5JLIA 1YVIA 2ETSA 2XL4A 1FTSA 3US6A 3MLGA 3N2ZB 1H6GA 4JW1A 4OINF 4I3MA 4U9EA 1L3PA 1T01A 2EPLX 3AJMA 3X1OA 5L0FA 4BEJA 5JRAA 5KYNA 3EH1A 4OIOF 3HKKA 2FAPB 5KYUA 2UUHA 1FR0A 2W45A 3S27A 2R9RB 2O9XA 3I4UA 2R7XA 1SF8A 1ZU5A 2A0BA 3NMJA 3EFOB 2GAQA 4U5FE 3RYLA 1PD0A 2YRFA 3DAGA 2CNWA 4JRZA 2XL8A 4DBQA 2XLDA 1QQ3A 1UG7A 1VLSA 2BC5A 2NUPB 2R25A 2NUTA 3AQBA 3CAXA 2NG1A 1V74B 3H2VA 4W8KA 1M2VA 4BJ1A 3ZQYA 5L0HA 4JVSA 4WGYA 5A69A 3FAJA 4JJGA 2JX0A 1E83A 4O6MA 3IQCA 4CS8C 1Z63A 1NU9C 1RJ9A 2ZXPA 4HE8D 2EIKC 2G3VA 1Z6AA 3TULA 3A11A 2R7OA 2XLMA 3W2WA 2YL0A 3O10A 1OXKA 4CSAA 1KNYA 3B9QA 4NY3A 3GM3A 1AUEA 256BA 2LSEA 2J0WA 3RQGA 2A6HF 2M4EA 3U3FA 3TK0A 4XPYA 3Q6MA 2QE9A 1OR3A 2I8BA 2MYSA 3ZIBA 1J8MF 4DJ9A 4Q5SF 3GM2A 2J7PD 2J8WA 4K0DA 1IW7F 3S9OA 4YK5A 4O6NA 1TKNA 2NUPA 3U8PA 4PJLA 3FDQA 3PMRA 3AG1C 5BQIA 4QI2A 3FMSA 3C8GD 1EKYA 2A68F 4MS2A 2IXPA 4ULVA 2Q9CA 3L8JA 1WASA 2L6GA 1T6IA 3BEHA 3MYIA 4PFPA 1GM5A 2R7VA 3EPVA 2QTVA 2VCCA 2X51A 3RF3A 2R7TA 2VH3A 2ZXRA 1E85A 2XLEA 3C62A 3R7CA 1VLTA 3C8GB 3SP1A 4IAOA 3RVZA 4A2NB 2Q9BA 1A7DA 2CW0F 3K6BA 2HZ8A 2YLGA 5BQGA 4AE4B 5EK0A 1LE4A 3FVYA 4LACB 1T6QA 3B0VC 3W8HA 4E0IA 1ZZPA 3FHDA 1V54C 2B0HA 3EHNA 4PJJA 3F47A 4YT2A 4MVMA 4CBEA 5JS5A 4P6IC 2XL6A 2XSEA 4PK4A 2J9WA 2MWQA 1AEPA 1WOLA 1G8XA 2F22A 2HJ3A 1LVKA 3IQTA 1YA9A 4P9FA 3T9OA 1CPQA 3GM1A 2P0NA 4D4NA 2KW3C 3K1HA 4N6HA 3A9CA 1YA7O 3T4RA 5CI8A 4MTFA 4CDYA 2OCCC 1I5NA 4LERA 3TD7A 4CS8A 3ZQVA 3WODF 2EINC 4OD4A 2KQ9A 1Q0MA 4NTFA 4AE4A 2JPUA 2PNOA 4MQ9F 3GODA 4DVYP 4JKVA 2J9VA 1ZHTA 4DVZA 2LFFA 1TR2A 4JTCB 3ASOC 1GS9A 1NFOA 4KNWA 3U3BA 3VAYA 1M56C 2QNLA 2XS8A 1CGOA 4G78A 3DM9B 4HFKB 3N24A 1DOWA 5KYYB 2Y3GA 4MVZA 5L0CA 3DZAA 4H4KC 5L3VA 3GWLA 3T6GB 3W4YA 3AGUA 2J0XA 1EQ1A 2WZLA 2G62A 4GYTA 5EGYA 1ZHWA 2CDQA 2Y39A 1L7CA 3PDMP 5JVEA 2QY9A 2P61A 3QTHA 3ZSUA 4ZLCA 4C7OA 4MNDA 3E70C 3DXJF 3G50A 2BL2A 1FMVA 3NKEA 3QVYA 2OQMA 3ZTZA 4OIQF 1VMAA 3JRMO 2HV7A 3NMKA 1S7ZA 5L0GA 2C03A 4CSAC 3K1IA 4MTOA 2J46A 5DQZA 1MMDA 3B71A 3HNJA 4C3BA 4PJMA 4EUKB 1APCA 4ZLDA 5KYYA 3L0IA 4OD5A 3UGOA 2IYLD 4E7ZA 4OIRF 4MW8A 4W8PA 1LIHA 1C17M 1AVOB 1YAUO 2J45A 4PACA 4QDLA 4E18A 1HY5A 1NLXA 4ER9A 1FMWA 3NG1A 2D5RB 3DAFA 1YZCA 3TOMA 5A6BA 1U0BB 4LDQA 5L0JA 2R03A 2A0UA 1SMYF 4J32B 2YZSA 3DKAA 1FFTC 4MW3A 1OW8A 5TJ5E 3SXKA 3U2LA 3H2UA 1YLMA 2ASRA 1ZHZA 3O6XA 4BG0A 1WN0A 5A6AA 3VF0A 3JT1A 4XTKA 1VYIA 3DI5A 2A6EF 1PD1A 2EIMC 4CIPA 4NQFA 5JT4A 4H54A 1K04A 3C18A 1GQAA 3LEVA 5DQTA 1MQVA 4E7SA 3NDBB 2EPMX 3O39A 2WVQA 4QI0A 5KYXB 3V5XA 3ASNC 5FCLA 3V5YA 4N6CA 4KC9A 1NU7D 3EGXA 5T3WA 2CCYA 1ORJA 3DWWA 1YARO 3FOOA 4BEMJ 2YL3A 4B6IA 4JEAA 4DRJB 3LUTB 4XLPF 2LFDA 2PBEA 4PR9A 1R4TA 1Z5ZA 2L6FA 4JCZA 2Y3BA 4HEAJ 3JCUQ 3JSZA 3U8VA 4CS9A 4DOZA 1OKKD 1WTYA 2RSEB 2H7BA 4M63A 1MMAA 2QUPA 4JTDB 4X0RA 2IXMA 4NTAA 1J8YF 3AG3C 3EG9B 1EA8A 5KYXA 4BJ5A 1RMVA 3B0PA 1HE9A 3ABKC 1JOGA 3LAYA 3EGDB 1F1MA 3MX3A 3K33A 3ABMC 4YT8A 3QW1A 3UMKA 1RKCA 2HMQA 1C02A 1QPUA 1VB5A 3DM5A 3G4ZA 1LKXA 3KKBA 3Q7LA 4JZAA 2V26A 4YWQA 3U2MA 3U9JA 4IWBA 2V3CC 3EFOA 1RCPA 2YL7A 4U5EE 1MNEA 5KYWB 1UFBA 4I44A 1D1BA 1FFHA 2TMVP 2XLOA 1LPEA 1WWPA 3LESA 3JYHA
chains in the Genus database with same CATH topology
1YA9A 2KC3A 1NFNA 1H7IA 1B68A 1OR2A 3R2PA 1EA8A 1LE4A 1LE2A 1GS9A 1NFOA 1LS4A 1OR3A 1BZ4A 3S84A 1EQ1A 1AEPA 1LPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA9 A;  2KC3 A;  1NFN A;  1H7I A;  1B68 A;  1OR2 A;  3R2P A;  1EA8 A;  1LE4 A;  1LE2 A;  1GS9 A;  1NFO A;  1LS4 A;  1OR3 A;  1BZ4 A;  3S84 A;  1EQ1 A;  1AEP A;  1LPE A; 
#chains in the Genus database with same CATH topology
 2XRH A;  1ST6 A;  2ZXW C;  5BQH A;  2YLD A;  2EPO A;  1LS1 A;  3LS0 A;  3QVZ A;  1Z7Q c;  2L7A A;  2W4M A;  4RDA A;  4OIP F;  1N1C A;  4IAQ A;  1LM3 B;  2FGY A;  4EBK A;  4IB4 A;  1NBB A;  4WJ0 A;  1EI7 A;  1O87 A;  2ZXO A;  4KBL A;  3K1I C;  1OKK A;  1WAT A;  3EZI A;  5B3S C;  1S05 A;  2OG2 A;  3LS1 A;  5DLJ A;  3ATP A;  3MFN A;  5E3A A;  2KNH A;  3NYM A;  5COM A;  2OU6 A;  2AVK A;  2VAS A;  3L34 A;  3DD7 A;  5FZT A;  2E87 A;  3S90 A;  2R7R A;  2KGO A;  3HNL A;  4RBN A;  2OJE D;  2AWC A;  1OQC A;  1OXB A;  5JSL A;  5L0D A;  3LJB A;  3VYW A;  1PCX A;  4XPX A;  1K40 A;  2GFH A;  2HSB A;  4IRU A;  2GDC A;  2LK4 A;  2PX3 A;  2KJG A;  3O55 A;  5A6J A;  1E2X A;  3QMK A;  4IGG A;  2J7P A;  1IZM A;  3RW0 A;  3C8G A;  4YT4 A;  3T6B A;  4JCH A;  3DJN B;  4J7T A;  4JEB A;  1V55 C;  4CIH A;  4R32 A;  3RH3 A;  4DRI B;  4CJO A;  3G4X A;  4I1M A;  1M6T A;  2J9B A;  1TWG A;  2DGJ A;  3C63 A;  3GOR A;  2QLA A;  2PFD A;  4FES A;  4J7Y A;  2WB7 A;  4O6Y A;  3ECS A;  5D91 A;  3TQO A;  4U9D A;  1T5O A;  1VTM P;  2XM4 A;  1JAF A;  2OOC A;  2WZG A;  1OW7 A;  4N06 A;  2WZF A;  3I5Q A;  3N0T A;  3EHM A;  4MVO A;  4CX9 A;  1R5I D;  2IXO A;  2KYH A;  5E33 A;  3T6J A;  2NPU A;  3Q6N A;  1RKE B;  2KC3 A;  2R7U A;  5L0I A;  4MVU A;  1TWA A;  3WAQ A;  1MND A;  1PV3 A;  3E9V A;  4CS9 C;  3HLZ A;  2H7V C;  3KYI A;  1G4U S;  3C7J A;  3FAP B;  4FWV A;  4P9T A;  3JSE O;  2EPN A;  4I1O B;  1LI5 A;  5D92 A;  4BJ5 C;  4MVR A;  2CYD A;  3AOU A;  3DE8 A;  3JTL O;  4BJT A;  4NTB A;  1U6H A;  5JUA A;  3F46 A;  3M1C B;  3SXY A;  3C8Z A;  5COG A;  1YYX A;  2Q7R A;  3MBG A;  3L1M A;  1RKE A;  3FOP A;  4WGZ A;  4YL3 A;  1XZQ A;  2HUJ A;  4IAR A;  3CEX A;  3V5Z A;  5T1D B;  4KNV A;  2DI3 A;  4G7H F;  4KI2 A;  2X0C A;  4E0H A;  2C04 A;  3UR3 C;  2HKV A;  2YKZ A;  1KU2 A;  1MMN A;  4EIY A;  2FFH A;  1ZW3 A;  1ZYR F;  2ICW G;  4U5H A;  4E17 A;  3MYF A;  3X2Q C;  1I4Y A;  2XM0 A;  2UUI A;  4U5D E;  3NYJ A;  5CIV A;  2IXN A;  4Z9H A;  4BJ6 A;  1HW1 A;  3J06 A;  2OJQ A;  2Q9A A;  2M64 A;  1KTM A;  4Q4Z F;  4UDV A;  2VC9 A;  3SEO A;  4C3D A;  2P1A A;  3SXM A;  2AP3 A;  2Q00 A;  2MHR A;  1JMW A;  1RXQ A;  3WHN A;  3KL4 A;  2WL8 A;  1I4Z A;  4U5G A;  1LE2 A;  2CNW D;  5CI9 A;  5L3Q A;  2VCA A;  1TFO B;  4N4W A;  3HJC A;  1LS4 A;  1VK5 A;  2JD3 A;  1QVX A;  2XLH A;  3HNI A;  2PX0 A;  1K05 A;  2YLI A;  5DS4 A;  1JR8 A;  1DOV A;  3U0C A;  1D0X A;  3JYY A;  4MTG A;  4XEK A;  2R7S A;  4DBR A;  2A1D D;  5BUO A;  2OKU A;  3OWT A;  1VOM A;  3UMH A;  1CGM E;  3ABL C;  4O79 A;  3S29 A;  2IM8 A;  3DMD A;  1GGQ A;  1B68 A;  1H7I A;  1VYK A;  2GA0 A;  3JZ0 A;  2L6H A;  4LDR A;  4MVS A;  5EHH A;  1ORY A;  3GEE A;  3NYL A;  3EQL F;  4F4B A;  4Z9J A;  1RJ9 B;  3UNG C;  3ZDL A;  2HJM A;  4G7O F;  1O3U A;  3V7O A;  2DYR C;  2HFI A;  1Y4C A;  4YT5 A;  3KMI A;  1NZE A;  4K1O A;  2DB4 A;  2KK1 A;  3U9M A;  3LLI A;  4ANJ A;  2PP4 A;  1OCZ C;  3VM6 A;  3GAN A;  3OA1 A;  3PHF 2;  3LNR A;  1A0B A;  1QLE C;  4Z9I A;  4EHP A;  2Y69 C;  3RQE A;  4AX2 A;  2LQG A;  5K0I A;  4CJG A;  3NRH A;  3ZWI A;  2R7W A;  5F28 E;  1D1C A;  1NFN A;  1BR4 A;  3M79 A;  2KSF A;  4JUR I;  2R7Q A;  4YL0 A;  2EPK X;  4GEH A;  1W2W A;  5DS5 A;  4L6R A;  2ZPA A;  1BBH A;  1MMG A;  3EG9 A;  3ITF A;  1G4W R;  3B29 A;  4YL1 A;  2BE5 F;  1SR2 A;  5B3I A;  1SYQ A;  2D4U A;  3EGD A;  4A4A A;  1ZW2 A;  4U5C E;  3IQ5 A;  4HFF B;  1A41 A;  4CS7 A;  3S28 A;  3TJ6 A;  2CGE A;  2LCH A;  4O7G A;  1HMO A;  1ZHY A;  2HS5 A;  1M57 C;  4PFO A;  5E2Q A;  1U89 A;  5JP7 A;  4EBB A;  5KYW A;  1HW2 A;  2I15 A;  1T9K A;  4CDA A;  1E84 A;  1ZHX A;  2PF4 E;  4NC3 A;  1CPR A;  3KYJ A;  3M4C A;  2LIG A;  5B1A C;  3RVY A;  4DXW A;  3S0X A;  2NSF A;  1TWC A;  3DE9 A;  4K7B A;  1TFK B;  1H9G A;  4EWC A;  1YYJ A;  3M15 A;  2H7O A;  3FXH A;  1T6U A;  3H65 A;  1TQG A;  4J30 B;  4Q7C A;  3RQF A;  2J9U A;  2ZD9 A;  2G3K A;  3CZ6 A;  4XEF A;  2WVN A;  1HE1 A;  1JPN A;  3I5P A;  4FX5 A;  1BDJ B;  3QW0 A;  4JIO A;  1BR2 A;  1JRA A;  4XEV A;  2IBF A;  4NCQ A;  1LI7 A;  4XQ1 A;  5DVW A;  3U5S A;  4BJ6 C;  1Q0F A;  1FNT c;  5GPG B;  1QZX A;  1ZVZ A;  3AQC A;  1Q0G A;  4AK9 A;  4YN0 B;  1NG1 A;  3EJN A;  4MVQ A;  4XLN F;  1C03 A;  2P6V A;  3CSK A;  4ULW A;  1G5Z A;  1A7E A;  1QSP A;  4BPM A;  4C3E A;  1Q0D A;  1YJG A;  4G0H A;  5B1B C;  3WG7 C;  3BRJ A;  1V4A A;  3Q7G A;  1M2O A;  3RKO F;  4U5B E;  2XXA B;  3DJU B;  4CDV A;  3POV A;  2L9J A;  2OEX A;  3ZG1 A;  3IQ6 A;  1A7V A;  3RFY A;  3ZC4 A;  5AC5 A;  2RD9 A;  3GEH A;  1XZP A;  2NSG A;  2YWA A;  3HTK C;  3VRC A;  1OR2 A;  4C7O B;  2XLV A;  3SYN A;  1TWH A;  1E86 A;  5AC4 A;  1OCO C;  2Y3D A;  4LLE A;  4IJJ A;  1CGN A;  1QKR A;  4XPW A;  5DS6 A;  4EBJ A;  5HV9 A;  2P7V A;  1NSG B;  2W4B A;  3CQZ A;  3M4B A;  5A6B D;  3QZC A;  1OCC C;  4DRH B;  4FAP B;  1O5H A;  3LLK A;  4YJW A;  1HMD A;  3NKD A;  5AGF A;  3ZVR A;  3GEI A;  4LLC A;  1BZ4 A;  2YQY A;  5F5H A;  2XXA A;  3UGP A;  2YL1 A;  2WVO A;  3LEO A;  3L8I A;  3SZR A;  3LNM B;  2Y3H A;  1SZI A;  3SNH A;  1D1A A;  2GWW A;  2R02 A;  2R05 A;  3EZH A;  1YDI A;  5IY5 C;  3B0U X;  4AL0 A;  4JJF A;  5COF A;  3K7D A;  4LDK A;  3TJ5 A;  3KPH A;  3IEE A;  2A69 F;  3OEO A;  4D4X A;  1Z23 A;  4ONS A;  2Q4F A;  2HSQ A;  2VB6 A;  2XLW A;  3K66 A;  1D0Y A;  2AU5 A;  2LP4 A;  2YVK A;  3R2P A;  4WAB A;  2HV6 A;  4AL1 A;  3IPM O;  3PCV A;  3GWN A;  2EIL C;  3KH2 A;  1ZU4 A;  3HNK A;  1Y6D A;  2H8A A;  5A6K A;  1YZA A;  3UMI A;  3AG4 C;  2OEV A;  2L81 A;  2YEV A;  2AWY A;  3W8I A;  5T3T A;  4EKW A;  1D0Z A;  3EH2 A;  2DYS C;  2Z15 A;  2IOQ A;  3IHU A;  4JTA B;  4JC7 A;  5KYU B;  1OW6 A;  1Q0K A;  4G7Z F;  4RD9 A;  2B0J A;  3S84 A;  5HSW A;  1WGW A;  2EIJ C;  3TOL A;  3EGX B;  4JE9 A;  1ORS C;  3ZTM A;  2VCB A;  2Q3T A;  3AG2 C;  3SXZ A;  3RIP A;  3NMI A;  5E3C A;  3W2V A;  4GQH A;  1Z3I X;  2LD6 A;  2XS1 A;  3AGT A;  1XWJ A;  1H9T A;  1BR1 A;  1JPJ A;  2NUT B;  4PJN A;  1FAP B;  2W9Y A;  4XWJ A;  1M2V B;  3JRT A;  5F5F A;  2HMZ A;  2YHS A;  1OCR C;  5JLI A;  1YVI A;  2ETS A;  2XL4 A;  1FTS A;  3US6 A;  3MLG A;  3N2Z B;  1H6G A;  4JW1 A;  4OIN F;  4I3M A;  4U9E A;  1L3P A;  1T01 A;  2EPL X;  3AJM A;  3X1O A;  5L0F A;  4BEJ A;  5JRA A;  5KYN A;  3EH1 A;  4OIO F;  3HKK A;  2FAP B;  5KYU A;  2UUH A;  1FR0 A;  2W45 A;  3S27 A;  2R9R B;  2O9X A;  3I4U A;  2R7X A;  1SF8 A;  1ZU5 A;  2A0B A;  3NMJ A;  3EFO B;  2GAQ A;  4U5F E;  3RYL A;  1PD0 A;  2YRF A;  3DAG A;  2CNW A;  4JRZ A;  2XL8 A;  4DBQ A;  2XLD A;  1QQ3 A;  1UG7 A;  1VLS A;  2BC5 A;  2NUP B;  2R25 A;  2NUT A;  3AQB A;  3CAX A;  2NG1 A;  1V74 B;  3H2V A;  4W8K A;  1M2V A;  4BJ1 A;  3ZQY A;  5L0H A;  4JVS A;  4WGY A;  5A69 A;  3FAJ A;  4JJG A;  2JX0 A;  1E83 A;  4O6M A;  3IQC A;  4CS8 C;  1Z63 A;  1NU9 C;  1RJ9 A;  2ZXP A;  4HE8 D;  2EIK C;  2G3V A;  1Z6A A;  3TUL A;  3A11 A;  2R7O A;  2XLM A;  3W2W A;  2YL0 A;  3O10 A;  1OXK A;  4CSA A;  1KNY A;  3B9Q A;  4NY3 A;  3GM3 A;  1AUE A;  256B A;  2LSE A;  2J0W A;  3RQG A;  2A6H F;  2M4E A;  3U3F A;  3TK0 A;  4XPY A;  3Q6M A;  2QE9 A;  1OR3 A;  2I8B A;  2MYS A;  3ZIB A;  1J8M F;  4DJ9 A;  4Q5S F;  3GM2 A;  2J7P D;  2J8W A;  4K0D A;  1IW7 F;  3S9O A;  4YK5 A;  4O6N A;  1TKN A;  2NUP A;  3U8P A;  4PJL A;  3FDQ A;  3PMR A;  3AG1 C;  5BQI A;  4QI2 A;  3FMS A;  3C8G D;  1EKY A;  2A68 F;  4MS2 A;  2IXP A;  4ULV A;  2Q9C A;  3L8J A;  1WAS A;  2L6G A;  1T6I A;  3BEH A;  3MYI A;  4PFP A;  1GM5 A;  2R7V A;  3EPV A;  2QTV A;  2VCC A;  2X51 A;  3RF3 A;  2R7T A;  2VH3 A;  2ZXR A;  1E85 A;  2XLE A;  3C62 A;  3R7C A;  1VLT A;  3C8G B;  3SP1 A;  4IAO A;  3RVZ A;  4A2N B;  2Q9B A;  1A7D A;  2CW0 F;  3K6B A;  2HZ8 A;  2YLG A;  5BQG A;  4AE4 B;  5EK0 A;  1LE4 A;  3FVY A;  4LAC B;  1T6Q A;  3B0V C;  3W8H A;  4E0I A;  1ZZP A;  3FHD A;  1V54 C;  2B0H A;  3EHN A;  4PJJ A;  3F47 A;  4YT2 A;  4MVM A;  4CBE A;  5JS5 A;  4P6I C;  2XL6 A;  2XSE A;  4PK4 A;  2J9W A;  2MWQ A;  1AEP A;  1WOL A;  1G8X A;  2F22 A;  2HJ3 A;  1LVK A;  3IQT A;  1YA9 A;  4P9F A;  3T9O A;  1CPQ A;  3GM1 A;  2P0N A;  4D4N A;  2KW3 C;  3K1H A;  4N6H A;  3A9C A;  1YA7 O;  3T4R A;  5CI8 A;  4MTF A;  4CDY A;  2OCC C;  1I5N A;  4LER A;  3TD7 A;  4CS8 A;  3ZQV A;  3WOD F;  2EIN C;  4OD4 A;  2KQ9 A;  1Q0M A;  4NTF A;  4AE4 A;  2JPU A;  2PNO A;  4MQ9 F;  3GOD A;  4DVY P;  4JKV A;  2J9V A;  1ZHT A;  4DVZ A;  2LFF A;  1TR2 A;  4JTC B;  3ASO C;  1GS9 A;  1NFO A;  4KNW A;  3U3B A;  3VAY A;  1M56 C;  2QNL A;  2XS8 A;  1CGO A;  4G78 A;  3DM9 B;  4HFK B;  3N24 A;  1DOW A;  5KYY B;  2Y3G A;  4MVZ A;  5L0C A;  3DZA A;  4H4K C;  5L3V A;  3GWL A;  3T6G B;  3W4Y A;  3AGU A;  2J0X A;  1EQ1 A;  2WZL A;  2G62 A;  4GYT A;  5EGY A;  1ZHW A;  2CDQ A;  2Y39 A;  1L7C A;  3PDM P;  5JVE A;  2QY9 A;  2P61 A;  3QTH A;  3ZSU A;  4ZLC A;  4C7O A;  4MND A;  3E70 C;  3DXJ F;  3G50 A;  2BL2 A;  1FMV A;  3NKE A;  3QVY A;  2OQM A;  3ZTZ A;  4OIQ F;  1VMA A;  3JRM O;  2HV7 A;  3NMK A;  1S7Z A;  5L0G A;  2C03 A;  4CSA C;  3K1I A;  4MTO A;  2J46 A;  5DQZ A;  1MMD A;  3B71 A;  3HNJ A;  4C3B A;  4PJM A;  4EUK B;  1APC A;  4ZLD A;  5KYY A;  3L0I A;  4OD5 A;  3UGO A;  2IYL D;  4E7Z A;  4OIR F;  4MW8 A;  4W8P A;  1LIH A;  1C17 M;  1AVO B;  1YAU O;  2J45 A;  4PAC A;  4QDL A;  4E18 A;  1HY5 A;  1NLX A;  4ER9 A;  1FMW A;  3NG1 A;  2D5R B;  3DAF A;  1YZC A;  3TOM A;  5A6B A;  1U0B B;  4LDQ A;  5L0J A;  2R03 A;  2A0U A;  1SMY F;  4J32 B;  2YZS A;  3DKA A;  1FFT C;  4MW3 A;  1OW8 A;  5TJ5 E;  3SXK A;  3U2L A;  3H2U A;  1YLM A;  2ASR A;  1ZHZ A;  3O6X A;  4BG0 A;  1WN0 A;  5A6A A;  3VF0 A;  3JT1 A;  4XTK A;  1VYI A;  3DI5 A;  2A6E F;  1PD1 A;  2EIM C;  4CIP A;  4NQF A;  5JT4 A;  4H54 A;  1K04 A;  3C18 A;  1GQA A;  3LEV A;  5DQT A;  1MQV A;  4E7S A;  3NDB B;  2EPM X;  3O39 A;  2WVQ A;  4QI0 A;  5KYX B;  3V5X A;  3ASN C;  5FCL A;  3V5Y A;  4N6C A;  4KC9 A;  1NU7 D;  3EGX A;  5T3W A;  2CCY A;  1ORJ A;  3DWW A;  1YAR O;  3FOO A;  4BEM J;  2YL3 A;  4B6I A;  4JEA A;  4DRJ B;  3LUT B;  4XLP F;  2LFD A;  2PBE A;  4PR9 A;  1R4T A;  1Z5Z A;  2L6F A;  4JCZ A;  2Y3B A;  4HEA J;  3JCU Q;  3JSZ A;  3U8V A;  4CS9 A;  4DOZ A;  1OKK D;  1WTY A;  2RSE B;  2H7B A;  4M63 A;  1MMA A;  2QUP A;  4JTD B;  4X0R A;  2IXM A;  4NTA A;  1J8Y F;  3AG3 C;  3EG9 B;  1EA8 A;  5KYX A;  4BJ5 A;  1RMV A;  3B0P A;  1HE9 A;  3ABK C;  1JOG A;  3LAY A;  3EGD B;  1F1M A;  3MX3 A;  3K33 A;  3ABM C;  4YT8 A;  3QW1 A;  3UMK A;  1RKC A;  2HMQ A;  1C02 A;  1QPU A;  1VB5 A;  3DM5 A;  3G4Z A;  1LKX A;  3KKB A;  3Q7L A;  4JZA A;  2V26 A;  4YWQ A;  3U2M A;  3U9J A;  4IWB A;  2V3C C;  3EFO A;  1RCP A;  2YL7 A;  4U5E E;  1MNE A;  5KYW B;  1UFB A;  4I44 A;  1D1B A;  1FFH A;  2TMV P;  2XLO A;  1LPE A;  1WWP A;  3LES A;  3JYH A; 
#chains in the Genus database with same CATH homology
 1YA9 A;  2KC3 A;  1NFN A;  1H7I A;  1B68 A;  1OR2 A;  3R2P A;  1EA8 A;  1LE4 A;  1LE2 A;  1GS9 A;  1NFO A;  1LS4 A;  1OR3 A;  1BZ4 A;  3S84 A;  1EQ1 A;  1AEP A;  1LPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...